WO2006012508A2 - Method of treating sjögren's syndrome - Google Patents

Method of treating sjögren's syndrome Download PDF

Info

Publication number
WO2006012508A2
WO2006012508A2 PCT/US2005/026027 US2005026027W WO2006012508A2 WO 2006012508 A2 WO2006012508 A2 WO 2006012508A2 US 2005026027 W US2005026027 W US 2005026027W WO 2006012508 A2 WO2006012508 A2 WO 2006012508A2
Authority
WO
WIPO (PCT)
Prior art keywords
antibody
administered
exposure
medicament
antibodies
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2005/026027
Other languages
English (en)
French (fr)
Other versions
WO2006012508A3 (en
Inventor
Elena Hitraya
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Genentech Inc
Original Assignee
Genentech Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to CA002573359A priority Critical patent/CA2573359A1/en
Priority to MX2007000748A priority patent/MX2007000748A/es
Priority to AU2005267028A priority patent/AU2005267028A1/en
Priority to NZ552433A priority patent/NZ552433A/en
Priority to JP2007522800A priority patent/JP2008507555A/ja
Priority to BRPI0513100-6A priority patent/BRPI0513100A/pt
Application filed by Genentech Inc filed Critical Genentech Inc
Priority to EP05782423A priority patent/EP1781378A2/en
Publication of WO2006012508A2 publication Critical patent/WO2006012508A2/en
Publication of WO2006012508A3 publication Critical patent/WO2006012508A3/en
Priority to IL180371A priority patent/IL180371A0/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2896Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against molecules with a "CD"-designation, not provided for elsewhere
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/395Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/435Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with one nitrogen as the only ring hetero atom
    • A61K31/47Quinolines; Isoquinolines
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/395Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/435Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with one nitrogen as the only ring hetero atom
    • A61K31/47Quinolines; Isoquinolines
    • A61K31/47064-Aminoquinolines; 8-Aminoquinolines, e.g. chloroquine, primaquine
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/56Compounds containing cyclopenta[a]hydrophenanthrene ring systems; Derivatives thereof, e.g. steroids
    • A61K31/57Compounds containing cyclopenta[a]hydrophenanthrene ring systems; Derivatives thereof, e.g. steroids substituted in position 17 beta by a chain of two carbon atoms, e.g. pregnane or progesterone
    • A61K31/573Compounds containing cyclopenta[a]hydrophenanthrene ring systems; Derivatives thereof, e.g. steroids substituted in position 17 beta by a chain of two carbon atoms, e.g. pregnane or progesterone substituted in position 21, e.g. cortisone, dexamethasone, prednisone or aldosterone
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A61K39/39533Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
    • A61K39/39541Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against normal tissues, cells
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00Drugs for disorders of the alimentary tract or the digestive system
    • A61P1/02Stomatological preparations, e.g. drugs for caries, aphtae, periodontitis
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P19/00Drugs for skeletal disorders
    • A61P19/02Drugs for skeletal disorders for joint disorders, e.g. arthritis, arthrosis
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P27/00Drugs for disorders of the senses
    • A61P27/02Ophthalmic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P43/00Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/24Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/565Complementarity determining region [CDR]
    • YGENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
    • Y02TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
    • Y02ATECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
    • Y02A50/00TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
    • Y02A50/30Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change

Definitions

  • the present invention concerns methods for treating Sjogren's syndrome in a subject, and kits with instructions for such use.
  • Background of the Invention Sjogren's syndrome
  • autoimmune diseases such as Sjogren's syndrome and lupus, among others, remain clinically important diseases in humans.
  • autoimmune diseases wreak their havoc through the body's own immune system. While the pathological mechanisms differ between individual types of autoimmune diseases, one general mechanism involves the binding of certain antibodies (referred to herein as self-reactive antibodies or autoantibodies) present.
  • Sjogren's syndrome is a chronic disorder in which white blood cells attack the moisture-producing glands.
  • the hallmark symptoms are dry eyes and dry mouth, caused by lymphocytic infiltrates of lacrimal and salivary glands.
  • the loss of tears and saliva may result in characteristic changes in the eyes (called aqueous tear deficiency or keratoconjunctivitis sicca) and in the mouth with deterioration of the teeth, increased oral infection, difficulty in swallowing, and painful mouth.
  • Patients may also have inflammation of the joints
  • the objective measures assess the severity of glandular impairment and not the degree of dyscomfort/dysfunction.
  • the primary endpoints may include improvement across two out of four Sjogren's disease domains: ocular dryness, oral dryness, fatigue, and laboratory tests. There may be ocular improvement that could be ⁇ 20% improvement in: patients' assessment of dry eyes (Visual Analogue Scale (VAS)), Shirmer I test (with/without anesthesia) such as 0-25 mm of wetting in 5 min for each eyes, and an ocular dye test scored according to van Bijsterveld.
  • VAS Visual Analogue Scale
  • Shirmer I test with/without anesthesia
  • ocular dye test scored according to van Bijsterveld.
  • Mariette et al Arthritis Rheum, 50:1270-1276 (2004) reported on a multicenter study with infliximab in treating primary Sjogren's syndrome. The primary endpoint was a decrease of at least 30% in 2 of the 3 VAS (dryness, asthenia and pain) . See also Mariette et al, Ann. Rheum. Dis., 62( 1): 66-66 ( July 2003) reporting the preliminary results of the TRIPSS study that there was an absence of efficiency of infliximab in primary Sjogren's syndrome.
  • Pillemer et al, Arthritis Rheum 50:2240-2245 (2004) investigated using etanercept in treating Sjogren's syndrome. The results were mild decreased ESR (p 0.004) and no effect on salivary or lacrimal function. Azuma et al, Arthritis Rheum, 46:1585-1594 (2002) disclosed suppression of TNF ⁇ - induced MMP9 by cepharantine. Steinfeld et al, Lab Invest 81:143-148 (2001) showed abnormal aquaporin-5 distribution.
  • EBV Epstein-Barr virus
  • This virus normally resides in the salivary glands for life but causes no problems. It has been speculated that this virus (or a closely-related virus) may trigger an autoimmune response in genetically susceptible individuals.
  • the putative infectious agent damages the salivary gland and attracts the "immune" lymphocytes into the salivary gland.
  • These lymphocytes release specific autoantibodies such as rheumatoid factor (RF), antinuclear antibodies, and antibodies directed against proteins termed Sjogren's-associated antigens A and B (or SS-A and SS-B).
  • RF rheumatoid factor
  • Sjogren's-associated antigens A and B or SS-A and SS-B
  • Autoantibodies against Ro/SS-A and La/SS-B antigens are present in the tear fluid of some patients with Sjogren's syndrome and their presence in serum or tear fluid is associated with the severity of keratoconjunctivitis sicca. Toker et al. BrJ Ophthalmol. 88(3):384-387 (2004).
  • centromere protein B centromere protein B
  • CENP C centromere protein C
  • abnormal levels and relative ratios of hormones may play a role in the pathogenesis of Sjogren's syndrome (Taiym et al. Oral Surg, Oral Med, Oral Pathol, Oral Radiol, & Endodontics. 97 (5):579-583 (2004)), and women with Sjogren's syndrome are androgen-deficient (Sullivan et al. J Rheumatol. 30 (11):2413-2419 (2003)). Apoptosis is also being studied in Sjogren's syndrome (Manganelli and Fietta, Seminars in Arthritis & Rheumatism
  • cevimeline may be useful for dry eye (Ono et al. Am / Ophthalmol. 138(1):6-17 (2004)) as well as diquafosol tetrasodium (Inspire Pharmaceuticals) ⁇ formulation of a dinucleotide that functions as an agonist at the P2Y2 receptor, stimulating the release of natural tear components targeting all three mechanisms of action involved in tear secretion - mucin, lipids and fluid, and RESTASIS® (cyclosporine ophthalmic emulsion); and pilocarpine may be useful in salivary enhancement (Fox Caries Res. 38(3):241-246 (2004)).
  • Various immunomodulant treatments based on cyclosporine, corticosteroids, methotrexate, or alpha-interferon have been proposed with different results. Rogers et al, Drugs
  • etanercept treatment may be beneficial in a small subgroup of Sjogren's syndrome patients with severe fatigue.
  • Cyclosporine A was found to be efficacious for treating moderate-to-severe dry eye disease.
  • the development of topical cyclosporine and other immunomodulating agents has shown promise in the treatment of keratoconjunctivitis sicca in Sjogren's syndrome.
  • Lymphocytes are one of many types of white blood cells produced in the bone marrow during the process of hematopoiesis. There are two major populations of lymphocytes: B lymphocytes (B cells) and T lymphocytes (T cells).
  • B cells mature within the bone marrow and leave the marrow expressing an antigen-binding antibody on their cell surface. When a na ⁇ ve B cell first encounters the antigen for which its membrane-bound antibody is specific, the cell begins to divide rapidly and its progeny differentiate into memory B cells and effector cells called "plasma cells". Memory B cells have a longer life span and continue to express membrane-bound antibody with the same specificity as the original parent cell. Plasma cells do not produce membrane-bound antibody, but instead produce the antibody in a form that can be secreted. Secreted antibodies are the major effector molecules of humoral immunity.
  • the CD20 antigen also called human B-lymphocyte-restricted differentiation antigen, Bp35
  • Bp35 human B-lymphocyte-restricted differentiation antigen
  • CD20 regulates an early step(s) in the activation process for cell- cycle initiation and differentiation (Tedder et al., supra), and possibly functions as a calcium- ion channel (Tedder et al. J. Cell. Biochem. 14D:195 (1990)). Given the expression of CD20 in B-cell lymphomas, this antigen can serve as a candidate for
  • targeting of such lymphomas.
  • such targeting can be generalized as follows: antibodies specific to the CD20 surface antigen of B cells are administered to a patient. These anti-CD20 antibodies specifically bind to the CD20 antigen of (ostensibly) both normal and malignant B cells; the antibody bound to the CD20 surface antigen may lead to the destruction and depletion of neoplastic B cells. Additionally, chemical agents or radioactive labels having the potential to destroy the tumor can be conjugated to the anti-CD20 antibody such that the agent is specifically "delivered" to the neoplastic B cells. Irrespective of the approach, a primary goal is to destroy the tumor; the specific approach can be determined by the particular anti-CD20 antibody that is utilized, and thus, the available approaches to targeting the CD20 antigen can vary considerably.
  • the rituximab (RITUXAN®) antibody is a genetically engineered chimeric murine/human monoclonal antibody directed against the CD20 antigen.
  • Rituximab is the antibody called "C2B8" in US Patent No.
  • Rituximab is indicated for the treatment of patients with relapsed or refractory low-grade or follicular, CD20-positive, B-cell non-Hodgkin's lymphoma.
  • CDC complement-dependent cytotoxicity
  • ADCC antibody-dependent cellular cytotoxicity
  • rituximab has been shown to have anti-proliferative effects in tritiated thymidine-incorporation assays and to induce apoptosis directly, while other anti-CD 19 and anti-CD20 antibodies do not (Maloney et al. Blood 88(10):637a (1996)). Synergy between rituximab and chemotherapies and toxins has also been observed experimentally. In particular, rituximab sensitizes drug-resistant human B-cell lymphoma cell lines to the cytotoxic effects of doxorubicin, CDDP, VP- 16, diphtheria toxin, and ricin (Demidem et al.
  • Rituximab was approved in the United States in November 1997 for the treatment of patients with relapsed or refractory low-grade or follicular CD20 + B-cell NHL at a dose of 375 mg/m 2 weekly for four doses.
  • Rituximab has also been studied in a variety of non-malignant autoimmune disorders, in which B cells and autoantibodies appear to play a role in disease pathophysiology. Edwards et al., Biochem Soc. Trans. 30:824-828 (2002). Rituximab has been reported to potentially relieve signs and symptoms of, for example, rheumatoid arthritis (RA) (Leandro et al, Ann. Rheum. Dis. 61:883-888 (2002); Edwards et al, Arthritis
  • RA rheumatoid arthritis
  • treaiEmeii ⁇ t regimen of rituximab was one gram administered intravenously on days 1 and 15. Infusions of rituximab in most patients with RA were well tolerated by most patients, with 36% of patients experiencing at least one adverse event during their first infusion (compared with 30% of patients receiving placebo). Overall, the majority of adverse events was considered to be mild to moderate in severity and was well balanced across all treatment groups.
  • rituximab The reported safety profile of rituximab in a small number of patients with neurologic disorders, including autoimmune neuropathy (Pestronk et al., supra), opsoclonus-myoclonus syndrome (Pranzatelli et al., supra), and RRMS (Cross et al, supra), was similar to that reported in oncology or RA.
  • Patents and patent publications concerning CD20 antibodies and CD20-binding molecules include US Patent Nos. 5,776,456, 5,736,137, 5,843,439, 6,399,061, and 6,682,734, as well as US 2002/0197255, US 2003/0021781 , US 2003/0082172, US 2003/0095963, US 2003/0147885 (Anderson et al); US Patent No.
  • Patent No. 6,242,195, US Patent No. 6,528,624 and US Patent No. 6,538,124 (Idusogie et al); WO 2000/42072 (Presta, L.); WO 2000/67796 (Curd et al); WO 2001/03734 (Grillo-Lopez et al); US 2002/0004587 and WO 2001/77342 (Miller and Presta); US 2002/0197256 (Grewal, L); US 2003/0157108 (Presta, L.); US Patent Nos. 6,565,827, 6,090,365, 6,287,537, 6,015,542, 5,843,398, and 5,595,721, (Kaminski et al); US Patent Nos. 5,500,362, 5,677,180, 5,721,108, 6,120,767, 6,652,852, 6,893,625 (Robinson et al); US Patent No. 6,410,391
  • the present invention involves administration of a CD20 antibody that provides a safe and active treatment regimen in subjects with Sjogren's syndrome, including selection of an efficacious dosing regimen.
  • the present invention concerns a method of treating Sjogren's syndrome in a patient comprising administering an effective amount of a CD20 antibody and an anti-malarial agent to the patient to provide at least about 30% improvement over baseline in two or more of dryness, fatigue, and joint pain on a Visual Analogue Scale (VAS).
  • VAS Visual Analogue Scale
  • the invention provides an article of manufacture comprising: a container comprising a CD20 antibody; a container comprising an anti-malarial agent; and a package insert with instructions for treating Sjogren's syndrome in a patient, wherein the instructions indicate that amounts of the CD20 antibody and the anti-malarial agent are administered to the patient that are effective to provide at least about 30% improvement over baseline in two or more of dryness, fatigue, and joint pain on a Visual Analogue Scale.
  • a third medicament is administered in an effective amount to the patient, wherein the CD20 antibody is a first medicament and the anti-malarial agent is a second medicament. More preferably, such third medicament is a chemotherapeutic agent, an immunosuppressive agent, a disease-modifying anti-rheumatic drug (DMARD), a cytotoxic agent, an integrin antagonist, a nonsteroidal antiinflammatory drug (NSAID), a cytokine antagonist, a secretory agonist for dry mouth or dry eye, or a hormone.
  • the patient has relapsed before being administered the CD20 antibody.
  • the patient has not relapsed before being administered the CD20 antibody.
  • the syndrome is secondary Sjogren's syndrome.
  • the present invention relates to a method of treating Sjogren's syndrome in a subject comprising administering an effective amount of a CD20 antibody to the subject to provide an initial antibody exposure followed by a second antibody exposure, wherein the second exposure is not provided until from about 16 to 54 weeks from the initial exposure.
  • the present invention relates to a method of treating Sjogren's syndrome in a subject comprising administering an effective amount of a CD20 antibody to the subject to provide an initial antibody exposure of about 0.5 to 4 grams followed by a second antibody exposure of about 0.5 to 4 grams, wherein the second exposure is not provided until from about 16 to 54 weeks from the initial exposure and each of the antibody exposures is provided to the subject as about 1 to 4 doses of antibody, more preferably as a single dose or as two or three separate doses of antibody.
  • a second medicament is administered with the initial exposure and/or later exposures, wherein the CD20 antibody is a first medicament.
  • the second medicament is a chemotherapeutic agent, an immunosuppressive agent, a disease- modifying anti-rheumatic drug (DMARD), a cytotoxic agent, an integrin antagonist, a nonsteroidal antiinflammatory drug (NSAID), a cytokine antagonist, a secretory agonist for dry mouth or dry eye, or a hormone.
  • the second medicament is an anti-malarial agent alone or with a steroid or is a steroid.
  • a steroid is administered with the first exposure, but not with the second exposure, or is administered in lower amounts than are used with the initial exposure.
  • the subject has never been previously treated with a CD20 antibody, and/or no other medicament than the CD20 antibody is administered to the subject to treat the Sjogren's syndrome.
  • the subject has an elevated level of anti- nuclear antibodies (ANA), anti-rheumatoid factor (RF) antibodies, antibodies directed against Sj ⁇ gren's- associated antigen A or B (SS-A or SS-B), antibodies directed against centromere protein B (CENP B) or centromere protein C (CENP C), an autoantibody to ICA69, or a combination of two or more of such antibodies.
  • ANA anti- nuclear antibodies
  • RF anti-rheumatoid factor
  • CENP B centromere protein B
  • CENP C centromere protein C
  • an autoantibody to ICA69 or a combination of two or more of such antibodies.
  • the antibodies directed against SS-A and SS-B are anti-Ro/SS-A antibodies, anti-La/SS-A antibodies, anti-La/SS-B antibodies, or anti-Ro/SS-B antibodies.
  • the invention provides an article of manufacture comprising:
  • a container comprising a CD20 antibody; and (b) a package insert with instructions for treating Sjogren's syndrome in a subject, wherein the instructions indicate that an amount of the antibody is administered to the subject that is effective to provide an initial antibody exposure followed by a second antibody exposure, wherein the second exposure is not provided until from about 16 to 54 weeks from the initial exposure.
  • such package insert is provided with instructions for treating Sjogren's syndrome in a subject, wherein the instructions indicate that an amount of the antibody is administered to the subject that is effective to provide an initial antibody exposure of about 0.5 to 4 grams followed by a second antibody exposure of about 0.5 to 4 grams, wherein the second exposure is not provided until from about 16 to 54 weeks from the initial exposure and each of the antibody exposures is provided to the subject as about one to four doses, preferably as a single dose or as two or three separate doses of antibody.
  • the treatments herein preferably reduce, minimize, or eliminate the need for co-, pre-, or post- administration of excessive amounts of second or third medicaments such as immunosuppressive agents or chemotherapeutic agents that are ordinarily standard treatment for such subjects, to avoid as much as possible the side effects of such standard treatment, as well as reduce costs and increase convenience to the subject, such as time convenience.
  • second or third medicaments such as immunosuppressive agents or chemotherapeutic agents that are ordinarily standard treatment for such subjects
  • FIG. IA is a sequence alignment comparing the amino acid sequences of the light chain variable domain (V L ) of each of murine 2H7 (SEQ ID NO:1), humanized 2H7.vl6 variant (SEQ ID NO:2), and the human kappa light chain subgroup I (SEQ ID NO:3).
  • the CDRs of V L of 2H7 and hu2H7.vl6 are as follows: CDRl (SEQ ID NO:4), CDR2 (SEQ ID NO:5 ), and CDR3 (SEQ ID NO:6).
  • FIG. IB is a sequence alignment comparing the amino acid sequences of the heavy chain variable domain (V H ) of each of murine 2H7 (SEQ ID NO:7), humanized 2H7.vl6 variant (SEQ ID NO:8), and the human consensus sequence of the heavy chain subgroup III (SEQ ID NO:9).
  • the CDRs of V H of 2H7 and hu2H7.vl6 are as follows: CDRl (SEQ ID NO: 10), CDR2 (SEQ ID NO: 11), and CDR3 (SEQ ID NO: 12).
  • the CDRl, CDR2 and CDR3 in each chain are enclosed within brackets, flanked by the framework regions, FR1-FR4, as indicated.
  • 2H7 refers to the murine 2H7 antibody.
  • the asterisks in between two rows of sequences indicate the positions that are different between the two sequences.
  • Residue numbering is according to Kabat et al. Sequences of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md. (1991), with insertions shown as a, b, c, d, and e.
  • FIG. 2 shows the amino acid sequence of the mature 2H7.vl 6 L chain (SEQ ID NO: 13)
  • FIG. 3 shows the amino acid sequence of the mature 2H7.vl6 H chain (SEQ ID NO:14).
  • FIG. 4 shows the amino acid sequence of the mature 2H7.v31 H chain (SEQ ID NO: 15).
  • the L chain of 2H7.v31 is the same as for 2H7.vl6.
  • FIG. 5 shows an alignment of the mature 2H7.vl6 and 2H7.v511 light chains (SEQ ID NOS: 13 and 16, respectively), with Kabat variable-domain residue numbering and Eu constant-domain residue numbering.
  • FIG. 6 shows an alignment of the mature 2H7.vl6 and 2H7.v511 heavy chains (SEQ ID NOS:14 and 17, respectively), with Kabat variable-domain residue numbering and Eu constant-domain residue numbering.
  • Sjogren's syndrome as used herein is an autoimmune disease or disorder in which immune cells attack the glands that produce tears and saliva. The hallmark symptoms of the disorder are dry mouth and dry eyes. In addition, Sjogren's syndrome may cause skin, nose, and vaginal dryness, and may affect other organs of the body including the kidneys, blood vessels, lungs, liver, pancreas, and brain.
  • Sjogren's syndrome can exist as a primary disorder ("primary Sjogren's syndrome”) or as a secondary disorder (“secondary Sjogren's syndrome”) that is associated with and/or secondary to other autoimmune disorders including rheumatic disorders such as rheumatoid arthritis, systemic lupus, polymyositis, scleroderma, and autoimmune hepatitis, lymphomas such as non-Hodgkin's lymphoma, and endocrine disorders such as thyroiditis.
  • the term "Sjogren's syndrome” as used herein applies to Sjogren's syndrome no matter what the stage, including both primary and secondary Sjogren's syndrome, and no matter what symptoms are evident, provided the diagnosis is made.
  • a "B cell” is a lymphocyte that matures within the bone marrow, and includes a na ⁇ ve B cell, memory
  • the B cell herein may be a normal or non-malignant B cell.
  • B-cell surface marker or "B-cell surface antigen” herein is an antigen expressed on the surface of a B cell that can be targeted with an antagonist that binds thereto.
  • Exemplary B-cell surface markers include the CDlO, CD19, CD20, CD21, CD22, CD23, CD24, CD37, CD40, CD53, CD72, CD73, CD74, CDw75, CDw76, CD77, CDw78, CD79a, CD79b, CD80, CD81, CD82, CD83, CDw84, CD85 and CD86 leukocyte surface markers (for descriptions, see The Leukocyte Antigen Facts Book, 2 nd Edition. 1997, ed. Barclay et al.
  • B-cell surface markers include RP105, FcRH2, B- cell CR2, CCR6, P2X5, HLA-DOB, CXCR5, FCER2, BR3, Btig, NAG14, SLGC16270, FcRHl, IRTA2, ATWD578, FcRH3, IRTAl, FcRH6, BCMA, and 239287.
  • the B-cell surface marker of particular interest is preferentially expressed on B cells compared to other non-B-cell tissues of a mammal and may be expressed on both precursor B cells and mature B cells.
  • the preferred B-cell surface markers herein are CD20 and CD22.
  • CD20 antigen is an about 35-kDa, non-glycosylated phosphoprotein found on the surface of greater than 90% of B cells from peripheral blood or lymphoid organs. CD20 is present on both normal B cells as well as malignant B cells, but is not expressed on stem cells. Other names for CD20 in the literature include "B -lymphocyte-restricted antigen” and "Bp35". The CD20 antigen is described in Clark et al.
  • CD22 antigen also known as BL-CAM or Lyb8
  • BL-CAM BL-CAM
  • Lyb8 is a type 1 integral membrane glycoprotein with molecular weight of about 130 (reduced) to 14OkD (unreduced). It is expressed in both the cytoplasm and cell membrane of B -lymphocytes.
  • CD22 antigen appears early in B-cell lymphocyte differentiation at approximately the same stage as the CD19 antigen. Unlike other B-cell markers, CD22 membrane expression is limited to the late differentiation stages comprised between mature B cells (CD22+) and plasma cells (CD22-).
  • the CD22 antigen is described, for example, in Wilson et al. J. Exp. Med. 173:137 (1991) and Wilson et al. J. Immunol. 150:5013 (1993).
  • an "antagonist” is a molecule that, upon binding to CD20 on B cells, destroys or depletes B cells in a mammal and/or interferes with one or more B cell functions, e.g. by reducing or preventing a humoral response elicited by the B cell.
  • the antagonist preferably is able to deplete B cells ⁇ i.e. reduce circulating B cell levels) in a mammal treated therewith. Such depletion may be achieved via various mechanisms such antibody- dependent cell-mediated cytotoxicity (ADCC) and/or complement dependent cytotoxicity (CDC), inhibition of B cell proliferation and/or induction of B cell death ⁇ e.g. via apoptosis).
  • ADCC antibody- dependent cell-mediated cytotoxicity
  • CDC complement dependent cytotoxicity
  • Antagonists included within the scope of the present invention include antibodies, synthetic or native-sequence peptides, immunoadhesins, and small- molecule antagonists that bind to CD20, optionally conjugated with or fused to a cytotoxic agent.
  • the preferred antagonist comprises an antibody.
  • an "antibody antagonist” herein is an antibody that, upon binding to a B-cell surface marker on B cells, destroys or depletes B cells in a mammal and/or interferes with one or more B-cell functions, e.g., by reducing or preventing a humoral response elicited by the B cell.
  • the antibody antagonist preferably is able to deplete B cells ⁇ i.e., reduce circulating B-cell levels) in a mammal treated therewith. Such depletion may be achieved via various mechanisms such antibody-dependent cell-mediated cytotoxicity (ADCC) and/or complement-dependent cytotoxicity (CDC), inhibition of B-cell proliferation and/or induction of B-cell death ⁇ e.g., via apoptosis).
  • ADCC antibody-dependent cell-mediated cytotoxicity
  • CDC complement-dependent cytotoxicity
  • antibody herein is used in the broadest sense and specifically covers monoclonal antibodies, polyclonal antibodies, multispecific antibodies ⁇ e.g. bispecific antibodies) formed from at least two intact antibodies, and antibody fragments so long as they exhibit the desired biological activity.
  • Antibody fragments comprise a portion of an intact antibody, preferably comprising the antigen binding region thereof.
  • antibody fragments include Fab, Fab', F(ab') 2 , and Fv fragments; diabodies; linear antibodies; single-chain antibody molecules; and multispecific antibodies formed from antibody fragments.
  • an “intact antibody” is one comprising heavy and light variable domains as well as an Fc region.
  • an "antibody that binds to a B-cell surface marker” is a molecule that, upon binding to a B-cell surface marker, destroys or depletes B cells in a mammal and/or interferes with one or more B-cell functions, e.g. by reducing or preventing a humoral response elicited by the B cell.
  • the antibody preferably is able to deplete B cells ⁇ i.e. reduce circulating B-cell levels) in a mammal treated therewith. Such depletion may be achieved via various mechanisms such antibody-dependent cell-mediated cytotoxicity (ADCC) and/or complement- dependent cytotoxicity (CDC), inhibition of B-cell proliferation and/or induction of B-cell death ⁇ e.g. via apoptosis).
  • the B-cell surface marker is CD20, so that the antibody that binds to a B-cell surface marker is an antibody that binds to CD20, or a "CD20 antibody.”
  • CD20 antibodies examples include: “C2B8,” which is now called “rituximab” (“RITUXAN®”) (US Patent No. 5,736,137); the yttrium-[90]-labeled 2B8 murine antibody designated “Y2B8” or “Ibritumomab Tiuxetan” (ZEV ALIN®) commercially available from IDEC Pharmaceuticals, Inc. (US Patent No. 5,736,137; 2B8 deposited with ATCC under accession no. HB11388 on June 22, 1993); murine IgG2a "Bl,” also called
  • Tositumomab optionally labeled with 131 I to generate the "13 H-Bl” or “iodine 1131 tositumomab” antibody (BEXXARTM) commercially available from Corixa (see, also, US Patent No. 5,595,721); murine monoclonal antibody “1F5" (Press et al. Blood 69(2):584-591 (1987) and variants thereof including "framework patched” or humanized 1F5 (WO 2003/002607, Leung, S.; ATCC deposit HB -96450); murine 2H7 and chimeric 2H7 antibody (US Patent No.
  • the preferred CD20 antibodies herein are chimeric, humanized, or human CD20 antibodies, more preferably rituximab, humanized 2H7, chimeric or humanized A20 antibody (Immunomedics), and HUMAX-CD20TM human CD20 antibody (Genmab).
  • rituximab or "RITUXAN®” herein refer to the genetically engineered chimeric murine/human monoclonal antibody directed against the CD20 antigen and designated "C2B8" in US Patent No. 5,736,137, including fragments thereof which retain the ability to bind CD20.
  • humanized 2H7 refers to a humanized CD20 antibody, or an antigen-binding fragment thereof, wherein the antibody is effective to deplete primate B cells in vivo, the antibody comprising in the H chain variable region (VH) thereof at least a CDR H3 sequence of
  • SEQ ID NO: 12 (Fig. IB) from an anti-human CD20 antibody and substantially the human consensus framework (FR) residues of the human heavy- chain subgroup III (V H III).
  • this antibody further comprises the H chain CDR Hl sequence of SEQ ID NO: 10 and CDR H2 sequence of SEQ ID NO: 11, and more preferably further comprises the L chain CDR Ll sequence of SEQ ID NO:4, CDR L2 sequence of SEQ ID NO:5, CDR L3 sequence of SEQ ID NO:6 and substantially the human consensus framework (FR) residues of the human light chain subgroup I (VI), wherein the VH region may be joined to a human IgG chain constant region, wherein the region may be, for example, IgGl or IgG3.
  • such antibody comprises the V H sequence of SEQ ID NO:8 (vl6, as shown in Fig. IB), optionally also comprising the V L sequence of SEQ ID NO:2 (vl6, as shown in Fig. IA), which may have the amino acid substitutions of D56A and NlOOA in the H chain and S92A in the L chain (v96).
  • the antibody is an intact antibody comprising the light and heavy chain amino acid sequences of SEQ ID NOS: 13 and 14, respectively, as shown in Figs. 2 and 3.
  • Another preferred embodiment is where the antibody is 2H7.v31 comprising the light and heavy chain amino acid sequences of SEQ ID NOS: 13 and 15, respectively, as shown in Figs. 2 and 4.
  • the antibody herein may further comprise at least one amino acid substitution in the Fc region that improves ADCC and/or CDC activity, such as one wherein the amino acid substitutions are S298A/E333A/K334A, more preferably 2H7.v31 having the heavy chain amino acid sequence of SEQ ID NO: 15 (as shown in Fig. 4). Any of these antibodies may further comprise at least one amino acid substitution in the Fc region that decreases CDC activity, for example, comprising at least the substitution K322A. See U.S. Patent No. 6,528,624Bl (Idusogie et al).
  • a preferred humanized 2H7 is an intact antibody or antibody fragment comprising the variable light chain sequence:
  • humanized 2H7 antibody is an intact antibody, preferably it comprises the light chain amino acid sequence:
  • FNRGEC (SEQ ID NO: 13); and the heavy chain amino acid sequence:
  • the V region of variants based on 2H7 version 16 will have the amino acid sequences of vl6 except at the positions of amino acid substitutions that are indicated in the table below. Unless otherwise indicated, the 2H7 variants will have the same L chain as that of vl6.
  • Antibody-dependent cell-mediated cytotoxicity and “ADCC” refer to a cell-mediated reaction in which nonspecific cytotoxic cells that express Fc receptors (FcRs) (e.g. Natural Killer (NK) cells, neutrophils, and macrophages) recognize bound antibody on a target cell and subsequently cause lysis of the target cell.
  • FcRs Fc receptors
  • FcR expression on hematopoietic cells in summarized is Table 3 on page 464 of Ravetch and Kinet, Annu. Rev. Immunol 9:457-92 (1991).
  • ADCC activity of a molecule of interest may be assessed in vitro, such as that described in US Patent No. 5,500,362 or 5,821,337.
  • Useful effector cells for such assays include peripheral blood mononuclear cells (PBMC) and Natural Killer (NK) cells.
  • PBMC peripheral blood mononuclear cells
  • NK Natural Killer
  • ADCC activity of the molecule of interest may be assessed in vivo, e.g., in a animal model such as that disclosed in Clynes et al. PNAS (USA) 95:652-656 (1998).
  • “Human ettector cells” are leukocytes that express one or more FcRs and perform effector functions. Preferably, the cells express at least Fc ⁇ RIII and carry out ADCC effector function.
  • human leukocytes that mediate ADCC include peripheral blood mononuclear cells (PBMC), natural killer (NK) cells, monocytes, cytotoxic T cells and neutrophils; with PBMCs and NK cells being preferred.
  • PBMC peripheral blood mononuclear cells
  • NK natural killer cells
  • Fc receptor or "FcR” are used to describe a receptor that binds to the Fc region of an antibody.
  • the preferred FcR is a native-sequence human FcR.
  • a preferred FcR is one that binds an IgG antibody (a gamma receptor) and includes receptors of the Fc ⁇ RI, Fc ⁇ RII, and Fc ⁇ RIII subclasses, including allelic variants and alternatively spliced forms of these receptors.
  • Fc ⁇ RII receptors include Fc ⁇ RIIA (an “activating receptor”) and Fc ⁇ RIIB (an “inhibiting receptor”), which have similar amino acid sequences that differ primarily in the cytoplasmic domains thereof.
  • Activating receptor Fc ⁇ RIIA contains an immunoreceptor tyrosine-based activation motif (ITAM) in its cytoplasmic domain.
  • Inhibiting receptor Fc ⁇ RIIB contains an immunoreceptor tyrosine-based inhibition motif (ITIM) in its cytoplasmic domain, (see Daeron, Annu. Rev. Immunol. 15:203-234 (1997)).
  • FcRs are reviewed in Ravetch and Kinet, Amu. Rev.
  • FcR neonatal receptor
  • “Complement dependent cytotoxicity” or “CDC” refer to the ability of a molecule to lyse a target in the presence of complement.
  • the complement activation pathway is initiated by the binding of the first component of the complement system (CIq) to a molecule (e.g. an antibody) complexed with a cognate antigen.
  • CIq first component of the complement system
  • a CDC assay e.g. as described in Gazzano-Santoro et al., J. Immunol. Methods 202:163 (1996), may be performed.
  • “Growth-inhibitory” antibodies are those that prevent or reduce proliferation of a cell expressing an antigen to which the antibody binds.
  • the antibody may prevent or reduce proliferation of B cells in vitro and/or in vivo.
  • Antibodies that "induce apoptosis” are those that induce programmed cell death, e.g. of a B cell, as determined by standard apoptosis assays, such as binding of annexin V, fragmentation of DNA, cell shrinkage, dilation of endoplasmic reticulum, cell fragmentation, and/or formation of membrane vesicles (called apoptotic bodies).
  • "Native antibodies” are usually heterotetrameric glycoproteins of about 150,000 daltons, composed of two identical light (L) chains and two identical heavy (H) chains. Each light chain is linked to a heavy chain by one covalent disulfide bond, while the number of disulfide linkages varies among the heavy chains of different immunoglobulin isotypes.
  • Each heavy and light chain also has regularly spaced intrachain disulfide bridges.
  • Each heavy chain has at one end a variable domain (V H ) followed by a number of constant domains.
  • Each light chain has a variable domain at one end (V L ) and a constant domain at its other end; the constant domain of the light chain is aligned with the first constant domain of the heavy chain, and the light chain variable domain is aligned with the variable domain of the heavy chain.
  • Particular amino acid residues are believed to form an interface between the light chain and heavy chain variable domains.
  • variable refers to the fact that certain portions of the variable domains differ extensively in sequence among antibodies and are used in the binding and specificity of each particular antibody for its particular antigen. However, the variability is not evenly distributed throughout the variable domains of antibodies. It is concentrated in three segments called hypervariable regions both in the light chain and the heavy chain variable domains. The more highly conserved portions of variable domains are called the framework regions (FRs).
  • the variable domains of native heavy and light chains each comprise four FRs, largely adopting a ⁇ -sheet configuration, connected by three hypervariable regions, which form loops connecting, and in some cases forming part of, the ⁇ -sheet structure.
  • the hypervariable regions in each chain are held together in close proximity by the FRs and, with the hypervariable regions from the other chain, contribute to the formation of the antigen-binding site of antibodies (see Kabat et at, Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, MD. (1991)).
  • the constant domains are not involved directly in binding an antibody to an antigen, but exhibit various effector functions, such as participation of the antibody in antibody dependent cellular cytotoxicity (ADCC).
  • Papain digestion of antibodies produces two identical antigen-binding fragments, called "Fab” fragments, each with a single antigen-binding site, and a residual "Fc” fragment, whose name reflects its ability to crystallize readily.
  • Pepsin treatment yields an F(ab') 2 fragment that has two antigen-binding sites and is still capable of cross-linking antigen.
  • Fv is the minimum antibody fragment that contains a complete antigen-recognition and antigen- binding site. This region consists of a dimer of one heavy chain and one light chain variable domain in tight, non-covalent association. It is in this configuration that the three hypervariable regions of each variable domain interact to define an antigen-binding site on the surface of the V H -V L dimer.
  • variable domain or half of an Fv comprising only three hypervariable regions specific for an antigen
  • variable domain or half of an Fv comprising only three hypervariable regions specific for an antigen
  • the Fab fragment also contains the constant domain of the light chain and the first constant domain (CHl) of the heavy chain.
  • Fab' fragments differ from Fab fragments by the addition of a few residues at the carboxy terminus of the heavy chain CHl domain including one or more cysteines from the antibody hinge region.
  • Fab'-SH is the designation herein for Fab' in which the cysteine residue(s) of the constant domains bear at least one free thiol group.
  • F(ab') 2 antibody fragments originally were produced as pairs of Fab' fragments that have hinge cysteines between them. Other chemical couplings of antibody fragments are also known.
  • the "light chains" of antibodies (immunoglobulins) from any vertebrate species can be assigned to one of two clearly distinct types, called kappa (K) and lambda ( ⁇ ), based on the amino acid sequences of their constant domains.
  • antibodies can be assigned to different classes. There are five major classes of intact antibodies: IgA, IgD, IgE, IgG, and IgM, and several of these may be further divided into subclasses (isotypes), e.g., IgGl, IgG2, IgG3, IgG4, IgA, and IgA2.
  • the heavy chain constant domains that correspond to the different classes of antibodies are called ⁇ , ⁇ , ⁇ , ⁇ , and ⁇ , respectively.
  • the subunit structures and three-dimensional configurations of different classes of immunoglobulins are well known.
  • Single-chain Fv or “scFv” antibody fragments comprise the V H and V L domains of antibody, wherein these domains are present in a single polypeptide chain.
  • the Fv polypeptide further comprises a polypeptide linker between the V H and V L domains that enables the scFv to form the desired structure for antigen binding.
  • diabodies refers fo " small antibody fragments with two antigen-binding sites, which fragments comprise a heavy-chain variable domain (VH) connected to a light-chain variable domain (V L ) in the same polypeptide chain (V H - VL).
  • VH heavy-chain variable domain
  • V L light-chain variable domain
  • the term "monoclonal antibody” as used herein refers to an antibody obtained from a population of substantially homogeneous antibodies, Le., the individual antibodies comprising the population are identical and/or bind the same epitope, except for possible variants that may arise during production of the monoclonal antibody, such variants generally being present in minor amounts.
  • each monoclonal antibody is directed against a single determinant on the antigen.
  • the monoclonal antibodies are advantageous in that they are uncontaminated by other immunoglobulins.
  • the modifier "monoclonal” indicates the character of the antibody as being obtained from a substantially homogeneous population of antibodies, and is not to be construed as requiring production of the antibody by any particular method.
  • the monoclonal antibodies to be used in accordance with the present invention may be made by the hybridoma method first described by Kohler et al, Nature, 256:495 (1975), or may be made by recombinant DNA methods (see, e.g., U.S. Patent No. 4,816,567).
  • the “monoclonal antibodies” may also be isolated from phage antibody libraries using the techniques described in Clackson et al., Nature, 352:624-628 (1991) and Marks et al., J. MoI. Biol, 222:581-597 (1991), for example.
  • the iponoclonal antibodies herein specifically include "chimeric" antibodies (immunoglobulins) in which a portion of the heavy and/or light chain is identical with or homologous to corresponding sequences in antibodies derived from a particular species or belonging to a particular antibody class or subclass, while the remainder of the chain(s) is identical with or homologous to corresponding sequences in antibodies derived from another species or belonging to another antibody class or subclass, as well as fragments of such antibodies, so long as they exhibit the desired biological activity (U.S. Patent No. 4,816,567; Morrison et al, Proc. Natl. Acad. ScL USA, 81:6851-6855 (1984)).
  • chimeric antibodies immunoglobulins in which a portion of the heavy and/or light chain is identical with or homologous to corresponding sequences in antibodies derived from a particular species or belonging to a particular antibody class or subclass, while the remainder of the chain(s) is identical with or homologous to corresponding sequence
  • Chimeric antibodies of interest herein include "primatized" antibodies comprising variable domain antigen-binding sequences derived from a non-human primate (e.g. Old World Monkey, such as baboon, rhesus or cynomolgus monkey) and human constant region sequences (US Pat No. 5,693,780).
  • a non-human primate e.g. Old World Monkey, such as baboon, rhesus or cynomolgus monkey
  • human constant region sequences US Pat No. 5,693,780
  • Humanized forms of non-human (e.g., murine) antibodies are chimeric antibodies that contain minimal sequence derived from non-human immunoglobulin.
  • humanized antibodies are human immunoglobulins (recipient antibody) in which residues from a hypervariable region of the recipient are replaced by residues from a hypervariable region of a non-human species (donor antibody) such as mouse, rat, rabbit or nonhuman primate having the desired specificity, affinity, and capacity.
  • donor antibody such as mouse, rat, rabbit or nonhuman primate having the desired specificity, affinity, and capacity.
  • framework region (FR) residues of the human immunoglobulin are replaced by corresponding non-human residues.
  • humanized antibodies may comprise residues that are not found in the recipient antibody or in the donor antibody. These modifications are made to further refine antibody performance.
  • the humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the hypervariable loops correspond to those of a non-human immunoglobulin and all or substantially all of the FRs are those of a human immunoglobulin sequence, except for FR substitution(s) as no ⁇ ed above.
  • the humanized antibody optionally also will comprise at least a portion of an immunoglobulin constant region, typically that of a human immunoglobulin. For further details, see Jones et al, Nature 321:522-525 (1986); Riechmann et al, Nature 332:323-329 (1988); and Presta, Curr. Op. Struct. Biol. 2:593- 596 (1992).
  • hypervariable region when used herein refers to the amino acid residues of an antibody that are responsible for antigen binding.
  • the hypervariable region comprises amino acid residues from a "complementarity determining region" or "CDR" (e.g. residues 24-34 (Ll), 50-56 (L2) and 89-97 (L3) in the light chain variable domain and 31-35 (Hl), 50-65 (H2) and 95-102 (H3) in the heavy chain variable domain; Kabat et al, Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, MD. (1991)) and/or those residues from a "hypervariable loop” (e.g. residues 26-32 (Ll),
  • a "naked antibody” is an antibody (as herein defined) that is not conjugated to a heterologous molecule, such as a cytotoxic moiety or radiolabel.
  • an “isolated” antibody is one that has been identified and separated and/or recovered from a component of its natural environment. Contaminant components of its natural environment are materials that would interfere with diagnostic or therapeutic uses for the antibody, and may include enzymes, hormones, and other proteinaceous or non-proteinaceous solutes.
  • the antibody will be purified (1) to greater than 95% by weight of antibody as determined by the Lo wry method, and most preferably more than
  • Isolated antibody includes the antibody in situ within recombinant cells since at least one component of the antibody's natural environment will not be present. Ordinarily, however, isolated antibody will be prepared by at least one purification step.
  • a "subject” herein is a human subject, including a patient, eligible for treatment for Sjogren's syndrome who is experiencing or has experienced one or more signs, symptoms, or other indicators of Sjogren's syndrome, has been diagnosed with Sjogren's syndrome, whether, for example, newly diagnosed or previously diagnosed and now experiencing a recurrence or relapse, or is at risk for developing Sjogren's syndrome.
  • the subject may have been previously treated with CD20 antibody or not so treated.
  • a subject eligible for treatment of Sjogren's syndrome may optionally be identified as one who has been screened, as in the blood, for elevated levels of infiltrating CD20 cells or is screened using an assay to detect auto-antibodies, wherein autoantibody production is assessed qualitatively, and preferably quantitatively.
  • Exemplary such auto-antibodies associated with Sjogren's syndrome include anti-nuclear antibodies (ANA), anti-rheumatoid factor (RF) antibodies, antibodies directed against proteins termed Sj ⁇ gren's-associated antigens A or B (or SS-A or SS-B), such as, for example, anti-Ro/SS-A antibodies, anti-La/SS-A antibodies, anti-La/SS-B antibodies, and anti-Ro/SS-B antibodies, antibodies directed against centromere protein B (CENP B) or centromere protein C (CENP C), an autoantibody to ICA69, or a combination of two or more of such antibodies.
  • ANA anti-nuclear antibodies
  • RF anti-rheumatoid factor
  • RF anti-rheumatoid factor
  • SS-A or SS-B antibodies directed against proteins termed Sj ⁇ gren's-associated antigens A or B
  • SS-A or SS-B such as, for example, anti-R
  • a "patient” herein is a human subject eligible for treatment for Sjogren's syndrome who is experiencing or has experienced one or more signs, symptoms, or other indicators of Sjogren's syndrome, whether, for example, newly diagnosed or previously diagnosed and now experiencing a recurrence or relapse.
  • the patient may Save ' Been ' previously" treated 1' wltFTdb20 antibody or not so treated.
  • a patient eligible for treatment of Sjogren's syndrome may optionally be identified as one who has been screened, as in the blood, for elevated levels of infiltrating CD20 cells or is screened using an assay to detect auto-antibodies, such as those noted above, wherein autoantibody production is assessed qualitatively, and preferably quantitatively.
  • Schirmer's test which involves numbing the eye from being irritated before placing a strip of paper (referred to as a Schirmer's strip) in the eye. This strip measures the amount of wetting that occurs over a five-minute period. Less than 5 mm of wetting is a strong indicator of dry eyes. This test is not 100% accurate and should be performed again if the diagnosis remains an issue.
  • Rose-Bengal dye test which stains for damaged/inflamed areas of the cornea.
  • Dry mouth can be checked by measuring salivary gland flow rates to determine whether there is decreased saliva production.
  • salivary gland flow rates In some patients, the infiltration of lymphocytes into the parotid or submandibular glands causes pain and swelling.
  • a biopsy may be taken from the inner surface of the lower lip to establish a firm diagnosis to show how many (if any) salivary glands remain and the type of inflammatory infiltrate present.
  • a positive result reveals characteristic inflammatory features consistent with the diagnosis of Sjogren's syndrome. It is likely that the mouth and eye dryness results both from destruction of the salivary glands and from interruption of nerve signals that control secretion.
  • RA rheumatoid arthritis
  • SLE systemic lupus erythematosus
  • SLE-like diseases SLE-like diseases.
  • RA rheumatoid arthritis
  • SLE systemic lupus erythematosus
  • SLE-like diseases SLE-like diseases.
  • RA rheumatoid arthritis
  • SLE systemic lupus erythematosus
  • SLE-like diseases SLE-like diseases.
  • aquaporins such as aquaporin 5 (AQP5) may be useful in diagnosis of this syndrome.
  • Treatment of a subject refers to both therapeutic treatment and prophylactic or preventative measures. Those in need of treatment include those already with Sjogren's syndrome as well as those in which the Sjogren's syndrome is to be prevented. Hence, the subject may have been diagnosed as having the Sjogren's syndrome or may be predisposed or susceptible to the Sjogren's syndrome. Treatment of a subject includes treatment of a patient.
  • Treatment of a patient herein refers to therapeutic treatment. Those patients in need of treatment are those diagnosed with Sjogren's syndrome.
  • a "symptom" of Sjogren's syndrome is any morbid phenomenon or departure from the normal in structure, function, or sensation, experienced by the subject or patient and indicative of disease.
  • an amount of the antibody or antagonist that is effective for treating Sjogren's syndrome refers to an amount of the antibody or antagonist that is effective for treating Sjogren's syndrome.
  • Antibody exposure refers to contact with or exposure to the antibody herein in one or more doses administered over a period of time of about 1 day to about 5 weeks. The doses may be given at one time or at a fixed or at irregular time intervals over this period of exposure, such as, for example, one dose weekly for four weeks or two doses separated by a time interval of about 13-17 days. Initial and later antibody exposures are separated in time from each other as described in detail herein.
  • An exposure not being administered or provided until a certain time "from the initial exposure" or from any prior exposure means that the time for the second or later exposure is measured from the time any of the doses from the prior exposure were administered, if more than one dose was administered in that exposure.
  • the second exposure is not given until at least about 16-54 weeks as measured from the time the first or the second dose was administered within that prior exposure.
  • the second exposure may be measured from the time of the first, second, or third dose within the prior exposure.
  • "from the initial exposure" or from any prior disclosure is measured from the time of the first dose.
  • immunosuppressive agent refers to substances that act to suppress or mask the immune system of the mammal being treated herein. This would include substances that suppress cytokine production, down-regulate or suppress self-antigen expression, or mask the MHC antigens.
  • agents examples include 2-amino-6-aryl-5-substituted pyrimidines (see U.S. Pat. No. 4,665,077); nonsteroidal antiinflammatory drugs (NSAIDs); ganciclovir, tacrolimus, glucocorticoids such as Cortisol or aldosterone, anti-inflammatory agents such as a cyclooxygenase inhibitor, a 5-lipoxygenase inhibitor, or a leukotriene receptor antagonist; purine antagonists such as azathioprine or mycophenolate mofetil (MMF); alkylating agents such as cyclophosphamide; bromocryptine; danazol; dapsone; glutaraldehyde (which masks the MHC antigens, as described in U.S.
  • NSAIDs nonsteroidal antiinflammatory drugs
  • ganciclovir tacrolimus
  • glucocorticoids such as Cortisol or aldosterone
  • anti-inflammatory agents such as a
  • anti-idiotypic antibodies for MHC antigens and MHC fragments include cyclosporin A; steroids such as corticosteroids or glucocorticosteroids or glucocorticoid analogs, e.g., prednisone, methylprednisolone, and dexamethasone; dihydrofolate reductase inhibitors such as methotrexate (oral or subcutaneous); antimalarial agents such as chloroquine and hydroxychloroquine; sulfasalazine; leflunomide; cytokine or cytokine receptor antibodies including anti-interferon-alpha, -beta, or - gamma antibodies, anti-tumor necrosis factor(TNF)-alpha antibodies (infliximab or adalimumab), anti-TNF- alpha immunoadhesin (etanercept), anti-TNF-beta antibodies, anti
  • T-cell receptor fragments Offner etal, Science, 251: 430-432 (1991); WO 90/11294; Ianeway, Nature, 341: 482 (1989); and WO 91/01133
  • BAFF antagonists such as BAFF antibodies and BR3 antibodies
  • anti-CD40 receptor or anti-CD40 ligand CD154
  • T-cell receptor antibodies EP 340,109
  • Some preferred immunosuppressive agents herein include cyclophosphamide, chlorambucil, azathioprine, or methotrexate.
  • cytotoxic agent refers to a substance that inhibits or prevents the function of cells and/or causes destruction of cells.
  • the term is intended to include radioactive isotopes ⁇ e.g. At 211 , 1 131 , 1 125 , Y 90 , Re 186 , Re 188 , Sm 153 , Bi 212 , P 32 and radioactive isotopes of Lu), chemotherapeutic agents, and toxins such as small-molecule toxins or enzymatically active toxins of bacterial, fungal, plant or animal origin, or fragments thereof.
  • chemotherapeutic agent is a chemical compound useful in the treatment of cancer.
  • examples of chemotherapeutic agents include alkylating agents such as thiotepa and cyclosphosphamide (CYTOXAN®); alkyl sulfonates such as busulfan, improsulfan and piposulfan; aziridines such as benzodopa, carboquone, meturedopa, and uredopa; ethylenimines and methylamelamines including altretamine, triethylenemelamine, trietylenephosphoramide, triethiylenethiophosphoramide and trimethylolomelamine; acetogenins (especially bullatacin and bullatacinone); delta-9-tetrahydrocannabinol (dronabinol, MARINOL®); beta-lapachone; lapachol; colchicines; betulinic acid; a camptothecin (including the synthetic analogue topote
  • calicheamicin especially calicheamicin gammall and calicheamicin omegall
  • dynemicin including dynemicin A; an esperamicin; as well as neocarzinostatin chromophore and related chromoprotein enediyne antiobiotic chromophores), aclacinomysins, actinomycin, authramycin, azaserine, bleomycins, cactinomycin, carabicin, carminomycin, carzinophilin, chromomycinis, dactinomycin, daunorubicin, detorubicin, 6-diazo-5-oxo-L-norleucine, doxorubicin (including ADRIAMYCIN®, morpholino-doxorubicin, cyano
  • anti-hormonal agents that act to regulate, reduce, block, or inhibit the effects of hormones that can promote the growth of cancer, and are often in the form of systemic, or whole- body treatment. They may be hormones themselves.
  • SERMs selective estrogen receptor modulators
  • tamoxifen including NOLVADEX® tamoxifen
  • raloxifene EVISTA®
  • droloxifene 4-hydroxytamoxifen, trioxifene, keoxifene, LYl 17018, onapristone, and toremifene (FARESTON®
  • anti-progesterones include estrogen receptor down-regulators (ERDs); estrogen receptor antagonists such as fulvestrant (FASLODEX®); agents that function to suppress or shut down the ovaries, for example, leutinizing hormone-releasing hormone (LHRH) agonists such as leuprolide acetate (LUPRON® and ELI
  • chemotherapeutic agents includes bisphosphonates such as clodronate (for example, BONEFOS® or OSTAC®), etidronate (DIDROCAL®), NE-58095, zoledronic acid/zoledronate (ZOMETA®), alendronate (FOSAMAX®), pamidronate (AREDIA®), tiludronate (SKELID®), or risedronate (ACTONEL®); as well as troxacitabine (a
  • antisense oligonucleotides particularly those that inhibit expression of genes in signaling pathways implicated in abherant cell proliferation, such as, for example, PKC-alpha, Raf, H-Ras, and epidermal growth factor receptor (EGF-R); vaccines such as THERATOPE® vaccine and gene therapy vaccines, for example, ALLOVECTIN® vaccine, LEUVECTIN® vaccine, and VAXID® vaccine; topoisomerase 1 inhibitor (e.g., LURTOTECAN®); rmRH (e.g., ABARELIX®); lapatinib ditosylate (an ErbB-
  • COX-2 inhibitors such as celecoxib (CELEBREX®; 4-(5 : (4-methylphenyl)-3-(trifluoromethyl)-lH-pyrazol-l-yl) benzenesulfonamide; and pharmaceutically acceptable salts, acids or derivatives of any of the above.
  • cytokine is a generic term for proteins released by one cell population that act on another cell as intercellular mediators.
  • cytokines are lymphokines, monokines; interleukins (ILs) such as IL-I, IL- l ⁇ , IL-2, IL-3, IL-4, IL-5, IL-6, DL-7, IL-8, IL-9, IL-U, IL-12, IL-15, including PROLEUKIN® rIL-2; a tumor necrosis factor such as TNF- ⁇ or TNF- ⁇ ; and other polypeptide factors including LIF and kit ligand (KL).
  • cytokine includes proteins from natural sources or from recombinant cell culture and biologically active equivalents of the native-sequence cytokines, including synthetically produced small-molecule entities and pharmaceutically acceptable derivatives and salts thereof.
  • hormone refers to polypeptide hormones, which are generally secreted by glandular organs with ducts. Included among the hormones are, for example, growth hormone such as human growth hormone, N-methionyl human growth hormone, and bovine growth hormone; parathyroid hormone; thyroxine; insulin; proinsulin; relaxin; estradiol; hormone-replacement therapy; androgens such as calusterone, dromostanolone propionate, epitiostanol, mepitiostane, or testolactone; prorelaxin; glycoprotein hormones such as follicle stimulating hormone (FSH), thyroid stimulating hormone (TSH), and luteinizing hormone (LH); prolactin, placental lactogen, mouse gonadotropin-associated peptide, gonadotropin-releasing hormone; inhibin; activin; mullerian-inhibiting substance; and thrombopoietin. As used herein, the term hormone includes proteins from natural sources
  • growth factor refers to proteins that promote growth, and include, for example, hepatic growth factor; fibroblast growth factor; vascular endothelial growth factor; nerve growth factors such as NGF- ⁇ ; platelet-derived growth factor; transforming growth factors (TGFs) such as TGF- ⁇ and TGF- ⁇ ; insulin-like growth factor-I and -II; erythropoietin (EPO); osteoinductive factors; interferons such as interferon- ⁇ , - ⁇ , and - ⁇ ; and colony stimulating factors (CSFs) such as macrophage-CSF (M-CSF); granulocyte-macrophage-CSF (GM- CSF); and granulocyte-CSF (G-CSF).
  • growth factor includes proteins from natural sources or from recombinant cell culture and biologically active equivalents of the native-sequence growth factor, including synthetically produced small-molecule entities and pharmaceutically acceptable derivatives and salts thereof.
  • integrin refers to a receptor protein that allows cells both to bind to and to respond to the extracellular matrix and is involved in a variety of cellular functions such as wound healing, cell differentiation, homing of tumor cells and apoptosis. They are part of a large family of cell adhesion receptors that are involved in cell-extracellular matrix and cell-cell interactions.
  • Functional integrins consist of two transmembrane glycoprotein subunits, called alpha and beta, that are non-covalently bound. The alpha subunits all share some homology to each other, as do the beta subunits.
  • the receptors always contain one alpha chain and one beta chain. Examples include Alpha ⁇ betal, Alpha3betal, Alpha7betal, LFA-I etc.
  • integrin includes proteins from natural sources or from recombinant cell culture and biologically active equivalents of the native-sequence integrin, including synthetically produced small-molecule entities and pharmaceutically acceptable derivatives and salts thereof.
  • TNF-alpha tumor necrosis factor alpha
  • TNF-alpha inhibitor herein is an agent that inhibits, to some extent, a biological function of TNF- alpha, generally through binding to TNF-alpha and neutralizing its activity.
  • TNF inhibitors specifically contemplated herein are etanercept (ENBREL®), infliximab (REMICADE®), and adalimumab (HUMIRATM).
  • DMARDs Disease-modifying anti-rheumatic drugs
  • hydroxycloroquine sulfasalazine, methotrexate, leflunomide, etanercept, infliximab (plus oral and subcutaneous methrotrexate), azathioprine, D-penicillamine, gold salts (oral), gold salts (intramuscular), minocycline, cyclosporine including cyclosporine A and topical cyclosporine, staphylococcal protein A immunoadsorption, including salts and derivatives thereof, etc. i
  • nonsteroidal anti-inflammatory drugs or “NSAIDs” are aspirin, acetylsalicylic acid, ibuprofen, naproxen, indomethacin, sulindac, tolmetin, including salts and derivatives thereof, etc.
  • NSAIDs nonsteroidal anti-inflammatory drugs
  • they are aspirin, naproxen, ibuprofen, indomethacin, or tolmetin.
  • integrin antagonists or antibodies include an LFA-I antibody, such as efalizumab (RAPTIV A ® ) commercially available from Genentech, or an alpha 4 integrin antibody such as natalizumab (ANTEGREN ® ) available from Biogen, or diazacyclic phenylalanine derivatives (WO 2003/89410), phenylalanine derivatives (WO 2003/70709, WO 2002/28830, WO 2002/16329 and WO 2003/53926), phenylpropionic acid derivatives (WO 2003/10135), enamine derivatives (WO 2001/79173), propanoic acid derivatives (WO 2000/37444), alkanoic acid derivatives (WO 2000/32575), substituted phenyl derivatives (US Pat.
  • LFA-I antibody such as efalizumab (RAPTIV A ® ) commercially available from Genentech
  • alpha 4 integrin antibody such as natalizumab (ANTEGREN ® ) available
  • “Secretory agonist for dry mouth or dry eye” is a medicament for treating dry mouth or dry eye, such as, for example, pilocarpine and pilocarpine hydrochloride, cevimeline (EVOXAC®), bromhexine, RESTASIS® (cyclosporine ophthalmic emulsion), diquafosol, purinergic receptor agonists, muscarinic agonists, parasympathomimetic agents, cysteamine eye drops (Kaiser-Kupfer et al., Arch Ophthalmol., 108(5): 689-693 (1990)), REFRESH ENDURA ® lubricant eye drops, and their pharmaceutical salts and derivatives.
  • pilocarpine and pilocarpine hydrochloride cevimeline (EVOXAC®), bromhexine, RESTASIS® (cyclosporine ophthalmic emulsion), diquafosol, purinergic receptor agonists, muscarinic agonist
  • Corticosteroid refers to any one of several synthetic or naturally occurring substances with the general chemical structure of steroids that mimic or augment the effects of the naturally occurring corticosteroids.
  • synthetic corticosteroids include prednisone, prednisolone (including methylprednisolone), dexamethasone or dexamethasone triamcinolone, hydrocortisone, and betamethasone.
  • the preferred corticosteroids herein are prednisone, methylprednisolone, hydrocortisone, or dexamethasone.
  • an "antimalarial agent” is an agent that treats malaria (including prevention of malaria), and is useful, for example, to treat the systemic complications of Sjogren's syndrome, such as arthritis, fatigue, and skin rashes.
  • agent includes, for example, hydrochloroquine, chloroquine, LARIUMTM, mefloquine, mefloquine hydrochloride, MEPHAQUINETM, primaquine - ATABRINETM, mepacrine, quinacrine, quinacrine hydrochloride, and quinine.
  • PreferaS ⁇ y, ' ⁇ t' is hydrochloroquine or chloroquine, most preferably hydroxychloroquine (such as the brand name PLAQUENIL®).
  • BAFF "BAFF polypeptide,” “TALL-I” or “TALL-I polypeptide,” and “BLyS” when used herein encompass “native-sequence BAFF polypeptides” and “BAFF variants”. "BAFF” is a designation given to those polypeptides that have any one of the amino acid sequences shown below:
  • a biological activity of BAFF can be selected from the group consisting of promoting B cell survival, promoting B cell maturation and binding to BR3.
  • Variants of BAFF will preferably have at least 80% or any successive integer up to 100% including, more preferably, at least 90%, and even more preferably, at least 95% amino acid sequence identity with a native sequence of a BAFF polypeptide.
  • a "native-sequence" BAFF polypeptide comprises a polypeptide having the same amino acid sequence as the corresponding BAFF polypeptide derived from nature.
  • BAFF exists in a soluble form following cleavage from the cell surface by furin-type proteases.
  • Such native-sequence BAFF polypeptides can be isolated from nature or can be produced by recombinant and/or synthetic means.
  • non-sequence BAFF polypeptide or “native BAFF” specifically encompasses naturally occurring truncated or secreted forms (e.g., an extracellular domain sequence), naturally occurring variant forms (e.g., alternatively spliced forms), and naturally occurring allelic variants of the polypeptide.
  • BAFF includes those polypeptides described in Shu et ah, J. Leukocyte Biol, 65:680 (1999); GenBank Accession No.
  • BAFF antagonist as used herein is used in the broadest sense, and includes any molecule that (1) binds a native-sequence BAFF polypeptide or binds a native-sequence of BR3 to partially or fully block BR3 interaction with BAFF polypeptide, and (2) partially or fully blocks, inhibits, or neutralizes native- sequence BAFF activity.
  • the BAFF receptor to be blocked is the BR3 receptor.
  • Native BAFF activity promotes, among other things, B-cell survival and/or B-cell maturation.
  • the inhibition, blockage or neutralization of BAFF activity results in a reduction in the number of
  • a BAFF antagonist according to this invention will partially or fully block, inhibit, or neutralize one or more biological activities of a BAFF polypeptide, in vitro and/or in vivo.
  • a biologically active BAFF potentiates any one or a combination of the following events in vitro and/or in vivo: an increased survival of B cells, an increased level of IgG and/or IgM, an increased numbers of plasma cells, and processing of NF- ⁇ b2/100 to p52 NF- ⁇ b in splenic B cells ⁇ e.g., Batten et al, J. Exp. Med. 192:1453-1465 (2000); Moore et al, Science 285:260-263 (1999); Kayagaki et al. Immunity 17:515-524 (2002)).
  • a BAFF antagonist can function in a direct or indirect manner to partially or fully block, inhibit or neutralize BAFF signaling, in vitro or in vivo.
  • the BAFF antagonist can directly bind BAFF.
  • BAFF antibodies that bind within a region of human BAFF comprising residues 162- 275 and/or a neighboring residue of a residue selected from the group consisting of 162, 163, 206, 211, 231, 233, 264 and 265 of human BAFF such that the antibody sterically hinders BAFF binding to BR3 are contemplated, where such residue numbers refer to SEQ ID NO: 16.
  • a direct binder is a polypeptide comprising any portion of a BAFF receptor that binds BAFF such as an extracellular domain of a BAFF receptor, or fragments and variants thereof that bind native BAFF.
  • BAFF antagonists include the polypeptides having a sequence of a polypeptide comprising the sequence of Formula I: X 1 -C-X 3 -D-X 5 -L-X 7 -X 8 -X 9 -XIO-XIi-Xi 2 -C-Xi 4 -XiS-Xi 6 -Xn (Formula I) (SEQ ID NO: 18) wherein Xi, X 3 , X 5 , X 7 , Xg, Xg, X 10 , Xn, X 12 , X 14 , X 15 and X[ 7 are any amino acid except cysteine; and wherein X ⁇ is an amino acid selected from the group consisting of L, F, I and V;
  • a polypeptide comprising the sequence of Formula I has the two Cs joined by disulfide bonding; X 5 LX 7 X 8 forming the conformation of a type I beta turn structure with the center of the turn between L and X 7 ; and has a positive value for the dihedral angle phi of X 8 .
  • X 10 is selected from the group consisting of W, F, V, L, I, Y, M and a non-polar amino amino acid.
  • Xio is W.
  • X 3 is an amino acid selected from the group consisting of M, V, L, I, Y, F, W and a non-polar amino acid.
  • X 5 is selected from the group consisting of V, L, P, S, I, A and R.
  • X 7 is selected from the group consisting of V, T, I and L.
  • X 8 is selected from the group consisting of R, K, G, N, H and a D-amino acid.
  • X 9 is selected from the group consisting of H, K, A, R and Q.
  • Xn is I or V.
  • X 12 is selected from the group consisting of P, A, D, E and S.
  • X 16 is L.
  • the sequence of Formula I is a sequence selected from the group consisting of ECFDLLVRAWVPCSVLK (SEQ ID NO: 19), ECFDLLVRHWVPCGLLR (SEQ ID NO:20), ECFDLLVRRWVPCEMLG (SEQ ID NO:21), ECFDLLVRSWVPCHMLR (SEQ ID NO:22), ECFDLLVRHWVACGLLR (SEQ ID NO:23), and QCFDRLNAWVPCSVLK (SEQ ID NO:24).
  • the BAFF antagonist comprises any one of the amino acid sequences selected from the group consisting of SEQ ID NO: 19, 20, 21, 22, and 23.
  • BAFF antagonists include the polypeptides having a sequence of a polypeptide comprising the sequence of Formula II:
  • X 1 -C-X 3 -D-X 5 -L-V-X 8 -X 9 -W-V-P-C-X 14 -X 15 -L-X n (Formula II) (SEQ ID NO:25 ) wherein X 1 , X 3 , X 5 , X 8 , X 9 , X 14 , X 15 and X 17 are any amino acid, except cysteine; and wherein the polypeptide does not comprise a cysteine within seven amino acid residues N-terminal to the most
  • a polypepti3e ' comprising the sequence of Formula II has a disulfide bond between the two Cs and has the conformation Of X 5 LX 7 X 8 forming a type I beta turn structure with the center of the turn between L and X 7 ; and has a positive value for the dihedral angle phi of X 8 .
  • X 3 is an amino acid selected from the group consisting of M, A, V, L, I, Y, F, W and a non-polar amino acid.
  • X 5 is selected from the group consisting of V, L, P, S, I, A and R.
  • X 8 is selected from the group consisting of R, K, G, N, H and D-amino acid.
  • X 9 is selected from the group consisting of H, K, A, R and Q.
  • the BAFF receptor from which the extracellular domain or BAFF-binding fragment or BAFF-binding variant thereof is derived is TACI, BR3 or BCMA.
  • the BAFF antagonist can bind an extracellular domain of a native-sequence BR3 at its BAFF binding region to partially or fully block, inhibit or neutralize BAFF binding to BR3 in vitro, in situ, or in vivo.
  • such indirect antagonist is an anti-BR3 antibody that binds in a region of BR3 comprising residues 23-38 of human BR3 as defined below (SEQ ID NO:26) or a neighboring region of those residues such that binding of human BR3 to BAFF is sterically hindered.
  • a BAFF antagonist according to this invention includes BAFF antibodies and immunoadhesins comprising an extracellular domain of a BAFF receptor, or fragments and variants thereof that bind native BAFF.
  • the BAFF receptor from which the extracellular domain or BAFF- binding fragment or BAFF-binding variant thereof is derived is TACI, BR3 or BCMA.
  • the immunoadhesin comprises an amino acid sequence of that of Formula I or Formula II as set forth above, including an amino acid sequence selected from any one of the group consisting of SEQ ID NOS:
  • the BAFF antagonist binds to a BAFF polypeptide or a BR3 polypeptide with a binding affinity of 10OnM or less. According to another embodiment, the BAFF antagonist binds to a BAFF polypeptide or a BR3 polypeptide with a binding affinity of 1OnM or less. According to yet another embodiment, the BAFF antagonist binds to a BAFF polypeptide or a BR3 polypeptide with a binding affinity of InM or less.
  • BR3 BR3 polypeptide
  • BR3 receptor when used herein encompass "native- sequence BR3 polypeptides” and “BR3 variants” (which are further defined herein).
  • BR3 is a designation given to those polypeptides comprising the following amino acid sequence and homologs thereof: human BR3 sequence (SEQ ID NO:26):
  • BR3 polypeptides of the invention can be isolated from a variety of sources, such as from human tissue types or from another source, or prepared by recombinant and/or synthetic methods.
  • the term BR3 includes the BR3 polypeptides described in WO 2002/24909 and WO 2003/14294.
  • a “native-sequence” BR3 polypeptide or “native BR3” comprises a polypeptide having the same amino acid sequence as the corresponding BR3 polypeptide derived from nature. Such native-sequence BR3 polypeptides can be isolated from nature or can be produced by recombinant and/or synthetic means.
  • the term "native-sequence BR3 polypeptide” specifically encompasses naturally occurring truncated, soluble or secreted forms ⁇ e.g., an extracellular domain sequence), naturally occurring variant forms ⁇ e.g., alternatively spliced forms) and naturally occurring allelic variants of the polypeptide.
  • the BR3 polypeptides of the invention include the BR3 polypeptide comprising or consisting of the contiguous sequence of amino acid residues 1 to 184 of a human BR3 (SEQ ID NO:26).
  • a BR3 "extracellular domain” or “ECD” refers to a form of the BR3 polypeptide that is essentially free of the transmembrane and cytoplasmic domains.
  • ECD forms of BR3 include a polypeptide comprising any one of the amino acid sequences selected from the group consisting of amino acids 1-77, 2-62, 2-71, 1-61, 7-71, 23- 38 and 2-63 of human BR3.
  • the invention contemplates BAFF antagonists that are polypeptides comprising any one of the above-mentioned ECD forms of human BR3 and variants and fragments thereof that bind a native BAFF.
  • Mini-BR3 is a 26-residue core region of the BAFF-binding domain of BR3, i.e., the amino acid sequence: TPCVPAECFD LLVRHCVACG LLRTPR (SEQ ID NO:27)
  • BR3 valiant means a BR3 polypeptide having at least about 80% amino acid sequence identity with the amino acid sequence of a native-sequence, full-length BR3 or BR3 ECD and binds a native-sequence BAFF polypeptide.
  • the BR3 variant includes a single cysteine-rich domain.
  • Such BR3 variant polypeptides include, for instance, BR3 polypeptides wherein one or more amino acid residues are added, or deleted, at the N- and/or C-terminus, as well as within one or more internal domains, of the full-length amino acid sequence. Fragments of the BR3 ECD that bind a native sequence BAFF polypeptide are also contemplated.
  • a BR3 variant polypeptide will have at least about 80% amino acid sequence identity, at least about 81 % amino acid sequence identity, at least about 82% amino acid sequence identity, at least about 83% amino acid sequence identity, at least about 84% amino acid sequence identity, at least about 85% amino acid sequence identity, at least about 86% amino acid sequence identity, at least about 87% amino acid sequence identity, at least about 88% amino acid sequence identity, at least about 89% amino acid sequence identity, at least about 90% amino acid sequence identity, at least about 91% amino acid sequence identity, at least about 92% amino acid sequence identity, at least about 93% amino acid sequence identity, at least about 94% amino acid sequence identity, at least about 95% amino acid sequence identity, at least about 96% amino acid sequence identity, at least about 97% amino acid sequence identity, at least about 98% amino acid sequence identity or at least about 99% amino acid sequence identity with a human BR3 polypeptide or a specified fragment thereof ⁇ e.g., ECD).
  • BR3 variant polypeptides do not encompass the native
  • BR3 polypeptide sequence is at least about 10 amino acids in length, at least about 20 amino acids in length, at least about 30 amino acids in length, at least about 40 amino acids in length, at least about 50 amino acids in length, at least about 60 amino acids in length, or at least about 70 amino acids in length.
  • the BAFF antagonists herein are immunoadhesins comprising a portion of BR3, TACI or BCMA that binds BAFF, or variants thereof that bind BAFF. In other embodiments, the BAFF antagonist is a BAFF antibody.
  • BAFF antibody is an antibody that binds BAFF, and preferably binds BAFF within a region of human BAFF comprising residues 162-275 of the human BAFF sequence disclosed herein under the "BAFF" definition (SEQ ID NO: 16).
  • the BAFF antagonist is BR3 antibody.
  • a “BR3 antibody” is an antibody that binds BR3, and is preferably one that binds BR3 within a region of human BR3 comprising residues 23-38 of the human BR3 sequence disclosed herein under the "BK3" definition (SEQ ID NO:26)7
  • BK3 definition of the human BR3 sequence disclosed herein under the "BK3" definition (SEQ ID NO:26)7
  • the amino acid positions of human BAFF and human BR3 referred to herein are according to the sequence numbering under human BAFF and human BR3, SEQ ID NOS: 16 and 26, respectively, disclosed herein under the "BAFF" and "BR3" definitions.
  • BAFF-binding polypeptides or BAFF antibodies can be found in, e.g., WO 2002/092620, WO 2003/014294, Gordon et al., Biochemistry 42(20):5977-5983 (2003), Kelley et al. J Biol
  • a "package insert” is used to refer to instructions customarily included in commercial packages of therapeutic products, that contain information about the indications, usage, dosage, administration, contraindications, other therapeutic products to be combined with the packaged product, and/or warnings concerning the use of such therapeutic products, etc.
  • a “medicament” is an active drug to treat the Sjogren's syndrome or its symptoms or side effects.
  • VAS Visual Analogue Scale
  • a "Visual Analogue Scale” or “VAS” is a measurement of a characteristic or attitude that is believed to range across a continuum of values and cannot easily be directly measured. For example, the amount of pain that a patient feels ranges across a continuum from none to an extreme amount of pain. From the patient's perspective this spectrum appears continuous because the patient's pain does not take discrete jumps, as a categorization of none, mild, moderate and severe would suggest. It was to capture this idea of an underlying continuum that the VAS was devised. As such an assessment is clearly highly subjective, these scales are of most value when looking at change within individuals, and are of less value for comparing across a group of individuals at one time point.
  • VAS improvement over baseline on a VAS herein refers to improvement of the individual patient over his/her own baseline measurement on such a scale before treatment.
  • a VAS is a horizontal line, 100 mm in length, anchored by word descriptors at each end.
  • the patient marks on the line the point that the patient feels represents his or her perception of his or her current state.
  • the VAS score is often determined by measuring in millimetres from the left-hand end of the line to the point that the patient marks.
  • VAS scales There are many other ways in which VAS scales have been presented, including vertical lines and lines with extra descriptors. Wewers & Lowe, Research in Nursing and Health 13: 227-236
  • the marker of fatigue on such scale is fatigue characterized by loss of strength and energy, weariness, tiredness, and other forms of fatigue as a symptom of Sjogren's syndrome
  • the marker of joint pain on such scale is joint pain or arthralgia affecting one or more joints that would occur as a symptom of Sjogren's syndrome, such as would occur with arthritis, for example, stiffening or inflammation of a joint such as the knee, knuckles, wrists, ankles, etc. II.
  • the present invention provides a method of treating Sjogren's syndrome in a patient eligible for treatment, comprising administering an effective amount of an antagonist, preferably an antibody, that binds to a B-cell surface marker (more preferably a CD20 antibody) and an anti-malarial agent to the patient to provide at least about 30% (preferably at least about 35-50%) improvement over baseline in the patient in two or more of the following three measurements: dryness, fatigue, and joint pain, on a VAS. More preferably, the patient exhibits improvement from baseline in dryness and at least one of joint pain or fatigue.
  • the anti-malarial agent is hydroxychloroquine and no other medication, such as a steroid, is given.
  • the effective amount provides improvement over a control treatment comprising administering the anti-malarial agent to a patient but without the CD20 antibody.
  • the preferred anti-malarial agent is hydroxychloroquine or chloroquine, most preferably hydroxychloroquine.
  • the present invention provides a method of treating Sjogren's syndrome in a subject eligible for treatment, comprising administering an effective amount of an antibody that binds to a B-cell surface marker (preferably a CD20 antibody) to the subject to provide an initial antibody exposure (of preferably about 0.5 to 4 grams, more preferably about 1.5 to 3.5 grams, and still more preferably about 1.5 to 2.5 grams) followed by a second antibody exposure (of preferably about 0.5 to 4 grams, more preferably about
  • a B-cell surface marker preferably a CD20 antibody
  • the second exposure not being provided until from about 16 to 54 weeks (preferably from about 20 to 30 weeks, more preferably from about 46 to 54 weeks) from the initial exposure.
  • the second antibody exposure is the next time the subject is treated with the CD20 antibody after the initial antibody exposure, there being no intervening CD20 antibody treatment or exposure between the initial and second exposures.
  • Treatment includes, for example, meeting one or more primary and/or secondary efficacy endpoints as set forth in the Examples herein.
  • the method preferably comprises administering to the subject an effective amount of the CD20 antibody to provide a third antibody exposure (preferably of about 0.5-4 grams, more preferably about 1.5-3.5, still more preferably about 1.5-2.5 grams), the third exposure not being provided until from about 46 to 60 weeks (preferably about 46 to 55, more preferably about 46 to 52 weeks) from the initial exposure.
  • a third antibody exposure preferably of about 0.5-4 grams, more preferably about 1.5-3.5, still more preferably about 1.5-2.5 grams
  • the third exposure not being provided until from about 46 to 60 weeks (preferably about 46 to 55, more preferably about 46 to 52 weeks) from the initial exposure.
  • no further antibody exposure is provided until at least about 70-75 weeks from the initial exposure, and still more preferably no further antibody exposure is provided until about 74-80 weeks from the initial exposure.
  • any one or more of the antibody exposures herein may be provided to the subject as a single dose of antibody, or as separate doses, for example, about 1-4 separate doses of the antibody (e.g, constituting a first and second dose, or a first, second, and third dose, or a first, second, third, and fourth dose, etc).
  • the particular number of doses (whether one, two or three or more) employed for each antibody exposure is dependent, for example, on the type of Sjogren's syndrome treated, the type of antibody employed, whether, what type, and how much and how many of a second medicament is employed as noted below, and the method and frequency of administration.
  • the later dose (for example, second or third dose) is preferably administered from about 1 to 20 days, more preferably from about 6 to 16 days, and most preferably from about 14 to 16 days from the time the previous dose was administered.
  • the separate doses are preferably administered within a total period of between about 1 day and 4 weeks, more preferably between about 1 and 20 days (e.g., within a period of 6-18 days).
  • the separate doses are administered about weekly, with the second dose being administered about one week from the first dose and any third or subsequent dose being administered about one week from the second dose.
  • Each such separate dose of the antibody is preferably about 0.5 to 1.5 grams, more preferably about 0.75 to 1.3 grams.
  • the subject is provided at least about three exposures of the antibody, for example, from about 3 to 60 exposures, and more particularly about 3 to 40 exposures, most particularly, about 3 to 20 exposures. Preferably, such exposures are administered at intervals each of 24 weeks.
  • each antibody exposure is provided as a single dose of the antibody. In an alternative embodiment, each antibody exposure is provided as separate doses of the antibody. However, not every antibody exposure need be provided as a single dose or as separate doses.
  • about 2-3 grams of the CD20 antibody is administered as the initial exposure. If about 3 grams are administered, then about 1 gram of the CD20 antibody is administered weekly for about three weeks as the initial exposure. If about 2 grams of the CD20 antibody is administered as the initial exposure, then about 1 gram of the CD20 antibody is administered followed in about two weeks by another about 1 gram of the antibody as the initial exposure.
  • the second exposure is at about six months from the initial exposure and is administered in an amount of about 2 grams. In an alternative preferred aspect, the second exposure is at about six months from the initial exposure and is administered as about 1 gram of the antibody followed in about two weeks by another about 1 gram of the antibody.
  • an anti-malarial agent is administered to the subject along with the CD20 antibody.
  • a steroid such as a corticosteroid is preferably administered with the initial antibody exposure.
  • the steroid is not administered with the second exposure or is administered with the second exposure but in lower amounts than are used with the initial exposure. Also preferred is wherein the steroid is not administered with third or later exposures.
  • the CD20 or B -cell surface marker antibody may be a naked antibody or may be conjugated with another molecule such as a cytotoxic agent such as a radioactive compound.
  • the preferred CD20 antibody herein is a chimeric, humanized, or human CD20 antibody, more preferably rituximab, humanized 2H7 (e.g. comprising the variable domain sequences in SEQ ID Nos. 2 and 8), chimeric or humanized A20 antibody (Immunomedics), and HUMAX-CD20TM human CD20 antibody
  • the Sjogren's syndrome can be at any stage, in one preferred embodiment, the Sjogren's syndrome is secondary Sjogren's syndrome. In another preferred embodiment, the Sjogren's syndrome is primary Sjogren's syndrome.
  • the subject has never been previously treated with drug(s), such as immunosuppressive agent(s), to treat the Sjogren's syndrome and/or has never been previously treated with an antibody to a B-cell surface marker (e.g. never been previously treated with a CD20 antibody).
  • the patient has relapsed with the syndrome. In another embodiment, the patient has not relapsed with the syndrome.
  • the subject has been previously treated with drug(s) to treat the syndrome and/or has been previously treated with such antibody.
  • the CD20 antibody is the only medicament administered to the subject to treat the syndrome.
  • the CD20 antibody is one of the medicaments used to treat the syndrome.
  • the subject does not have rheumatoid arthritis.
  • the subject does not have multiple sclerosis.
  • the subject does not have lupus or ANCA-associated vasculitis.
  • the subject does not have an autoimmune disease other than Sjogren's syndrome.
  • an "autoimmune disease” herein is a disease or disorder arising from and directed against an individual's own tissues or organs or a co-segregate or manifestation thereof or resulting condition therefrom. In one embodiment, it refers to a condition that results from, or is aggravated by, the production by B cells of antibodies that are reactive with normal body tissues and antigens. In other embodiments, the autoimmune disease is one that involves secretion of an autoantibody that is specific for an epitope from a self antigen (e.g. a nuclear antigen).
  • a self antigen e.g. a nuclear antigen
  • a B-cell surface marker e.g. with the CD20 antibody
  • the antagonist such as CD20 antibody (or combination of antagonists, e.g. antibodies) is a first medicament and the anti-malarial agent is a second medicament.
  • the antibody is administered in multiple exposures, such medicament is called a second medicament, wherein the antibody is a first medicament.
  • additional medicaments include a chemotherapeutic agent, an interferon class drug such as interferon-alpha (e.g., from Amarillo Biosciences, Inc.), IFN-beta-la (REBIF ® and AVONEX ® ) or IFN-beta-lb (BETASERON ® ), an oligopeptide such as glatiramer acetate (COPAXONE ® ), a cytotoxic agent (such as mitoxantrone (NOVANTRONE ® ), methotrexate, cyclophosphamide, chlorambucil, and azathioprine), piroxicam (FELDENE®), a non-steroidal, anti-inflammatory medication possessing analgesic and antipyretic properties, intravenous immunoglobulin (gamma globulin), lymphocyte-depleting therapy (e.g., mitoxantrone, cyclophosphamide, CAMPATHTM antibodies, anti-CD
  • statin e.g., MMF or cyclosporine
  • cholesterol-lowering drug of the "statin” class which includes cerivastatin (BAYCOLTM), fluvastatin (LESCOLTM), atorvastatin (LIPITORTM), lovastatin (MEVACORTM), pravastatin (PRAVACHOLTM), and simvastatin (ZOCORTM)
  • estradiol, testosterone optionally at elevated dosages; Stuve et al.
  • DMARD such as an anti-malarial agent including those set forth above, NSAID, plasmapheresis, levothyroxine, cyclosporin A, somatastatin analogue, cytokine, anti-cytokine antagonist or antibody, anti-metabolite, immunosuppressive agent, rehabilitative surgery, radioiodine, thyroidectomy, BAFF antagonist such as BAFF or BR3 antibodies or immunoadhesins, anti-CD40 receptor or anti-CD40 ligand (CD154), anti-IL-6 receptor antagonist/antibody, another B-cell surface antagonist or antibody such as humanized 2H7 or other humanized or human CD20 antibody with rituximab, etc.
  • additional medicament also includes other types of treatments such as gene therapy, for example, human gene transfer studies for head and neck cancer treatment of patients to repair damaged salivary glands
  • medicaments include a moisture-replacement therapy such as eye drops to ease, for example, the symptoms of dryness, chemotherapeutic agent, a cytotoxic agent, anti-integrin, gamma globulin, anti-CD4, cladr ⁇ b ine,"corticosteroid, MMF, cyclosporine, cholesterol-lowering drug of the statin class, estradiol, testosterone, androgen, hormone-replacement drug, a TNF inhibitor, DMARD, NSAID (to treat, for example musculoskeletal symptoms), levothyroxine, cyclosporin A, somatastatin analogue, cytokine antagonist or cytokine-receptor antagonist, anti-metabolite, anti-malarial agent, BAFF antagonist such as BAFF antibody or BR3 antibody, especially a BAFF antibody, immunosuppressive agent, and another B-cell surface marker antibody, such as a combination of rituximab and humanized 2H7 or other humanized CD20
  • the more preferred such medicaments are a chemotherapeutic agent, an immunosuppressive agent, a BAFF antagonist such as a BAFF or BR3 antibody, a DMARD, moisture replacement therapy, a cytotoxic agent, an integrin antagonist, a NSAID, a cytokine antagonist, a secretory agonist, or a hormone, or a combination thereof, more preferably a steroid, a secretory agonist for dry mouth or dry eye, a NSAID, or an immunosuppressive agent, or a combination thereof.
  • a DMARD such as anti-malarial agents may be useful, for example, for relief of joint pains, skin rashes, and hair loss.
  • Steroids may be required, for example, in some subjects with more severe complications such as vasculitis or nervous system involvement, and with organ- threatening disease (e.g., when NSAIDS and anti-malarial agents have failed), including steroids such as corticosteroids, e.g., prednisone, methylprednisolone, hydrocortisone, or dexamethasone.
  • steroids such as corticosteroids, e.g., prednisone, methylprednisolone, hydrocortisone, or dexamethasone.
  • Secretory agonists such as SALAGEN® pilocarpine hydrochloride, EVOXAC® cevimeline, or bromhexine or pharmaceutical salts thereof are useful as second medicaments to treat for dry mouth, for example, and diquafosol, REFRESH ENDURA ® lubricant eye drops, cevimeline, cysteamine eye drops, and cyclosporine ophthalmic emulsion to treat dry eye.
  • NSAIDs are useful, for example, for relief of joint pains, swelling, muscle ache, fever, and include aspirin, naproxen, ibuprofen, indomethacin, and tolmetin.
  • Immunosuppressants may be required, for example, for very active disease with major organ involvement, and include such agents as cyclophosphamide (CYTOXAN®), chlorambucil, azathioprine (IMURAN®), and methotrexate.
  • BAFF antagonists may be useful in combination with the CD20 antibody for efficacy.
  • DMARDs DMARDs
  • NSAIDs and for more severe complications, a corticosteroid, chemotherapeutic agent, an immunosuppressive agent, a cytotoxic agent, an integrin antagonist, a cytokine antagonist, or a hormone, most preferably a NSAID, a corticosteroid, or an immunosuppressive agent.
  • an anti-malarial agent alone or with another second medicament.
  • the second or third medicament is or comprises a steroid, for example, a corticosteroid, which is preferably prednisone, methylprednisolone, hydrocortisone, or dexamethasone.
  • a corticosteroid which is preferably prednisone, methylprednisolone, hydrocortisone, or dexamethasone.
  • Such steroid is preferably administered in lower amounts than are used if the CD20 antibody is not administered to a patient treated with steroid.
  • the second or third medicament is a secretory agonist for dry mouth, more preferably pilocarpine hydrochloride, cevimeline, or bromhexine or pharmaceutical salts thereof, or for dry eye (for example, diquafosol, cysteamine eye drops, REFRESH ENDURA ® lubricant eye drops, cevimeline, and cyclosporine ophthalmic emulsion).
  • a secretory agonist for dry mouth more preferably pilocarpine hydrochloride, cevimeline, or bromhexine or pharmaceutical salts thereof
  • dry eye for example, diquafosol, cysteamine eye drops, REFRESH ENDURA ® lubricant eye drops, cevimeline, and cyclosporine ophthalmic emulsion.
  • the second or third medicament is a NSAID, more preferably aspirin, naproxen, ibuprofen, indomethacin, or tolmetin.
  • the second or third medicament is an immunosuppressive agent, more preferably cyclophosphamide, chlorambucil, azathioprine, or methotrexate. All these ' second or third medicaments may be used in combination with each other or by themselves with the CD20 antibody, so that the expression "second medicament” or “third medicament” as used herein does not mean it is the only medicament besides the first or second medicament, respectively. Thus, the second or third medicament need not be one medicament, but may constitute or comprise more than one such drug. These second and third medicaments as set forth herein are generally used in the same dosages and with administration routes as used hereinbefore or about from 1 to 99% of the heretofore-employed dosages.
  • second or third medicaments are used at all, preferably, they are used in lower amounts than if the CD20 antibody were not present, especially in subsequent dosings beyond the initial dosing with antibody, so as to eliminate or reduce side effects caused thereby.
  • a second medicament is administered in an effective amount with an antibody exposure, it may be administered with any exposure, for example, only with one exposure, or with more than one exposure.
  • the second medicament is administered with the initial exposure.
  • the second medicament is administered with the initial and second exposures.
  • the second medicament is administered with all exposures. It is preferred that after the initial exposure, such as of steroid, the amount of such agent is reduced or eliminated so as to reduce the exposure of the subject to an agent with side effects such as prednisone and cyclophosphamide.
  • the combined administration of a second and/or third medicament includes co-administration (concurrent administration), using separate formulations or a single pharmaceutical formulation, and consecutive administration in either order, wherein preferably there is a time period while both (or all) active agents (medicaments) simultaneously exert their biological activities.
  • the antibody or antagonist herein is administered by any suitable ineans, including parenteral, topical, subcutaneous, intraperitoneal, iiitrapulmonary, intranasal, and/or intralesional administration.
  • Parenteral infusions include intramuscular, intravenous, intraarterial, intraperitoneal, or subcutaneous administration.
  • Intrathecal administration is also contemplated (see, e.g., US 2002/0009444, Grillo-Lopez, A concerning intrathecal delivery of a CD20 antibody).
  • the antibody or antagonist may suitably be administered by pulse infusion, e.g., with declining doses of the antibody or antagonist.
  • the dosing is given intravenously or subcutaneously, and more preferably by intravenous infusion(s).
  • each exposure may be provided using the same or a different administration means.
  • each exposure is by intravenous administration.
  • each exposure is given by subcutaneous administration.
  • the exposures are given by both intravenous and subcutaneous administration.
  • the CD20 antibody is administered as a slow intravenous infusion rather than an intravenous push or bolus.
  • a steroid such as prednisolone or methylprednisolone ⁇ e.g., about 80- 120 mg Lv., more specifically about 100 mg i.v.) is administered about 30 minutes prior to any infusion of the CD20 antibody.
  • the CD20 antibody is, for example, infused through a dedicated line.
  • such infusion is preferably commenced at a rate of about 50 mg/hour. This may be escalated, e.g., at a rate of about 50 mg/hour increments every about 30 minutes to a maximum of about 400 mg/hour. However, if the subject is experiencing an infusion-related reaction, the infusion rate is preferably reduced, e.g., to half the curreS rate * (Fg.', from 100 mg/hour to 50 mg/hour.
  • the infusion of such dose of CD20 antibody ⁇ e.g., an about 1000-nig total dose) is completed at about 255 minutes (4 hours 15 min.).
  • the subjects receive a prophylactic treatment of acetaminophen/paracetamol ⁇ e.g., about 1 g) and diphenhydramine HCl ⁇ e.g., about 50 mg or equivalent dose of similar agent) by mouth about 30 to 60 minutes prior to the start of an infusion.
  • acetaminophen/paracetamol e.g., about 1 g
  • diphenhydramine HCl e.g., about 50 mg or equivalent dose of similar agent
  • the second or subsequent CD20 antibody infusions in this infusion embodiment are preferably commenced at a higher rate than the initial infusion, e.g., at about 100 mg/hour.
  • This rate may be escalated, e.g., at a rate of about 100 mg/hour increments every about 30 minutes to a maximum of about 400 mg/hour.
  • Subjects who experience an infusion-related reaction preferably have the infusion rate reduced to half that rate, e.g., from 100 mg/hour to 50 mg/hour.
  • the infusion of such second or subsequent dose of CD20 antibody ⁇ e.g., an about 1000-mg total dose) is completed by about 195 minutes (3 hours 15 minutes).
  • CD20 antigen to be used for production of, or screening for, antibody(ies) may be, e.g., a soluble form of CD20 or a portion thereof, containing the desired epitope.
  • cells expressing CD20 at their cell surface can be used to generate, or screen for, antibody(ies).
  • Other forms of CD20 useful for generating antibodies will be apparent to those skilled in the art.
  • a desciiption follows as to exemplary techniques for the production of the antibodies used in accordance with the present invention.
  • Polyclonal antibodies are preferably raised in animals by multiple subcutaneous (sc) or intraperitoneal
  • a protein that is immunogenic in the species to be immunized e.g., keyhole limpet hemocyanin, serum albumin, bovine thyroglobulin, or soybean trypsin inhibitor
  • a bifunctional or derivatizing agent for example
  • Animals are immunized against the antigen, immunogenic conjugates, or derivatives by combining, e.g., 100 ⁇ g or 5 ⁇ g of the protein or conjugate (for rabbits or mice, respectively) with 3 volumes of Freund's complete adjuvant and injecting the solution intradermally at multiple sites.
  • the animals are boosted with 1/5 to 1/10 the original amount of peptide or conjugate in Freund's complete adjuvant by subcutaneous injection at multiple sites.
  • Seven to 14 days later the animals are bled and the serum is assayed for antibody titer. Animals are boosted until the titer plateaus.
  • the animal is boosted with the conjugate of the same antigen, but conjugated to a different protein and/or through a different cross-linking reagent.
  • Conjugates also can be made in recombinant cell culture as protein fusions.
  • aggregating agents such as alum are suitably used to enhance the immune response.
  • Monoclonal antibodies are obtained from a population of substantially homogeneous antibodies, i.e., the individual antibodies comprising the population are identical and/or bind the same epitope except for possible variants that arise during production of the monoclonal antibody, such variants generally being present in minor amounts.
  • the modifier "monoclonal” indicates the character of the antibody as not being a mixture of discrete or polyclonal antibodies.
  • the monoclonal antibodies may be made using the hybridoma method first described by Kohler et al, Nature, 256:495 (1975), or may be made by recombinant DNA methods (U.S. Patent No.
  • a mouse or other appropriate host animal such as a hamster
  • lymphocytes that produce or are capable of producing antibodies that will specifically bind to the protein used for immunization.
  • lymphocytes may be immunized in vitro. Lymphocytes then are fused with myeloma cells using a suitable fusing agent, such as polyethylene glycol, to form a hybridoma cell (Goding, Monoclonal Antibodies: Principles and Practice, pp.59-103 (Academic Press, 1986)).
  • the hybridoma cells thus prepared are seeded and grown in a suitable culture medium that preferably contains one or more substances that inhibit the growth or survival of the unfused, parental myeloma cells.
  • a suitable culture medium that preferably contains one or more substances that inhibit the growth or survival of the unfused, parental myeloma cells.
  • the parental myeloma cells lack the enzyme hypoxanthine guanine phosphoribosyl transferase
  • HGPRT the culture medium for the hybridomas typically will include hypoxanthine, aminopterin, and thymidine (HAT medium), which substances prevent the growth of HGPRT-deficient cells.
  • hypoxanthine aminopterin
  • HAT medium thymidine
  • Preferred myeloma cells are those that fuse efficiently, support stable high-level production of antibody by the selected antibody-producing cells, and are sensitive to a medium such as HAT medium.
  • preferred myeloma cell lines are murine myeloma lines, such as those derived from MOPC-21 and MPC-I l mouse tumors available from the SaIk Institute Cell Distribution Center, San Diego, California USA, and SP-2 or X63-Ag8-653 cells available from the American Type Culture Collection, Rockville, Maryland USA.
  • Human myeloma and mouse-human heteromyeloma cell lines also have been described for the production of human monoclonal antibodies (Kozbor, /. Immunol., 133:3001 (1984); Brodeur et al, Monoclonal Antibody Production Techniques and Applications, pp. 51-63 (Marcel Dekker, Inc., New York, 1987)).
  • Culture medium in which hybridoma cells are growing is assayed for production of monoclonal antibodies directed against the antigen.
  • the binding specificity of monoclonal antibodies produced by hybridoma cells is determined by immunoprecipitation or by an in vitro binding assay, such as radioimmunoassay (RIA) or enzyme-linked immunoabsorbent assay (ELISA).
  • RIA radioimmunoassay
  • ELISA enzyme-linked immunoabsorbent assay
  • the binding affinity of the monoclonal antibody can, for example, be determined by the Scatchard analysis of Munson et al., Anal. Biochem., 107:220 (1980).
  • the clones may be subcloned by limiting dilution procedures and grown by standard methods (Goding, Monoclonal Antibodies: Principles arid Practice, pp.59-103 (Academic Press, 1986)). Suitable culture media for this purpose include, for example, D-MEM or RPMI- 1640 medium.
  • the hybridoma cells may be grown in vivo as ascites tumors in an animal.
  • the monoclonal antibodies secreted by the subclones are suitably separated from the culture medium, ascites fluid, or serum by conventional immunoglobulin purification procedures such as, for example, protein A-
  • Sepharose Sepharose, hydroxylapatite chromatography, gel electrophoresis, dialysis, or affinity chromatography.
  • DNA encoding the monoclonal antibodies is readily isolated and sequenced using conventional procedures ⁇ e.g., by using oligonucleotide probes that are capable of binding specifically to genes encoding the heavy and light chains of murine antibodies).
  • the hybridoma cells serve as a preferred source of such DNA.
  • the DNA may be placed into expression vectors, which are then transfected into host cells such as E. coli cells, simian COS cells, Chinese Hamster Ovary (CHO) cells, or myeloma cells that do not otherwise produce immunoglobulin protein, to obtain the synthesis of monoclonal antibodies in the recombinant host cells.
  • antibodies or antibody fragments can be isolated from antibody phage libraries generated using the techniques described in McCafferty et al, Nature, 348:552-554 (1990). Clackson et al, Nature, 352:624-628 (1991) and Marks et al, J. MoI Biol, 222:581-597 (1991) describe the isolation of murine and human antibodies, respectively, using phage libraries.
  • the DNA also may be modified, for example, by substituting the coding sequence for human heavy- and light chain constant domains in place of the homologous murine sequences (U.S. Patent No. 4,816,567;
  • non-immunoglobulin polypeptides are substituted for the constant domains of an antibody, or they are substituted for the variable domains of one antigen-combining site of an antibody to create a chimeric bivalent antibody comprising one antigen-combining site having specificity for an antigen and another antigen-combining site having specificity for a different antigen.
  • a humanized antibody has one or more amino acid residues introduced into it from a source that is non-human. These non-human amino acid residues are often referred to as "import" residues, which are typically taken from an "import” variable domain. Humanization can be essentially performed following the method of Winter and co-workers (Jones et al, Nature, 321:522-525 (1986); Riechmann et al, Nature, 332:323-327 (1988); Verhoeyen et al, Science, 239:1534-1536 (1988)), by substituting hypervariable region sequences for the corresponding sequences of a human antibody.
  • humanized antibodies are chimeric antibodies (U.S. Patent No. 4,816,567) wherein substantially less than an intact human variable domain has been substituted by the corresponding sequence from a non-human species.
  • humanized antibodies are typically human antibodies in which some hypervariable region residues and possibly some FR residues are substituted by residues from analogous sites in rodent antibodies.
  • the choice of human variable domains, both light and heavy, to be used in making the humanized antibodies is very important to reduce antigenicity.
  • the sequence of the variable domain of a rodent antibody is screened against the entire library of known human variable- domain sequences.
  • the human sequence that is closest to that of the rodent is then accepted as the human framework region (FR) for the humanized antibody (Sims et al, J. Immunol, 151:2296 (1993); Chothia et al, J. MoI. Biol, 196:901 (1987)).
  • Another method uses a particular framework region derived from the consensus sequence of all human antibodies of a particular subgroup of light or heavy chain variable regions. The same framework may be used for several different humanized antibodies (Carter et al, Proc. Natl. Acad. ScL USA, 89:4285 (1992); Presta et al, J. Immunol, 151:2623 (1993)).
  • humanized antibodies are prepared by a process of analysis of the parental sequences and various conceptual humanized products using three-dimensional models of the parental and humanized sequences.
  • Three-dimensional immunoglobulin models are commonly available and are familiar to those skilled in the art.
  • Computer programs are available that illustrate and display probable three-dimensional conformational structures of selected candidate immunoglobulin sequences. Inspection of these displays permits analysis of the likely role of the residues in the functioning of the candidate immunoglobulin sequence, i.e., the analysis of residues that influence the ability of the candidate immunoglobulin to bind its antigen.
  • FR residues can be selected and combined from the recipient and import sequences so that the desired antibody characteristic, such as increased affinity for the target antigen(s), is achieved.
  • the hypervariable region residues are directly and most substantially involved in influencing antigen binding.
  • human antibodies can be generated.
  • transgenic animals e.g., mice
  • transgenic animals e.g., mice
  • J H antibody heavy chain joining region
  • transfer of the human germ-line immunoglobulin gene array in such germ-line mutant mice will result in the production of human antibodies upon antigen challenge. See, e.g., Jakobovits et al., Proc. Natl. Acad. Sci.
  • phage display technology can be used to produce human antibodies and antibody fragments in vitro, from immunoglobulin variable (V) domain gene repertoires from unimmunized donors.
  • V domain genes are cloned in- frame into either a major or minor coat protein gene of a filamentous bacteriophage, such as M13 or fd, and displayed as functional antibody fragments on the surface of the phage particle.
  • a filamentous bacteriophage such as M13 or fd
  • selections based on the functional properties of the antibody also result in selection of the gene encoding the antibody exhibiting those properties.
  • the phage mimics some of the properties of the B cell.
  • Phage display can be performed in a variety of formats; for their review see, e.g., Johnson, Kevin S. and Chiswell, David J., Current Opinion in Structural
  • V-gene segments can be used for phage display.
  • Clackson et al, Nature, 352:624-628 (1991) isolated a diverse array of anti-oxazolone antibodies from a small random combinatorial library of V genes derived from the spleens of immunized mice.
  • a repertoire of V genes from unimmunized human donors can be constructed and antibodies to a diverse array of antigens (including self- antigens) can be isolated essentially following the techniques described by Marks et al., J. MoI. Biol. 222:581-
  • Human antibodies may also be generated by in vitro activated B cells (see US Patents 5,567,610 and
  • F(ab') 2 fragments can be isolated directly from recombinant host cell culture.
  • Other techniques for the production of antibody fragments will be apparent to the skilled practitioner.
  • the antibody of choice is a single chain Fv fragment (scFv). See WO 93/16185; US Patent No. 5,571,894; and US Patent No. 5,587,458.
  • the antibody fragment may also be a "linear antibody", e.g., as described in US Patent 5,641,870 for example. Such linear antibody fragments may be monospecific or bispecific.
  • Bispecific antibodies are antibodies that have binding specificities for at least two different epitopes. Exemplary bispecific antibodies may bind to two different epitopes of the CD20 antigen. Other such antibodies may bind CD20 and further bind a second B-cell surface marker. Alternatively, an anti-CD20 binding arm may be combined with an arm that binds to a triggering molecule on a leukocyte such as a T-cell receptor molecule (e.g. CD2 or CD3), or Fc receptors for IgG (Fc ⁇ R), such as Fc ⁇ RI (CD64), Fc ⁇ RII (CD32) and Fc ⁇ RIII (CD16) so as to focus cellular defense mechanisms to the B cell.
  • a triggering molecule such as a T-cell receptor molecule (e.g. CD2 or CD3), or Fc receptors for IgG (Fc ⁇ R), such as Fc ⁇ RI (CD64), Fc ⁇ RII (CD32) and Fc ⁇ RIII (CD16) so as to focus cellular defense
  • Bispecific antibodies may also be used to localize cytotoxic agents to the B cell. These antibodies possess a CD20-binding arm and an arm that binds the cytotoxic agent (e.g. saporin, anti-interferon- ⁇ , vinca alkaloid, ricin A chain, methotrexate or radioactive isotope hapten).
  • cytotoxic agent e.g. saporin, anti-interferon- ⁇ , vinca alkaloid, ricin A chain, methotrexate or radioactive isotope hapten.
  • Bispecific antibodies can be prepared as full length antibodies or antibody fragments (e.g. F(ab') 2 bispecific antibodies).
  • bispecific antibodies are known in the art. Traditional production of full length bispecific antibodies is based on the coexpression of two immunoglobulin heavy chain-light chain pairs, where the two chains have different specificities (Millstein et al, Nature, 305:537-539 (1983)). Because of the random assortment of immunoglobulin heavy and light chains, these hybridomas (quadromas) produce a potential mixture of 10 different antibody molecules, of which only one has the correct bispecific structure. Purification of the correct molecule, which is usually done by affinity chromatography steps, is rather cumbersome, and the product yields are low. Similar procedures are disclosed in WO 93/08829, and in
  • antibody variable domains with the desired binding specificities are fused to immunoglobulin constant domain sequences.
  • the fusion preferably is with an immunoglobulin heavy chain constant domain, comprising at least part of the hinge, CH2, and CH3 regions. It is preferred to have the first heavy chain constant region (CHl) containing the site necessary for light chain binding, present in at least one of the fusions.
  • DNAs encoding the immunoglobulin heavy chain fusions and, if desired, the immunoglobulin light chain are inserted into separate expression vectors, and are co-transfected into a suitable host organism.
  • the bispecific antibodies are composed of a hybrid immunoglobulin heavy chain with a first binding specificity in one arm, and a hybrid immunoglobulin heavy chain-light chain pair (providing a second binding specificity) in the other arm. It was found that this asymmetric structure facilitates the separation of the desired bispecific compound from unwanted immunoglobulin chain combinations, as the presence of an immunoglobulin light chain in only one half of the bispecific molecule provides for a facile way of separation. This approach is disclosed in WO 94/04690. For further details of generating bispecific antibodies see, for example, Suresh et al, Methods in Enzymology,
  • the interface between a pair of antibody molecules can be engineered to maximize the percentage of heterodimers that are recovered from recombinant cell culture.
  • the preferred interface comprises at least a part of the C H 3 domain of an antibody constant domain.
  • one or more small amino acid side chains from the interface of the first antibody molecule are replaced with larger side chains (e.g. tyrosine or tryptophan).
  • Compensatory "cavities" of , identical or similar size to the large side chain(s) are created on the interface of the second antibody molecule by replacing large amino acid side chains with smaller ones (e.g. alanine or threonine).
  • Bispecific antibodies include cross-linked or "heteroconjugate" antibodies.
  • one of the antibodies in the heteroconjugate can be coupled to avidin, the other to biotin.
  • Such antibodies have, for example, been proposed to target immune system cells to unwanted cells (US Patent No. 4,676,980), and for treatment of HIV infection (WO 91/00360, WO 92/200373, and EP 03089).
  • Heteroconjugate antibodies may be made using any convenient cross-linking methods. Suitable cross-linking agents are well known in the art, and are disclosed in US Patent No. 4,676,980, along with a number of cross-linking techniques.
  • bispecific antibodies can be prepared using chemical linkage.
  • Brennan et al, Science, 229: 81 (1985) describe a procedure wherein intact antibodies are proteolytically cleaved to generate
  • F(ab') 2 fragments These fragments are reduced in the presence of the dithiol complexing agent sodium arsenite to stabilize vicinal dithiols and prevent intermolecular disulfide formation.
  • the Fab ! fragments generated are then converted to thionitrobenzoate (TNB) derivatives.
  • TNB thionitrobenzoate
  • One of the Fab '-TNB derivatives is then reconverted to the Fab'-thiol by reduction with mercaptoethylamine and is mixed with an equimolar amount of the other Fab'- TNB derivative to form the bispecific antibody.
  • the bispecific antibodies produced can be used as agents for the selective immobilization of enzymes.
  • bispecific antibodies have been produced using leucine zippers.
  • the leucine zipper peptides from the Fos and Jun proteins were linked to the Fab' portions of two different antibodies by gene fusion.
  • the antibody homodimers were reduced at the hinge region to form monomers and then re-oxidized to form the antibody heterodimers. This method can also be utilized for the production of antibody homodimers.
  • the "diabody" technology described by Hollinger et al, Proc. Natl. Acad.
  • the fragments comprise a heavy chain variable domain (V H ) connected to a light chain variable domain (V L ) by a linker that is too short to allow pairing bstween the two domains on the same chain. Accordingly, the V H and V L domains of one fragment are forced to pair with the complementary V L and V H domains of another fragment, thereby forming two antigen- binding sites.
  • V H and V L domains of one fragment are forced to pair with the complementary V L and V H domains of another fragment, thereby forming two antigen- binding sites.
  • Another strategy for making bispecific antibody fragments by the use of single-chain Fv (sFv) dimers has also been reported. See Gruber et al, J. Immunol, 152:5368 (1994). Antibodies with more than two valencies are contemplated. For example, trispecific antibodies can be prepared. Tutt et al. J. Immunol. 147: 60 (1991).
  • the antibody used in the methods or included in the articles of manufacture herein is optionally conjugated to a cytotoxic agent.
  • the (CD20) antibody may be conjugated to a drug as described in WO2004/032828.
  • Conjugates of an antibody and one or more small molecule toxins such as a calicheamicin, a maytansine (US Patent No. 5,208,020), a trichothene, and CC1065 are also contemplated herein.
  • the antibody is conjugated to one or more maytansine molecules ⁇ e.g. about 1 to about 10 maytansine molecules per antibody molecule).
  • Maytansine may, for example, be converted to May- SS-Me, which may be reduced to May-SH3 and reacted with modified antibody (Chari et al Cancer Research 52: 127-131 (1992)) to generate a maytansinoid-antibody conjugate.
  • the antibody is conjugated to one or more calicheamicin molecules.
  • the calicheamicin family of antibiotics are capable of producing double-stranded DNA breaks at sub-picomolar concentrations.
  • Structural analogues of calicheamicin that may be used include, but are not limited to, ⁇ /, (X 2 1 , Ot 3 1 , N-acetyl- ⁇
  • Enzymatically active toxins and fragments thereof that can be used include diphtheria A chain, nonbinding active fragments of diphtheria toxin, exotoxin A chain (from Pseudomonas aeruginosa), ricin A chain, abrin A chain, modeccin A chain, alpha-sarcin, Aleurites fordii proteins, dianthin proteins, Phytolaca americana proteins (PAPI, PAPII, and PAP-S), momordica charantia inhibitor, curcin, crotin, sapaonaria officinalis inhibitor, gelonin, mitogellin, restrictocin, phenomycin, enomycin and the tricothecenes. See, for example, WO 93/21232 published October 28, 1993.
  • the present invention further contemplates antibody conjugated with a compound with nucleolytic activity ⁇ e.g. a ribonuclease or a DNA endonuclease such as a deoxyribonuclease; DNase).
  • a compound with nucleolytic activity e.g. a ribonuclease or a DNA endonuclease such as a deoxyribonuclease; DNase).
  • radioactive isotopes are available for the production of radioconjugated antibodies. Examples include At 211 , 1 131 , 1 125 , Y 90 , Re 186 , Re 188 , Sm 153 , Bi 212 , P 32 and radioactive isotopes of Lu.
  • Conjugates of the antibody and cytotoxic agent may be made using a variety of bifunctional protein coupling agents such as N-succinimidyl-3-(2-pyridyldithiol) propionate (SPDP), succinimidyl-4-(N- maleimidomethyl) cyclohexane-1-carboxylate, iminothiolane (IT), bifunctional derivatives of imidoesters (such as dimethyl adipimidate HCl), active esters (such as disuccinimidyl suberate), aldehydes (such as glutareldehyde), bis-azido compounds (such as bis (p-azidobenzoyl) hexanediamine), bis-diazonium derivatives
  • SPDP N-succinimidyl-3-(2-pyridyldithiol) propionate
  • IT iminothiolane
  • bifunctional derivatives of imidoesters such as dimethyl adipimi
  • a ricin immunotoxin can be prepared as described in Vitetta et al. Science 238: 1098 (1987).
  • Carbon- 14-labeled l-isothiocyanatobenzyl-3- methyldiethylene triaminepentaacetic acid (MX-DTPA) is an exemplary chelating agent for conjugation of radionucleotide to the antibody. See WO94/11026.
  • the linker may be a "cleavable linker" facilitating release of the cytotoxic drug in the cell.
  • a "cleavable linker” facilitating release of the cytotoxic drug in the cell.
  • an acid-labile linker, peptidase-sensitive linker, dimethyl linker or disulfide-containing linker (Chari et al. Cancer Research 52: 127-131 (1992)) may be used.
  • a fusion protein comprising the antibody and cytotoxic agent may be made, e.g. by recombinant techniques or peptide synthesis.
  • the antibody may be conjugated to a "receptor" (such streptavidin) for utilization in tumor pretargeting wherein the antibody-receptor conjugate is administered to the subject, followed by removal of unbound conjugate from the circulation using a clearing agent and then administration of a "ligand” ⁇ e.g. avidin) that is conjugated to a cytotoxic agent ⁇ e.g. a radionucleotide).
  • the antibodies of the present invention may also be conjugated with a prodrug-activating enzyme that converts a prodrug ⁇ e.g. a peptidyl chemotherapeutic agent, see WO81/01145) to an active anti-cancer drug.
  • a prodrug-activating enzyme that converts a prodrug ⁇ e.g. a peptidyl chemotherapeutic agent, see WO81/01145.
  • the enzyme component of such conjugates includes any enzyme capable of acting on a prodrug in such a way so as to covert it into its more active, cytotoxic form.
  • Enzymes that are useful in the method of this invention include, but are not limited to, alkaline phosphatase useful for converting phosphate-containing prodrugs into free drugs; arylsulfatase useful for converting sulfate-containing prodrugs into free drugs; cytosine deaminase useful for converting non-toxic 5- fluorocytosine into the anti-cancer drug, 5-fluorouracil; proteases, such as serratia protease, thermolysin, subtilisin, carboxypeptidases and cathepsins (such as cathepsins B and L), that are useful for converting peptide- containing prodrugs into free drugs; D-alanylcarboxypeptidases, useful for converting prodrugs that contain D- amino acid substituents; carbohydrate-clea
  • antibodies with enzymatic activity can be used to convert the prodrugs of the invention into free active drugs (see, e.g., Massey, Nature 328: 457-458 (1987)).
  • Antibody-abzyme conjugates can be prepared as described herein for delivery of the abzyme to a tumor cell population.
  • the enzymes of this invention can be covalently bound to the antibody by techniques well known in the art such as the use of the heterobifunctional crosslinking reagents discussed above.
  • fusion proteins comprising at least the antigen binding region of an antibody of the invention linked to at least a functionally active portion of an enzyme of the invention can be constructed using recombinant DNA techniques well known in the art (see, e.g., Neuberger et al., Nature, 312: 604-608 (1984)).
  • Other modifications of the antibody are contemplated herein.
  • the antibody may be linked to one of a variety of nonproteinaceous polymers, e.g., polyethylene glycol (PEG), polypropylene glycol, polyoxyalkylenes, or copolymers of polyethylene glycol and polypropylene glycol.
  • Antibody fragments, such as Fab', linked to one or more PEG molecules are an especially preferred embodiment of the invention.
  • Liposomes containing the antibody are prepared by methods known in the art, such as described in Epstein et al, Proc. Natl. Acad. ScL
  • Particularly useful liposomes can be generated by the reverse phase evaporation method with a lipid composition comprising phosphatidylcholine, cholesterol and PEG-derivatized phosphatidylethanolamine
  • Liposomes are extruded through filters of defined pore size to yield liposomes with the desired diameter.
  • Fab 1 fragments of an antibody of the present invention can be conjugated to the liposomes as described in Martin et al. J. Biol. Chem. 257: 286-288 (1982) via a disulfide interchange reaction.
  • a chemotherapeutic agent is optionally contained within the liposome. See Gabizon et al. J. National Cancer /r ⁇ f.81(19)1484 (1989).
  • Amino acid sequence modification(s) of protein or peptide antibodies described herein are contemplated. For example, it may be desirable to improve the binding affinity and/or other biological properties of the antibody.
  • Amino acid sequence variants of the antibody are prepared by introducing appropriate nucleotide changes into the antibody nucleic acid, or by peptide synthesis. Such modifications include, for example, deletions from, and/or insertions into and/or substitutions of, residues within the amino acid sequences of the antibody. Any combination of deletion, insertion, and substitution is made to arrive at the final construct, provided that the final construct possesses the desired characteristics.
  • the amino acid changes also may alter post-translational processes of the antibody, such as changing the number or position of glycosylation sites.
  • a useful method for identification of certain residues or regions of the antibody that are preferred locations for mutagenesis is called "alanine scanning mutagenesis" as described by Cunningham and Wells Science, 244:1081-1085 (1989).
  • a residue or group of target residues are identified (e.g., charged residues such as arg, asp, his, lys, and glu) and replaced by a neutral or negatively charged amino acid (most preferably alanine or polyalanine) to affect the interaction of the amino acids with antigen.
  • Those amino acid locations demonstrating functional sensitivity to the substitutions then are refined by introducing further or other variants at, or for, the sites of substitution.
  • the site for introducing an amino acid sequence variation is predetermined, the nature of the mutation per se need not be predetermined. For example, to analyze the performance of a mutation at a given site, ala scanning or random mutagenesis is conducted at the target codon or region and the expressed antibody variants are screened for the desired activity.
  • Amino acid sequence insertions include amino- and/or carboxyl-terminal fusions ranging in length from one residue to polypeptides containing a hundred or more residues, as well as intrasequence insertions of single or multiple amino acid residues.
  • terminal insertions include an antibody with an N-terminal methionyl residue or the antibody fused to a cytotoxic polypeptide.
  • Other insertional variants of the antibody molecule include the fusion to the N- or C-terminus of the antibody of an enzyme, or a polypeptide that increases the serum half-life of the antibody.
  • variants are an amino acid substitution variant. These variants have at least one amino acid residue in the antibody molecule replaced by different residue.
  • the sites of greatest interest for substitutional mutagenesis of antibodies include the hypervariable regions, but FR alterations are also contemplated. Conservative substitutions are shown in Table 1 under the heading of "preferred substitutions". If such substitutions result in a change in biological activity, then more substantial changes, denominated "exemplary substitutions" in Table 1, or as further described below in reference to amino acid classes, may be introduced and the products screened.
  • Substantial modifications in the biological properties of the antibody are accomplished by selecting substitutions that differ significantly in their effect on maintaining (a) the structure of the polypeptide backbone in the area of the substitution, for example, as a sheet or helical conformation, (b) the charge or hydrophobicity of the molecule at the target site, or (c) the bulk of the side chain.
  • Amino acids may be grouped according to similarities in the properties of their side chains (in A. L. Lehninger, in Biochemistry, second ed., pp. 73-75, Worth Publishers, New York (1975)):
  • Naturally occurring residues may be divided into groups based on common side-chain properties:
  • hydrophobic Norleucine, Met, Ala, VaI, Leu, He
  • neutral hydrophilic Cys, Ser, Thr, Asn, GIn
  • cysteine residue not involved in maintaining the proper conformation of the antibody also may be substituted, generally with serine, to improve the oxidative stability of the molecule and prevent aberrant crosslinking.
  • cysteine bo ⁇ d(s) may be added to the antibody to improve its stability (particularly where the antibody is an antibody fragment such as an Fv fragment).
  • a particularly preferred type of substitutional variant involves substituting one or more hypervariable region residues of a parent antibody.
  • the resulting variant(s) selected for further development will have improved biological properties relative to the parent antibody from which they are generated.
  • a convenient way for generating such substitutional variants is affinity maturation using phage display. Briefly, several hypervariable region sites (e.g. 6-7 sites) are mutated to generate all possible amino substitutions at each site.
  • the antibody variants thus generated are displayed in a monovalent fashion from filamentous phage particles as fusions to the gene III product of M13 packaged within each particle. The phage-displayed variants are then screened for their biological activity (e.g. binding affinity) as herein disclosed.
  • alanine scanning mutagenesis can be performed to identify hypervariable region residues contributing significantly to antigen binding.
  • Another type of amino acid variant of the antibody alters the original glycosylation pattern of the antibody. Such altering includes deleting one or more carbohydrate moieties found in the antibody, and/or adding one or more glycosylation sites that are not present in the antibody.
  • N-linked refers to the attachment of the carbohydrate moiety to the side chain of an asparagine residue.
  • the tripeptide sequences asparagine-X-serine and asparagine-X-threonine, where X is any amino acid except proline, are the recognition sequences for enzymatic attachment of the carbohydrate moiety to the asparagine side chain.
  • O-linked glycosylation refers to the attachment of one of the sugars N-aceylgalactosamine, galactose, or xylose to a hydroxyamino acid, most commonly serine or threonine, although 5-hydroxyproline or 5-hydroxylysine may also be used.
  • glycosylation sites to the antibody is conveniently accomplished by altering the amino acid sequence such that it contains one or more of the above-described tripeptide sequences (for N-linked glycosylation sites).
  • the alteration may also be made by the addition of, or substitution by, one or more serine or threonine residues to the sequence of the original antibody (for O-linked glycosylation sites).
  • the carbohydrate attached thereto may be altered.
  • antibodies with a mature carbohydrate structure that lacks fucose attached to an Fc region of the antibody are described in US Pat Appl No US 2003/0157108 (Presta, L.). See also US 2004/0093621 (Kyowa
  • Antibodies with a bisecting N-acetylglucosamine (GIcNAc) in the carbohydrate attached to an Fc region of the antibody are referenced in WO 2003/011878, Jean-Mairet et al. and US Patent No. 6,602,684, Umana et al.
  • Antibodies with at least one galactose residue in the oligosaccharide attached to an Fc region of the antibody are reported in " WO 1997/30087, Patel et al. See, also, WO 1998/58964 (Raju, S.) and WO 1999/22764 (Raju, S.) concerning antibodies with altered carbohydrate attached to the Fc region thereof.
  • the preferred glycosylation variant herein comprises an Fc region, wherein a carbohydrate structure attached to the Fc region lacks fucose.
  • Such variants have improved ADCC function.
  • the Fc region further comprises one or more amino acid substitutions therein which further improve ADCC, for example, substitutions at positions 298, 333, and/or 334 of the Fc region (Eu numbering of residues).
  • Examples of cell lines producing defucosylated antibodies include Lecl3 CHO cells deficient in protein fucosylation (Ripka et al. Arch. Biochem. Biophys. 249:533-545 (1986); US Pat Appl No US 2003/0157108 Al, Presta, L; and WO 2004/056312 Al, Adams et al., especially at Example 11), and knockout cell lines, such as alpha- 1,6-fucosyltransferase gene, FUT8, knockout CHO cells (Yamane-Ohnuki et al. Biotech. Bioeng. 87: 614 (2004)).
  • Nucleic acid molecules encoding amino acid sequence variants of the antibody are prepared by a variety of methods known in the art. These methods include, but are not limited to, isolation from a natural source (in the case of naturally occurring amino acid sequence variants) or preparation by oligonucleotide- mediated (or site-directed) mutagenesis, PCR mutagenesis, and cassette mutagenesis of an earlier prepared variant or a non- variant version of the antibody.
  • ADCC antigen-dependent cell-mediated cyotoxicity
  • CDC complement dependent cytotoxicity
  • This may be achieved by introducing one or more amino acid substitutions in an Fc region of an antibody.
  • cysteine residue(s) may be introduced in the Fc region, thereby allowing interchain disulfide bond formation in this region.
  • the homodimeric antibody thus generated may have improved internalization capability and/or increased complement-mediated cell killing and antibody- dependent cellular cytotoxicity (ADCC). See Caron et al, J. Exp Med. 176:1191-1195 (1992) and Shopes, B. /. Immunol.
  • Homodimeric antibodies with enhanced anti-tumor activity may also be prepared using heterobifunctional cross-linkers as described in Wolff et al. Cancer Research 53:2560-2565 (1993).
  • an antibody can be engineered that has dual Fc regions and may thereby have enhanced complement lysis and ADCC capabilities. See Stevenson et al. Anti-Cancer Drug Design 3:219-230 (1989).
  • WO00/42072 (Presta, L.) describes antibodies with improved ADCC function in the presence of human effector cells, where the antibodies comprise amino acid substitutions in the Fc region thereof.
  • the antibody with improved ADCC comprises substitutions at positions 298, 333, and/or 334 of the Fc region.
  • the altered Fc region is a human IgGl Fc region comprising or consisting of substitutions at one, two or three of these positions.
  • Antibodies with altered CIq binding and/or complement dependent cytotoxicity are described in WO99/51642, US Patent No. 6,194,551Bl, US Patent No. 6,242,195Bl, US Patent No. 6,528,624Bl and US Patent No. 6,538,124 (Idusogie et al.).
  • the antibodies comprise an amino acid substitution at one or more of amino acid positions 270, 322, 326, 327, 329, 313, 333 and/or 334 of the Fc region thereof.
  • a salvage receptor binding epitope into the antibody (especially an antibody fragment) as described in US Patent 5,739,277, for example.
  • the term "salvage receptor binding epitope” refers to an epitope of the Fc region of an IgG molecule (e.g., IgGj, IgG 2 , IgG 3 , or IgG 4 ) that is responsible for increasing the in vivo serum half-life of the IgG molecule.
  • an IgG molecule e.g., IgGj, IgG 2 , IgG 3 , or IgG 4
  • Antibodies with substitutions in an Fc region thereof and increased serum half-lives are also described in
  • Therapeutic formulations of the antbodies used in accordance with the present invention are prepared for storage by mixing an antibody having the desired degree of purity with optional pharmaceutically acceptable carriers, excipients or stabilizers (Remington's Pharmaceutical Sciences 16th edition, Osol, A. Ed. (1980)), in the form of lyophilized formulations or aqueous solutions.
  • Acceptable carriers, excipients, or stabilizers are nontoxic to recipients at the dosages and concentrations employed, and include buffers such as phosphate, citrate, and other organic acids; antioxidants including ascorbic acid and methionine; preservatives (such as octadecyldimethylbenzyl ammonium chloride; hexamethonium chloride; benzalkonium chloride, benzethonium chloride; phenol, butyl or benzyl alcohol; alkyl parabens such as methyl or propyl paraben; catechol; resorcinol; cyclohexanol; 3-pentanol; and m-cresol); low molecular weight (less than about 10 residues) polypeptides; proteins, such as serum albumin, gelatin, or immunoglobulins; hydrophilic polymers such as polyvinylpyrrolidone; amino acids such as glycine, glutamine, asparagine, histidine,
  • Zn-protein complexes Zn-protein complexes
  • non-ionic surfactants such as TWEENTM, PLURONICSTM or polyethylene glycol (PEG).
  • Exemplary anti-CD20 antibody formulations are described in WO98/56418. This publication describes a liquid multidose formulation comprising 40 mg/mL rituximab, 25 mM acetate, 150 mM trehalose, 0.9% benzyl alcohol, 0.02% polysorbate 20 at pH 5.0 that has a minimum shelf life of two years storage at 2-8°C.
  • Another anti-CD20 formulation of interest comprises 10 mg/mL rituximab in 9.0 mg/mL sodium chloride, 7.35 mg/mL sodium citrate dihydrate, 0.7 mg/mL polysorbate 80, and Sterile Water for Injection, pH 6.5. Lyophilized formulations adapted for subcutaneous administration are described in US Pat No.
  • Such lyophilized formulations may be reconstituted with a suitable diluent to a high protein concentration and the reconstituted formulation may be administered subcutaneously to the mammal to be treated herein.
  • the formulation herein may also contain more than one active compound (a second or third medicament as noted above) as necessary, preferably those with complementary activities that do not adversely affect each other.
  • a second or third medicament as noted above
  • the type and effective amounts of such medicaments depend, for example, on the amount of antibody present in the formulation, and clinical parameters of the subjects. The preferred such medicaments are noted above.
  • the active ingredients may also be entrapped in microcapsules prepared, for example, by coacervation techniques or by interfacial polymerization, for example, hydroxymethylcellulose or gelatin-microcapsules and poly-(methylmethacylate) microcapsules, respectively, in colloidal drug delivery systems (for example, liposomes, albumin microspheres, microemulsions, nano-particles and nanocapsules) or in macroemulsions.
  • colloidal drug delivery systems for example, liposomes, albumin microspheres, microemulsions, nano-particles and nanocapsules
  • Sustained-release preparations may be prepared. Suitable examples of sustained-release preparations include semipermeable matrices of solid hydrophobic polymers containing the antibody, which matrices are in the form of shaped articles, e.g. films, or microcapsules. Examples of sustained-release matrices include polyesters, hydrogels (for example, poly(2-hydroxyethyl-methacrylate), or poly(vinylalcohol)), polylactides (U.S. Pat. No.
  • copolymers of L-glutamic acid and ⁇ ethyl-L-glutamate copolymers of L-glutamic acid and ⁇ ethyl-L-glutamate, non-degradable ethylene- vinyl acetate, degradable lactic acid-glycolic acid copolymers such as the LUPRON DEPOTTM (injectable microspheres composed of lactic acid-glycolic acid copolymer and leuprolide acetate), and poly-D-(-)-3- hydroxybutyric acid.
  • LUPRON DEPOTTM injectable microspheres composed of lactic acid-glycolic acid copolymer and leuprolide acetate
  • poly-D-(-)-3- hydroxybutyric acid poly-D-(-)-3- hydroxybutyric acid.
  • the formulations to be used for in vivo administration must be sterile. This is readily accomplished by filtration through sterile filtration membranes.
  • articles of manufacture containing materials useful for the treatment of Sjogren's syndrome described above are provided.
  • the article of manufacture comprises (a) a container comprising an antagonist that binds to a B-cell surface marker (e.g., an antibody that so binds, including a CD20 antibody) (preferably the container comprises the antagonist or antibody and a pharmaceutically acceptable carrier or diluent within the container); (b) a container comprising an anti-malarial agent (preferably the container comprises the anti-malarial agent and a pharmaceutically acceptable carrier or diluent within the container); and (c) a package insert with instructions for treating Sjogren's syndrome in a patient, wherein the instructions indicate that amounts of the antibody or antagonist and the anti-malarial agent are administered to the patient that are effective to provide at least an about 30% improvement over baseline in two or more of dryness, fatigue, and joint pain on a Visual Analogue Scale.
  • a B-cell surface marker e.g., an antibody that so binds, including a CD20 antibody
  • the article of manufacture herein further comprises a container comprising a third medicament, wherein the antagonist or antibody is a first medicament and the anti-malarial agent is a second medicament, and which article further comprises instructions on the package insert for treating the patient with the third medicament, in an effective amount.
  • the third medicament may be any of those set forth above, with an exemplary third medicament being a chemotherapeutic agent, an immunosuppressive agent, a cytotoxic agent, an integrin antagonist, a cytokine antagonist, or a hormone.
  • the preferred third medicaments are those set forth above, and most preferred is a steroid.
  • the invention provides an article of manufacture comprising: (a) a container comprising an antibody that binds to a B-cell surface marker (e.g., a CD20 antibody) (preferably the container comprises the antibody and a pharmaceutically acceptable carrier or diluent within the container); and (b) a package insert with instructions for treating Sjogren's syndrome in a subject, wherein the instructions indicate that an amount of the antibody is administered to the subject that is effective to provide an initial antibody exposure followed by a second antibody exposure, wherein the second exposure is not provided until from about 16 to 54 weeks from the initial exposure.
  • a B-cell surface marker e.g., a CD20 antibody
  • the instructions indicate that an amount of the antibody is administered to the subject that is effective to provide an initial antibody exposure followed by a second antibody exposure, wherein the second exposure is not provided until from about 16 to 54 weeks from the initial exposure.
  • such package insert is provided with instructions for treating Sjogren's syndrome in a subject, wherein the instructions indicate that an amount of the antibody is administered to the subject that is effective to provide an initial antibody exposure of about 0.5 to 4 grams followed by a second antibody exposure of about 0.5 to 4 grams, wherein the second exposure is not provided until from about 16 to 54 weeks from the initial exposure and each of the antibody exposures is provided to the subject as about one to four doses, preferably as a single dose or as two or three separate doses of antibody.
  • the article of manufacture herein further comprises a container comprising a second medicament, wherein the CD20 antibody is a first medicament, and which article further comprises instructions on the package insert for treating the subject with the second medicament, in an effective amount.
  • the second medicament may be any of those set forth above, with an exemplary second medicament being a chemotherapeutic agent, an immunosuppressive agent, a cytotoxic agent, an integrin antagonist, a cytokine antagonist, or a hormone, most preferably an anti-malarial agent.
  • the article of manufacture herein further comprises a container comprising a third medicament, with instructions on the package insert for treating the subject with the third medicament.
  • such third medicament is those that are mentioned above as preferred, and most preferably a steroid.
  • the package insert is on or associated with the container.
  • Suitable containers include, for example, bottles, vials, syringes, etc.
  • the containers may be formed from a variety of materials such as glass or plastic.
  • the container holds or contains a composition that is effective for treating the Sjogren's syndrome and may have a sterile access port (for example the container may be an intravenous solution bag or a vial having a stopper pierceable by a hypodermic injection needle).
  • At least one active agent in the composition is the antagonist or antibody.
  • the label or package insert indicates that the composition is used for treating
  • the article of manufacture may further comprise an additional container comprising a pharmaceutically acceptable diluent buffer, such as bacteriostatic water for injection (BWFI), phosphate-buffered saline, Ringer's solution, and/or dextrose solution.
  • a pharmaceutically acceptable diluent buffer such as bacteriostatic water for injection (BWFI), phosphate-buffered saline, Ringer's solution, and/or dextrose solution.
  • BWFI bacteriostatic water for injection
  • phosphate-buffered saline such as bacteriostatic water for injection (BWFI), phosphate-buffered saline, Ringer's solution, and/or dextrose solution.
  • BWFI bacteriostatic water for injection
  • the article of manufacture may further include other materials desirable from a commercial and user standpoint, including other buffers, diluents, filters, needles, and syringes.
  • Rituximab 1000 mg i.v. x 2 is administered i.v. in two initial doses at days 1 and 15 with i.v. hydrochloroquinone (HQ) plus steroids.
  • This experimental regimen is compared to the same regimen except using rituximab placebo instead of rituximab, with 1:1 randomization between the two arms of the study, with about 48 patients per arm (total 96 patients).
  • This rituximab-based regimen challenges the current standard of care, limits patient exposure to steroids and its known toxicities, and demonstrates improved net clinical benefit.
  • the primary objective is to determine the proportion of patients achieving the primary efficacy endpoitit, which is improvement in VAS (dryness, fatigue, joint pain) and no prespecified adverse event.
  • the primary endpoint is defined as improvement over baseline in 2 out of 3 VAS scale (dryness, fatigue, joint pain) of at least about 30% over baseline.
  • the secondary endpoints are salivary scintigraphy, Rose Bengal, individual VAS, TJC, SF-36,
  • ESR ESR
  • hyperglobulinemia as well as exploratory methods such as infiltrate, biopsy, MRI, and presence of anti-SSA/Ro/anti-SSB/La antibodies. It is predicted and expected that administration of rituximab (or humanized 2H7 substituted for rituximab) to the patients in the protocol set forth above will ameliorate one or more signs, symptoms, or other indicators of Sjogren's syndrome over the control.
  • a response rate in VAS (two of three of dryness, fatigue, joint pain): at least about 30% over baseline, preferably about 40 to > 50%, more preferably about 50 to > 60%, where expected placebo response is about
  • TJC Treatment Joint Count
  • ⁇ MOS Short form-36 (SF-36): about 40% to > 50% of patients will have a clinical response (expected placebo response is about 30%)
  • ESR Erythrocyte sedimentation rate
  • a response rate in VAS two of three of dryness, fatigue, joint pain
  • objective measurement from phase II at least about 30% over baseline, preferably about 40 to > 60% where expected placebo response is about 30%.
  • the primary efficacy endpoint of the trial is at 50 weeks, and efficacy measures are assessed by a unique Examining Assessor who is not involved with patient treatment or other study procedures. Safety follow-up is required until 12 months following the last dose of rituximab or return of B cells into the normal range, whichever occurs later.
  • the primary objective is to determine the proportion of patients achieving a primary endpoint and no prespecified adverse event.
  • a primary endpoint is obtaining at least 30% improvement over the subject's baseline in two or more of dryness, fatigue, and joint pain on a VAS. See Example 1 for expected and preferred Phase II and III primary and secondary endpoints for use in this trial.
  • the experimental arm receives the first i.v. rituximab/placebo infusion of 1000 mg on day 0 with the second infusion occurring on day 8 and the third infusion on day 15. These subjects also receive 2 initial doses of i.v. prednisone and HQ (750mg/m 2 ) on days 3 and 18. AU subjects receive a second rituximab/placebo infusion course of 1000 mg i.v. separated by 14 days at weeks 24 and 26, respectively.
  • B-cell counts (CD 19) are assessed at baseline, at the end of each course of rituximab/placebo, and every 4 weeks thereafter throughout the study. AU B-cell counts will be conducted at the sponsor-assigned central laboratory. B-cell depletion is defined as ⁇ _5 CD 19+ B cells/ ⁇ l or > 95% depletion of CD 19+ B cells from baseline value at screening. At the end of 50 weeks, subjects who received placebo rituximab or active rituximab but demonstrate B-cell recovery will complete study participation. Subjects who received rituximab but have not demonstrated B-cell recovery will be followed for 12 months after the last course of rituximab or until B-cell recovery, whichever occurs first. Sites will be informed as to whether a subject must continue in follow-up but not whether the subject received placebo or rituximab.
  • Subjects who reach the primary endpoint of confirmed clinical response without a prespecified adverse event at week 50 receive cyclosphosphamide given at month 14 and 17 or placebo i.v. HQ. All subjects, including those who discontinue, will be observed for 50 weeks after their last rituximab/placebo infusion or until their B-cell counts recover.
  • the primary outcome of this study is to determine the proportion of subjects able to be effectively and safely re-treated with rituximab.
  • a dose of 1000 mg rituximab or placebo equivalent is administered i.v. at days 0, 8 and 15, and again at weeks 24 and 26.
  • Baseline immuno-suppression may include anti-malarial agent, prednisone, hydroxychloroquine, methotrexate, azathioprine or MMF.
  • Baseline medications such as MTX, AZA or" MMF are discontinued " at trial entry to prevent over-immunosuppression.
  • Subjects that have received cyclophosphamide therapy within the 3 months prior to enrollment will be excluded.
  • the CD20 antibody would be administered initially within about the 2-week time period, followed by another treatment at about 4-8 months, followed by another treatment at about one year from initial treatment (measured from the time any one of the doses was given), followed by treatment at about two years from initial treatment, with expected success, in about one-gram x 2-4 dosing for each treatment, administered together, about weekly, or about every other week over about two to four weeks.
  • This re-treatment protocol is expected to be successfully used for many years with little or no adverse effects.
  • rituximab MABTHERA ® /RITUXAN ®
  • Subjects are randomized at week 2 to receive rituximab and HQ and prednisone or placebo.
  • Subjects are monitored for disease activity, use of additional immunosuppressants, flares of disease, prednisone use, and safety events over the 50 weeks of the study.
  • the primary efficacy endpoint of the trial will be at 50 weeks, and efficacy measures are assessed by a unique Examining Assessor who is not involved with patient treatment or other study procedures.
  • Safety follow-up is required until 12 months following the last dose of rituximab or return of B cells into the normal range, whichever occurs later.
  • the primary objective is to investigate the efficacy of rituximab relative to placebo to improve signs, symptoms or other indicators in subjects with Sjogren's syndrome over 50 weeks. See Example 1 for expected and preferred Phase II and III primary and secondary endpoints for use in this trial.
  • Consented subjects participate in a screening period lasting up to 14 days to determine eligibility. Subjects are treated with oral prednisone 0.4mg/kg/day to 1.0 mg/kg/day for 28 days. Eligible subjects are randomized in a 1:1 ratio to receive rituximab lOOOmg i.v. x 2 (days 1, 15) plus prednisone and HQ during the 50-week treatment and observation period. The first rituximab/placebo infusion occurs on Day 0 with the second infusion occurring on Day 15 +/- 1 day. Changes in immunosuppressive drugs are not permitted during the study, unless mandated by toxicity, and requests to taper an immunosuppressive drug must be discussed in advance with the Medical Monitor.
  • a subsequent course of rituximab or placebo infusions is administered at weeks 24 and 26 and consists of 2 biweekly doses.
  • Courses of rituximab treatment must be separated by a minimum interval of 16 weeks.
  • ' Patients '" are"assessed montr ⁇ ly ' ior 12 months.
  • B-cell counts are assessed at baseline, at the end of each course of rituximab/placebo infusion, and subsequently every 4 weeks throughout the treatment/observation period.
  • AU B-cell counts are performed by a central laboratory, and physicians will be blinded to B-cell counts.
  • B-cell depletion is defined as ⁇ _5 CD19+ B cells/ ⁇ l or > 95% depletion of CD 19+ B cells from baseline value at screening.
  • subjects who received rituximab placebo or rituximab but demonstrate B-cell recovery will complete study participation.
  • Subjects who received rituximab but have not demonstrated B-cell recovery at 50 weeks are observed for 6 months following the last course of rituximab or until B-cell recovery, whichever occurs first.
  • the primary efficacy outcome measure is the time-adjusted area under the curve minus baseline of BILAG score at week 50.
  • a dose of 1000 mg rituximab or placebo equivalent is administered i.v. on day 0 and day 15.
  • the CD20 antibody would be administered initially within about the 2-week time period, followed by another treatment at about 4-8 months, followed by another treatment at about one year from initial treatment (measured from the time any one of the doses was given), followed by treatment at about two years from initial treatment, with expected success, in about one-gram x 2-4 dosing for each treatment, administered together, about weekly, or about every other week over about two to four weeks.
  • This re-treatment protocol is expected to be successfully used for many years with little or no adverse effects.
  • the CD20 antibody will be effective for treating patients with less severe symptoms such as those with mild systemic primary Sjogren's syndrome, where the primary endpoint would be at least 30% improvement over baseline of one or more of fatigue, chronic pain, or dryness on a VAS and/or the patient is not on any concomitant medication such as a hydroxychloroquine and/or steroid before treatment and/or does not need to be placed on such medication during the treatment with CD20 antibody.
  • the expected and preferred primary and secondary Phase II and Phase III endpoints noted in Example 1 would be used for such trial, except that for the primary endpoint, only one of the VAS factors need be improved to indicate efficacy.
  • Example 3 results would be successful if the same types of patients were initially treated with rituximab and then re-treated with rituximab one year after first being treated, using the same dosing and other protocol of Example 3 except that rituximab is given at one-year intervals rather than six-month intervals. The same or similar results would be expected for patients with less severe symptoms as noted above.
  • Example 5
  • humanized 2H7 antibodies comprising one, two, three, four, five, or six of the following CDR sequences: CDR Ll sequence RASSSVSYXH wherein X is M or L (SEQ ID NO: 18), for example, SEQ ID NO:4 (Fig.
  • variable light- and variable heavy- framework sequences such as substantially the human consensus FR residues of human light-chain kappa subgroup I (V L ⁇ I), and substantially the human consensus FR residues of human heavy-chain subgroup III (V H ⁇ i). See also WO 2004/056312 (Lowman et al).
  • variable heavy region may be joined to a human IgG chain constant region, wherein the region may be, for example, IgGl or IgG3, including native-sequence and non-native-sequence constant regions.
  • region may be, for example, IgGl or IgG3, including native-sequence and non-native-sequence constant regions.
  • such antibody comprises the variable heavy-domain sequence of SEQ ID NO: 1
  • variable light-domain sequence of SEQ ID NO:2 optionally also comprising the variable light-domain sequence of SEQ ID NO:2 (vl6, as shown in Fig. IA), which optionally comprises one or more amino acid substitution(s) at positions 56, 100, and/or 100a, e.g., D56A, NlOOA, or NlOOY, and/or SlOOaR in the variable heavy domain and one or more amino acid substitutions) at positions 32 and/or 92, e.g. M32L and/or S92A, in the variable light domain.
  • the antibody is an intact antibody comprising the light-chain amino acid sequence of SEQ
  • a preferred humanized 2H7 antibody is ocrelizumab (Genentech, Inc.).
  • the antibody herein may further comprise at least one amino acid substitution in the Fc region that improves ADCC activity, such as one wherein the amino acid substitutions are at positions 298, 333, and 334, preferably S298A, E333A, and K334A, using Eu numbering of heavy-chain residues. See also US Patent No. 6,737,056, L. Presta.
  • any of these antibodies may comprise at least one substitution in the Fc region that improves FcRn binding or serum half-life, for example, a substitution at heavy-chain position 434, such as N434W. See also US Patent No. 6,737,056, L. Presta.
  • any of these antibodies may further comprise at least one amino acid substitution in the Fc region that increases CDC activity, for example, comprising at least a substitution at position 326, preferably K326A or K326W. See also US Patent No. 6,528,624, Idusogie et al.
  • Some preferred humanized 2H7 variants are those comprising the variable light domain of SEQ ID NO:2 and the variable heavy domain of SEQ ID NO:8, including those with or without substitutions in an Fc region (Il present), and those comprising! ' variable heavy domain with alteration in SEQ ID NO:8 of NlOOA; or D56A and NlOOA; or D56A, NlOOY, and SlOOaR; and a variable light domain with alteration in SEQ E) NO:2 of M32L; or S92A; or M32L and S92A.
  • M34 in the variable heavy domain of 2H7.vl6 has been identified as a potential source of antibody stability and is another potential candidate for substitution.
  • variable region of variants based on 2H7.vl6 comprise the amino acid sequences of vl6 except at the positions of amino acid substitutions that are indicated in Table 2 below. Unless otherwise indicated, the 2H7 variants will have the same light chain as that of vl 6.
  • One preferred humanized 2H7 comprises 2H7.vl6 variable light-domain sequence:
  • humanized 2H7.vl6 antibody is an intact antibody, it may comprise the light-chain amino acid sequence:
  • Another preferred humanized 2H7 antibody comprises 2H7.v511 variable light-domain sequence: DIQMTQSPSSLSASVGDRVTITCRASSSVSYLHWYQQKPGKAPKPLIYAPSNLASGVPSRFSGSGSGTDF TLTISSLQPEDFATYYCQQWAFNPPTFGQGTKVEIKR (SEQ ID NO:23) and 2H7.v511 variable heavy-domain sequence:
  • humanized 2H7.v31 antibody is an intact antibody, it may comprise the light-chain amino acid sequence:
  • FNRGEC (SEQ ID NO: 13) and the heavy-chain amino acid sequence of SEQ ID NO: 15 or:
  • a preferred embodiment herein is where the antibody is humanized 2H7 comprising the variable domain sequences in SEQ ID NOS:2 and 8. Another preferred embodiment herein is where the antibody is humanized 2H7 comprising the variable domain sequences in SEQ ID NOS:23 and 24.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Animal Behavior & Ethology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Immunology (AREA)
  • Organic Chemistry (AREA)
  • Engineering & Computer Science (AREA)
  • Epidemiology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Molecular Biology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Mycology (AREA)
  • Biochemistry (AREA)
  • Biophysics (AREA)
  • Genetics & Genomics (AREA)
  • Microbiology (AREA)
  • Biomedical Technology (AREA)
  • Ophthalmology & Optometry (AREA)
  • Orthopedic Medicine & Surgery (AREA)
  • Rheumatology (AREA)
  • Physical Education & Sports Medicine (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
  • Peptides Or Proteins (AREA)
PCT/US2005/026027 2004-07-22 2005-07-21 Method of treating sjögren's syndrome Ceased WO2006012508A2 (en)

Priority Applications (8)

Application Number Priority Date Filing Date Title
MX2007000748A MX2007000748A (es) 2004-07-22 2005-07-21 Metodos para tratar el sindrome de sjogren.
AU2005267028A AU2005267028A1 (en) 2004-07-22 2005-07-21 Method of treating Sjogren's syndrome
NZ552433A NZ552433A (en) 2004-07-22 2005-07-21 Method of treating sjogrenÆs syndrome
JP2007522800A JP2008507555A (ja) 2004-07-22 2005-07-21 シェーグレン症候群の治療方法
BRPI0513100-6A BRPI0513100A (pt) 2004-07-22 2005-07-21 métodos de tratamento da sìndrome de sjÍgren e artigos manufaturados
CA002573359A CA2573359A1 (en) 2004-07-22 2005-07-21 Method of treating sjogren's syndrome
EP05782423A EP1781378A2 (en) 2004-07-22 2005-07-21 Method of treating sjögren's syndrome
IL180371A IL180371A0 (en) 2004-07-22 2006-12-26 Method of treating sjogren's syndrome

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US59030204P 2004-07-22 2004-07-22
US60/590,302 2004-07-22

Publications (2)

Publication Number Publication Date
WO2006012508A2 true WO2006012508A2 (en) 2006-02-02
WO2006012508A3 WO2006012508A3 (en) 2006-06-08

Family

ID=35502496

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2005/026027 Ceased WO2006012508A2 (en) 2004-07-22 2005-07-21 Method of treating sjögren's syndrome

Country Status (17)

Country Link
US (2) US20060062787A1 (enExample)
EP (1) EP1781378A2 (enExample)
JP (1) JP2008507555A (enExample)
KR (1) KR20070036187A (enExample)
CN (1) CN101027100A (enExample)
AR (1) AR050354A1 (enExample)
AU (1) AU2005267028A1 (enExample)
BR (1) BRPI0513100A (enExample)
CA (1) CA2573359A1 (enExample)
IL (1) IL180371A0 (enExample)
MX (1) MX2007000748A (enExample)
MY (1) MY154992A (enExample)
NZ (1) NZ552433A (enExample)
RU (1) RU2007106722A (enExample)
TW (1) TW200618809A (enExample)
WO (1) WO2006012508A2 (enExample)
ZA (1) ZA200700904B (enExample)

Cited By (9)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2006084264A3 (en) * 2005-02-07 2007-07-26 Genentech Inc Cd20 antibody variants and uses thereof
JP2010513366A (ja) * 2006-12-22 2010-04-30 シグマ−タウ・インドゥストリエ・ファルマチェウチケ・リウニテ・ソシエタ・ペル・アチオニ 眼科用薬物の輸送に有用なゲル
WO2010075249A2 (en) 2008-12-22 2010-07-01 Genentech, Inc. A method for treating rheumatoid arthritis with b-cell antagonists
WO2011100403A1 (en) 2010-02-10 2011-08-18 Immunogen, Inc Cd20 antibodies and uses thereof
US8883980B2 (en) 2003-11-05 2014-11-11 Roche Glycart Ag Antigen binding molecules with increased Fc receptor binding affinity and effector function
JP2014231515A (ja) * 2007-04-30 2014-12-11 イミュテップImmutep 細胞傷害活性抗lag−3モノクローナル抗体および臓器移植拒絶および自己免疫疾患の治療または予防における該抗体の使用方法
EP3095463A2 (en) 2008-09-16 2016-11-23 F. Hoffmann-La Roche AG Methods for treating progressive multiple sclerosis
US10280221B2 (en) 2013-03-15 2019-05-07 Glaxosmithkline Intellectual Property Development Limited Anti-LAG-3 binding proteins
US11680104B2 (en) 2015-09-02 2023-06-20 Immutep S.A.S. Anti-LAG-3 antibodies

Families Citing this family (31)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
AU777970C (en) 1999-05-07 2006-08-17 F. Hoffman-La Roche Ag Treatment of autoimmune diseases with antagonists which bind to B cell surface markers
WO2002022212A2 (en) * 2000-09-18 2002-03-21 Idec Pharmaceuticals Corporation Combination therapy for treatment of autoimmune diseases using b cell depleting/immunoregulatory antibody combination
WO2007001448A2 (en) * 2004-11-04 2007-01-04 Massachusetts Institute Of Technology Coated controlled release polymer particles as efficient oral delivery vehicles for biopharmaceuticals
US9267937B2 (en) * 2005-12-15 2016-02-23 Massachusetts Institute Of Technology System for screening particles
JP2009534309A (ja) * 2006-03-31 2009-09-24 マサチューセッツ インスティテュート オブ テクノロジー 治療剤の標的化送達のためのシステム
EP2019691B1 (en) 2006-05-15 2020-08-12 Massachusetts Institute of Technology Polymers for functional particles
US20110052697A1 (en) * 2006-05-17 2011-03-03 Gwangju Institute Of Science & Technology Aptamer-Directed Drug Delivery
US9381477B2 (en) * 2006-06-23 2016-07-05 Massachusetts Institute Of Technology Microfluidic synthesis of organic nanoparticles
WO2008019142A2 (en) * 2006-08-04 2008-02-14 Massachusetts Institute Of Technology Oligonucleotide systems for targeted intracellular delivery
US20100303723A1 (en) * 2006-11-20 2010-12-02 Massachusetts Institute Of Technology Drug delivery systems using fc fragments
EP2134830A2 (en) * 2007-02-09 2009-12-23 Massachusetts Institute of Technology Oscillating cell culture bioreactor
EP2144600A4 (en) * 2007-04-04 2011-03-16 Massachusetts Inst Technology POLY (AMINIC ACID) TARGET MOLECULES
WO2008124634A1 (en) * 2007-04-04 2008-10-16 Massachusetts Institute Of Technology Polymer-encapsulated reverse micelles
EP2620157A3 (en) 2007-10-12 2013-10-16 Massachusetts Institute of Technology Vaccine nanotechnology
US8343498B2 (en) * 2008-10-12 2013-01-01 Massachusetts Institute Of Technology Adjuvant incorporation in immunonanotherapeutics
US8591905B2 (en) 2008-10-12 2013-11-26 The Brigham And Women's Hospital, Inc. Nicotine immunonanotherapeutics
US8277812B2 (en) 2008-10-12 2012-10-02 Massachusetts Institute Of Technology Immunonanotherapeutics that provide IgG humoral response without T-cell antigen
US8343497B2 (en) 2008-10-12 2013-01-01 The Brigham And Women's Hospital, Inc. Targeting of antigen presenting cells with immunonanotherapeutics
WO2010047681A1 (en) * 2008-10-24 2010-04-29 Bridge Pharma, Inc. Treating xerophthalmia with norketotifen
US8765787B2 (en) * 2008-11-21 2014-07-01 Bridge Pharma, Inc. Methods of treatment of xerophthalmia with self-preserving ocular formulations of norketotifen
WO2010104696A1 (en) * 2009-03-11 2010-09-16 Invitrx, Inc. Method and composition for the treatment of moderate to severe keratoconjunctivitis sicca
AR078161A1 (es) * 2009-09-11 2011-10-19 Hoffmann La Roche Formulaciones farmaceuticas muy concentradas de un anticuerpo anti cd20. uso de la formulacion. metodo de tratamiento.
CA2863066A1 (en) 2012-01-31 2013-08-08 Genentech, Inc. Anti-ig-e m1' antibodies and methods using same
KR101660825B1 (ko) * 2012-11-09 2016-09-29 고려대학교 산학협력단 단백질 나노입자 융합 하이드로젤의 용도
US10001477B2 (en) 2012-11-09 2018-06-19 Korea University Research And Business Foundation Use of protein nanoparticle based hydrogel
US11240613B2 (en) * 2014-01-30 2022-02-01 Cochlear Limited Bone conduction implant
AR104368A1 (es) 2015-04-03 2017-07-19 Lilly Co Eli Anticuerpos biespecíficos anti-cd20- / anti-baff
EP3569617A1 (en) * 2018-05-18 2019-11-20 Trion Research GmbH Pharmaceutical preparation for use in treating epstein- barr virus positive patients with reactivation phenomenon- associated diseases
WO2020227341A1 (en) * 2019-05-06 2020-11-12 9 Meters Biopharma, Inc. Compositions and methods for treating sjogren's syndrome
WO2021091706A1 (en) * 2019-11-06 2021-05-14 Novartis Ag Treatment for sjögren's syndrome
US20210196652A1 (en) * 2019-12-27 2021-07-01 Meshaberase, LLC Use of cysteamine and derivatives thereof to treat dysfunctional tear syndrome (dts)

Family Cites Families (61)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US2370030A (en) * 1940-08-31 1945-02-20 Texas Co Conversion of hydrocarbons
US4690905A (en) * 1983-11-16 1987-09-01 Albert Einstein College Of Medicine Of Yeshiva University, A Division Of Yeshiva University Method for removal of human antibodies to native DNA from serum
US6893625B1 (en) * 1986-10-27 2005-05-17 Royalty Pharma Finance Trust Chimeric antibody with specificity to human B cell surface antigen
IL85035A0 (en) * 1987-01-08 1988-06-30 Int Genetic Eng Polynucleotide molecule,a chimeric antibody with specificity for human b cell surface antigen,a process for the preparation and methods utilizing the same
US5506126A (en) * 1988-02-25 1996-04-09 The General Hospital Corporation Rapid immunoselection cloning method
US4861579A (en) * 1988-03-17 1989-08-29 American Cyanamid Company Suppression of B-lymphocytes in mammals by administration of anti-B-lymphocyte antibodies
IE922437A1 (en) * 1991-07-25 1993-01-27 Idec Pharma Corp Recombinant antibodies for human therapy
US5565332A (en) * 1991-09-23 1996-10-15 Medical Research Council Production of chimeric antibodies - a combinatorial approach
US5573905A (en) * 1992-03-30 1996-11-12 The Scripps Research Institute Encoded combinatorial chemical libraries
EP1005870B1 (en) * 1992-11-13 2009-01-21 Biogen Idec Inc. Therapeutic application of chimeric antibodies to human B lymphocyte restricted differentiation antigen for treatment of B cell lymphoma
US5736137A (en) * 1992-11-13 1998-04-07 Idec Pharmaceuticals Corporation Therapeutic application of chimeric and radiolabeled antibodies to human B lymphocyte restricted differentiation antigen for treatment of B cell lymphoma
US7744877B2 (en) * 1992-11-13 2010-06-29 Biogen Idec Inc. Expression and use of anti-CD20 Antibodies
US5595721A (en) * 1993-09-16 1997-01-21 Coulter Pharmaceutical, Inc. Radioimmunotherapy of lymphoma using anti-CD20
IL114909A (en) * 1994-08-12 1999-10-28 Immunomedics Inc Immunoconjugates and humanized antibodies specific for b-cell lymphoma and leukemia cells
US20010056066A1 (en) * 1996-07-26 2001-12-27 Smithkline Beecham Corporation Method of treating immune cell mediated systemic diseases
AU5605398A (en) * 1996-12-11 1998-07-03 University Of Florida Novel methods and compositions for treatment of autoimmune diseases
US6306393B1 (en) * 1997-03-24 2001-10-23 Immunomedics, Inc. Immunotherapy of B-cell malignancies using anti-CD22 antibodies
US6171586B1 (en) * 1997-06-13 2001-01-09 Genentech, Inc. Antibody formulation
AU8296098A (en) * 1997-07-08 1999-02-08 Board Of Regents, The University Of Texas System Compositions and methods for homoconjugates of antibodies which induce growth arrest or apoptosis of tumor cells
US6194551B1 (en) * 1998-04-02 2001-02-27 Genentech, Inc. Polypeptide variants
US6242195B1 (en) * 1998-04-02 2001-06-05 Genentech, Inc. Methods for determining binding of an analyte to a receptor
US6528624B1 (en) * 1998-04-02 2003-03-04 Genentech, Inc. Polypeptide variants
HK1041221A1 (zh) * 1998-08-11 2002-07-05 Idec药物公司 包括施用抗-cd20抗体的b-细胞淋巴瘤联合疗法
US6224866B1 (en) * 1998-10-07 2001-05-01 Biocrystal Ltd. Immunotherapy of B cell involvement in progression of solid, nonlymphoid tumors
ES2338287T3 (es) * 1998-11-09 2010-05-05 Biogen Idec Inc. Tratamiento de anticuerpos anti-cd20 de pacientes que reciben trasplantes de injertos de medula osea o celulas madre de sangre periferica.
US6737056B1 (en) * 1999-01-15 2004-05-18 Genentech, Inc. Polypeptide variants with altered effector function
US20030095967A1 (en) * 1999-01-25 2003-05-22 Mackay Fabienne BAFF, inhibitors thereof and their use in the modulation of B-cell response and treatment of autoimmune disorders
US6897044B1 (en) * 1999-01-28 2005-05-24 Biogen Idec, Inc. Production of tetravalent antibodies
US6383276B1 (en) * 1999-03-12 2002-05-07 Fuji Photo Film Co., Ltd. Azomethine compound and oily magenta ink
HK1046635B (en) * 1999-06-09 2009-10-09 Immunomedics, Inc. Immunotherapy of autoimmune disorders using antibodies which target b-cells
DE19930748C2 (de) * 1999-07-02 2001-05-17 Infineon Technologies Ag Verfahren zur Herstellung von EEPROM- und DRAM-Grabenspeicherzellbereichen auf einem Chip
WO2001013945A1 (en) * 1999-08-23 2001-03-01 Biocrystal Ltd. Methods and compositions for immunotherapy of b cell involvement in promotion of a disease condition comprising multiple sclerosis
IL149500A0 (en) * 1999-11-08 2002-11-10 Idec Pharma Corp Treatment of b cell malignancies using anti-cd40l antibodies in combination with anti-cd20 antibodies and/or chemotherapeutics and radiotherapy
US20020006404A1 (en) * 1999-11-08 2002-01-17 Idec Pharmaceuticals Corporation Treatment of cell malignancies using combination of B cell depleting antibody and immune modulating antibody related applications
US20020028178A1 (en) * 2000-07-12 2002-03-07 Nabil Hanna Treatment of B cell malignancies using combination of B cell depleting antibody and immune modulating antibody related applications
WO2001072333A1 (en) * 2000-03-24 2001-10-04 Chiron Corporation Methods of therapy for non-hodgkin's lymphoma using a combination_of an antibody to cd20 and interleuking-2
US20030185796A1 (en) * 2000-03-24 2003-10-02 Chiron Corporation Methods of therapy for non-hodgkin's lymphoma
KR20020091170A (ko) * 2000-03-31 2002-12-05 아이덱 파마슈티칼즈 코포레이션 B 세포 림프종의 치료를 위한 항-사이토카인 항체 또는길항제 및 항-cd20의 조합된 사용
SI2857516T1 (sl) * 2000-04-11 2017-09-29 Genentech, Inc. Multivalentna protitelesa in njihove uporabe
MXPA02010507A (es) * 2000-04-25 2003-05-14 Idec Pharma Corp Administracion intratecal de rituximab para el tratamiento de linfomas del sistema nervioso central.
CA2411102A1 (en) * 2000-06-20 2001-12-27 Idec Pharmaceutical Corporation Cold anti-cd20 antibody/radiolabeled anti-cd22 antibody combination
ATE440618T1 (de) * 2000-06-22 2009-09-15 Univ Iowa Res Found Kombination von cpg und antikírpern gegen cd19, cd20,cd22 oder cd40 zur prävention oder behandlung von krebs.
WO2002022212A2 (en) * 2000-09-18 2002-03-21 Idec Pharmaceuticals Corporation Combination therapy for treatment of autoimmune diseases using b cell depleting/immunoregulatory antibody combination
US20030103971A1 (en) * 2001-11-09 2003-06-05 Kandasamy Hariharan Immunoregulatory antibodies and uses thereof
CA2440831C (en) * 2001-04-02 2013-05-28 Genentech, Inc. Combination therapy using cd40 and cd20 ligands
PL377119A1 (pl) * 2001-08-03 2006-01-23 Genentech, Inc. Peptydy TACIs i BR3 i ich zastosowanie
EP1438583B1 (en) * 2001-09-20 2009-09-16 Board of Regents, The University of Texas System Measuring circulating therapeutic antibody, antigen and antigen/antibody complexes using elisa assays
ES2326964T3 (es) * 2001-10-25 2009-10-22 Genentech, Inc. Composiciones de glicoproteina.
US20040093621A1 (en) * 2001-12-25 2004-05-13 Kyowa Hakko Kogyo Co., Ltd Antibody composition which specifically binds to CD20
CN100522999C (zh) * 2002-02-14 2009-08-05 免疫医疗公司 抗cd20抗体及其融合蛋白和使用方法
US20030180292A1 (en) * 2002-03-14 2003-09-25 Idec Pharmaceuticals Treatment of B cell malignancies using anti-CD40L antibodies in combination with anti-CD20 antibodies and/or chemotherapeutics and radiotherapy
US20030219818A1 (en) * 2002-05-10 2003-11-27 Bohen Sean P. Methods and compositions for determining neoplastic disease responsiveness to antibody therapy
DE60332957D1 (de) * 2002-12-16 2010-07-22 Genentech Inc Immunoglobulinvarianten und deren verwendungen
US20040126665A1 (en) * 2002-12-26 2004-07-01 Luying Sun Gel polymer electrolyte battery and method of producing the same
NZ587776A (en) * 2003-04-09 2012-03-30 Genentech Inc Therapy of autoimmune disease in a patient with an inadequate response to a TNF-alpha inhibitor using anti-CD20 antibody
AR044388A1 (es) * 2003-05-20 2005-09-07 Applied Molecular Evolution Moleculas de union a cd20
CA2528434A1 (en) * 2003-06-05 2005-01-06 Genentech, Inc. Combination therapy for b cell disorders
BRPI0412217A (pt) * 2003-07-29 2006-08-22 Genentech Inc método de avaliação da eficácia de anticorpo, métodos de imunoterapia, método de detecção de anticorpos neutralizantes a anticorpo terapêutico e método de avaliação da eficácia de antagonista
US8147832B2 (en) * 2003-08-14 2012-04-03 Merck Patent Gmbh CD20-binding polypeptide compositions and methods
JP2007504138A (ja) * 2003-08-29 2007-03-01 ジェネンテック・インコーポレーテッド 眼疾患の治療法
JP4653109B2 (ja) * 2003-11-05 2011-03-16 ロシュ グリクアート アクチェンゲゼルシャフト 高められたFcレセプター結合親和性及びエフェクター機能をもつCD20抗体

Cited By (16)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US8883980B2 (en) 2003-11-05 2014-11-11 Roche Glycart Ag Antigen binding molecules with increased Fc receptor binding affinity and effector function
US9296820B2 (en) 2003-11-05 2016-03-29 Roche Glycart Ag Polynucleotides encoding anti-CD20 antigen binding molecules with increased Fc receptor binding affinity and effector function
WO2006084264A3 (en) * 2005-02-07 2007-07-26 Genentech Inc Cd20 antibody variants and uses thereof
JP2010513366A (ja) * 2006-12-22 2010-04-30 シグマ−タウ・インドゥストリエ・ファルマチェウチケ・リウニテ・ソシエタ・ペル・アチオニ 眼科用薬物の輸送に有用なゲル
JP2017048235A (ja) * 2007-04-30 2017-03-09 イミュテップImmutep 細胞傷害活性抗lag−3モノクローナル抗体および臓器移植拒絶および自己免疫疾患の治療または予防における該抗体の使用方法
JP2014231515A (ja) * 2007-04-30 2014-12-11 イミュテップImmutep 細胞傷害活性抗lag−3モノクローナル抗体および臓器移植拒絶および自己免疫疾患の治療または予防における該抗体の使用方法
EP3095463A2 (en) 2008-09-16 2016-11-23 F. Hoffmann-La Roche AG Methods for treating progressive multiple sclerosis
US9683047B2 (en) 2008-09-16 2017-06-20 Genentech, Inc. Methods for treating progressive multiple sclerosis
US9994642B2 (en) 2008-09-16 2018-06-12 Genentech, Inc. Methods for treating progressive multiple sclerosis
EP3747464A1 (en) 2008-09-16 2020-12-09 F. Hoffmann-La Roche AG Methods for treating progessive multiple sclerosis using an anti-cd20 antibody
EP4364800A2 (en) 2008-09-16 2024-05-08 F. Hoffmann-La Roche AG Methods for treating progressive multiple sclerosis
WO2010075249A2 (en) 2008-12-22 2010-07-01 Genentech, Inc. A method for treating rheumatoid arthritis with b-cell antagonists
WO2011100403A1 (en) 2010-02-10 2011-08-18 Immunogen, Inc Cd20 antibodies and uses thereof
US10280221B2 (en) 2013-03-15 2019-05-07 Glaxosmithkline Intellectual Property Development Limited Anti-LAG-3 binding proteins
US10344088B2 (en) 2013-03-15 2019-07-09 Glaxosmithkline Intellectual Property Development Limited Antigen binding proteins
US11680104B2 (en) 2015-09-02 2023-06-20 Immutep S.A.S. Anti-LAG-3 antibodies

Also Published As

Publication number Publication date
WO2006012508A3 (en) 2006-06-08
ZA200700904B (en) 2008-10-29
MY154992A (en) 2015-08-28
TW200618809A (en) 2006-06-16
AR050354A1 (es) 2006-10-18
JP2008507555A (ja) 2008-03-13
MX2007000748A (es) 2007-03-28
IL180371A0 (en) 2007-06-03
CA2573359A1 (en) 2006-02-02
US20070014797A1 (en) 2007-01-18
US20060062787A1 (en) 2006-03-23
BRPI0513100A (pt) 2007-10-23
NZ552433A (en) 2009-10-30
CN101027100A (zh) 2007-08-29
AU2005267028A1 (en) 2006-02-02
RU2007106722A (ru) 2008-08-27
KR20070036187A (ko) 2007-04-02
EP1781378A2 (en) 2007-05-09

Similar Documents

Publication Publication Date Title
US20250171551A1 (en) Methods for treating progressive multiple sclerosis
US20070014797A1 (en) Method for treating Sjogren's syndrome
RU2411956C2 (ru) Способ лечения васкулита
US20100233121A1 (en) Method for treating multiple sclerosis
US20100303810A1 (en) Method for treating lupus
US20090226439A1 (en) Method for treating dementia or alzheimer's disease
JP2008501706A5 (enExample)
US20060233797A1 (en) Treatment of inflammatory bowel disease (IBD)
US20210388099A1 (en) Method for treating multiple sclerosis
HK1103669A (en) Method of treating sjorgren's syndrome
MX2007003857A (en) Method for treating vasculitis

Legal Events

Date Code Title Description
AK Designated states

Kind code of ref document: A2

Designated state(s): AE AG AL AM AT AU AZ BA BB BG BR BW BY BZ CA CH CN CO CR CU CZ DE DK DM DZ EC EE EG ES FI GB GD GE GH GM HR HU ID IL IN IS JP KE KG KM KP KR KZ LC LK LR LS LT LU LV MA MD MG MK MN MW MX MZ NA NG NI NO NZ OM PG PH PL PT RO RU SC SD SE SG SK SL SM SY TJ TM TN TR TT TZ UA UG US UZ VC VN YU ZA ZM ZW

AL Designated countries for regional patents

Kind code of ref document: A2

Designated state(s): BW GH GM KE LS MW MZ NA SD SL SZ TZ UG ZM ZW AM AZ BY KG KZ MD RU TJ TM AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HU IE IS IT LT LU LV MC NL PL PT RO SE SI SK TR BF BJ CF CG CI CM GA GN GQ GW ML MR NE SN TD TG

121 Ep: the epo has been informed by wipo that ep was designated in this application
WWE Wipo information: entry into national phase

Ref document number: 180371

Country of ref document: IL

WWE Wipo information: entry into national phase

Ref document number: 2005267028

Country of ref document: AU

WWE Wipo information: entry into national phase

Ref document number: 60/DELNP/2007

Country of ref document: IN

WWE Wipo information: entry into national phase

Ref document number: 552433

Country of ref document: NZ

WWE Wipo information: entry into national phase

Ref document number: 2573359

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: MX/a/2007/000748

Country of ref document: MX

WWE Wipo information: entry into national phase

Ref document number: 2007522800

Country of ref document: JP

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2005267028

Country of ref document: AU

Date of ref document: 20050721

Kind code of ref document: A

WWP Wipo information: published in national office

Ref document number: 2005267028

Country of ref document: AU

WWE Wipo information: entry into national phase

Ref document number: 200700904

Country of ref document: ZA

WWE Wipo information: entry into national phase

Ref document number: 1020077004071

Country of ref document: KR

Ref document number: 2005782423

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: 2007106722

Country of ref document: RU

WWE Wipo information: entry into national phase

Ref document number: 200580031902.0

Country of ref document: CN

WWP Wipo information: published in national office

Ref document number: 1020077004071

Country of ref document: KR

WWP Wipo information: published in national office

Ref document number: 2005782423

Country of ref document: EP

ENP Entry into the national phase

Ref document number: PI0513100

Country of ref document: BR