WO2005115444A2 - Compositions with modified nucleases targeted to viral nucleic acids and methods of use for prevention and treatment of viral diseases - Google Patents
Compositions with modified nucleases targeted to viral nucleic acids and methods of use for prevention and treatment of viral diseases Download PDFInfo
- Publication number
- WO2005115444A2 WO2005115444A2 PCT/US2005/012532 US2005012532W WO2005115444A2 WO 2005115444 A2 WO2005115444 A2 WO 2005115444A2 US 2005012532 W US2005012532 W US 2005012532W WO 2005115444 A2 WO2005115444 A2 WO 2005115444A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- group
- nuclease
- composition according
- viral
- antiviral
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K9/00—Medicinal preparations characterised by special physical form
- A61K9/14—Particulate form, e.g. powders, Processes for size reducing of pure drugs or the resulting products, Pure drug nanoparticles
- A61K9/16—Agglomerates; Granulates; Microbeadlets ; Microspheres; Pellets; Solid products obtained by spray drying, spray freeze drying, spray congealing,(multiple) emulsion solvent evaporation or extraction
- A61K9/167—Agglomerates; Granulates; Microbeadlets ; Microspheres; Pellets; Solid products obtained by spray drying, spray freeze drying, spray congealing,(multiple) emulsion solvent evaporation or extraction with an outer layer or coating comprising drug; with chemically bound drugs or non-active substances on their surface
- A61K9/1676—Agglomerates; Granulates; Microbeadlets ; Microspheres; Pellets; Solid products obtained by spray drying, spray freeze drying, spray congealing,(multiple) emulsion solvent evaporation or extraction with an outer layer or coating comprising drug; with chemically bound drugs or non-active substances on their surface having a drug-free core with discrete complete coating layer containing drug
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/43—Enzymes; Proenzymes; Derivatives thereof
- A61K38/46—Hydrolases (3)
- A61K38/465—Hydrolases (3) acting on ester bonds (3.1), e.g. lipases, ribonucleases
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K9/00—Medicinal preparations characterised by special physical form
- A61K9/14—Particulate form, e.g. powders, Processes for size reducing of pure drugs or the resulting products, Pure drug nanoparticles
- A61K9/16—Agglomerates; Granulates; Microbeadlets ; Microspheres; Pellets; Solid products obtained by spray drying, spray freeze drying, spray congealing,(multiple) emulsion solvent evaporation or extraction
- A61K9/1605—Excipients; Inactive ingredients
- A61K9/1629—Organic macromolecular compounds
- A61K9/1641—Organic macromolecular compounds obtained otherwise than by reactions only involving carbon-to-carbon unsaturated bonds, e.g. polyethylene glycol, poloxamers
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K9/00—Medicinal preparations characterised by special physical form
- A61K9/14—Particulate form, e.g. powders, Processes for size reducing of pure drugs or the resulting products, Pure drug nanoparticles
- A61K9/16—Agglomerates; Granulates; Microbeadlets ; Microspheres; Pellets; Solid products obtained by spray drying, spray freeze drying, spray congealing,(multiple) emulsion solvent evaporation or extraction
- A61K9/1605—Excipients; Inactive ingredients
- A61K9/1629—Organic macromolecular compounds
- A61K9/1652—Polysaccharides, e.g. alginate, cellulose derivatives; Cyclodextrin
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K9/00—Medicinal preparations characterised by special physical form
- A61K9/14—Particulate form, e.g. powders, Processes for size reducing of pure drugs or the resulting products, Pure drug nanoparticles
- A61K9/16—Agglomerates; Granulates; Microbeadlets ; Microspheres; Pellets; Solid products obtained by spray drying, spray freeze drying, spray congealing,(multiple) emulsion solvent evaporation or extraction
- A61K9/1605—Excipients; Inactive ingredients
- A61K9/1629—Organic macromolecular compounds
- A61K9/1658—Proteins, e.g. albumin, gelatin
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
- A61P31/14—Antivirals for RNA viruses
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
- A61P31/20—Antivirals for DNA viruses
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Y—ENZYMES
- C12Y301/00—Hydrolases acting on ester bonds (3.1)
- C12Y301/21—Endodeoxyribonucleases producing 5'-phosphomonoesters (3.1.21)
- C12Y301/21001—Deoxyribonuclease I (3.1.21.1)
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
- Y02A—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
- Y02A50/00—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
- Y02A50/30—Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change
Definitions
- This invention relates to new compositions comprising chemically and genetically modified nucleases targeted to cleave viral nucleic acids present during a viral replication cycle, and to methods of using hydrolytic properties of nucleases for prevention and treatment of diseases caused by human, animal, and plant viruses.
- DNase I inhibits synthesis and replication of viral double-stranded (ds) DNA in cells infected with vaccinia virus, human herpes virus, cytomegalovirus and adenovirus without affecting synthesis of cellular genomic DNA and integrity of the treated cells (Trukhachev and Salganik, Virology 33, 552, 1967; Salganik et al., Dokl. Akad. Nauk SSSR (Proc. USSR Acad. Sci.) 180: 1473-1476, 1968; Lapik, et al., Pharmac. Toxicol. 2: 210, 1970; Salganik, Current Trends in Life Sciences, 12: 115-119, 1984).
- ds viral double-stranded
- Bovine pancreatic RNase A has been shown to inhibit viral replication in cells infected with influenza, tick-born encephalitis and poliomyelitis and viruses (LeClerc, Nature 177:578-579 (1956); Salganik, Cu ⁇ ent Trends in Life Sciences, 12: 115-123, 1984).
- Therapeutic activity of native bovine pancreatic DNase I against human herpes and adenovimses and bovine pancreatic RNase A against tick-borne encephalitis and influenza vimses have been demonstrated in clinical trials (Salganik et al., Nature 214, 100, 1967; Gutarov et al., Zhurn. Nevropath. Psychiatry.
- Bovine pancreatic DNase I directed against dsDNA-parvovirus combined with the bovine pancreatic RNase A directed against ssRNA-paramixo virus have been shown effective in treatment of dogs infected by both vimses (US patent 5,484,589 to Salganik).
- RNases such as cytotoxic Onconase® isolated from oocytes and embryos of Northern Leopard Frog (Rana pipiens) and bovine seminal RNase A (BS-RNase) have been shown also to moderately inhibit replication of HIV-I in cell culture (Youle, et al., Proc. Natl. Acad. Sci. USA 91, No. 13: 6012-6016, 1994; Saxena, et al. J. Biol. Chem. 271: 20783-20788, 1996; Huang, et al., Proc. Natl. Acad. Sci. USA 96: 2678-2681, 1999). These studies of antiviral properties of native bovine pancreatic DNase I and RNase
- A do not address the shortcomings of native nucleases such as high susceptibility to endogenous proteolytic degradation, low cellular uptake, short half-life and others. Further, those studies, do not address major issues for antiviral therapeutics such as a likelihood development of viral resistance during treatment by nucleases.
- an embodiment of the invention is an antiviral composition
- a modified nuclease wherein at least one amino acid in the amino acid sequence of the modified nuclease is a non-natural amino acid residue that is substituted for a naturally-occu ⁇ ing amino acid in the amino acid sequence of a parent nuclease, wherein the modified nuclease has greater hydrolytic activity than the parent nuclease.
- the substituted non-natural amino acid in alternative embodiments is a keto or a thiol side chain group.
- the non-natural amino acid is located at the N- or C-terminus of the amino acid sequence of the nuclease.
- the non-natural amino acid is located in position of the sequence comprising a substrate nucleic acid binding domain of the nuclease.
- the substituted non-natural amino-acid residue comprises a multiply-charged side chain group.
- the modified nuclease has increased affinity for the substrate nucleic acid compared to the parent nuclease.
- the non-natural amino acid residue is in a position of the amino acid sequence of the parent nuclease comprising a binding domain for a modulator of activity of the nuclease.
- the modulator in a related embodiment is an inhibitor of the nuclease activity, for example, the modulator is a protease.
- the substituted non- natural amino acid residue comprises a bulky neutral or charged side chain group.
- the keto or thiol side chain group is covalently attached to a neutral steric hindrance or multiply- charged moiety.
- the neutral steric hindrance moiety is a bulky organic moiety or a polymer, and the moiety is selected from the group of dendrimers, charged gold nanoparticles, non- natural amino acid residues with multiply-charged side chains, oligomers of natural and non-natural amino acid residues with single-charged side chains, mannose 6-phosphate residues and oligomers of mannose 6-phosphate residues.
- the antiviral composition has greater hydrolytic activity towards a substrate nucleic acid in the presence of the modulator compared to the parent nuclease.
- the parent nuclease is of biological origin, selected from for example an origin in a mammal, an amphibian, a bacterium, an insect and a plant.
- an exemplary parent nuclease is selected from human DNase I (ref. SWISS PROT P24855) and bovine DNase I (ref. SWISS PROT P00639).
- the amino acid residue and its position in the amino acid sequence of the non-natural amino acid within DNA binding domains of human or bovine DNase I are: Arg(R)9 or Gln(Q)9, Glu(E)13, Thr(T)14, Ser(S)43, His(H)44, Asn(N)74, Arg(R)l l l, Asn(N)170, Ser(S)206, Thr(T)207, and Tyr(Y)211.
- the modified DNase I has at least about 3 -fold greater hydrolytic activity than the parent nuclease wherein the substrate is double-stranded viral DNA.
- the modulator in certain embodiments is an inhibitor of the DNase I activity, for example, the modulator is G-actin.
- the non-natural amino acid comprises a bulky neutral or charged side chain group, and is a residue and location in a position within the G-actin binding domain of a human or a bovine DNase I, selected from at least one of the group consisting of: His(H)44, Leu(L)45, Val(V)48, Gly(G)49, Leu(L)52, Asp(D)53, Asn(N)56, His(H)64 or Tyr(Y)65, Val(V)66, Val(V)67, Ser(S)68, Glu(E)69, Ser(S)94,Tyr(Y)96, and Ala(A)114.
- the modified DNase I has at least about 10-fold greater hydrolytic activity towards double-stranded DNA in the presence of a physiological concentration of G-actin than the parent nuclease.
- the modified DNase I has substitutions in the residues at positions in the amino acid sequence of the parent human DNase I: Q11RU/E13KU (2+ V N74KU (2+) /A114FU ( eto) , wherein RU is non-natural homoarginine, KU (2+) is non-natural lysine with two positively charged side-chain amino groups and Pjj (keto) j s non _ namra ⁇ p-acetyl-L-phenylalanine residue carrying a keto group.
- the parent nuclease is selected from the group of RNase A-like nucleases comprising human RNase I (ref. SWISS PROT P07998), bovine RNase A (ref. SWISS PROT P00656), RNase S derivative of human RNase I, and RNase S derivative of bovine RNase A.
- the parent nuclease comprises a binding domain for a modulator which is an inhibitor which is endogenous RNase inhibitor (RI).
- RI endogenous RNase inhibitor
- the modified RNase comprises at least 3 -times greater hydrolytic activity towards single-stranded RNA in the presence of a physiological concentration of the RI compared to the parent nuclease.
- the non-natural amino acid is a bulky neutral or charged side chain group, and is a residue and location in a position within the RI binding domains of RNase consisting of at least one selected from the group of: Lys(K)l, Lys(K)7, Gln(Q)l 1, Asn(N)71, Asp(E)l 11, and from Arg(R)85 to Asn(N)94 of the parent nuclease.
- the modified human RNase I comprises substitutions in positions selected from parent human RNase I: KlFU (keto) /Ql lA/N71A/El l lA, wherein FU ( eto) is non-natural p- acetyl-L-phenylalanine residue carrying a keto group.
- the modified human RNase S comprises substitutions selected from positions of a peptide fragment having positions 1-15 in the amino acid sequence of the parent human RNase I: K1FU ( et0 7Ql 1 A; and truncated S- protein positions 21-124 amino acid: N71A/G89FU (keto) /El l lA, wherein FU ( et0) is non- natural p-acetyl-L-phenylalanine residue carrying a keto group.
- the parent nuclease is an artificial nuclease.
- the artificial nuclease is a molecular scaffold comprising at least one recognition domain for a substrate nucleic acid and at least one catalytic domain for hydrolysis of the phosphodiester bonds of a substrate nucleic acid.
- the molecular scaffold is a synthetic peptide, peptide oligomer or peptide dendrimer.
- the synthetic peptide is a hydrolytic oligopeptide comprising hydrolytically-functional amino acids: Arg, Asp, Cys, His, Lys, Ser, Tyr and Trp, and further comprising amino acids: Ala, Gly, Leu, Phe.
- the hydrolytic oligopeptide is a dipeptide or tripeptide selected from the group consisting of: Ser-His, His-Asp, Cys-His, Ser-His-Asp, Ser-His-Gly, Ser-His-His, and His-Phe-Asp.
- the hydrolytic oligopeptide is a hexapeptide having an amino acid sequence selected from the group consisting of: Gly-Phe-Ser-Leu-His-Ala (Seq. ID NO: 10), Phe-Ser-Phe-Leu-His-Ala (Seq. ID NO: 1 1), and Ser-Ser-Phe-Leu-His-Ala (Seq.
- the hydrolytic oligopeptide is an undecapeptide selected from the group consisting of: Ser-Gly-Gly-His-Gly-Gly-Arg-Gly-Gly-His-Phe (Seq. ID NO: 14), Ser- Gly-Gly-Ser-Gly-Gly-Ser-Gly-Gly-His-Phe (Seq. ID NO: 15), Ser-Gly-Gly-Arg-Gly-Gly- His-Gly-Gly-His-Phe (SEQ ID NO: 16).
- the molecular scaffold is a polypeptide, and the nucleic acid recognition domain and the catalytic domain are embedded within a structural unit of the polypeptide.
- the catalytic domain specifically binds a hydrolytic metal, wherein the metal is a lanthanide.
- the polypeptide is a hydrolytic polypeptide selected from the group comprising: TERRRQQLDKDGDGTIDEREIKIHFQNKRAKIK (SEQ ID NO: 4), TERRRFDKDQNGYIGAADLRHVKIWFQNKRAKIK (SEQ ID NO: 5), TERRRFRVFDKDGNGYISAAEKIWFQNKRAKIK (SEQ ID NO: 6), TRRRRFSLFDKDGDGTITTKEEVWFQNRRMKWK (SEQ ID NO: 7), and DEKRPRTAFSGEQLARLKREFNENRYLTERRRLRVFDKDGNGFISAAEKIWFQNKR AKIKKST (SEQ ID NO: 8).
- the molecular scaffold is a polymeric carrier with multiple attachment sites comprising the nucleic acid recognition domain and the catalytic domain attached to separate sites of the polymeric carrier.
- the nucleic acid recognition domain is selected from the group comprising sequence-specific modified oligonucleotides, zinc fingers, and hairpin polyamides.
- the catalytic domain is a metal-binding peptide or a synthetic metal complex. Further, the metal binding peptide is Zn(II)-binding peptide: Asp-Pro- Asp-Glu-Leu-Glu- His-Ala-Ala-Lys-His-Glu-Ala-Ala-Ala-Lys-CONH 2 (Seq. ID NO:9).
- lanthanide complexes of polyalcohol and macrocyclic ligands Co(III) complexes of polyamine ligands
- Fe(II)- bleomycin complex Fe(II)- bleomycin complex
- Cu(II) complexes of kanamycin and neamine kan
- an antiviral composition represented by formula Nuc-(T b ) r , wherein Nuc comprises a nuclease covalently associated with at least one targeting ligand (T b ) r , wherein b is an integer from 1 to 8 that relates to the type of the ligand, and r is integer from 1 to 4 that relates to the quantity of each type of the ligand.
- formula (T b ) r -P m -H further comprises at least one targeting ligand (T b ) r wherein the ligand is covalently associated with a polymer P m of m units of monomer P, wherein m is an integer from 1 to 2000, wherein P m is covalently linked to a non-polar moiety H.
- an antiviral composition represented by a formula Nuc-H, wherein Nuc comprises a nuclease covalently associated with a non-polar moiety H, and H is selected from the group of hydrocarbons consisting of alkyl, aryl, substituted alkyl and substituted aryl chains. Accordingly, in the formula Nuc-H-(T b ) r , the composition is further covalently linked with at least one targeting ligand (T ) r , wherein b is an integer from 1 to 8 that relates to the type of the ligand, and r is integer from 1 to 4 that relates to the quantity of each type of the ligand.
- an antiviral composition represented by formula (Nuc a ) q -P n - H comprising at least one nuclease moiety (Nuc a ) q , wherein a is an integer from 1 to 3 that relates to the type of the nuclease and q is an integer from 1 to 50 that relates to the quantity of each nuclease, and Nuc being covalently associated with a polymer P n of n units of monomer P, wherein n is an integer from 1 to 2000, and P n is covalently linked to a non- polar moiety H.
- an antiviral composition represented by formula (Nuc a ) q -P n - H-P m -(T b ) r comprising two of the compositions above that are covalently linked to eachother.
- formula [(Nuc a )q-P n -H]i-D-[H-P m -(T b ) r ] k there is a composition in which i and k relate to the quantity of each type of the composition and are integers from 1 to 8, and each composition is further non-covalently linked to a hydrophobic core platform D via non-polar moiety H, wherein D is a dendrimer modified to include an extended hydrophobic core.
- an antiviral composition represented by formula (Nuc a ) q -P n -H- L a (+) as above, further covalently linked to a modified oligonucleotide L a (+) having a nucleotide sequence capable of base pairings, wherein L a ( + ) hybridizes to an oligonucleotide L a ( . ) having a respective complementary nucleotide sequence.
- an antiviral composition represented by formula (T ) r -P m -H-L (+), covalently linked to a modified oligonucleotide L b (+ > having a unique nucleotide sequence capable of base pairings, wherein the nucleotide sequence of L ( +) hybridizes to a respective complementary oligonucleotide L b ( . ) .
- an antiviral composition represented by formula [(Nuc a ) q -P n -H— L a (+) ] k -[(L a ( . ) ) k -D c - (L b ( . ) )i]-[L b (+ )-H -P -(T b ) r ]i according to the compositions above, wherein i and k relate to the quantity of each type of the composition and are integers from 1 to 8, wherein L a ( + ) or L b ( + ) hybridize to their respective complementary oligonucleotides
- L a ( . ) or L b ( . ) covalently linked to a multivalent molecular scaffold D c having a finite number of attachment sites, wherein c is a number of attachment sites and is an integer from 4 to 64.
- the formula [(Nuc a ) q -P n -H] k -D s -L a (+) can further have a plurality of compositions covalently linked to a multivalent molecular scaffold D s having a finite number of attachment sites, wherein s is a number of attachment sites and is an integer from 4 to 64, wherein D s is further covalently linked to a modified oligonucleotide L a (+) having a unique nucleotide sequence capable of base pairings.
- nuclease Nuc is selected from the group consisting of a wild-type native nuclease, a genetically modified nuclease, a chemically and genetically modified nuclease of biological origin, and an artificial nuclease.
- the formula [(T b )r-P m -H]i-D s -L b (+) can further have a plurality of the compositions covalently linked to a multivalent molecular scaffold D s having a finite number of attachment sites, wherein s is a number of attachment sites and is an integer from 4 to 64, and wherein D s is further covalently linked to a modified oligonucleotide L a (+) having a unique nucleotide sequence capable of base pairings.
- An embodiment of the invention provides an antiviral composition with the formula ⁇ [(Nuc a ) q -P n -H] k -D s -L a (+ ) ⁇ j -[L a ( . ) ] j -D c -[(L b (-) ] f - ⁇ [L b ( + )-D s -[H-P n -(T b ) q ] ⁇ f
- j and f relate to the quantity of each moiety and are integers from 1 to 8, wherein each composition is linked to a modified oligonucleotide L a ( . ) or L b ( .
- L a (+ > or L b ( + ) having a unique nucleotide sequence capable of base pairings and undergoing hybridization with their respective complementary oligonucleotides L a (+ > or L b ( + ), and wherein L a (.) and L b (.) are further covalently linked to a multivalent molecular scaffold D c with a finite number of attachment sites, wherein c is the number of attachment sites of D c and is an integer from 4 to 64.
- the polymer is selected from the group consisting of PEG
- the polymer has a configuration selected from linear, branched, forked or star-like.
- the antiviral compositions herein can further have at least one hydrolysable linker.
- the multivalent molecular scaffold D c or D s of the antiviral compositions herein is, in related embodiments, a dendrimer.
- the dendrimer is selected from the group consisting of poly(aminoamine)PAMAM, PAMAM(ethylenediamine-EDA), and poly(lysine) dendrimers.
- L a ' b (+) and L a ' b (-) are Locked Nucleic Acids (LNA), Bridged Nucleic Acids (BNA), Peptide Nucleic Acids (PNA), bis-PNA, hydroxyproline PNA (HypNA), serine PNA (SerNA), hairpin polyamides, morpholino oligos, phosphorothioate (PS) oligos, or py ⁇ olidine-amide oligonucleotide mimic (POM).
- LNA Locked Nucleic Acids
- BNA Bridged Nucleic Acids
- PNA Peptide Nucleic Acids
- HypNA hydroxyproline PNA
- SerNA serine PNA
- hairpin polyamides morpholino oligos
- PS phosphorothioate
- POM py ⁇ olidine-amide oligonucleotide mimic
- oligonucleotides L a ( +) or L ( + ) has a unique nucleotide sequence, i.e., the sequence is not found in the genome of the subject to be treated, and the nucleotide sequence is further linked to a bi-functional chemical reagent forming a covalent bond formation between the hybridized oligonucleotides.
- the bi-functional chemical reagent has a dormant chemical group that is activated for covalent bond formation between the hybridized oligonucleotides.
- the dormant chemical group comprises an aromatic ⁇ - chloroethyl alkylating group inhibited by a neighboring formyl residue, and the aromatic ⁇ - chloroethyl alkylating group is chemically activated through reduction of the formyl residue using sodium borohydride to form the covalent bond between the hybridized oligonucleotides.
- the dormant chemical group is a photoactive cross-linker is selected from the group consisting of azides, psoralens or porphyrins.
- the dormant azide, psoralen or porphyrin cross-linker further is photoactivated to form a covalent bond between the hybridized oligonucleotides.
- the targeting ligand T b in certain embodiments is selected from the group of oligomers having nucleotide sequence-specific binding affinity to a viral nucleic acid and further consisting of: peptide nucleic acid (PNA), bis-PNA, hydroxyproline PNA (HypNA), serine PNA (SerNA), Locked Nucleic Acid (LNA), Bridged Nucleic Acids (BNA), hairpin polyamides, morpholino oligos, phosphorothioate (PS) oligos, py ⁇ olidine-amide oligonucleotide mimic (POM), and an oligopeptide having a sequence of a zinc finger.
- PNA peptide nucleic acid
- HypNA hydroxyproline PNA
- SerNA serine PNA
- LNA Locked Nucleic Acid
- BNA Bridged Nucleic Acids
- hairpin polyamides morpholino oligos, phosphorothioate (PS)
- the targeting ligand T b is selected from the group of sequence-specific nucleic acid binding proteins comprising designed zinc finger proteins (ZFP) and arginine-rich peptides.
- the targeting ligand T b is a membrane permeating peptide or polypeptide.
- the membrane permeating peptide is selected from the group consisting of: basic poly(Arg) and poly(Lys) peptides; basic poly(Arg) and poly(Lys) peptides containing non-natural analogs of arginine and lysine residues; and Arg(R)/Lys(K)-rich peptides derived from genes.
- the basic poly(Arg) peptide in certain related embodiments contains 6-10 Arg-residues.
- the Arg/Lys-rich peptide is selected from the group of peptides consisting of: YGRKKRPQRRR (HIV TAT 47-57 ; SEQ ID NO: 17); RQIKIWFQNRRMKWKK (Drosophila Antennapedia (ANTpl6); SEQ ID NO: 18); RRWRRWWRRWWRRWRR (W R; SEQ ID NO 19); CWK ⁇ 8 (AlkCWK 18 ; SEQ ID NO: 20); K 18 WCCWK 18 (Di-CWK 18 ; SEQ ID NO: 21);
- WTLNSAGYLLGKINLKALAALAKKIL Transportan; SEQ ID NO 22); GLFEALEELWEAK(DipaLytic; SEQ ID NO: 23); K 16 GGCRGDMFGCAK, 6 RGD (K ⁇ 6 RGD; SEQ ID NO: 24); K 16 GGCMFGCGG (PI; SEQ ID NO: 25); KielCRRARGDNPDDRCT (P2; SEQ ID NO: 26); KKWKMRRNQFWVKVQRbAK (B) bA (P3; SEQ ID NO 27); VAYISRGGVSTYYSDTVKGRFTRQKYNKRA (P3a; SEQ ID NO: 28); IGRIDPANGKTKYAPKFQDKATRSNYYGNSPS (P9.3; SEQ ID NO: 29) KETWWETWWTEWSQPKKKRKV (Pep-1; SEQ ID NO: 30); PLAEIDGIELTY (Plae SEQ ID NO: 31); K ⁇ 6 GGPLAE
- LAKH(LAKA) 2 LKAC (HA2; SEQ ID NO: 35); (LARL) 6 NHCH 3 (LARL4 6 ; SEQ ID NO 36); KLLKLLLKLWLLKLLL (Hel-11-7; SEQ ID NO 37); (KKKK) 2 GGC (KK; SEQ ID NO: 38); (KWKK) 2 GCC (KWK; SEQ ID NO: 39); (RWRR) 2 GGC (RWR; SEQ ID NO 40); PKKKRKV (SV40 NLS7; SEQ ID NO 41); PEVKKKRKPEYP (NLS 12; SEQ ID NO 42); TPPKKKRKVEDP (NLS12a; SEQ ID NO: 43); GGGGPKKKRKVGG (SV40 NLS13 SEQ ID NO 44); GGGFSTSLRARKA (AV NLS13; SEQ ID NO: 45): CKKKKKKSEDEYPYVPN (AV RME NLS 17; SEQ ID NO: 46) CKKKKKKKSEDE
- the membrane permeating polypeptide is selected from the group of polypeptides comprising: HSV-1 tegument protein VP22; HSV-1 tegument protein VP22r fused with nuclear export signal (NES); mutant B- subunit of E. coli enterotoxin EtxB (H57S); detoxified exotoxin A (ETA), and analogs thereof.
- the amino acid sequence comprises D-amino acids; in other embodiments, the sequences herein are envisioned to comprise all or substantially all D-amino acids.
- the targeting ligand T is selected from the group consisting of ligands of host cell surface receptors (CSR) expressed by a T cell in the host cell (T-CSR) , i.e., the vims host cells (T-CSR).
- CSR host cell surface receptors
- T-CSR is a selected from the group of receptors for steroids and mimetic or derivatives, the receptors comprising those for steroids such as cortisol, corticosterone, glucocorticoid dexametasone and others.
- the T-CSR is a peptide derived from a viral nuclear capsid protein selected from the group of: heparan sulfate receptor binding peptides: HPV 31 LI Cta: GYRARPKFKAGKR SEQ ID NO: 53; HPV 45 LI Ctb: RPAKRVRIRSKK: (SEQ ID NO: 54); hpv-16 11 Cta: SSTSTTAKRKKRKL (SEQ ID NO: 55); HPV-16 L2 Ct: MLRKRRKRL (SEQ ID NO: 56) HPV-16 L2 Nt: MRHKRSAKRTKRA (SEQ ID NO: 57).
- the T-CSR is selected from the group of synthetic peptides derived from viral envelope proteins comprising: T-peptide: ASTTTNYT- (SEQ ID NO: 1), and D-Ala-T-peptide- Amide (DAPTA).
- the T-CSR is a folate derivative.
- the T-CSR further comprises a ligand host cell receptor selected of the group of monosaccharides: D-mannose, D-Glucose, L-galactose, L-fucose (6-deoxygalactose), N-acetylglucosamine, N- acetylgalactosamine, N-acetylneuraminic acid (sialic acid), and N-acetylmuramic acid, derivatives of L-fucose and D-mannose occupying the carbon-6 position such as D- mannose-6-phosphate, L-fucosyl-lactose, D-mannitol, mannan and their analogs.
- a ligand host cell receptor selected of the group of monosaccharides: D-mannose, D-Glucose, L-galactose, L-fucose (6-deoxygalactose), N-acetylglucosamine, N- acetylgal
- the targeting ligand T b in certain embodiments is a CSR-derivative having binding affinity to a viral glycoprotein expressed on the membrane of vims-infected cell.
- the CSR-derivative is a T-cell receptor such as a CD4 or a CD8 or other.
- the CSR-derivative is a chemokine receptor such as a CXCR4 or a CCR5.
- targeting ligand T b is an inhibitor of prenylation targeting cysteine containing CX ⁇ X 2 X sequences near the C-terminus of viral proteins, i.e., is a prenylation inhibitor.
- the prenylation inhibitor can further comprise a peptidomimetic.
- compositions in related embodiments further comprises a pharmaceutically acceptable buffer.
- Kits comprising a unit dosage of any or of a plurality of these compositions, optionally having instructions for use, are provided.
- Another embodiment of the invention provided herein is a method for preventing and treating a viral disease in a subject caused by infection with at least one viral agent, the method involving administeringa combination of nucleases, such that the nucleases are targeted to the genomic and intermediate forms of replicating viral nucleic acids.
- the replication of ssDNA vimses is accompanied by appearance of ssDNA, dsDNA, ssRNA (mRNA), therefore without being limited by any particular mechanism or theory, a combination of different nucleases targeted to digest specifically the appropriate forms of viral nucleic acids increases the antiviral effect of this method.
- the replication of dsDNA vimses is accompanied by the appearance of dsDNA, ssDNA, ssRNA.
- RNA RT vimses generate intermediate forms of hybrid RNA-DNA molecules, ssRNA and dsRNA. Combination of RNase H, DNase digesting ssDNA and RNases digesting ssRNA and dsRNA will increases the antiviral effects of nucleases.
- Another embodiment of the invention provided herein is a method for preventing and treating a viral disease in a subject caused by infection with at least one viral agent selected from the group consisting of emerging wild-type vimses, naturally occurring mutant vimses and mutant vimses occurring in the course of an antiviral therapy, the method comprising: administering a nuclease, wherein the nuclease is selected from a group of nucleases with preferential hydrolytic activity towards the genomic form of viral nucleic acid as found in virions of the viral agent, providing that the nuclease is not wild-type bovine pancreatic DNase I or wild-type bovine pancreatic RNase A.
- Another embodiment of the invention provided herein is a method for preventing and treating a viral disease in a subject caused by infection with at least one viral agent selected from the group consisting of emerging wild-type vimses, naturally occurring mutant vimses and mutant vimses occurring in the course of an antiviral therapy, the method comprising: administering a plurality of nucleases or nuclease-derived antiviral compositions, wherein at least two nucleases or nuclease-derived antiviral compositions are enzymes with preferential hydrolytic activity towards the viral genomic form of nucleic acid as found in virions of the viral agent and toward intermediate forms of nucleic acids appearing during the replication of viral genomic nucleic acids.
- Another embodiment of the invention provided herein is a method for preventing and treating a viral disease in a subject caused by infection with at least one viral agent selected from the group consisting of emerging wild-type vimses, naturally occurring mutant vimses and mutant vimses occu ⁇ ing in the course of an antiviral therapy, the method comprising: administering at least one antiviral nuclease or nuclease-derived antiviral composition, wherein nuclease is an enzyme with preferential hydrolytic activity towards at least one replicating intermediate form of viral nucleic acid as found in the life cycle of the viral agent.
- Another embodiment of the invention provided herein is a method for preventing development of viral resistance to nucleases administered for treating a viral disease, the method comprising administering a plurality of nucleases or nuclease-derived antiviral compositions, wherein at least one nuclease or nuclease-derived antiviral composition is an enzyme with preferential hydrolytic activity towards a viral genomic form of nucleic acid as found in virions of the viral agent, and at least one nuclease or nuclease-derived antiviral compositions is an enzyme with preferential hydrolytic activity towards at least one replicating intermediate form of viral nucleic acid as found in the life cycle of the viral agent.
- Another embodiment of the invention provided herein is a method for treating a viral disease in a subject having an infection by a vims that has developed resistance to antiviral therapeutic agents, the agents generally being chemotherapeutic dmgs of low molecular weight, rather than nucleases administered as administered by the methods herein for treatment.
- Drug-resistant vimses are susceptible to the antiviral activity of nucleases because they digest viral nucleic acids without regard for present or potential alterations in the sequenceof nucleotides in the drug-resistant viral mutant. For this reason, development of resistance to nucleases is extremely unlikely or even hardly possible, and a drug-resistant mutant of a vims is susceptible to the antiviral activity of nucleases provided herein.
- Another embodiment of the invention provided herein is a method for treating a viral disease in a subject and preventing the development of viral resistance to antiviral therapeutics other than nucleases administered for treatment, the method comprising administering the antiviral dmgs in combination with at least one nuclease or nuclease- derived composition.
- the antiviral therapeutic is at least one compound selected from the group of antiviral compounds consisting of viral entry inhibitors, viral assembly inhibitors, viral DNA and RNA polymerase inhibitors, viral reverse transcriptase inhibitors, viral protease inhibitors, viral integrase inhibitors, and inhibitors of viral shedding.
- Another embodiment of the invention provided herein is a method for preventing and treating a non-viral disease in a subject, wherein a viral infection has been implicated as a contributing factor, the method comprising administering therapeutics directed against the non-viral disease in combination with at least one antiviral nuclease or an antiviral nuclease- derived composition.
- the antiviral nuclease in various embodiments is selected from the group of wild-type nucleases of human, animal, bacterial, plant and artificial origin; genetically-engineered common and uncommon mutants of wild-type nucleases of human, animal, bacterial, plant and artificial origin; and chemically and genetically modified common and uncommon mutants of wild-type nucleases of human, animal, bacterial, plant and artificial origin.
- the viral agent in various embodiments is a dsDNA vims or an ssDNA vims of Groups I and II, respectively, and the antiviral nuclease is selected from the group consisting of Group I dsDNA-specific nucleases, Group II ssDNA-specific nucleases, Group IV ssRNA-specific nucleases, Group VI non-specific nucleases and Group VII artificial nucleases.
- the viral agent in various embodiments is a dsRNA, an ss(+)RNA, or an ss(-)RNA vims of Groups III, IV and V, respectively, and the nuclease is selected from the group consisting of Group I dsDNA-specific nucleases, Group II ssDNA- specific nucleases, Group III dsRNA-specific nucleases, Group IV ssRNA-specific nucleases, Group VI non-specific nucleases and Group VII artificial nucleases.
- the viral agent in various embodiments is an s/s(+)RNA Reverse Transcriptase (RT) vims of Group VI, and the nuclease is selected from the group consisting of Group I dsDNA-specific nucleases, Group II ssDNA-specific nucleases, Group IV ssRNA-specific nucleases, Group VI non-specific nucleases and Group VII artificial nucleases.
- RT s/s(+)RNA Reverse Transcriptase
- the viral agent in various embodiments is a dsDNA Reverse Transcriptase (RT) vims of Group VII, and the nuclease is selected from the group consisting of Group I dsDNA-specific nucleases, Group II ssDNA-specific nucleases, Group IV dsRNA-specific nucleases, Group IV ssRNA-specific nucleases, Group I dsDNA Reverse Transcriptase (RT) vims of Group VII, and the nuclease is selected from the group consisting of Group I dsDNA-specific nucleases, Group II ssDNA-specific nucleases, Group IV dsRNA-specific nucleases, Group IV ssRNA-specific nucleases, Group
- the viral agent in various embodiments is a plurality of vimses selected from Group I dsDNA vimses, Group II ssDNA vimses, Group VI ss(+)RNA RT and Group VII of dsDNA RT vimses, and the nucleases are selected from the group consisting of Group I dsDNA-specific nucleases, Group II ssDNA-specific nucleases, Group IV ssRNA-specific nucleases, Group V hybrid-specific nucleases, Group VI non-specific nucleases and Group VII artificial nucleases.
- the viral agent in various embodiments is a plurality of vimses selected from Group III dsRNA, Group IV ss(+)RNA, Group V ss(-)RNA vimses, Group VI ss(+)RNA RT and Group VII dsDNA RT vimses, and the nucleases are selected from the group consisting of Group I dsDNA-specific nucleases, Group II ssDNA-specific nucleases, Group III dsRNA-specific nucleases, Group IV ssRNA-specific nucleases, Group
- V hybrid-specific nucleases Group VI non-specific nucleases and Group VII artificial nucleases.
- Kits are provided for any of the above compositions, which in related embodiments in addition to the composition include a container and instmctions for use.
- the compositions may be provided with a pharmaceutically acceptable buffer, ca ⁇ ier, or salt, and may be provided in a unit dose.
- the present invention is directed in part to a novel combinatorial method for prevention and treatment of viral diseases, which takes into account multiple intermediate forms of viral nucleic acids appearing in the course of viral replication cycle, by administering selected combinations of nuclease-based antiviral compositions directed against this plurality of viral nucleic acids.
- the present invention is also directed to antiviral compositions derived from a variety of chemically and genetically modified nucleases targeted to different forms of viral nucleic acids and characterized by enhanced hydrolytic activity under physiological conditions, extended half-life, high-cellular uptake, low immunogenicity, resistance to intracellular inhibitors and degradation by endogenous proteases.
- An embodiment of invention provides antiviral compositions derived from wide variety of nucleases of mammalian, bacterial, plant and artificial origin, including semi- synthetic and synthetic nucleases that exhibit hydrolytic activity towards a form of viral DNA and/or RNA.
- Antiviral nucleases provided herein comprise compositions of wild-type native and recombinant, chemically/genetically enhanced, semi-synthetic and synthetic nucleases exhibiting hydrolytic activity towards certain forms of viral nucleic acids appearing in the course of viral replication cycle.
- antiviral nucleases are divided into seven different groups in compliance with the stmcture of their prefe ⁇ ed substrates-viral nucleic acids.
- the vimses are divided according to the Baltimore classification into seven fundamentally different groups in accordance with the stmcture of viral nucleic acids and different patterns of their replication.
- nucleases with preferential hydrolytic activity towards double-stranded viral DNA which belong to the DNase-I family including human DNase I and bovine DNase A, DNase ⁇ , ⁇ , ⁇ and others, and their chemically/genetically enhanced variants
- nucleases with preferential hydrolytic activity towards single-stranded viral DNA ssDNA
- ssDNA single-stranded viral DNA
- endoG mammalian endonuclease G
- extra-cellular fungal nuclease Bhl from Basidiobolus haptosporus Mung Bean nuclease and their chemically/genetically enhanced variants
- nucleases with prefe ⁇ ed hydrolytic activity towards single-stranded viral RNA ssRNA
- ssRNA single-stranded viral RNA
- dsRNA double-stranded viral RNA
- the artificial nucleases may be further classified as biological nucleases including peptides and peptidomimetics exhibiting nucleolytic activity exemplified by nucleolytic di/tri peptides such as Ser-His, Ser-His-Asp or chemical nucleases based on catalytic activity of metal-ion complexes exemplified by tetravalent ion of cerium Ce(IV), which has been found to be among the most effective metal ions for double-stranded DNA hydrolysis.
- nucleolytic di/tri peptides such as Ser-His, Ser-His-Asp or chemical nucleases based on catalytic activity of metal-ion complexes exemplified by tetravalent ion of cerium Ce(IV), which has been found to be among the most effective metal ions for double-stranded DNA hydrolysis.
- the invention is directed in part to chemically/genetically enhanced variants of native nucleases containing non-natural amino acid residues substituting natural amino acids in selected positions.
- Such chemically/genetically enhanced variants of native nucleases are characterized by increased nucleolytic activity and/or resistance against endogenous proteases and/or nuclease inhibitors, wherein the enhanced variants of native nucleases are selected on the basis of their maximal hydrolytic activity at minimal cytotoxicity in physiological conditions.
- the chemically/genetically modified variants with enhanced hydrolytic activity towards the particular form of viral nucleic acid are obtained by substitution of one or more neutral or negatively charged naturally occu ⁇ ing or "natural" amino acids located within the nuclease binding domain of its substrate or of its inhibitor, the substitution being with one or more non-naturally occuring or "non-natural” amino acids or the substituted amino acid carrying positive multiple-charged or bulky neutral side chains or keto groups.
- a keto group is introduced for subsequent attachment of small molecular weight multiply-charged chemical moieties or steric hindrance moieties such as a large molecular weight polymeric carrier to provide nuclease with enhanced resistance against proteolytic digestion, increased half-life and cellular uptake.
- the invention provides antiviral compositions which are chemically/genetically enhanced nucleases within the following groups: Group I-dsDNA- specific nucleases exemplified by highly-hydrolytically active and actin-resistant uncommon mutant variants of human DNase I obtained by the following substitutions: Ql lRU/E13KU (2+) /N74KU (2+) /A114FU ( et0) with five additional positive charges (+5), wherein RU is non-natural homoarginine, KU (2+) is non-natural lysine with two positively charged side-chain amino groups and FU ( eto) is non-natural p-acetyl-L-phenylalanine residue carrying a keto group; Group III-ssRNA-specif ⁇ c nucleases exemplified by ribonuclease inhibitor (R ⁇ )-resistant and non-toxic uncommon mutants of human RNase I obtained by the following substitutions: KlFU (keto) /Ql 1 A/N71
- the antiviral compositions disclosed in this invention comprise multivalent "shell-core” dendrimer complexes, wherein "shell” dendrimer ca ⁇ ies multiple nonfunctional antiviral nuclease-polymer conjugates or multiple targeting ligands, wherein one or more "shell” dendrimers are associated with a "core” dendrimer through Watson-Crick bonding between the pairs of complementary oligonucleotides covalently associated with the dendrimers and chemically modified to enable a subsequent covalent bond formation between the complementary pairs.
- the antiviral compositions comprise native and chemically/genetically enhanced antiviral nucleases covalently associated with hetero-bi- functional polymers, wherein said hetero-bi-functional polymers are associated directly or through multivalent molecular scaffolds such as dendrimers or star polymers with multiple targeting ligands of various functions.
- the targeting ligands carried by polymeric carriers may comprise: a) oligomers with sequence-specific affinity to the selected sites of viral nucleic cell such as peptide nucleic acids (PNA), morpholino and py ⁇ olidine-amide oligonucleotide mimic (POM) oligo nucleotides, hairpin polyamides, zinc fingers, etc.; b) membrane permeating peptides (MPP) including poly-Arg/Lys peptides, Arg-rich peptides derived from HIV-TAT, Antennapedia, detoxified exotoxin A (ETA), etc.
- PNA peptide nucleic acids
- POM py ⁇ olidine-amide oligonucleotide mimic
- MPP membrane permeating peptides
- T-CSR cell surface receptor-recognizing ligands
- CSR cell surface receptors
- the invention provides antiviral compositions comprising modified RNase S, in the form of a non-covalent nucleolytic complex formed between two conjugates of about equal molecular weight, wherein the first conjugate is the 11.5 kDa human S-protein (21-124) covalently attached to a 20 kDa targeted polymeric carrier, and the second conjugate is the 2 kDa human S-peptide (1-15) covalently attached to a 30 kDa targeted polymeric carrier, wherein each polymeric ca ⁇ ier is covalently associated with membrane permeating peptide Arg(R)8 and bis-PNA complementary to a conserved domain of the targeted viral nucleic acid.
- modified RNase S in the form of a non-covalent nucleolytic complex formed between two conjugates of about equal molecular weight, wherein the first conjugate is the 11.5 kDa human S-protein (21-124) covalently attached to a 20 kDa targeted polymeric carrier, and the second conjugate is the 2 kDa human S
- the invention provides an antiviral composition
- PEG-DNase-RNase S in the form of a non-covalent nucleolytic complex formed between two conjugates of about equal molecular weight, wherein the first conjugate is the 11.5 kDa human S-protein (21-124) covalently attached to 31 kDa human DNase I and to a 20 kDa targeted polymeric carrier, and the second conjugate is the 2 kDa human S-peptide (1-15) covalently attached to a 60 kDa targeted polymeric ca ⁇ ier, wherein each polymeric carrier is covalently associated with membrane permeating peptide Arg(R)8 and bis-PNA complementary to the selected nucleotide sequence of the targeted viral DNA or RNA.
- the invention provides multifunctional antiviral compositions comprising nucleases and targeting ligands covalently associated with polymeric carriers comprising multivalent dendrimers and "shell" dendrimer-"core” dendrimer complexes, wherein the terminal groups of the dendrimers are chemically modified to include sequence-specific oligonucleotides undergoing hybridization and subsequent covalent bond formation with complementary oligonucleotides associated with nucleases and targeting ligands and or other multiarmed dendrimers.
- the covalent binding of two complementary base-paired oligo- or poly-deoxynucleotides can be ca ⁇ ied out by the use of bifunctional reagents exemplified but not limited to a heterofunctional polyalkylating agent N,N,N'-tri-( ⁇ -chloroethyl)-N'-(p-formylphenyl)propylene diamine-1,3.
- the reagent is attached to one of oligo- or polydeoxynucleotides through a highly reactive aliphatic ⁇ - chloroethylamino group.
- the reactivity of the potentially active aromatic alkylating group is strongly inhibited by the neighboring formyl residue. This group might be activated, when needed, after base-pairing of oligo- and polynucleotides by its activation through reduction of the formyl residue using sodium borohydride.
- the invention in other embodiments also provides methods for prevention and treatment of viral diseases in human and nonhuman animals, insects and plants, comprising an application of the vims-group-specific "cocktails" containing a mix of nuclease-derived antiviral compositions, including but not limited to the antiviral compositions of this invention, wherein each antiviral "cocktail” includes nucleases with hydrolytic activity towards certain intermediate replicating forms of viral nucleic acids appearing during the replication cycle of the targeted vims.
- the invention provides a method for prevention and treatment of viral diseases caused by DNA vimses including Group I of dsDNA and Group II of ssDNA vimses by application of antiviral nucleases selected from the group of nucleases comprising Group I of dsDNA-specific nucleases, Group II of ssDNA-specific nucleases, Group IV of ssRN A-specific nucleases, Group VI of non-specific nucleases and Group VII of artificial nucleases according to the "Classification of Nucleases" of the present invention.
- the invention provides a method for prevention and treatment of viral diseases caused by RNA vimses including Group III of dsRNA vimses, Group IV of ss(+)RNA vimses and Group V of ss(-)RNA vimses by application of antiviral nucleases selected from the group of nucleases comprising Group III-dsRNA-specific nucleases, Group IV of ssRNA-specific nucleases with addition of nucleases selected from the Group I of dsDNA-specific nucleases, Group II of ssDNA-specific nucleases, Group VI of non-specific nucleases, and Group VII of artificial nucleases according to the "Classification of Nucleases" of the present invention.
- the invention provides a method for prevention and treatment of viral diseases caused by Group VI of ss(+)RNA RT vimses by application of antiviral nucleases selected from the group of nucleases comprising Group I of dsDNA- specific nucleases, Group II of ssDNA-specific nucleases, Group IV of ssRNA-specific nucleases, Group V of RNA-DNA-hybrid-specific nucleases, Group VI of non-specific nucleases, and Group VII of artificial nucleases according to the "Classification of Nucleases" of the present invention.
- the invention provides a method for prevention and treatment of viral diseases caused by Group VII of dsDNA RT vimses by application of antiviral nucleases selected from the group of nucleases comprising Group I of dsDNA- specific nucleases, Group II of ssDNA-specific nucleases, Group III of dsRNA-specific nucleases, Group IV of ssRN A-specific nucleases, Group V of RNA-DNA-hybrid-specific nucleases, Group VI of non-specific nucleases and Group VII of artificial nucleases according to the "Classification of Nucleases" of the present invention.
- the invention also provides methods for preventing the development of viral resistance to antiviral therapeutics other than nucleases, the method comprising administering the antiviral dmgs in combination with at least one nuclease or nuclease-derived composition, wherein the antiviral therapeutic administered for treatment is at least one compound selected from the group of antiviral compounds consisting of viral entry inhibitors, viral assembly inhibitors, viral DNA and RNA polymerase inhibitors, viral reverse transcriptase inhibitors, viral protease inhibitors, viral integrase inhibitors, and inhibitors of viral shedding.
- the present invention provides antiviral therapeutic compositions and vims-specific methods for prevention and treatment of viral diseases.
- the antiviral compositions in certain embodiments are derived from antiviral nucleases covalently associated with various polymeric earners.
- the antiviral nucleases comprise wild-type and chemically and/or genetically modified nucleases of mammalian, amphibian, bacterial and plant origin as well as nucleases of artificial origin with enhanced hydrolytic-activity against one or more stmctural forms of nucleic acids.
- the nucleases are chemically and genetically modified to increase bioavailability, hydrolytic-activity towards small concentrations of viral nucleic acids, and resistance against potent nuclease inhibitors.
- the targeted multivalent polymeric carriers-nuclease complexes exhibit antiviral action by selective targeting and ultimate hydrolytic-digestion of specific form of viral nucleic acids, which appears in the course of viral replication cycle inside infected cells, thereby blocking synthesis of viral proteins and viral replication.
- the targeted polymeric ca ⁇ iers comprise high-molecular weight molecular scaffolds including but not limited to hydrophilic polymers, star polymers, block- copolymers or dendrimers covalently associated with targeting ligands of various functions.
- the targeting ligands include ligands directing antiviral nuclease-polymer complexes to host cells, ligands enhancing cellular and nuclear uptake, and ligands with sequence specific binding affinity to viral nucleic acids.
- the multivalent antiviral nuclease-polymeric complexes can target viral nucleic acids inside infected cells for ultimate hydrolytic- digestion, while providing the nuclease with protection from endogenous proteases which are found both in blood plasma and inside the cells; and result in high cellular uptake, prolonged half-life, decreased immunogenicity and cytotoxicity.
- the present invention also provides a method of use of antiviral compositions derived from wild-type and chemically/genetically enhanced nucleases as well as nucleases covalently associated with polymeric carriers for prevention and treatment of viral diseases caused by vimses divided into seven groups according the Baltimore classification. More specifically the method comprises targeting one or more viral nucleic acids appearing in the course of viral replication cycle inside vims infected cells for ultimate hydrolytic-digestion by the specially selected combination of both naked nucleases and various nuclease-polymer complexes with established high-hydrolytic-activity against one or more particular forms of viral nucleic acids, including single-stranded, double-stranded, hybrid and other forms of viral DNA and RNA appearing in the course of replication of the particular vims.
- nuclease and antiviral nuclease refer to an enzyme with hydrolytic activity towards at least one specific form of a viral nucleic acid, such as DNA or RNA.
- the antiviral nucleases within the scope of the present invention include wild type nucleases, homologues of wild-type nucleases, chemically and genetically modified nucleases of human, animal, bacterial, and plant origin, and di/tri peptides, peptidomimetics exhibiting hydrolytic activity towards nucleic acids and other artificial nucleases.
- the nucleases within the scope of the present invention include dimers, trimers and higher oligomers of wild-type and modified nucleases.
- nuclease-derived composition refers to any chemical composition which includes a wild type or a chemically/genetically modified nuclease or a nuclease in complex with a polymeric carrier as one of its components.
- subject refers to a human, and to any animal, plant or microorganism of practical importance which can be infected by a viral agent.
- viral agent refers to a vims, a provims, a phage and to any other vims- like microorganism.
- nucleic acid refers to any linear, circular or super- coiled, single-stranded or double-stranded, DNA or RNA, which appears during the course of a viral replication cycle.
- nuclease targeted to a viral nucleic acid defines one or more nucleases, which possesses greater hydrolytic activity towards a specific form of a viral nucleic acid and is covalently associated directly or indirectly through a polymeric ca ⁇ ier with a ligands having specific ability to bind to a nucleotide sequence of a targeted viral nucleic acid.
- common mutant nuclease refers to a nuclease variant having at least one common or natural amino acid residue replaced by another common or natural amino acid residue.
- a “common mutant nuclease” is typically produced by random or site-directed mutagenesis and substitutes one or more of the naturally occurring amino acid building blocks.
- uncommon mutant nuclease refers to a nuclease variant having at least one naturally occurring amino acid residue is replaced by an "uncommon” or non-naturally occu ⁇ ing amino acid residue.
- the identity of the 20 naturally-occu ⁇ ing L-amino acid residues is well established.
- the term "uncommon amino acid residue” includes, without limitation, any non-naturally occu ⁇ ing amino acid such as a ⁇ - ⁇ - etc.
- D-amino acid and any D-amino acid such as D-serine, D-aspartate, N-methyl-D-aspartate and others, which may occur naturally at rare amounts in various living organisms from bacteria to mammals (Yang, et al., FEBS Letters 552 (2-3): 95-98, 2003), as well as to rarely occurring formyl- methionine (RajBhandary, J Bacteriol 176, 547, 1994) and selenocysteine (A. Bock, et al, Mol. Microbiol 5, 515, 1991), which are incorporated in response to punctuation signals during translation in certain organisms.
- D-amino acid such as D-serine, D-aspartate, N-methyl-D-aspartate and others, which may occur naturally at rare amounts in various living organisms from bacteria to mammals (Yang, et al., FEBS Letters 552 (2-3): 95-98, 2003), as well as to rarely occurring formy
- non-natural amino acid refers to natural amino acids analogs that do not occur naturally in living organisms.
- the analogs are chemically modified to acquire single and multiply charged, branched and otherwise modified side chains.
- Common mutagenesis methods are generally limited to the common 20 amino acids although in a number of cases it has been possible to competitively incorporate close stmctural analogs of common amino acids throughout the proteome (Kirshenbaum et al., Chem. Bio.Chem. 3:235(2002); Doring et al. Science 292:501, 2001).
- the nucleases containing non-natural amino acids can be produced by biosynthetic and semisynthetic techniques, for example, utilizing amber codon suppression method.
- the term includes but is not limited to natural amino acid derivatives with chemically modified side chain groups, including multiply-charged, steric hindrance, caged and other chemical modifications.
- keto-modified nuclease refers to an uncommon mutant nuclease obtained by site-specific inco ⁇ oration of a non-natural amino acid such as p-phenyl-alanine and m- phenyl-alanine carrying a keto group.
- a non-natural amino acid such as p-phenyl-alanine and m- phenyl-alanine carrying a keto group.
- the unique reactivity of the keto group allows it to be selectively modified by a wide variety of agents including hydrazide, hydroxylamine or semi-carbamide derivatives.
- thiol-modified nuclease refers to common and uncommon mutant nucleases obtained by site-specific inco ⁇ oration of either a natural or an uncommon amino acid carrying a thiol group such cysteine, selenocysteine and other non-natural cysteine- derivatives.
- keto-thiol-modified nuclease refers to an uncommon mutant nuclease obtained by site-specific substitution of at least two reactive moieties: non-natural amino acid such as p-phenyl-alanine and m-phenyl-alanine carrying the keto group, and a natural or non-natural amino acid carrying the thiol group such cysteine, selenocysteine and other non-natural cysteine-derivatives.
- alkyl refers to the hydrocarbons and phospholipids, including but not limited to l,2-dipalmitoyl-sn-glycero-3- phosphatidyl ethanolamine (DSPE), lauryl, myristoyl, palmitoyl, stearoyl, oleoyl, and lineoyl analogs of DSPE, fatty acids, etc.
- DSPE distearoyl-phosphatidyl ethanolamine
- Singly-charged refers to a net charge of +1 or -1 at physiological pH.
- Singly-charged non-natural amino acids include, but are not limited to, Homoarginine, Homolysine, Diaminobutanoic acid (Dab) (Shakkottai, et al. J. Biol. Chem., Vol. 276, Issue 46, 43145-43151, November 16, 2001) and others.
- Multiply-charged refers to a net charge greater than +1 and less than -1 at physiological pH.
- Multiply-charged non-natural amino acids include, but are not limited to, lysine carrying from +1 to +3 positive charges, di-aspartate carrying -2 negative charges, etc.
- ACE antiviral complex containing enzyme
- ACE refers to an enzyme that is covalently associated with at least one targeting or delivery enhancing ligand, or is covalently associated with at least one polymeric ca ⁇ ier, or any combination thereof including but not limited to one or more multivalent polymeric ca ⁇ iers carrying one or more targeted or delivery enhancing ligands.
- artificial nuclease refers to a nuclease comprising a semi-synthetic or synthetic molecular scaffold containing at least one recognition domain for a substrate nucleic acid and at least one catalytic domain for hydrolysis of the phosphodiester bonds of a nucleic acid.
- the molecular scaffold may comprise peptide or peptide dendrimer or peptide-mimetic or polypeptide or any other biological or synthetic polymers or combinations thereof.
- the catalytic domains of artificial nucleases may be of biological or inorganic chemical nature. Synthetic polymers used as backbones of artificial nucleases may contain multiple organic or inorganic functional groups as catalytic elements (Suh, Ace. Chem. Res.
- Inorganic catalytic domains may be represented by hydrolytic metals such as lanthanide ions or their complexes covalently or non-covalently associated with the nucleic acid recognition domain of an artificial nuclease (Yamamoto et al., Nuc. Ac. Res., 31 (15): 4497-4502, 2003; Welch et al., PNAS, 100(7):3725-3730, 2003).
- the side chain imidazole group of histidine is exemplary for nucleolytic acid-base catalysis.
- histidine can act as a donor or an acceptor of protons (Gray, Enzye Catalyzed Reactions, Van Nostrand Reinhold, London, pp.264-271, 1971; Galburt, et al., Nat. Struct. Biolo, 6:1096-1099, 1999; Van der Woerd, et al, Stmcture 9:133-144, 2001).
- some non-natural histidine derivatives may have steric factors that are the same or similar to that of histidine but have different properties relating to acidity and nucleophilicity.
- Known histidine derivatives include ⁇ -(l,2,3-triazol-4-yl)-DL-alanine (2), ⁇ -(l,2,4-triazol-3-yl)-DL-alanine (3), ⁇ -l,2,3,4-Tetrazol-5-yl)-DL-alanine (4), some of which are efficiently inco ⁇ orated into a protein in vivo (Ikeda, et al., Protein Engineering 16: 699-706, 2003).
- compositions herein include those that are (isolated from nature) native or recombinant, wild-type, and also include chemically/genetically engineered, semi-synthetic and synthetic nucleases, and such nucleases having various targeting ligands covalently associated, for example, with multivalent polymeric ca ⁇ iers.
- Polymeric carriers provide the nuclease-based antiviral compositions with an extended half-life, resistance to degradation by proteases, decreased immunogenicity and toxicity, and targeting moieties provide an address to target the nuclease-based antiviral compositions to infected cells, high cellular and nucleus uptake, and direct nucleases to vims-specific nucleic acids and their replicating intermediates inside the cytoplasm or nucleus of the infected cells. Classification of Viruses.
- Vimses can be broadly classified according to the form of nucleic acid found in the virion. Recent classification emphasizes the effect of genomic content on viral replication strategies. According to the "Vims Taxonomy,” vimses are divided into seven groups based upon the stmcture of the virion nucleic acids and different basic patterns of their replication. The vimses are grouped according to a method devised by David Baltimore refe ⁇ ed to herein as the "Baltimore classification" ('Vims Taxonomy' , H.V. van Regenmortel, et al.
- DNA vimses replicate in the nucleus and rely on the cellular machinery for transcription and proteosynthesis, with exception of poxvimses, which replicate in the cytoplasm using host cell enzymes for viral DNA replication.
- DNA vimses include dsDNA and ssDNA viruses.
- Group I dsDNA vimses comprise non-enveloped vimses of Adenoviridae (Human adenovims C) and Papovaviridae (Polyomavrius, PapiUomavims), enveloped vimses of He ⁇ esviridae (Simplexvims, Varicellovirus, Cytomegalovirus, Roseolavims, Lymphocriptovirus/Epstein-Ba ⁇ vims) and Poxviridae (Variola vims causing smallpox and Vaccinia vims, infecting mammals and birds).
- the group includes also insect Baculoviridae, Iridoviridae, Polydnaviridae, algae Phycodnaviridae and others.
- the dsDNA vimses have single-component linear or circular genomes ranging in size from 5 kilobase pairs (kbp) for Polydnavimses through 30-38 kbp for Adenovimses, to about 200 kbp for Baculo vimses and He ⁇ esviruses to over 300 kbp for Poxvimses and Phycodnavimses.
- Replication of the dsDNA viruses is ca ⁇ ied out by semi-conservative replication as for cellular genomes.
- replication occurs mainly in the nucleus, using cellular enzymes such as DNA polymerases, topoisomerases, ligases, DNA-dependent RNA polymerase's etc., and others.
- the replication of the dsDNA vimses depends entirely on host DNA replication machinery. Viral dsDNA is produced in the S and G2 phases of cell division. However, the replication of Poxvimses, some Baculovimses (granulosis group), and Iridoviruses takes place also in other cell cycle periods within vims-specified "inclusion bodies" in the cytoplasm, using viral genome encoded enzyme such as DNA polymerase.
- this invention provides a method of inhibiting replication of dsDNA vimses by treating with one or more nucleases with prefe ⁇ ed hydrolytic activity towards viral genomic dsDNA, ssDNA areas of replicating viral dsDNA and intermediately transcribed viral ssRNA.
- Group II ssDNA vimses comprise non-enveloped Parvovimses and Circovimses.
- the group includes Circo-like vimses infecting birds and Gemini vimses and Banana Bunchy Top-Related Vimses (BBTRV) infecting plants.
- the ssDNA vimses may have single linear, or single, double or multi-component circular DNA genomes, all relatively small in size: 3 kb for Circovimses, 4-5 kb for Parvovimses, 2.7-5.4 kb for Geminivimses and 5-6 kb for BBTRV.
- replication steps of ssDNA vimses which occur in the nucleus are identified: formation of (-) sense DNA strand, soon after infection; formation of a "replicative form” intermediate dsDNA; primary transcription of dsDNA template by host enzymes; early translation of mRNA encoding regulatory proteins; "rolling circle” replication of viral ssDNA; late transcription controlled by viral regulatory proteins; synthesis of late viral stmctural proteins; and assembly of viral ssDNA and stmctural proteins into mature virions.
- parvoviridae such as adeno-associated vims (AAV) have evolved a biphasic life cycle to ensure persistence in its primate host, needing an unrelated ssDNA helper vims, adenovims or he ⁇ es vims, for productive infection (Muzyczka et al., In Fields Virology, 4th Edn, pp. 2327-2359, 2001,. D. M. Knipe et al., Eds., Philadelphia: Lippincott Williams & Wilkins).
- AAV adeno-associated vims
- AAV type 2 (AAV-2) establishes latency by preferential integration into a specific site on human chromosome 19 (Huser & Heilbronn J Gen Virol 84: 133-137, 2003, Kotin et al. , Proc Natl Acad Sci US A 87: 2211-2215, 1990.
- this invention provides a method of inhibiting replication of ssDNA vimses by treating with one or more nucleases with prefe ⁇ ed hydrolytic activity towards viral genomic ssDNA, intermediate dsDNA and ssRNA.
- RNA Viruses Most RNA vimses replicate in the cytoplasm with exception of Orthomyxoviruses
- RNA vimses from those of host cells containing DNA genomes.
- the RNA vims genome can be composed of double-stranded RNA or dsRNA, negative-sense i.e., antisense or ss(-)RNA, and positive-sense RNA encoding viral proteins or ss(+)RNA.
- the RNA replication process is catalyzed by RNA-dependent RNA polymerases (RdRps), which are formed by vims encoded proteins (e.g., polymerase, helicase) and some host factors.
- RdRps RNA-dependent RNA polymerases
- Group III dsRNA vimses comprise non-enveloped Reovimses, Bimavimses, Partitivimses, Totivimses and Cryptoviruses.
- Reovimses infect animals, plants and insects;
- Bimavimses infect vertebrates and invertebrates.
- Partitivimses infect mainly fungi, which in turn may infect plants;
- Totivimses infect fungi, protozoa and insects.
- Cryptoviruses occur in plants and are apparently transmissible via seed or pollen.
- the single or multi-component viral dsRNA genomes range in size from 4-7 kbp for Partitivimses, Bimavimses and Totivimses, to 20-27 kbp for Reovimses.
- Reovimses have 10-12 segments of dsRNA inside a single capsid.
- transcription of dsRNA genome by vims specific transcriptase occurs inside partially uncoated subvims particles.
- the primary transcription results in synthesis of multiple ss(+)RNAs.
- the latter while released in the cytoplasm, serve both as late mRNA to encoding synthesis of stmctural proteins, and as templates for dsRNA synthesis, which occurs inside newly formed capsids.
- dsRNA vimses The following replication steps of dsRNA vimses are identified: primary transcription of dsRNA forming ss(+)RNA by viral RNA-dependent RNA polymerase (RdRp) inside partially-open capsid; export of ss(+)RNA into cytoplasm; translation of ss(+)RNA in cytoplasm and accumulation of regulatory and early stmctural viral proteins; assembly of ss(+)RNA and viral proteins into immature virions; replication of ss(+)RNA via complementary ss(-)RNA into dsRNA by viral RdRp inside immature virions; secondary transcription of dsRNA, translation of ss(+)RNA and accumulation of late stmctural viral proteins; and assembly of genomic dsRNA and structural proteins into mature virions.
- RdRp RNA-dependent RNA polymerase
- Group-IV ss(+)RNA vimses comprise non-enveloped vimses (Picornavrisues; Calicivimses; Rhinovimses, and common cold vimses), and enveloped vimses (Nidovriruses, Coronavirases/SARS, Flaviviridae, Hepatitis C vims/HCV; Togaviridae, etc.), vimses of plants (Bromovims, Comovims, Potyvirus, Tobacco Mosaic Virus/TMV, etc.), vimses of insects (Nodavirus, Tetravims) and fungi (Barnavirus).
- the single and multi-component genomes of ss(+)RNA vimses range in size from less than 5 kb for Barnavirus to 7-12 kb for Picomavimses and Flaviviridae to non-segmented 27-31 kb Coronavims, which causes Severe Acute Respiratory Syndrome (SARS) in humans.
- SARS Severe Acute Respiratory Syndrome
- ss(+)RNA vimses These viral genomes act as mRNA and are translated after infection of the host cell.
- dsRNA forms of viral genomes and subgenomic RNAs were isolated from cells infected by many of ss(+)RNA vimses, including most plant vimses including TMV, some picorna-like insect vimses, and coronavimses.
- the ss(+)RNA vimses replicate in cytoplasm of infected cells.
- Replication steps include: translation of ss(+)RNA as mRNA with early production of RdRp; synthesis of ss(-)RNA on ss(+)RNA template by RdRp with formation of membrane associated replicative complex (RC), with ss(-)RNA being in the form of genomic-length dsRNA produced by membrane bound RNA polymerase, (e.g.
- Sindbis vims the type alphavims of togaviridae, has three intermediate replicative forms of dsRNA with one being full-length genome and the other two co ⁇ esponding to the first two-thirds (the non-stmctural region) and the remaining one-third (the stmctural region) of the genome, respectively); synthesis of multiple ss(+)RNA, mRNA and ss(-)RNA; translation of ss(+)RNA and mRNA and synthesis of stmctural protein; and assembly of stmctural protein and ss(+)RNA into mature virions.
- SI Sindbis vims
- Group V ss(-)RNA viruses comprise enveloped, single (-)RNA strand vimses (Mononegavirales: Filoviridae, Paramyxoviridae, Rhabdoviridae), multiple (-)RNA strand vimses (Orthomyxoviridae, Bunyaviridae, Arenaviridae).
- the size of viral genomes for Mononegavirales is 11-19 kb, 10-14 kb for 6-8-component Orthomyxo vimses (e.g Influenza vimses), and 11-20 kb for 3-component Bunyavimses.
- ss(-)RNA vimses directly infect only higher Eukarya (antropods and vertebrates), they may also infect plants as a result of close association of some insects and host plants.
- the ss(-)RNA vimses replicate in the host cell cytoplasm with exception of Orthomyxoviruses which replicate in the nucleus of the host cells.
- replication steps are identified: primary transcription of ss(-)RNA by viral RdRp with production of mainly mRNA, ss(+)RNA and formation of replicative complex (RC) with ss(+)RNA being partially in dsRNA form within RC; production of full length ss(+)RNA and progeny ss(-)RNA; secondary transcription from progeny ss(-)RNA; translation and accumulation of stmctural proteins; nucleocapsid assembly and maturation; and budding of nucleocapsid through host membrane containing viral envelope proteins.
- RC replicative complex
- RNA vimses no intermediate viral DNA is synthesized during replication of RNA vimses.
- RT reverse transcriptase
- LCMV lymphocytic choriomeningitis vims
- endogenous RT may reverse-transcribe RNA derived from other infectious vimses (Zhdanov, Nature 256: 471-473, 1975).
- the source of the endogenous RT could be endogenous retrovimses or a variety of other interspersed elements (Wiener et al., A. Rev. Biochem. 55, 631-661, 1986), wherein reverse transcripts from such endogenous sources may account for 10-20% of the mammalian genome (Coffin, in Reverse Transcriptase, pp.445-479, 1993, Eds. Skalka and Gough, Cold Spring Harbor Lab Press, NY).
- RNA vimses Antiviral effects of RNase I against RNA vimses is enhanced herein by combining RNase I with DNase I. Su ⁇ risingly, a strong synergistic inhibitory effect is produced by combining DNase I and RNase I on the replication of equine encephalitis vims (see example 40). The occu ⁇ ence of intermediate viral DNA during the replication of other RNA vimses is envisioned as equivalent to this observation.
- the phrase "intermediate viral DNA" as used herein shall mean viral-specific DNA that is synthesized during the replication cycle of any vims including a DNA or an RNA vims.
- intermediate viral DNA is generally thought by one of ordinary skill in the art of virology to be the product of RT activity in an RNA vims life cycle, the phrase "intermediate viral DNA" as used herein is not limited by any specific mechanism of synthesis, rather refers to any or all species of viral DNA found in replication of a vims, regardless of mode of production.
- an embodiment of the compositions herein is a combination of the nucleases having nucleolytic activity for Group I dsDNA and for Group II ssDNA vimses, which is a resulting antiviral "cocktail" against all RNA vimses.
- the invention relates to a method of inhibiting replication of dsRNA, ss(+)RNA and ss(-)RNA vimses by one or more nucleases with prefe ⁇ ed hydrolytic activity towards viral dsRNA, ssRNA and intermediate viral ssDNA and dsDNA.
- RNA Reverse Transcribed (RT) Viruses DNA and RNA Reverse Transcribed (RT) Viruses.
- Group VI ss(+)RNA RT vimses comprise enveloped Retroviridae family members, which include Lentivimses such as human immunodeficiency vims (HIV) infecting humans, simian immunodeficiency vims (SIV) infecting monkeys, Visna-maedi vims (VISNA) infecting sheeps, and equine infectious anemia vims (EIAV) infecting horses; Alpharetroviruses, which include avian leucosis vims (ALV) and Roues sarcoma vims (RSV); Gamma retrovimses, which include feline leukemia vims (FLU) and Maloney marine leukemia vims (MOVE); Betaretroviruses, which include mammalian mouse mammary tumor virus, MMTV) and Mason-Pfizer monkey vims (MPMV), Deltaretrovimses represented by human T-lymphotropic vims (HTLV),
- Retrovirus virions fuse with a targeted cell membrane, releasing viral genomes each containing two ss(+)RNA molecules into the cytoplasm.
- Reverse transcriptase RT
- All retroviruses encode four genes called gag, pro, pol and env.
- the sizes of the retroviral ss(+)RNA genomes range from 7,000-11,000 b; the size of HIV genome is 9,749 b.
- the following replication steps are identified: reverse transcription of virion ss(+)RN A in cytoplasm by virion-associated RT to produce a resulting intermediate RNA- DNA hybrid complex; digestion of RNA within the RNA-DNA complex by RNase H; replication of the remaining dsDNA by RT into linear and circular dsDNA forms with long terminal repeats (LTR); import of dsDNA into the nucleus; integration of linear proviral DNA into host cell DNA by integrase; replication and transcription of integrated dsDNA by host enzymes with production of progeny ss(+)RNA; translation and accumulation of late stmctural protein; assembly of proteins with progeny ss(+)RN A into viral nucleoprotein; budding through cell membrane; and inco ⁇ oration of viral envelope glycoproteins into the virion during budding.
- LTR long terminal repeats
- this invention provides a method of inhibiting replication of ss(+)RNA RT vimses by one or more nucleases with prefe ⁇ ed hydrolytic activity towards viral genomic ssRNA, and intermediate hybrid RNA-DNA, ssDNA, dsDNA and ssRNA.
- Group VII dsDNA RT vimses comprise enveloped Hepadnaviridae family, which includes hepatitis B vims (HBV), and as described herein, Group VII also includes unique non-enveloped Hepatitis Delta Vims (HDV), replication and spread of which require presence of HBV.
- HDV has a genome of 1,678 bases consisting of a covalently closed circular ss(-)RNA molecule that folds in a rigid dsRNA rod-like stmcture by extensive intramolecular base pairing. Using a mechanism known in many plant vimses as the double rolling circle model, both RNAs are transcribed from a single initiation. Similar to other ss(- )RNA vimses, HDV produces intermediate dsRNA in the course of replication.
- the following viral replication steps are identified for dsDNA RT vimses: entrance of viral nucleocapsid into the cytoplasm to reach the cell nucleus, and synthesis of circular dsDNA and repair of gaps in (+) DNA strand to yield a covalently closed circular (CCC) super-coiled DNA; transcription of the CCC template to obtain four viral ss(+)RNAs, which are then transported to the cytoplasm; reverse transcription inside the new viral nucleocapsid; production of replicative intermediates in CCC-DNA, relaxed circular RC- DNA, linear ssDNA and dsDNA in addition to ss(+)RNA; transcription of DNA to synthesize mRNA(s) and ss(+)RNA by host DNA-dependent RNA polymerase; translation of mRNA and ss(+)RNA in cytoplasm; accumulation of viral RNA and proteins; interaction of viral proteins with ss(+)RNA and assembly of provisions; reverse transcription of ss(+)RNA inside virions by viral
- this invention provides a method of inhibiting replication of dsDNA RT vimses by one or more nucleases having hydrolytic activity towards viral genomic dsDNA, and or intermediate viral hybrid RNA-DNA, circular ssDNA, linear ssDNA, dsDNA and ssRNA.
- additional nucleases having hydrolytic activity towards viral dsRNA are required.
- vimses comprise seven groups according to form of their DNA or RNA genomes, and compositions and methods for treatment of vims diseases caused by each group require different strategies that depend on the nature of intermediary forms of DNA and RNA that are different and possibly multiple.
- Various embodiments of the present invention envision a multi-target approach to inhibition of replication of vimses, based on characteristics of nucleases that are targeted to different intermediate forms of replicating viral nucleic acids. Classification of relevant antiviral nucleases and descriptions of their characteristic properties are outlined below. Classification of Nucleases.
- Nucleases can be broadly classified based on specificity of their hydrolytic attack toward the phosphodiester bonds between sugar moieties, riboses or deoxyriboses within two different nucleic acids: DNA and RNA. Accordingly, these enzymes were initially classified as DNases and RNases (Kunitz, J. Gen. Physiol 24: 15, 1940). Even though some bacterial endonucleases and venom phosphodiesterases hydrolyze both RNA and DNA (Schmidt, in Chargaff and Davidson (eds.), The Nucleic Acids, Vol. 1 , Academic Press, 1955), the classification of nucleases into DNase and RNase suggested by Kunitz was considered sufficient at that time.
- nucleases may differ significantly in their hydrolytic- activity towards various forms of DNA and RNA
- new classification schemes were suggested, which take into consideration the stmctural specificity of substrates such as double- or single-strandedness of DNA and RNA, existence of hybrid DNA-RNA forms and A-, B- and Z-conformations of DNA, and cleavage specificity such as DNA cleavage by DNase I in minor grove domain, etc.
- nucleases Classification herein of nucleases as antiviral agents as used herein for therapeutic pu ⁇ oses is based on characteristics of the nucleases such as biological source, and stmcture and specificity of nucleic acid substrates, i.e., viral genomes and nucleic acid intermediates that appear during a viral replication cycle.
- the nucleases are further subdivided into endonucleases and exonucleases according to the mode of action.
- the endonucleases split DNA or RNA at internal sites, while exonucleases progressively split off single nucleotides from 3' or 5' ends of DNA or RNA.
- viral dsDNA appears in its unprotected form inside the cell in the course of a viral replication cycle in a right-handed and extended B-DNA form, except when forming DNA-RNA hybrids, which are A-type helices.
- B-DNA must usually transform into A-DNA type prior to hybrid formation.
- A-type helices are also right-handed but are shorter and wider that B-type helices.
- Z-DNA is a left-handed helix longer than B-DNA helix and with reverse twist (Calladine and Drew, Understanding DNA, Academic, London, 1997).
- the antiviral nucleases described herein comprise wild-type native and recombinant natural nucleases, i.e., chemically/genetically modified natural nucleases to enhance their binding affinity and hydrolytic activity towards their particular targeted substrate, to increase nuclease resistance to inhibitors and endogenous proteases.
- the antiviral nucleases provided herein also comprise artificial nucleases, including semi-synthetic biological and chemical nucleases specially designed to possess hydrolytic activity towards specific forms of viral nucleic acids.
- the antiviral nucleases are classified into seven groups according to the nature and the form of their prefe ⁇ ed substrates, which constitute various forms of viral nucleic acids appearing in the course of a viral replication cycle.
- Group I dsDNA-specific nucleases are enzymes with preferential hydrolytic activity towards double-stranded DNA. This group includes wild-type native and recombinant, chemically/genetically modified DNase-like nucleases of mammalina, bacterial or plant origin which digest linear, nicked-circular or super-coiled double-stranded DNA.
- Nucleases in this group include the DNase I family, DNase ⁇ , DNase ⁇ , DNase ⁇ , DNase II family, DNase Il-like Acid DNase (DLAD), Exonuclease III, and the like, as well as artificial nucleases that harbor a sequence-specific recognition domain for a double-stranded viral DNA.
- DNase I family
- DNase ⁇ DNase ⁇
- DNase II family
- DLAD DNase Il-like Acid DNase
- Exonuclease III Exonuclease III
- Human pancreatic DNase I has optimal activity at slightly alkaline conditions, such as pH about 6-9.5. Optimal activity of DNase I requires presence of divalent captions such as Mg 2+ , Mn + and Ca 2+ , and activity is significantly decreased under physiological concentrations of sodium, potassium and phosphate salts. For example human DNase I retains about 50% of its activity at 50 mM NaCl, and less than 10% of its maximum activity at physiological concentrations (about 150-200 mM NaCl). Another factor contributing to limited hydrolytic potency of native wild-type DNase
- Endogenous human DNase I in semm is the presence of DNA binding proteins in human serum.
- Endogenous human DNase I present in semm in typical concentrations of (about 3.2 +/-1.4 ng/ml) has a very low or undetectable level of nucleolytic activity on endogenous serum DNA, primarily due to the presence of actin, a potent inhibitor of DNase I.
- Pharmacodynamics studies showed that a minimum wild-type recombinant human DNase I semm concentration as high as 50- 100 ng/ml is required to achieve detectable catalytic activity against 25-250 ng/ml endogenous DNA in human semm (Prince, et al., Clin. Exp. Immunol. 113(2):289-96, 1998).
- Variants of recombinant human rh-DNase I are disclosed in US patent applications (2001/0041360 of Nov. 15, 2001 to Lazarus et al., and 2002/0173025 of Nov. 21, 2002 to Lazarus and Pan) which have increased activity that is less susceptible to inhibition by actin and at physiological concentrations of salts. These variants have mutations at or near amino acid residues involved in binding of substrate DNA and G-actin. Although G-actin is a potent inhibitor of human, bovine, mouse and rabbit DNase I, amphibian DNase I is unaffected by G-actin.
- Residues Y65, V67 and A114 which are responsible for actin- binding in human and bovine DNase I, are not conserved in amphibian DNase (Paudel and Liao, J. Biol. Chem. 261 : 16012-16017, 1986; Yasuda T. et al. J. Biochem.(Tokyo) 108: 393-398, 1990).
- Human pancreatic DNase I is a 282-amino acid glycoprotein with two Asn-linked glycosylation sites at positions N18 and N106.
- the enzyme consists of 22 signal amino acids (MW 2197.7 Da) and 260 chain amino acids (MW 29253.9 Da), including a positive arginine residue and a positive lysine residue in signal, 13 positive arginine residues in the chain (R31, R41, R73, R79, R85, Ri l l, R117, R121, R126, R177, R185, R213, R222), 6 positive lysine residues in the chain (K2, K15, K50, K77, K157, K260), 12 negative glutamate residues (E) in the chain and 22 negative aspartate (D) residues in chain, which results in a total negative charge (2+13+6-12-22) of -13 for 282 amino acid (MW 31,451.6 Da) native human pancreatic DNase I (ref.
- Human pancreatic DNase I also contains mannose-6-phopshate (M-6-P) residues assigned to two sites of glycolsylation - two asparagine residues Asn- 106 and Asn- 18, and the nuclease exhibits very strong binding affinity to cation-independent mannose-6- phosphate receptor (CI-MPR) (Cacia et al., Biochemistry 37:15154-15161, 1998).
- M-6-P mannose-6-phopshate
- bovine pancreatic DNase I has been shown to enter living human cells through engagement of CI-MPR present on cytoplasmic membrane (Oliveri, et al., Eur. J. Immun. 34:273-279, 2004).
- bovine pancreatic DNase I is glycosylated at a single site Asn-18 (Liao, et al., J. Biol. Chem. 248: 1489-1493, 1973).
- the bovine DNase I contains high-mannose and hybrid oligosaccharides with the latter containing sialic acid (Salnikow, et al., J. Biol. Chem. 245:5685-5690, 1970), but no M-6-P residues are present on the bovine DNase I (Cacia et al., Biochemistry 37:15154-15161, 1998).
- this invention describes polymeric complex containing nuclease such as DNase I, RNase I and others wherein the polymer is modified to contain multiple mannose-6-phopshate (M-6-P) residues targeting CI-MPR cell surface receptors (see Example 3).
- M-6-P mannose-6-phopshate
- Human DNase II is a 344 amino acid (MW38 kDa) endonuclease that functions optimally within about pH 4.5-5.0 without an apparent requirement for divalent captions. Human DNase II cuts DNA similarly to DNase I, producing single-strand nicks rather than double-strand cuts (Baker et al, Gene 215:281-289 (1998). Although DNase II may enhance or induce cell apoptosis, possibly by direct damage of cellular DNA, recent data demonstrated that over-expression of DNase II is not sufficient to induce cell death in vivo (Evans et al., Gene 295:61-70, 2002).
- DNase II enzymes are involved in engulfment- mediated clearance of DNA (Evans et al., Gene 295:61-70, 2002, Mvllroy et al., Genes Dev. 14:549-558, 2000).
- DNase II has a leader peptide, which promotes enzyme insertion into the endoplasmic reticulum (Lyon et al., Gene 252:147-154, 2000; Shiokawa and Tanuma, Biochem. Biophys. Res. Commun. 247:864-869, 1998; Baker, et al., Gene 215:281-289, 1998).
- DNase II Unlike DNase I that has tissue specific expression patterns, DNase II has a ubiquitous tissue distribution (Krieser et al., Gene 269: 205-216 (2001), consistent with its proposed roles in DNA degradation subsequent to phagocytosis and DNA cannibalism.
- the DNase II family includes acidic nucleases such as mammalian DNase Il-like acid DNase (DLAD), a 40.7 kDa basic cytoplasmic protein sharing 37% amino acid identity with DNase II, which is expressed in mammalian liver (Shiokawa and Tanuma, Nucl. Acid Res. 27(20):4083-4089, 1999).
- High nucleolytic activity of DNase II at acidic conditions is a feature of DNase Il-derived antiviral compositions provided herein. Simultaneous endosomal Engulfment of vims and exogenous DNase II as provided herein promotes hydrolytic digestion of viral DNA by the nuclease within acidic secondary lysosomes.
- Group II ssDNA-specific nucleases comprise enzymes with prefe ⁇ ed hydrolytic activity towards single-stranded DNA including wild-type native and recombinant, chemically/genetically modified Bhl nuclease from Basidiobolus haptosporus, Mung Bean nuclease, and the like, as well as artificial nucleases, which harbor a special sequence- specific recognition domain for a single-stranded viral DNA.
- the properties of two Group II representatives: human endonuclease G and fungal Bhl nuclease are described.
- Endonuclease G a sugar-nonspecific 29 kDa enzyme displays strong hydrolytic activity towards ssDNA and ssRNA.
- the enzyme is responsible for major nuclease activity in mitochondria, and it is released from intermembrane spaces of mitochondria during apoptosis in a caspase independent fashion (Pa ⁇ ish, et al. Nature 412: 90-94, 2001; Liu, et al., Nature 412:95-99, 2001).
- EndoG has greater hydrolytic activity on single-stranded nucleic acid substrates ssDNA and ssRNA than on dsDNA (Cote and Ruiz- Carrillo, Science 261 :765-769, 1993; Ikeda, et al., Biochem Biophys. Res Comm. 235:291- 294, 1997). EndoG requires either Mg 2+ or Mn 2+ and not Ca 2+ as its divalent caption (Ruiz- Carrillo and Renaud, EMBO J. 6:401-407, 1987; Gershenson, et al. Nucleic Acid Res 23:88- 97, 1995). EndoG has biphasic pH optima for attacking dsDNA (at pH 9.0 and pH 7.0), and is inhibited about 15-fold at physiological monovalent caption strength.
- First-hit kinetics indicates that supercoiled plasmids are relaxed by a single-stranded nick produced by the action of endoG (Widlak, et al. J. Biol. Chem. 276(51):48404-48409, 2001).
- the endoG provides an important nicking function for mitochondrial DNA (mtDNA) in vivo, while mitochondrial factors such as specific membrane phospholipids, polyamines and single-stranded DNA-binding protein (SSB) have been shown to modulate the enzyme's activity and prevent cleavage at single-stranded moieties of mtDNA.
- mtDNA mitochondrial DNA
- SSB single-stranded DNA-binding protein
- Phosphatidylcholine and phosphatidylethanolamine major constituents of the mitochondrial inner membrane, have been shown to stimulate purified Endo G activity in vitro by 5- to 10-fold.
- Spermine also stimulates the enzyme activity for about 4-fold at lower concentrations of 5-100 ⁇ M, and largely inhibits the degradation of ssDNA and dsDNA at concentrations over 500 ⁇ M (Ikeda, et al. J. Biochem. Mol. Biol. Biophys. 6(1).T7-21, 2002).
- Bhl nuclease an extracellular nuclease isolated from Basidiobolus haptosporus (Basidiobolus ranarum), a fungus which belongs to the order Entomophthorales of the Zygomycetes.
- Basidiobolus ranarum Basidiobolus ranarum
- This saprophytic fungus has a world-wide distribution and can be found in intestinal contents of reptiles, amphibians, and some mammals.
- Single-strand-specific nucleases with high-selectivity towards single-stranded nucleic acids and single-stranded regions in double-stranded nucleic acids are widely distributed in microorganisms, plants and animals.
- the Bhl nuclease is a 30 kDa metalloprotein which has no obligate requirement for metal ions to be active, and it has highly prefe ⁇ ed hydrolytic activity towards single-stranded DNA versus single-stranded RNA, although as some other single-stranded-specific the enzyme at high concentrations may slowly digest double-stranded DNA. Influence of salt concentration on the ssDNase activity of nuclease Bhl showed that the activity reaches its maximum around 25-50 mM of NaCl or KC1.
- Group III dsRNA-specific nucleases comprise enzymes with prefe ⁇ ed hydrolytic activity towards double-stranded RNA.
- This group includes wild-type native and recombinant, chemically/genetically modified RNase Ill-like nucleases, as well as artificial nucleases, which harbor a special sequence-specific recognition domain for a double- stranded viral RNA. Properties Group representative nucleases mammalian RNase III and human RNase I are described.
- Mammalian RNase III nucleases belong to a super-family of double-stranded RNA-specific endoribonucleases that participate in diverse maturation and decay pathways in both eukaryotic and prokaryotic cells (Aravind et al., Methods Enzymol 341 : 3-28, 2001).
- the RNase III super-family also includes human Dicer, a multi-domain 218 kDa endonuclease responsible for processing double-stranded RNA to small interfering RNAs (siRNAs), silencing certain genes during a process of RNA interference (RNAi). It also catalyzes excision of regulatory microRNA from precursors (Provost, et al., EMBO J.
- RNase III proteins contain a signature sequence (HNERLEFLGDS; SEQ ID NO:2) and range in size between 25-55 kDa. In some species like Drosophila and Caenorhabditis elegans, the enzyme contains 2 copies of the sequence (Filippov, et al., Gene (Amst.) 245, 213-221, 2000), which may suggest that some RNase III proteins can form an active catalytic center as a monomer. Deletion and mutation of the signature sequence abolishes or reduces catalytic activity of the enzyme (Nicholson, Prog.
- Crooke encodes a 160 kDa (1374 amino acid) protein containing multiple domains involved in pre-ribosomal RNA processing (Wu, et al., J Biol Chem 275:36957-36965 (2000).
- the human RNase III domain (425 amino acids: residues 949-1374) is located at the carboxy terminus of the protein and is homologues to C. elegans, yeast and bacterial RNase III.
- Human RNase III contains proline rich (1-220 amino acids) and serine-arginine-rich (amino acids 221-470) domains near the amino terminus.
- Group IV ssRNA-specific nucleases comprise enzymes with prefe ⁇ ed hydrolytic activity towards single-stranded RNA.
- This group includes wild-type native and recombinant, chemically/genetically modified RNase A-like nucleases, as well as artificial, which harbor a special sequence-specific recognition domain for viral single-stranded RNAs. Relevant properties of Group IV representative bovine pancreatic RNase A and human pancreatic RNase I are described herein.
- RNase A hydrolyzes single-stranded RNA phosphodiester bonds, particularly those linked to pyrimidine bases such as uracil via a two-step reaction which involves two histidine residues H12 and HI 19.
- the side chains of the following residues form the active domain of the enzyme: Hisl2, Lys41, Val43, Asn44, Thr45, Hisl9, Phel20, Aspl21, Serl23 (Raines, Chem. Rev. 98:1045-1065, 1998).
- ribonuclease inhibitor is a 50 kDa protein that constitutes of about 0.01% of the protein in the cytosol of mammalian cells (Blackburn and Moore, Enzymes XV: 317-433, 1982). A group of 24 amino acid residues are involved in contact of RNase A with RI.
- RNase A is cleaved by subtilisin or protease K between Ala20 and Ser21 residues, producing enzymatically active RNase S comprising a tightly bound non-covalent complex of S-peptide (residues 1-20) and S-protein (residues 21- 124) that possesses full activity of RNase A (Richards and Vithayathil, J. Biol. Chem. 234:1459-1465, 1959).
- human pancreatic RNase I Another representative of this group is human pancreatic RNase I, which is considered to be a homolog of bovine pancreatic RNase A (Seno, et al. Biochem. Biophys. Acta 1218:466-468, 1994; Beintema, et al. Anal. Biochem. 136:48-64, 1984).
- Human RNase I shares about 70% homology with bovine RNase A and possesses similar key stmctural and catalytic residues (Weickmann, et al., Biochemistry 20:1272-1278 (1981).
- Human RNase I has six basic amino acids at positions where RNase A has instead neutral residues, in particular Arg(R)4 and Lys(K)102 are located near the binding sites for RNA.
- RNase I hydrolytic activity is differentially influenced by ionic strength and divalent ions, and compared to RNase A it has a four amino acid carboxyl-terminal extension, So ⁇ entino and Libonatti, Arch. Biochem. Biophys. 312:340-348, 1992; So ⁇ entino, et al., J. Biol. Chem. 267:14859-14865, 1992).
- RNase I is about 500 times more enzymatically active with double-stranded RNA substrate than RNase A. It has been postulated that strong local positive electrostatic potential could destabilize the double strand (So ⁇ entino and Libonatti, FEBBS Lett, 404, 1-5, 1997).
- Fully enzymatically active human RNase S can be reconstituted combining synthetic or cloned human S-peptide (residues 1-15 (SEQ ID NO: 60): Lys(K)-Glu(E)-Ser(S)-Arg(R)-Ala(A)-Lys(K) 2 -Phe(F)- QRQ-His(H)-Met(M)-Asp(D)-Ser(S) and cloned truncated human S-protein (21-124).
- the gene fragment coding for human S-peptide and human S-protein was obtained from human placental cDNA (Dubel, Tumor Targeting 4:37-46, 1999).
- Antiviral compositions derived from non-immunogenic human RNase I and human RNase S are provided herein for treatment and prevention of viral diseases caused by RNA vimses.
- potential host cells can be preventively loaded with a fairly high concentration of human S-peptide that is conjugated with a high molecular weight hydrophilic polymer such as PEG, and is targeted to receptors of the vims host cells by a special ligand e.g. folate in the case of Ebola vims, and carrying a membrane penetrating peptide such as Poly(Arg) peptide, HIV-TAT 3- , etc.
- a special ligand e.g. folate in the case of Ebola vims
- a membrane penetrating peptide such as Poly(Arg) peptide, HIV-TAT 3- , etc.
- S-peptide-PEG conjugates are characterized by prolonged half-life, strong proteolytic resistance and high cellular uptake.
- a next step is administering the human S-protein- PEG conjugate of the same molecular weight and half-life as S-peptide-PEG conjugate, and targeted by the same folate ligand and poly(Arg) peptide.
- the double-targeting technique can decrease reconstitution of fully active RNase S inside non-targeted cells, and therefore decrease side effects.
- This group further includes common and uncommon mutants of each of human RNase I, bovine RNase A and their RNases S, such mutants exhibiting lower binding affinity to RI while maintaining high enzymatic activity and low cytotoxicity comparable to those of the native RNase I, RNase A and RNase S.
- the mutants include substitutions in which at least one wild-type or natural amino acid, located in, for example, the conserved nuclease RJ-binding domain, is replaced by a non-natural amino acid, for example, an amino acid carrying a bulky neutral or a charged side chain or a keto group.
- the Rl-binding domain conserved in human RNase I and bovine RNase A, includes three amino acids, Lys(K)l, Lys(K)7 and Gln(Q)l l localized within tmncated S-peptide region (Lys(K)l-Ser(S)15), two amino acids that are localized in S-protein region Asn(N)71 and Asp(E)l l l, and ten amino acids that are within the second loop region of S-protein between two di-sulfide bonds Arg(R)85-Asn(N)94.
- Group IV ssRNA-specific uncommon mutants are exemplified by ribonuclease inhibitor (R ⁇ )-resistant and non-toxic uncommon mutants of human RNase I obtained by genetic engineering to produce the following substitutions: KlFU (keto) /Ql lA/N71A/El l lA; and human RNase S consisting of tmncated S-peptide (1-15 amino acid residues fragment) obtained by the following substitutions KlFU (ket0) /Ql lA; and truncated S-protein (residues 21-124 amino acid residues fragment) obtained by the following substitutions N71A/G89FU (keto) /El l lA, wherein FU (keto) is non- natural p-acetyl-L-phenylalanine residue carrying a keto group.
- R ⁇ ribonuclease inhibitor
- Group V hybrid-specific nucleases comprise enzymes with preferential enzymatic activity for RNA-DNA hybrids as a substrate.
- the family includes wild-type, native, and recombinant, chemically/genetically modified RNase H family of nucleases, as well as artificial nucleases, each member having a sequence-specific recognition domain for single- stranded RNA in a viral RNA-DNA hybrid.
- the Group V antiviral nucleases are represented by two classes of mammalian RNase H, type 1 and type 2 that hydrolyze the RNA strand in RNA-DNA heteroduplexes.
- RNase H enzymes have been identified in all organisms (Stein & Hausen, Science 166, 393- 395, 1969; and Cathala et al. J. Biol. Chem. 254, 7353-7361, 1979; Frank, et al., J. Biol. Chem. 379, 1407-1412, 1998; Frank, et al.
- RNase H type 1 Prior to availability of cloned genes and sequence comparisons, eukaryotic RNase H enzymes were classified by their purification characteristics into RNase H type 1 and type 2 (Busen and Hausen, Eur. J. Biochem. 52:179-190, 1975).
- RNase H type 1 requires Mg 2+ or Mn 2+ ions for activity, and remains active in the presence of sulfhydryl reagents such as n- ethyl-maleimide.
- RNase H type 2 is active only with Mg ions, and is inhibited by Mn ions and sulfhydryl reagents.
- Mammalian RNase H type 1 and type 2 enzymes have been isolated and bio-chemically characterized in various mammalian tissues including calf thymus (B ⁇ sen, J. Biol Chem. 255: 9434-9443, 1980; Vonwirth, et al., Experientia, 46(3):319-321, 1990), mouse cells (Masutani, et al., J. Biol Chem. 265: 10210-10216, 1990), HeLa cells (Kane, Biochemistry 27: 3187-3190, 1988), human erythroleukemia cells (Eder and Walder, J. Biol.
- RNase H type 2 purified to near homogeneity from human placenta has molecular weight about 33 kDa, is active in a pH range of 6.5-10 with optimum at reduced conditions pH 8.5-9, requires presence of Mg ions, and is inhibited by Mn 2+ ions and sulfhydryls such as n-ethyl-maleimide (Frank, et al., Nucleic Acids Res.22: 5247-5254, 1994).
- E. coli RNase HI belongs to RNase H type 1 (Itaya, Proc. Natl. Acad. Sci. USA 87: 8587-8591, 1990), while E. coli RNase H2 belongs to RNase H type 2 (Davis, et al., Science 252: 88-95, 1991).
- human RNase HI is homologues to E. coli RNase HI, its biochemical properties are similar to those for RNase H type 2, whereas human RNase H2 which is homologues to E. coli RNase H2, has biochemical properties similar to those of RNase H type 1.
- RNase H genes Two human RNase H genes have been cloned and expressed: RNase HI (Wu, et al., Antisense Nucleic Acid Drug Dev. 8, 53-61, 1998; US patent application 2003/0144496, July 31, 2003 to Crooke et al.), and RNase H2 (Frank, et al, Proc. Natl. Acad. Sci. U. S. A. 95, 12872-12877, 1998; Cerritelli and Crouch, Genomics 53: 307-311, 1998).
- Human RNase HI is a 286 amino acid protein expressed ubiquitously in human cells and tissues. The amino acid sequence of human RNase HI displays strong homology with RNase HI from yeast, Escherichia coli, chicken, and mouse.
- the human RNase H2 enzyme is a 299- amino acid protein with a calculated mass of 33.4 kDa and is ubiquitously expressed in human cells and tissues (Frank, et al., Proc. Natl. Acad. Sci. U. S. A. 95, 12872-12877, 1998).
- Human RNase H2 shares strong amino acid sequence homology with RNase H2 from Caenorhabditis elegans, yeast, B.subtilis and E. coli (Wu, et al., Antisense Nucleic Acid Drug Dev., 8, 53-61, 1998; Ohtani, et al. Biochemistry 38:605-618, 1999).
- Group VI non-specific nucleases comprise enzymes with non-preferential hydrolytic activity towards all nucleic acids. These include including Benzonaze ® , an endonuclease isolated from Serratia marcescens (Eaves and Jeffries J. Bact. 85: 273-278, 1963; Nestle and Roberts, J. Biol. Chem. 244: 5219-52225, 1969), nuclease CI isolated from Cunninghamella echinulata (Ho, et al., Eur. J. Biochem. 256:112-118, 1998) and the like.
- Benzonaze ® an endonuclease isolated from Serratia marcescens (Eaves and Jeffries J. Bact. 85: 273-278, 1963; Nestle and Roberts, J. Biol. Chem. 244: 5219-52225, 1969), nuclease CI isolated from Cunninghamella echinulata (Ho, et al., Eur. J. Bio
- Benzonaze ® digests nucleic acids to 5'-monophosphate terminated oligonucleotides of about 2-5 bases in length (Nestle and Roberts, J. Biol. Chem. 244: 5219-52225 1969; Janning, et al., Rapid Commun. Mass. Spectrom. 8:1035-1040, 1994). Although the nuclease is capable of cleavage at nearly all positions along a nucleic acid chain, some sequence preferences have been demonstrated (Meiss, et al., Biochemistry 34:11979-11988, 1995). The enzyme prefers GC-rich regions in dsDNA while avoiding d(A)/d(T)-tracts.
- the enzyme consists of two identical 245-amino acid subunits of 30 kDa. It is functional between pH 6-10, with optimum pH of 8-9, and from temperatures of 0 ° C to 42 ° C, with optimum at 37°C.
- the enzyme requires Mg 2+ for activation in the concentration range of 1-10 mM, with optimum at 1-2 mM.
- the activity is inhibited (approximately 75% reduction in relative activity) in the presence of high concentrations (>150 mM) of monovalent captions (Na+, K+, etc.), which is typical of physiological conditions.
- Benzonase is commercially available from Novagen, Epicentre and other suppliers.
- Nuclease CI from Cunninghamella echinulata var. echinulata degrades single- stranded and double-stranded DNA and RNA with about equal cleavage rates. When digesting nucleic acid duplexes, this enzyme recognizes one strand where cleavage takes
- the nuclease requires Mg or Mn divalent captions, and is inhibited by metal ion chelators such as EDTA.
- Enzyme activity significantly decreases below pH about 6.0.
- the enzyme shows a higher activity at higher temperatures, with optimum temperature of 55 C with Mn 2+ or 50 C with Mg 2+ (Ho, et al., Eur. J. Biochem. 256:112-118, 1998).
- Group VII artificial nucleases include enzymatic compounds with pre-designed preferential activity towards one or more forms of viral nucleic acids.
- Artificial biological or chemical nucleic acid cleaving agents that mimic the hydrolytic function of natural enzymes have been developed (Sigman et al., Chem. Rev. 93:2295-2316, 1993; Komiyama and Sumaoka, Cu ⁇ . Opin. Chem. Biol.2:751-757, 1998; Kramer, Coord. Chem. Rev. 182:243-261, 1999; Ott and Kramer, Appl. Microbiol. Biotechnol., 52:761-767, 1999; Franklin, Cu ⁇ . Opin. Chem. Biol. 5:201-208, 2001).
- Artificial nucleic acid cleaving agents include peptides and peptidomimetics . that exhibit nucleolytic activity, and chemical nucleases having hydrolytic activity such as lanthanide-ion complexes (Wan, et al. Chin. Sci. Bull. 45(22): 2017-2028, 2000; Sigman et al., Chem. Rev. 93:2295-2316, 1993).
- Synthetic polymers have been used as backbones of artificial nucleases.
- the artificial metallonuclease was obtained by random attachment of Cu(II) complex of Cys to cross- linked polystyrenes (Jung, et al. J. Am. Chem. Soc. 120:12008-12016, 1998; Suh, Ace. Chem. Res. 36:562-570, 2003). Fully-synthetic molecules have been also designed as nuclease mimics by either using peptidic or non-peptidic backbones.
- a short peptide capable of hydrolytic cleavage activity with multiple categories of natural substrates including nucleic acids and proteins is Ser-His (Li, et al., Bioorganic & Medicinal Chemistry 8(12): 2675-2680, 2000).
- Seryl-histidine (S-H) di-peptide and seryl- histidine-aspartate (S-H-D) tri-peptide can non-specifically cleave molecules of single- stranded or double-stranded DNA and RNA that are linear, circular or super-coiled, and therefore can be applied to prevention and treatment of viral diseases.
- a catalytic group from a natural enzyme active site or from another peptide-based entity with similar catalytic properties may be chosen as the active group of the artificial nuclease.
- mimics of RNase A that digest ssRNA can be obtained by coupling two or four imidazole groups (Breslow and Labelle, J. Am. Chem. Soc. 108(10):2625, 1986; Breslow, Ace. Chem. Res. 24(11): 317, 1991) with nucleic acid intercalators such as acridine (Lorente, et al. Tetrahedron Letters 37(25):4417, 1996).
- Ribozyme mimics carrying oligonucleotides complementary to the selected site can carry out site-directed RNA scission (Ciesiolka et al., Eur. J., Bioch.204, 575- 581, 1992).
- Artificial nucleases can be designed as polypeptides comprising two domains: a nucleic acid-binding domain and a metal-binding domain.
- the nucleic acid-binding domain may be any amino acid sequence that specifically binds to a nucleic acid sequence, e.g. a sequence present in a viral dsDNA, ssDNA, dsRNA, ssRNA, RNA-DNA hybrid, B-DNA, A-DNA, or the like.
- the metal binding domain may be located within the nucleic acid- binding domain, and binds any metal such as Ca(II), Eu(II), Zn(II), Cr(IV), Cd(II), Ce(III), Fe(III), Co(III), Cu(II) and preferably binds a hydrolytic metal such as a lanthanide.
- the hydrolytic polypeptides may comprise the following amino acid sequences: TERRRQQLDKDGDGTIDEREIKIHFQNKRAKIK (SEQ ID NO: 4),
- TERRRFDKDQNGYIGAADLRHVKIWFQNKRAKIK SEQ ID NO: 5
- TERRRFRVFDKDGNGYISAAEKIWFQNKEAKIK SEQ ID NO: 6
- TRRRRFSLFDKDGDGTITTKEEVWFQNRRMKWK SEQ ID NO: 7
- DEKRPRTAFSGEQLARLKREFNENRYLTERRRLRVFDKDGNGFISAAEKIWFQNKR- AKIKKST SEQ ID NO: 8
- a catalytically active portions of these polypeptides thereof US patent application No. 2002/0146788 to Franklin, inco ⁇ orated here by reference in its
- a Zn -binding peptide PI Asp-Pro- Asp-Glu-Leu-Glu-His-Ala-Ala-Lys-His-Glu- Ala-Ala-Ala-Lys-CONH 2 (SEQ ID NO: 9), tethered to DNA-intercalating rhodium complex has been shown to hydrolytically digest plasmid DNA and oligonucleotide substrates (Copeland, et al., Biochemistry 41:343-356, 2002; Fitzsimmons and Barton, J. Am. Chem. Soc. 119: 3379-3380, 1997).
- Chemical nucleases and other artificial nucleic acid cleaving agents based on metal complexes can be further divided in two main groups according to their mechanisms of action: free radical or oxidative cleavage or phosphodiester bond hydrolysis.
- Some free radical cleavage agents such as EDTA-Fe 2+ , Cu(phen) 2 + and other transition metal based compounds abstract hydrogen atoms with hydroxyl radicals generated through a Fenton reaction with hydrogen peroxide (Wan et al., Chin. Sci. Bull., 45:2017-2028 (2000).
- Some artificial nucleases possess specific hydrolytic activity towards a particular form of DNA and/or RNA.
- the free radical cleavage activity of Cu(phen) 2 + has specificity towards right- handed double-stranded B-DNA, and is about 6-7-times less reactive towards a wider and flatter helix of double-stranded A-DNA, about 50-times less reactive towards left-handed double-stranded Z-DNA compared to B-DNA, and has little reactivity towards single- stranded DNA (Kuwabara, et al., Biochemistry, 25(23):7401 (1986).
- the compound is also active against single-stranded RNA, but has no reactivity on double-stranded RNA (Murakawa, et al. Nucleic Acid Res. 17(130):5361, 1989).
- nucleic acid cleaving agents that catalyze phosphodiester bond hydrolysis rather than employ an oxidative mechanism are more desirable for clinical applications. Hydrolytic cleavage does not require redox-active co- reactants, and results in strand ends that cannot be relegated by enzymes. Furthermore, oxidative action produces highly-reactive and diffusible free radicals and metal oxenes (Sigman et al., Chem. Rev. 93:2295-2316, 1993). However, while chemical nucleases such as metal-ion complexes have potential cytotoxicity, these may have practical applications in treatment of viral infections in wild animals, birds, insects and plants.
- RNA nearly 100,000-fold times more reactive towards hydrolysis than DNA
- a complementary DNA oligonucleotide can be used to target site-specific cleavage of viral RNA (Thompson, et al. Biorg. Chem. 23: 471-481, 1995).
- Both oxidative (Zheng, et al., J. Am. Chem. Soc. 118:2320-2325, 1996) and hydrolytic (Brown et al., Nature 303: 543-546, 1983) cleavage agents are generally less reactive towards double- stranded RNA compared to single-stranded RNA.
- Duplex RNA adopts an A-type of double-helix which has much deeper and na ⁇ ower major groove than B-DNA, and as a result many agents that bind to double- stranded DNA can not bind to dsRNA. Further, duplex RNA is less flexible that single- stranded RNA, hence hydrolysis of 2'-OH may be inhibited, due to orientation of the substrate (Kolasa, et al. Inorg. Chem. 32: 3983-84, 1993).
- transition metal complexes such as Cu([9]aneN 3 )Cl 2 are effective in cleaving both ssRNA and dsRNA (Hegg, et al, Inorg. Chem. 36:1715-1718, 1997).
- a complex of Cu([9]aneN 3 )Cl 2 attached to a flexible bi-functional PEG equipped with viral nucleic acid targeting oligomers can be used for cleavage of viral double-stranded RNA.
- Oligonucleotide-bound Fe(III)/EDTA complexes can selectively hydrolyze RNA molecules (Brown et al., Nature, 303, 543-546, 1985).
- RNA hydrolysis has been shown with acridine-tethered oligonucleotides, which interact with the RNA and activate the target phosphodiester linkages (Ciesolka et al., Eur. J. Biochem 204, 583-589, 1992). Bulge sites in RNA, formed by acridine-bearing oligonucleotides, are then preferentially hydrolyzed by unbound lanthanide complexes (Kuzuya, et al. J. Am. Chem. Soc.
- Cerium Ce(IV)-ion is a lanthanide that can access a tetravalent oxidation state under aqueous conditions.
- the Ce(IV) is among the most effective metal ions for double- stranded DNA hydrolysis, providing DNA hydrolysis rates of 20-1000-times faster than Ln(III) ions (Komiayma, Che. Comm: 1443-1451, 1999).
- Site selective preferential hydrolysis of double-stranded DNA has been achieved due to substantially greater substrate specificity of Ce(IV)/EDTA complex for single-stranded DNA.
- the native and/or modified nucleases of animal, insect, bacterial or plant origin, as well as artificial nucleases described herein have an antiviral activity due to hydrolytic digestion of nucleic acid, and can be directed towards a specific form of a virion nucleic acid or towards an intermediate viral nucleic acid appearing in the course of viral replication, for the animal, bacterial, insect and plant vimses described herein.
- this invention provides antiviral nucleases that are chemically/genetically modified to contain non-natural amino acids.
- a semi-synthetic approach has been used to site-specifically inco ⁇ orate non-natural amino acids into proteins.
- segments of proteins are synthesized by solid phase peptide synthesis and the segments are either chemically (Dawson, et al. Science 266, 776-779, 1994) or enzymatically (Southworth, et al. BioTechniques 27:110-120, 1999) ligated.
- EPL Expressed protein ligation
- EPL involves ligation of a thioester-modified C-terminal of a recombinant protein to an N-terminal cysteine of a synthetic peptide and therefore is limited to inco ⁇ oration of non-natural amino acids into a C-terminus of the recombinant protein.
- a biosynthetic in vitro method based on amber codon suppression has been developed allowing site-specific inco ⁇ oration of non-natural amino acids into proteins (Noren, et al. Science 244:182-188, 1989; Bain, et al., J. Am. Chem. Soc. 11 :8013-8014, 1989).
- This technique involves amber suppressor aminoacyl-tRNA that is chemically modified with a desired non-natural amino acid residue, wherein the resulting aa u -tRNA is then added in vitro together with mRNA and DNA containing a gene of interest having an amber stop codon (UAG) at the desired site.
- UAG amber stop codon
- this technique allows inco ⁇ oration of only one kind of non-natural amino acid into the protein of interest.
- a ketone handle-containing amino acid has been site-specifically inco ⁇ orated into proteins in vitro and subsequently modified with small molecule fluorophore and biotin derivative (Wang, et al., Proc. Nat. Ac. Sci. USA 100(1):56-61, 2003; Comish, et al., J. Am. Chem. Soc. 118:8150-8151, 1996).
- the reactive thiol group of cysteine has been used extensively for protein modification, including attachment of folic acid to RNase A (US patent 6,280,991 to Raines, 2001), attachment of multi-charged moieties to proteases (US patent application 2002/0127695 to Davies, et al., 2002), and attachment of various biophysical probes (Gaietta, et al., Science 296:503-507, 2000).
- the site selective reaction with a cysteine residue is often complicated by presence of more than one reactive cysteine residue in a protein, as well as exchange reactions in the presence of free thiol when a disulfide linkage is formed. Therefore, the availability of a non-natural amino acid with orthogonal reactivity allows for site-selective modification of a protein, when a single cysteine can not be site-selectively modified or when two different site-specific modifications are required.
- a technology that allows site-specific insertion of two different non-natural amino acids has been the use of an mRNA having a four base codon, in combination with a chemically aminoacylated mutant tRNA with a cognate four base anticodon (Moore, et al., J. Mol. Biol. 298:195-209, 2000).
- This approach allowed insertion of two different non- natural amino acids into a protein (Hohsaka, et al., J. Amer Chem Soc 121 : 12194-12195, 1999; Hohsaka and Sisido, Cu ⁇ . Opin Chem Biol 6:809-815, 2002).
- Biosynthetic methods in vivo can enable protein modification with non-natural amino acids.
- An expanded genetic code (EGC) technique allows insertion of genetically encoded non-natural amino acids both in eukaryotes such as Saccharomyces cerevisiae (Chin et al, Science, 301 :964-967, 2003), and prokaryotes such as E. coli (Wang, et al. Science 292:498, 2001; Doring et al., Science 292:501-504, 2001).
- the EGC technique involves generation of a novel suppressor tRNA-codon pair and an aminoacyl-tRNA synthetase (aaRS) that inco ⁇ orates a non-natural amino acid.
- the new tRNA and aaRS should be orthogonal to the endogenous tRNA and aaRS in the cell to avoid cross aminoacylation, and they should function efficiently with the translational apparatus (Wang and Shultz, Chem. Comm. 1, 2002).
- the chosen orthogonal pair was the amber suppressor tyrosyl-tRNA Synthetase (Tyr-RS)/tRNAcuA pair from E. coli.
- E. coli Tyr-RS efficiently aminoacylates E. coli tRNAcu A , when both are encoded in S. cerevisae, but this pair not aminoacylate S. cerevisae cytoplasmic tRNAs.
- E. coli tyrosyl IRNA CUA is a poor substrate for S. cerevisae aminoacyl-tRNA synthetases, and it functions efficiently in protein translation in S. cerevisae (Edwards, et al. Proc. Nat. Ac Sci. USA 88:1153, 1991).
- E. coli does not have an editing mechanism and therefore does not proofread an non-natural amino acid ligated to tRNA.
- Tyr-RS amino acid specificity so it aminoacylates E. coli tRNAcu A with a desired non-natural amino acid, for example, p-acetyl-L-phenylalanine with the keto handle and none of the endogenous amino acids Tyr-RS have been mutated and grown in the presence of 1 mM of p-acetyl-L-phenylalanine residue.
- Tyr-RS was selected with higher activity for p-acetyl-L-phenylalanine than for natural amino acids.
- Encoding of non-natural amino acids into the nucleases as described herein makes it possible to tailor changes in antiviral nucleases in live mammalian cells, and therefore antiviral properties of genetically modified nucleases such as their hydrolytic activity towards viral nucleic acids under the presence of nuclease inhibitors can function directly in vivo.
- An important factor affecting catalytic activity of enzymes is distant or long-range electrostatic interactions between the enzyme and its substrate. Such interactions between the charged amino acid residues of the nuclease and its protein inhibitor, or between the nuclease and the charged backbone of its substrate, may take place before the physical contact is made or when the charged moieties that do not make physical contact due to some steric hindrance. Increased local electrostatic attraction of "cationized" human DNase I (having mutations that cause a charge change of +5) toward negatively charged phosphates on the viral DNA backbone makes the genetically modified enzyme effective in binding to viral DNA. Such binding occur even at low concentrations of viral DNA in blood or in infected cells.
- HBV DNA is below 33 ng/mL. Peak concentration of HBV DNA is comparable with the lower limit of typical concentrations of endogenous cellular DNA in a human, ranging from 25 ng/ml to 250 ng/ml (Pan, et al., J. Biol. Chem. 273, No 29: 18374-381, 1998).
- Embodiments of the invention provide antiviral compositions having genetically enhanced nucleases produced by genetic encoding techniques in vivo, and/or semi-synthesis in vitro as described above.
- the modified nucleases contain non-natural amino acids, such as multi-charged lysine having a more positively charged and bulky side chain group than natural lysine (Bioorg. & Med. Chem.
- the genetically enhanced nucleases of Group I dsDNA-specific nucleases are exemplified by hyper-active actin-resistant uncommon mutant variant of human DNase I obtained by the following substitutions Ql lR/E13KU (2+) /N74KU (2+) /A114FU ( eto)(+5) with additional five positive charges compared to native DNase I, wherein KU (2+) is non-natural lysine with two positively charged side-chain amine groups and FU ( eto) is non-natural p- acetyl-L-phenylalanine residue carrying the keto group.
- the genetically enhanced Group IV ssRNA-specific nucleases are exemplified by ribonuclease inhibitor (R ⁇ )-resistant and non-toxic uncommon mutants of human RNase I obtained by the following substitutions KlFU ( eto) /Ql lA/N71A El l lA; and human RNase S consisting of truncated S-peptide (1-15 amino acid residues fragment) obtained by the following substitutions KlFU ( eto) /Ql lA; and truncated S-protein (residues 21-124 amino acid residues fragment) obtained by the following substitutions N71A/G89FU (keto) /El l lA, wherein FU (ke 0 is non-natural p-acetyl-L-phenylalanine residue carrying the keto group.
- R ⁇ ribonuclease inhibitor
- the chemical/genetic modifications of antiviral nucleases comprise semi-synthetic nucleases obtained via either native chemical ligation wherein a chemically-synthesized peptide is ligated to another peptide or protein with use of C-terminal thioester and N-terminal cysteine residue (Dawson, et al., Science 266:776-779, 1994), or via intein-mediated protein ligation, which requires a cysteine residue at the ligation site (Evans, et al. Protein Sci.
- this invention provides the synthesized hydrolytic oligopeptides such as dipeptides: Ser-His, His-Asp, Cys-His; tripeptides: Ser-His-Asp, Ser- His-Gly, Ser-His-His, His-Phe-Asp and His-Lys-His; tetrapeptide: Glu-His-Asp-His hexapeptides: Gly-Phe-Ser-Leu-His-Ala (SEQ ID NO: 10), Phe-Ser-Phe-Leu-His-Ala (SEQ ID NO: 11), and Ser-Ser-Phe-Leu-His-Ala (SEQ ID NO: 12); octapeptides: Arg-Arg-T ⁇ - His-Arg-Leu-Lys-Glu (SEQ ID NO: 13) undecapeptides: Ser-Gly-Gly-His-Gly-Gly-Arg-
- the invention provides multiple natural or modified di/tri peptides, hexapeptides and undecapeptides covalently attached to a large molecular mass polymeric ca ⁇ ier targeted to unprotected viral nucleic acids inside infected cells.
- antiviral complexes with enzymes ACE are characterized by enhanced therapeutic efficacy, strong proteolytic resistance, long half-life, low immunogenicity and high cellular uptake.
- the conjugation of an antiviral nuclease to a polymeric carrier can be accomplished via one or more of multiple routes known in the art of protein chemistry.
- the polymeric carriers of this invention comprise a single or a plurality of molecular scaffolds upon which one or more antiviral nucleases and various targeting moieties may be attached.
- Exemplary polymeric carriers include poly(ethylene glycol) (PEG), HPMA (Poly- [N-2(2-hydroxypropyl) methacrylamide]); carboxymethylcellulose; dextran; polyvinyl alcohol; polyvinyl py ⁇ olidone; poly-l,3-dioxolane; poly-l,3,6-trioxane; polypropylene oxide; poly(ethylene/propylene glycol); an ethylene/maleic anhydride copolymer; a polypropylene oxide/ethylene oxide copolymer; a polyethylene glyco/thiomalic acid copolymer; derivatives of PEG such as PEG-[NH2] n ; copolymers such as [PEG-Lys] n , PEG- PEI, PAMAM, PAMAM(EDA); and poly(
- the prefe ⁇ ed polymeric carriers of compositions provided herein are PEG and PEG- derivatives, PAMAM dendrimers and their derivatives, and any combinations thereof having a total molecular weight below 200 kDa.
- Proteins conjugated to PEG and PEG- derivatives were found to have enhanced proteolytic resistance, markedly improved circulating half-life as a result of increased hydrodynamic radius of the protein-polymer conjugate, reduced antigenicity, immunogenicity and toxicity, improved solubility, thermal and mechanical stability (Chapman, Adv Dmg Del Rev 54:531-545, 2002); Harris, Ed., Poly(Ethylene Glycol) Chemistry: Biotechnical and Biomedical Applications, Plenum Press, NY, 1991).
- a method of attaching a protein to a polymeric ca ⁇ ier is via the nonselective conversion of one or more of the ⁇ -amino group of lysine, the ring amine group of histidine, or the ⁇ -amino group of N-terminus residues of the protein into amides with the subsequent loss of positive charges (Abuchovsky et al., J. Biol. Chem. 252: 3571-3581 & 3582-3586, 1977; Ha ⁇ is (Ed.), Poly(Ethylene Glycol) Chemistry: Biotechnical and Biomedical Applications, Plenum Press, NY, 1991; Zalipsky, Bioconj. Chem. 6:150-165, 1995; Francis et al., Int. J.
- site-specific attachment of polymer to protein leads to more predictable and generally higher level of the biological activity of the protein in protein-polymer complexes.
- Cysteine occurs less frequently in proteins than lysine, about 1.7% versus 5.7% of all residues, and is mostly confined in unreactive double-sulfide bonds.
- a single cysteine introduced into protein by site-specific mutagenesis can be derivatized by thiol-specific maleimide-based or haloacetamide-based reagents (Goodson et al., Biotechnology 8, 343-346, 1990; Chikoti et al., Bioconjugate Chem.
- An alternative strategy involves attaching polymers at N-terminal amino acid residues of protein. Examples include selective oxidation of N-terminal serine or theronine to the co ⁇ esponding aldehyde and subsequent coupling with hydrazine, alkoxyamine or hydrazide derivatives (Geoghegan and Strogh, Bioconjugate Chem. 3, 138-146, 1992).
- PEG carrying a single aldehyde group has been attached to recombinant human G-CSF, a protein used to treat hematopoietic disorders, and to human leukocyte interferon commonly refe ⁇ ed to as consensus interferon IFN-con (US patent application 2003/0096400 to Kinstler May 22, 2003).
- the reaction included reducing alkylation conditions at acidic pH 4.0 to selectively activate the ⁇ -amino group at the protein amino-terminus.
- G-CSF with 6 kda PEG attached to its N-terminus retains 68% of activity in vitro, while the same protein having PEG non-selectively attached to both lysine and N- terminal amines retained only 21% of its activity.
- N-terminal modification differ from protein to protein, thus IFN-con with 12 kDa PEG covalently attached to its N- terminus has been shown to retain only 20% of in vitro activity (US patent application 2003/0096400 to Kinstler May 22, 2003).
- Hetero-bi-functional PEG derivatives such as ⁇ -N-hydroxysuccinimidyl ester-PEG- propionaldehyde (NHS-PEG-CHO), as well as multivalent polymeric carriers can be used to link the antiviral nucleases of the present invention to various dmg delivery enhancement ligands.
- the NHS groups can be conjugated to ⁇ -amino groups of lysine- terminated ligand under mild alkaline conditions, at a pH of about 8.0, while CHO group can be conjugated to ⁇ -amino groups at nuclease N-termini at acidic pH of about 5.0.
- a ⁇ -peptide a 40-43 amino acid proteolytic fragment of the ⁇ -Amyloid precursor protein, has been coupled with 3 kDa PEG through its C-terminus using standard Fmoc protocols on PAP Tenta-Gel (Burkoth et al., J. Am. Chem. Soc.120:7655-7656, 1998; Bayer and Rapp in Poly(Ethylene Glycol) Chemistry: Biotechnical and Biomedical Applications, M. Harris Rd, Plenum Press, NY pp. 325-345, 1992).
- hGRF Human growth hormone-releasing factor
- C-terminal modification of genetically modified nuclease with (Gly) ceremoni-Cys extension at its C-terminus was ca ⁇ ied out using S-cyanocysteine (Cys-CN) conversion chemistry.
- the genetically modified human RNase I with added peptide (Gly) m -Cys, with m of about 2-4 at its C-terminus was covalently attached to amino- group terminated PEG immobilized on a solid resin.
- the amino-group carrying polymers can include multi-armed branched R-[PEG-NH 2 ] n , [PEG-Lys] n , NH -terminated dendrimers, PEI-PEG copolymers and other polymers.
- the reaction involves cleavage at cysteine residue at the C-terminal. Conversion of free cysteine residues in proteins to residues of S-cyanocysteine (Cys-CN) can be accomplished under mild conditions using the reagent 2-nitro-5-thiocyanobenzoic acid (NTCB; Takenawa, et al. J. Biochem. 123:1137- 1144, 1998; Jacobson, et al., J. Biol. Chem. 248(19):6583-6591, 1973; Degani and Patchomik, J. Org. Chem. 36:2727, 1971).
- NTCB 2-nitro-5-thiocyanobenzoic acid
- the invention provides antiviral nucleases that are genetically modified by having N or/and C-terminal of the nuclease, fused to human albumin (HA) to prepare a human albumin fusion antiviral nuclease, such that a human albumin fusion antiviral nuclease may be also produced by inserting an antiviral nuclease into an internal region of HA. Fusion of antiviral nucleases such as human DNase I, DNase- ⁇ , DNase- ⁇ , DNase- ⁇ , human RNase I, human RNase III, etc. can be ca ⁇ ied out using the method of US patent application No.
- antiviral compositions provided herein are native and/or chemically/genetically enhanced antiviral nucleases covalently associated with hetero-bi- functional polymers, the hetero-bi-functional polymers associated directly or through multivalent molecular scaffolds such as dendrimers or star polymers with multiple targeting ligands of various functions.
- the invention in other embodiments provides "shell-core” complexes of multivalent molecular scaffolds, and a method of making such complexes.
- the terminal groups of the multivalent molecular "shelf-scaffolds exemplified by PAMAM dendrimers are chemically modified to include sequence-specific oligonucleotides, which undergo Watson- Crick hybridization and subsequent covalent bond formation with complementary that are oligonucleotides that are associated with a similarly-modified "core”dendrimer.
- each complementary base-paired oligo- or polydeoxynucleotides can be carried out by the use of bifunctional reagents exemplified but not limited to heterofunctional polyalkylating agent N,N,N'-tri-( ⁇ -chloroethyl)-N'-(p- formylphenyl)propylene diamine-1,3.
- the reagent is attached to the oligo- or polydeoxynucleotide through a highly reactive aliphatic ⁇ -chloroethylamino group.
- the reactivity of the potentially active aromatic alkylating group is strongly inhibited by a neighboring formyl residue.
- LNA Locked Nucleic Acids
- the targeting ligands may comprise modified oligomers that are sequence-specific for a viral nucleic acid target sequence, and may further comprise one or more of: peptide nucleic acids (PNA) including bis-PNA; locked or bridged nucleic acids (LNA/BNA) capable of forming stable duplexes with single-stranded and double-stranded DNA and RNA, phosphoroamidate oligonucleotides that are sequence-specific binding for viral double-stranded and single-stranded viral DNA and RNA; mo ⁇ holino oligonucleotides with mo ⁇ holino nucleosides; linked together by phosphorodiamidate groups which form stable sequence specific complexes with ssRNA, S-DNA (phosphorothioate); py ⁇ olidine- amide oligonucleotide mimic POM with very high affinity to complementary ssRNA and ssDNA while exhibiting kinetic binding specificity for RNA over DNA and other oligomers; hai ⁇
- HypNA hydroxyproline peptide nucleic acids
- SerNA serine peptide nucleic acid
- oligonucleotide analogs including their monomers, homodimers, heterodimers and homopolymers and heteropolymers of these and other oligonucleotide analogs shown for example in the US patent application 2003/0059789 March 27, 2003 to Efimov, et. al.
- Standard bases such as adenine, thymine, uracil, cytosine and guanine and rare natural and synthetic bases such as dihydrouracil, 4-thiouracil, pseudouracil, hypoxanthine, wybutosine, 5'-uracil, 5-methylcytosine, 5-methyladenine, 2'-O-methylcytosine, 1-N- methyladenosine, 2,2-N-dimethylguanine, 7-methylguanine, and like being attached to ribose or to deoxyribose or to 2 '-4 '-cyclic ribose, or to other derivatives of pentoses or like, can be used to form nucleosides are when phosphorylated to form nucleotides.
- Oligo- and polynucleotides composed from nucleotides containing pentose 2-O-4'-C-methylene bridge form locked or bridged nucleic acids (LNA/BNA; Petersen and Wengel, Trends in Biochem. 21, 74-81, 2003).
- the 2-O-4'-C-ethylene-bridged nucleic acids (ENA) are particularly strongly base paired to the complementary nucleotide sequences of RNA and DNA (Koizumi et al., Nucleic Acids Res. 31, 3267-3273, 2003).
- PNA, LNA/BNA, ENA, phosphorothioate and phosphoramidate oligo- and polynucleotides are resistant to nucleases.
- Targeting ligands comprising nuclease-resistant oligonucleotides that are complementary in nucleotide sequence to the selected nucleotide sequences of viral single-stranded or double- stranded DNA or RNA can function in compositions to target, i.e., can direct nucleases or nuclease-polymer complexes to viral nucleic acids inside vims infected cells.
- the sequence specific oligomers exhibit their own antiviral action via multiple pathways.
- antisense phosphorothioate oligonucleotides were shown to block the proliferation of HIV-1 in acutely infected cells in a non-sequence-specific manner (Matsukura, et al., Proc. Nat. Ac. Sci., USA 84: 7706-10, 1987), most likely by the inhibition of the reverse transcriptase (RT) (Bioziau, et al., Proc. Nat. Ac. Sci., USA 89: 768-72, 1992; Majumdar et al, Biochem 28: 1340-6, 1989).
- RT reverse transcriptase
- Phosphorothioate-containing oligonucleotides have been shown to inhibit avian myeloblastosis vims (AMV) RT, Pol I (Klenow fragment), human polymerases ⁇ , ⁇ , and ⁇ (Marshall, et al., Proc. Nat. Ac. Sci., USA 89: 6265-6269, 1992; Gao, et al., J. Biol. Chem. 264: 11521-11526, 1989), and human DNA polymerases and RNase H (Gao, et al., Mol. Pharmac. 41 : 223-229, 1992).
- AMV avian myeloblastosis vims
- Pol I Klenow fragment
- human polymerases ⁇ , ⁇ , and ⁇ Marshall, et al., Proc. Nat. Ac. Sci., USA 89: 6265-6269, 1992; Gao, et al., J. Biol. Che
- G-rich oligonucleotides can interfere with the gpl20/CD4 interaction or HIV integrase activity (Jing, Expert Opin. Investigate. Drugs 9: 1777-1785, 2000). These oligomers form tetramers stabilized by G-quartets, which leading to anti-HIV-1 activity (Jing, et al., J. Biol. Chem. 275, 3421-30, 2000).
- the targeting ligands for antiviral nuclease-derived compositions provided herein include membrane permeating peptides (MPP) to facilitate intracellular delivery of the macromolecular nuclease and nuclease-polymer complexes.
- MPP membrane permeating peptides
- the poly(Arginine) based MPP has been proposed as a dmg carrier enhancing delivery of various compounds across epithelial tissues, including the skin, gastrointestinal tract, pulmonary epithelium, and the like (US patent 2003/0083256 of May 2003 to Rothbard, et al.).
- MPPs have been used as ca ⁇ ier molecules for intracellular delivery of various exogenous molecules, such as from small bioctive molecules with low membrane permeability, such as cyclosporin A (Rothbard et al., Nat. Med. 6:1253-1257, 2000) and oligoDNAs (Astriab-Fisher et al, Biochem. Pharmacal. 60:83-90, 2000), and proteins having a molecular mass up to 120 KDa (Schwartz, et al., Science, 285:1569-1572, 1999), 45 nm diameter magnetic beads (Lewin, et al. Nat. Biotechnol.
- MPP examples include but not limted to poly(Arg Lys) peptides, Arg-rich peptides derived from HIV-TAT, Antennapedia, ETA, nuclear localization export signals (NLS/NES) such as: HIV TAT 47-57 : YGRKKRPQRRR (SEQ ID NO: 17); Drosophila Antennapedia (ANTp 16): RQIKIWFQNRRMKWKK (SEQ ID NO: 18); W/R: RRWRRWWRRWRRWRR (SEQ ID NO: 19), AlkCWK ⁇ 8 : CWK, 8 (SEQ ID NO: 20); Di-CWK 18 : K, 8 WCCWK ⁇ 8 (SEQ ID NO: 21); Transports: WTLNSAGYLLGKTNLK
- PNA-PEG-conjugates PNA-PEG-R8, PNA-PEG-D SH and PNA-PEG-DSPE are prepared and tested for uptake into human cells, by being added directly to the cell culture medium. HeLa cells grown on cover slips are incubated with 5 ⁇ M of each PNA-PEG- conjugate in serum-free medium overnight, and are then fixed and examined by fluorescence microscopy. All three compounds, PNA-PEG-D S H, PNA-PEG-R8 and PNA- PEG-DSPE were shown to be distributed within the cytoplasm but not in the nucleus. These results indicate that cellular uptake of conjugates containing MPP such as R8 may still involve the endocytotic pathway.
- the targeting ligands for antiviral nuclease-derived compositions herein may further comprise cell surface receptor recognizing ligands (T-CSR) exhibiting high-binding affinity to host cell surface receptors (CSR) expressed by a particular vims host cell.
- T-CSR are exemplified by an 8-amino acid T-peptide (ASTTTNYT; SEQ ID NO: 1) and other short synthetic peptides derived from envelope protein gpl20 of HIV-I and from other viral proteins, having partial amino acid sequence homology with the HIV gpl20 fragment (residues 414-434), targeting primary host T-cells containing CD4 receptor (Chersi et. al., Viral. Immunol.
- vims specific T-CSR is a peptide containing positively- charged sequences of human papillomavirus type 16 capsid proteins.
- Such peptides synthesized to contain heparin and DNA-binding sequences can serve as transfection agents for dmg delivery into the cytoplasm of target cells via the heparan sulfate receptor, and once inside the cell nucleus can act as nuclear localization factors (NLS) (Bousarghin, et al. J. Gen. Virol. 84:157-164, 2003).
- NLS nuclear localization factors
- T-CSR mannose-6- phopshate
- M-6-P mannose-6- phopshate
- CD-MPR 46 kDa cation-dependent MPR
- IGF-II insulin-like growth factor-II receptor
- the CI-MPR extracytoplasmic domain contains two distinct M-6-P-binding sites and a single IGF-H-binding site, whereas the CD-MPR contains a single M-6-P-binding site and does not bind IGF-II (Ghosh, et al., Nature 4:202-212, 2003). Both receptors are present on cell membrane as non-covalent dimmers allowing for high -affinity binding of ligands that are multivalent for M-6-P residues (Byrd, et al., J. Biol. Chem. 275:18638-18656, 2000).
- He ⁇ es simplex vims contains glycoprotein D (gD) modified with mannose-6-phosphate, which actively binds to both CI-MPR and CD- MPR. HSV uses distinct cell surface receptors in a sequential fashion to enter cells. The vims initially adsorbs onto heparan and chondroitin sulfate glycosaminoglycans GAGs, which are numerous components of cell membrane (Shieh, et al., J. Cell. Biol. 116:1273- 1281, 1992; Leduc, et al, Abstract C-90 of the 18 th Intern.
- MPR MPR which facilitate HSV entry into the cells
- MPRs found on the cell surface almost exclusively in the clathrin-coated pits have been also shown to bind extracellular lysosomal enzymes as well as human DNase I and direct them to endosomes and lysosomes (Oliveri, et al., Eur. J. Immunol. 34:273-279, 2004; Ghosh, et al., Nature 4:202-212, 2003).
- T-CSR is folic acid targeting folate receptor- ⁇ (FR- ⁇ ), which has been identified as a significant co-factor for cellular entry of ssRNA Filovimses such as Marburg (MBG) and Ebola (EBO; Chan, et al., Cell 106:117-126, 2001).
- ssRNA Filovimses such as Marburg (MBG) and Ebola (EBO; Chan, et al., Cell 106:117-126, 2001.
- influenza vims infection which is initiated by interactions between viral hemagglutinin protein and sialic acid containing cell receptors (Mochalova, et al. Virology 313 (2):473-480, 2003).
- Synthetic peptides containing sialic-acid binding sequences may serve as targeting ligands, directing an antiviral nuclease to vims host cells.
- Carbohydrate- protein specificity of interaction are at least equivalent to or exceed that of many other ligand binding systems. See for example, reviews of carbohydrate ligands for targeted delivery of therapeutics (Davis et al., Cu ⁇ . Opin. Dmg. Disc. & Dev. 5(2):279-288, 2002; Rihova, Adv. Dmg Deliv. Rev. 29: 273-289, 1998; and Yamazaki, et al., Adv. Dmg Deliv Rev. 43:225-244, 2000). Such interactions include both proteins and polypeptides (Opanasopit, et al. Am J.
- the targeting ligands ca ⁇ ied by polymeric carriers may also comprise one or more of various cell surface receptors (CSR) themselves with specific binding affinity to viral glycoproteins expressed on the membrane of infected cells such as T4 cell receptor CD4, co-receptors CCR5 and CXCR4, having affinity to HIV glycoprotein gpl20 CSR, and which are expressed on HIV infected cell membranes and on others (EBO).
- CSR cell surface receptors
- FR- ⁇ can be used for targeting a cell infected with Marburg (MBG) or Ebola (EBO) vims.
- In vitro resistance can be observed in all vimses against all existing therapeutic agents by a straightforward procedure well know to the skilled artisan ofgrowing the vims in medium with progressively increasing concentrations of the respective antiviral agent.
- Vimses resistant to antiviral therapeutics have also been isolated from both treated and newly infected patients.
- Mechanisms of viral resistance include point mutations, recombination and gene amplification. Mutations in viral RNA genomes occur with higher frequency than mutations in genomes of DNA vimses because RNA polymerase, unlike DNA polymerase, does not have a proof reading mechanism.
- the reverse transcriptase of HIV-I makes on average 1 e ⁇ or per 10 000 bases copied resulting in daily production in a single infected individual of about 10 billion single-point mutants of viral RNA. Additional genetic variations are is produced by the recombining of the genomes of vimses of different strains. This may occur when two vimses of different strains simultaneously infect the same cell and segments of their transcribed genes are recombined into the progeny virus genome.
- High level resistance to a single dmg may be confe ⁇ ed by a single mutation.
- mono-therapy of HIV-I infected individuals with lamivudine or nevirapine results in development of high-grade resistance within about one month of treatment.
- some other antiviral dmgs the resistance development is more complex requiring the accumulation of three or more mutations.
- anti-HIV dmgs such as zidovudine and some protease inhibitors
- a mutation confe ⁇ ing resistance to one dmg may even re-sensitize the vims to another antiviral dmg.
- a mutation at RT position 184 of HIV-I RNA confers high grade resistance to lamivudine, but at the same time re-sensitizes the vims to zidovudine providing basis for the combination therapy of zidovudine and lamivudine.
- zidovudine-resistant HIV have reduced replicative capacity and therefore reduced transmissibility compared with the wild-type viral strain in the absence of the dmg. Since then, transmission of drug- resistant HIV has been observed via the sexual vertical and parenteral routes. Drug-resistant mutant vimses have also been detected in individuals soon after HIV seroconversion.
- nucleases kill vimses by impairing the unprotected viral nucleic acids at the expense of the cleavage of phosphodiester bonds between the nucleotides of viral DNA and RNA molecules.
- the substitution of phosphodiester bonds with nuclease-resistant bonds in viral nucleic acids requires major changes in the nature of dozens of both viral and cellular enzymes responsible for the synthesis of the viral nucleic acids is an enormous phenomenon.
- Inclusion of antiviral nucleases into conventional mono-therapy regimen may preclude occu ⁇ ence of drug-resistant mutants or significantly reduce chances for their survival and/or transmission while resulting in lower toxicity compared to combination therapy by two or three conventional antiviral dmgs.
- a method for treating viral diseases in human and nonhuman animals, insects and plants comprising administering virus-group-specific-nuclease- derived antiviral compositions in combination with conventional mono-therapy regimen, wherein the method completely eliminates occu ⁇ ence of drug-resistant mutants or significantly reduce chances for their survival and/or transmission while resulting in lower toxicity compared to conventional combination therapy by two or three antiviral dmgs.
- the invention provides a method for prevention and treatment of viral diseases caused by Group I dsDNA vimses, Group II ssDNA vimses, by administering an antiviral nuclease selected from group of nucleases comprising Group I dsDNA-specific nucleases, Group II ssDN A-specific nucleases, Group IV ssRNA-specific nucleases, Group VI non-specific nucleases and Group VII artificial nucleases the Group being defined, according to the classification of nucleases described herein.
- the invention provides a method for preventing and treating a viral disease caused by Group III dsRNA or Group IV ss(+)RNA vimses, the method involving administering an antiviral nuclease selected from the group of nucleases comprising Group II ssDNA-specific nucleases, Group III dsRNA-specific nucleases, Group IV ssRNA-specific nucleases, Group VI non-specific nucleases and Group VII artificial nucleases, the Groups as defined, according to the classification of nucleases described herein.
- the invention provides a method for preventing and treating a viral disease caused by Group V ss(-)RNA vimses, by administering an antiviral nuclease selected from the group of nucleases comprising Group III dsRNA-specific nuclease, Group IV ssRNA-specific nucleases, Group VI non-specific nucleases and Group VII artificial nucleases according to the classification of nucleases described herein.
- the invention provides a method for prevention and treating of viral diseases caused by Group VI ss(-)RNA RT vimses, by administering an antiviral nuclease selected from the group of nucleases comprising Group I dsDNA-specific nucleases, Group II ssDNA-specific nucleases, Group IV ssRNA-specific nucleases, Group V hybrid-specific nucleases, Group VI non-specific nucleases and Group VII artificial nucleases according to the classification of nucleases described herein.
- the invention provides a method for preventing and treating a viral disease caused by Group VII dsDNA RT vimses by administering an antiviral nuclease selected from the group of nucleases comprising Group I dsDNA-specific nucleases, Group II ssDNA-specific nucleases, Group III dsRNA-specific nucleases, Group IV ssRNA-specific nucleases, Group V hybrid-specific nucleases, Group VI non-specific nucleases and Group VII artificial nucleases according to the classification of nucleases described herein.
- an antiviral nuclease selected from the group of nucleases comprising Group I dsDNA-specific nucleases, Group II ssDNA-specific nucleases, Group III dsRNA-specific nucleases, Group IV ssRNA-specific nucleases, Group V hybrid-specific nucleases, Group VI non-specific nucleases and Group VII artificial nucleases according to the classification of nucleases described
- compositions are administered parenterally (subcutaneously, intramuscularly, intravenously), as aerosols for inhalation, intranasally, as eye drops, locally for applying on cutaneous viral lesions, for example, per anus, per vagina.
- parenterally subcutaneously, intramuscularly, intravenously
- aerosols for inhalation intranasally, as eye drops
- cutaneous viral lesions for example, per anus, per vagina.
- the antiviral conjugates of this example could be modified by methods known in the art (see for example, US Patent 5,698,515 to Pate, et al., December 16, 1997; US Patent Application 2003/0087808 to Soltero, et al, May 8, 2003).
- the present invention in various embodiments provides pharmaceutical compositions comprising a therapeutically effective amount of an antiviral nuclease- containing composition as described herein.
- All of the pharmaceutical compositions described herein can be formulated with or without an agent or device for sustained release, for delivery locally or systemically.
- a pharmaceutically acceptable ca ⁇ ier or excipient can be added.
- Such a ca ⁇ ier includes but is not limited to saline, buffered saline, dextrose, water, glycerol, ethanol, and combinations thereof.
- the formulation should suit the mode of administration.
- An "effective amount" as the term is used herein is an amount of a therapeutic agent or combination of agents sufficient to achieve a recognized medical endpoint, in this case, remediation of a symptom of a viral infection. The effective amount can be determined empirically by a skilled artisan according to established methods of measurement of relevant parameters, as described herein.
- compositions herein can further comprise wetting or emulsifying agents, or pH buffering agents.
- the composition can be a liquid solution, suspension, emulsion, tablet, pill, capsule, sustained release formulation, or powder.
- the compositions can be formulated as a suppository, with traditional binders and carriers such as triglycerides.
- Oral formulation can include standard ca ⁇ iers such as pharmaceutical grades of mannitol, lactose, starch, magnesium stearate, sodium saccharine, cellulose, magnesium carbonate, etc.
- Various delivery systems are known and can be used to administer a composition of the invention, e.g., encapsulation in liposomes, microparticles, microcapsules and the like.
- a composition herein is formulated in accordance with routine procedures as a pharmaceutical composition adapted, for example, for subcutaneous administration to human beings.
- compositions for subcutaneous administration are solutions in sterile isotonic aqueous buffer.
- the composition may also include a solubilizing agent and a local anesthetic to ameliorate pain at the site of the injection.
- the ingredients are provided either separately or mixed together in unit dosage form, for example, as a dry, lyophilized powder or water-free concentrate in a hermetically sealed container such as an ampoule or sachette, for example, indicating the quantity of active agent.
- composition is to be administered by infusion, it can be dispensed with an infusion bottle containing sterile pharmaceutical grade water, buffer, or saline.
- an ampoule of sterile water or saline for injection can be provided so that the ingredients may be mixed prior to administration.
- the compositions herein can in various components thereof be formulated as suppositories, which contain active ingredient in the range of about 0.5% to about 10% by weight; oral formulations preferably contain about 10% to about 95% active ingredient by weight.
- a daily dose is administered as a single dose, or is divided into a plurality of smaller fractional doses, to be administered several times during the day.
- a dosing schedule refers to a protocol for administering any of the compositions comprising for instance one or more of an in vivo proteasome inhibitor composition as described herein, in an effective dose, administered simultaneously or within a particular interval of each other, for example, within one day of each other, or as a combined preparation, or separately, and includes the amount of the composition delivered per unit time such as per day, and the duration or period of time over which each composition is administered.
- the invention provides a method for preventing or treating a viral infection, the method comprising administering to a subject in need thereof composition of at least one nuclease-containing composition as described herein, each in an amount sufficient to decrease the number of infective units in the subject; and determining the amount of vims-specific nucleic acid or infective units or a viral specific protein content, thereby treating or preventing the infection.
- Determining the amount of effective antiviral activity is measuring a parameter selected from the group of cell fluorescence of a cell in a biopsy or culture sample; fluorescence of a protein band on an SDS gel of a tissue or cell sample; antibody binding of a protein on a gel sample; or a viral-encoded protein function as is known to one skilled in the art of virology.
- Administering the composition described herein reduces viral load in the subject, compared to viral load assayed prior to administering the composition, for example, administering the composition reduces viral load by about 50%, or by about 70%, compared to that assayed prior to administering the composition.
- compositions of the invention can be formulated as neutral or salt forms.
- Pharmaceutically acceptable salts include those formed with free amino groups such as those derived from hydrochloric, phosphoric, acetic, oxalic, tartaric acids, etc., and those formed with free carboxyl groups such as those derived from sodium, potassium, ammonium, calcium, ferric hydroxides, isopropylamine, triethylamine, 2-ethylamino ethanol, histidine, procaine, etc.
- the amount of the therapeutic of the invention which will be effective in the treatment of a particular vims will depend on the nature of the vims, and can be determined by standard clinical techniques.
- the precise dose to be employed in the formulation will also depend on the route of administration, and the seriousness of the disease or disorder, and should be decided according to the judgment of the practitioner and each patient's circumstances. Routine determinations of sample levels of a proteasome activity are determined by one of ordinary skill in the art. Effective doses may be extrapolated from dose-response curves derived from in vitro or animals or animal model test systems, by one of ordinary skill in the art of pharmacology. Dosages of the compositions to be administered to a subject are adjusted for known variations from species to species using standard data encompassing criteria for abso ⁇ tion, distribution, half-life kinetics in circulation, metabolism, excretion, and toxicology of the compositions of the embodiments herein.
- Suitable dosage ranges for administration are generally about 0.01 micrograms to about 10,000 micrograms of each active compound per kilogram body weight per day, for example, about 0.01 micrograms to about 1 microgram/kg, about 0.1 micrograms/kg to about 10 micrograms/kg, about 1 microgram/kg to about 500 micrograms/kg, or about 10 micrograms/kg to about 10 mg/kg of body weight per day. Suitable dosage ranges for administration are thus generally about 0.01 micrograms/kg body weight/day to about 10 mg/kg body weight/day.
- the invention in other embodiments provides a pharmaceutical pack or kit comprising one or more containers filled with one or more of the ingredients of the pharmaceutical compositions of the invention.
- a container having a unit dosage of the nuclease composition In such a pack or kit can be found a container having a unit dosage of the nuclease composition. Associated with such container(s) can be various written materials such as instmctions for use, or a notice in the form prescribed by a governmental agency regulating the manufacture, use or sale of pharmaceuticals or biological products, which notice reflects approval by the agency of manufacture, use or sale for human administration. As a prefe ⁇ ed dosage for administration is intravenous, the unit dosage can be prepackaged in an infusion bottle or bag.
- N is a nuclease selected from one of the groups described herein in the Classification of Nucleases, with preferential hydrolytic activity towards genomic or intermediate nucleic acid of the targeted virus.
- the nuclease is exemplified by a recombinant bovine DNase (TURBO DNase ® ; TDNase) supplied by Ambion, Inc., Cat. No 2239) genetically modified to enhance its affinity for and hydrolytic activity towards viral dsDNA, although any other natural or artificial nuclease with preferential hydrolytic activity towards dsDNA can be applied.
- the nuclease is covalently attached to one terminus of a hetero-tri-functional forked
- hydrophilic polymeric ca ⁇ ier P think protects the nuclease from proteolytic degradation by endogenous proteases while increasing the solubility and half-life as well as cellular and nuclear uptake of the antiviral conjugate.
- Hydrophilic polymers capable of carrying out these functions include: polyethylene glycol (PEG), and other polyalkylene oxides; poly (NH-2-(hydroxypropyl)glutamine (PHEG); poly(n-2-hydroxypropyl) methacrylamide (HPMA) and others.
- the polymer may also contain hydrolyzable linkages to enable its hydrolytic degradation within the cell to facilitate the release of active compounds.
- Suitable hydrolyzable linkages include, for example, carboxylate and phosphate esters, acetals, imines, orthoesters, enol ethers, diketane acetals, ketals, anhydrides, etc. Formation of such linkages within the polymer may be conducted using routine organic synthesis techniques known to those skilled in the art.
- the hydrophilic hetero-tri-functional polymer P n is exemplified by a forked 2 x 20 kDa PEG 2 having an aldehyde group at the "tmnk” end and succinylamide (NHS) and maleimide (MAL) groups at the fork ends: CHO-PEG 2 - (NHS;MAL).
- a more stable vinylsulfone (VS) can be used instead of MAL.
- T 1 is selected from the group of membrane penetrating peptides (MPP) including but not limited to basic peptides containing D- or L-arginine residues or arginine-rich peptides derived from HIV-TAT 43- , and Antennapedia ⁇ g, transportan, penetratin, etc. to provide for high cellular uptake of the antiviral conjugate.
- MPP membrane penetrating peptides
- the membrane penetrating peptide T 1 is exemplified by lysine-terminated poly-Arg nanopeptide Lys-Arg8 (K-R8).
- T is selected from the group of oligomers with sequence-specific binding affinity towards targeted viral nucleic acid including but not limited to PNA, LNA, phosphorothio, mo ⁇ holino, polyamides and other nucl ease-resistant oligomers capable of providing targeted hydrolytic digestion of viral nucleic acid at a location inside the infected cell.
- the sequence-specific oligomer T 2 is exemplified by the cationic bis-PNA, complementary to vaccinia vims dsDNA designed to direct the nuclease-containing conjugate to the viral dsDNA for ultimate hydrolytic digestion.
- the vaccinia vims (VV) harboring genomic viral dsDNA, exemplifies targeted vims although any other vims could be inactivated by a composition of this example carrying an appropriate nuclease and oligomer having a nucleotide sequence complementary to a region of targeted viral nucleic acid.
- the complementary oligomer bis-PNA is modified with J-pseudocytosine using standard techniques (Synthesis, Properties and Potential Applications, Bioorganic & Medicinal Chemistry, 1996, 4, 5-23; Kuhn et al., Nucl. Acids Res. 26: 582-587, 1998), and is purified by reverse phase HPLC, and characterized by MALDI-TOF mass spectrometry (Egholm et al., Nucl. Acid Res. 23: 217-222, 1995).
- the Cys-terminated modified cationic bis-PNA f-Cys-JT 2 J 2 T 5 -(Lys-aha) 2 -Lys-T 5 C 2 T 2 C-LysNH 2 (SEQ ID NO: 50) wherein J is pseudocytosine, is designed to form stable complexes with a region of a TK gene of dsDNA of vaccinia vims.
- the bis-PNA contains for example a sequence complementary to the 10- mer of homopurine strand GA 2 G 2 As (SEQ ID NO: 51), according to the published sequences of the vaccinia vims TK gene: (GenBank No. J02425; Hmby, et al., Proc. Natl.
- the N-terminus of cationic bis-PNA also contains a fluorophore and a cysteine amino acid residue denoted as f-Cys.
- f-Cys a fluorophore Cy3 (Amersham Pharmacia #PA23001) is conjugated to the amino group of the cysteine.
- Cys-bis-PNA is diluted in 0.1M sodium carbonate pH 9.0 to a volume 35 ⁇ l; 1 mg of Cy3 fluorophore is dissolved in 30 ⁇ l H2O, and 15 ⁇ l of the fluorophore is added to the Cys-bis-PNA solution and the mixture is incubated overnight in the dark at room temperature.
- the NHS-group of the CHO-PEG-(NHS; MAL) reacts with the ⁇ -amino group of the lysine-terminated octa-arginine membrane penetrating peptide K-R8 at slightly basic pH, about for example pH 7.5, resulting information of CHO-PEG- (R8, VS).
- the free MAL-group selectively reacts with the SH-group of Cys- terminated bis-PNA at neutral pH.
- butyraldehyde CHO-group of CHO-PEG-(R8, bis- PNA) is reacted with the N-terminal ⁇ -amino group of TDNase at acidic pH for example, about 5.0, to yield the resulting TDNase-PEG-(R8, bis-PNA) conjugate.
- the acidic pH promotes the reaction of the butyraldehyde and the N-terminal amino group.
- Butyraldehyde is chosen because it is more selective under mild acidic conditions than propionaldehyde, and more stable in basic media than acetaldehyde (U.S. Patent 5,932,462, to Harris, et al. issued August 3, 1999)
- the resulting 75 kDa conjugate TDNase(31kDa)-PEG(40KDa)- R8(1.5kDa)-bis-PNA(2.5KDa) is separated and fractionated, and enzymatic activity and other specific properties can be assayed.
- concentration of the nuclease in collected fractions is assessed by absorbance at 280 nm using an extinction coefficient of 1.34.
- Conjugates are further analyzed by electrophoresis on for example, 7.5% SDS-PAGE, and stained with Coomassie blue to determine purity.
- the 75 kDa anti-vaccinia-vims conjugate is taken up by cells and is localized to the cytoplasm, where replication of vaccinia vims occurs.
- nuclease- polymer conjugates of greater total molecular weight and therefore greater hydrodynamic radius can be similarly prepared and are within the scope of equivalents of these compositions.
- Large polymer conjugates are useful with RNase-like nucleases since almost all RNA containing vimses with exception of influenza vims replicate inside the cytoplasm.
- polymer conjugates are useful with DNase-like nucleases to allow penetration of the antiviral compound into the cell nucleus.
- a nuclear localization factor (NLS) instead of or in addition to an MPP, as a targeting moiety is used in a multivalent constmct as described herein.
- Antiviral composition comprising a hetero-bi-functional polymer carrying multiple nucleolytic di/tri peptides, a targeting oligomer and a membrane permeating peptide
- the nuclease as exemplified by a non-natural homolog of tri-peptide Ser-His-Asp containing terminal D-amino acids D-Ser-His-D-Asp, possesses nucleolytic activities towards DNA and RNA (Li et al., Bioorg.Medic.
- the targeting oligomer of the composition, "T” is, for example, a 15-mer Peptide Nucleic Acid (PNA ⁇ 5 ): Cys-3'-TCCCAGGCTCAGATC-5' (SEQ ID NO: 52), having a nucleotide sequence designed to specifically hybridize with a TAR (trans-activation-response) hai ⁇ in element in the nucleotide sequence of HIV-I viral ssRNA.
- the PNA 15 has been designed to further have a single Cys amino acid residue at the end of the sequence that co ⁇ esponds to the 3'- terminus.
- the PNA 15 has been shown to block interaction of TAT protein with TAR and to halt viral replication in vitro (Mayhood, et al. Biochemistry 39:11532-11539, 2000; Kashik et al., J. Virology 76: 3881-3891, 2002).
- n is for example, 684
- the conjugate is a hetero-bi-functional 30 kDa 8-arm-PEG: VS-PEG-[NH 2 ] 8 -VS.
- nucleolytic tri-peptide D-Ser-His-D-Asp (SHD in the one letter amino acid code) to the amine groups of the polymeric ca ⁇ ier is ca ⁇ ied out to ensure that the peptide is bound in a known active orientation via a carboxyl group of the D-Asp residue. Since di-peptide Ser-His and tri-peptide Ser-His-Asp exhibit similar nucleolytic activities, coupling the C-terminus of the Asp residue of the tri-peptide to the ca ⁇ ier is not expected to affect nucleolytic activity.
- N-terminal t-Boc-protected tri-peptide containing two D-amino acids can be obtained by custom synthisis from was custom synthesized by Invitrogen Co ⁇ oration (Carlsbad, CA).
- Hetero-bi-functional 8-arm 30 kDa VS-PEG-[NH ] 8 is custom synthesized by Nektar Therapeutics (Birmingham, AL).
- the ratio of biotinylated tri-peptide to amine groups of the polymeric ca ⁇ ier VS-PEG- [NH2] 8 is chosen as 5:1.
- the coupling reagent is ED AC (l-Ethyl-3-(3-dimethyl-amino- propyl)carbodiimide hydrochloride obtained from Uptima (uptima@interchim.com).
- ED AC is the activating agent for two carboxyl groups of the D-Asp residue, to form an amide bond with primary amines of 8-arm PEG-[NH 2 ]g.
- the resulting conjugate PNA !5 -PEG-[SHD]g-R8 contains eight tri-peptides, SHD, having hydrolytic nuclease activity with genomic ssRNA, intermediate RNA-DNA hybrid and dsDNA as substrates, and contains two targeting ligands, Cys-terminated PNA 15 with high-binding affinity towards TAR element of HIV RNA inside the host cell, and contains the membrane penetrating peptide Cys-R8 to enhance cellular uptake of the antiviral conjugate.
- An SH-group of terminal Cys residues in both targeting ligands is used to form a hydrolytically stable bond with two terminal VS groups of bi-functional 8-arm-PEG.
- the hydrophilic polymers such as PEG protect an antiviral nuclease from proteolytic degradation by endogenous proteases while increasing cellular and nuclear uptake, solubility, and half-life of the antiviral conjugates.
- This Example describes synthesis of "arm-constructs" (Nuc a ) q -P n -R and (T b ) r -P n -L (+) , wherein in P n , the term n is an integer from 1 to about 2000, and the polymer P n is a linear or branched hetero-bi-functional PEG (bi-PEG), wherein R is a sequence-specific chemically-modified oligonucleotide L( + ), which undergoes Watson-Crick hybridization and subsequent covalent bond formation with a complementary oligonucleotide L ( .
- R is a reactive conjugating moiety, examples of which include but are not limited to aldehyde (CHO), maleimide (MAL), vinylsulfone (VS), hydrazine (HZ), succinate (NHS), and carboxylic acid (COOH) groups, to form a covalent multi-armed antiviral complex using N-P(n)-R and T'-P(n)-R constructs and chemically- modified dendrimer D as described below in Example 6.
- CHO aldehyde
- MAL maleimide
- VS vinylsulfone
- HZ hydrazine
- NHS succinate
- COOH carboxylic acid
- R is a hydrophobic entity H, such that a non-covalent multi-armed antiviral complex using (Nuc a ) q -P n -H and (T ) P n -H constructs and hydrophobic core dendrimer G0(C ⁇ 2 ) is formed as described in Example 5.
- the term (T b ) r in which b and r can be from 1 to about 8, represents a targeting moiety such as a modified oligonucleotide complementary to a specific nucleotide sequence of a target viral nucleic acid.
- the targeting moiety T can be prepared from such analogs as modified PNA, or other sequence specific oligomers, cell membrane penetrating peptides (MPP) such as basic Arginine- and Lysine-rich peptides, nuclear transport or export signal peptides (NLS or NES), targeting ligands T-CSR with specific affinity to host cell surface receptors (CSR), oligo- and poly-saccharides, phospholipids, etc.
- MPP cell membrane penetrating peptides
- NLS or NES nuclear transport or export signal peptides
- T-CSR with specific affinity to host cell surface receptors
- oligo- and poly-saccharides oligo- and poly-saccharides
- phospholipids etc.
- the targeted bi-PEG conjugates described in this example comprise the following types of targeting ligands:
- Modified sequence-specific oligonucleotides are prepared, each having a nucleotide sequence that is complementary to a region of a targeted viral nucleic acid.
- the hetero-bi- functional PEG conjugate has one terminal covalently attached to a sequence-specific oligomer that targets viral DNA and RNA, and antiviral dendrimers covalently attached to the second terminal of said polymer.
- This example features bis-PNA complementary to the TK-gene of vaccinia vims.
- modified nucleotides can be used in the scope of this invention. These include peptide nucleic acids (PNA), Locked/Bridged Nucleic Acids (LNA/BNA) forming stable duplexes with viral ssDNA and ssRNA, cationic homopyrimidine bis-PNAs forming stable complexes with purine strands of viral dsDNA or dsRNA, novel PNA analogs such as hydroxyproline-PNA (HypNA), serine-PNA (SerNA) including their monomers, dimers and polymers disclosed in the (US patent application 2003/0059789 from March 27, 2003 to Efimov et al.), sequence-specific hai ⁇ in polyamides targeting minor-groove of viral dsDNA, mo ⁇ holino oligos targeting viral ssRNA (Summerton and Weller, Anti-sense
- PNA peptid
- PNA molecules have 50 to 100-fold greater affinity for complementary RNA and DNA than do conventional oligonucleotides with the same number of bases (Nilesen et al., Science 254: 1497-1500, 1991; Hanvey et al., Science: 258: 1481-1485, 1992).
- Modified cationic bis-PNAs have even higher binding efficiency in regards to binding of double- stranded nucleic acids at physiological conditions via a formation of a strand displacement complex composed of an internal bis-PNA-DNA helix and a virtually single-stranded (non- complementary) DNA strand (Egholm, et al. Nucleic Acid Res. 23:, 217-222, 1995; Griffith et al. J. Am. Chem. Soc. 117:831-832, 1995).
- a cationic bis-PNA targeted towards TK-gene of vaccinia vims is prepared as described below.
- MPP membrane penetrating peptides
- This example features MPP compositions comprising poly(D-Arg) octamer R8, Antennapedia 3 - 48 (AP 43 ⁇ t ) and HIV TAT 4 -57 .
- other basic peptides containing arginine residues or analogs, arginine-rich peptides and proteins such as transportan, penetratin and the like are within the scope of this invention.
- Cysteine-terminated membrane permeating peptides C-R8 consisting of one L- Cysteine and nine D- Arginine residues, Antennapedia 43 . 8j and TAT 49 . 5 peptides are synthesized by automated peptide synthesizer ABI433 using standard solid-phase Fmoc chemistry as described (US patent application 2002/012719810 to Rothbard, et al.). Terminal SH-groups of Cys-terminated delivery-enhancing peptides R8, TAT 43-49 and Antennapedia 43-48 are covalently attached to MAL group of 5 kDa MAL-PEG-DSPE at a pH of 7.0.
- the cell membrane permeating rates of resulting three delivery-enhancing transporters R8-PEG-DSPE, TAT ⁇ g-PEG-DSPE and Antennapedia 43 ⁇ 8 -PEG-DSPE are compared by cellular assays using Jurkat cells (human T-cells) and marine B cells (CH27) as described (US patent application 2002/012719810 to Rothbard, et al.)
- R8-PEG-DSPE is shown to enter cells approximately 50-fold faster than Antennapedia 43 ⁇ 8 -PEG-DSPE, and about 100-fold faster than TAT 43-49 -PEG-DSPE.
- Nuclear localization signals are naturally occu ⁇ ing peptide sequences found in some native viral proteins, which mediate delivery of large proteins from the cytoplasm into the cell nucleus.
- Typical peptide sequences of NLS contain several basic amino acids.
- the NLS featured in this example is 7-amino acid peptide PKKKRKV (SEQ ID NO: 41), which is a monopartite NLS from SV40 large T antigen.
- NLS sequences can be used and are within the scope of this invention including 12-amino acid peptide PEVKKKRKPEYP (SEQ ID NO: 42; US patent 6,312,956 to Lane, inco ⁇ orated here by reference), 13-amino acid peptide GGGGPKKKRKVGG (SEQ ID NO: 44) of SV40 large T antigen (Lanford, Cell 37:801-813, 1984), 13-amino acid peptide GGGFSTSLRARKA (SEQ ID NO: 45) of adenoviral NLS, 17-amino acid peptide CKKKKKKSEDEYPYVPN (SEQ ID NO: 46) of adenoviral receptor mediated endocytosis (RME) protein, 28-amino acid peptide CKKKKKKKSEDEYPYVPNFSTSLRARKA (SEQ ID NO: 47) of adenoviral fiber protein (Tkachenko, et al., J.
- R8-PEG-NLS To attach NLS to R8-PEG-NHS, an extra lysine is added to the N-terminal end (Chan and White, Fmoc solid phase peptide synthesis. A Practical Approach, Oxford University Press, 2000).
- the two conjugates R8-PEG-NLS and R8-PEG-DSPE are synthesized as described in Examples 1 and 2, and are tested both for cellular and nuclear uptake after addition to the cell culture. Hela cells grown on cover slips are incubated with 5 ⁇ M of each conjugate in serum-free medium overnight, then fixed and examined by fluorescence microscopy.
- R8-PEG-DSPE is found to be distributed within the cytoplasm and is absent from the nucleus, while R8-PEG-NLS is accumulated primarily in the nucleus.
- T-CSR targeting ligands exhibiting high-binding affinity to host cell surface receptors are prepared.
- a peptide T (ASTTNYT; SEQ ID NO: 1) having a sequence derived from envelope protein gpl20 of HIV-I is sythesized as a T-CSR to target HIV primary host cells containing CD4 receptor.
- Peptide T can be attached to bi-PEG via an additional lysine or cysteine residue at the C-terminus, providing the necessary reaction groups, NH 2 - amino group, ⁇ -amino or SH-thiol groups.
- vims specific T-CSR are synthetic peptides derived from positively-charged sequences of human papillomavirus type 16 capsid proteins LI and L2 exhibiting high binding affinity to heparan sulfate receptors such as HPV 31 LI Cta: GYRARPKFKAGKR SEQ ID NO: 53; HPV 45 LI Ctb: RPAKRVRIRSKK: (SEQ ID NO: 54); hpv-16 11 Cta: SSTSTTAKRKKRKL (SEQ ID NO: 55); HPV-16 L2 Ct: MLRKRRKRL (SEQ ID NO: 56) HPV-16 L2 Nt: MRHKRSAKRTKRA (SEQ ID NO: 57) and others (Bousarghin, et al. J. Gen. Virol. 84:157-164, 2003).
- T-CSR within the scope of this invention includes folic acid or pteroyl glutamic acid, a vitamin consisting of a pteridine ring linked by a methylene bridge to a para-aminobenzoic acid moiety, which is joined through an amide linkage to a glutamic acid residue
- Folates are required for the survival and growth of eukaryotic cells, and cellular folate uptake is mediated by at least two independent transport mechanisms (Weitman et al., Cancer Res. 52:3396-3401, 1992; Ross et al., Cancer, 1994, 73(9), 2432- 2443, 1994.
- Reduced folates are internalized via a carrier-mediated low affinity (K m values are in 1-10 ⁇ M range) anion-transport system that is found in nearly all cells.
- Folic acid and 5-methyl tetrahydrofolate can also enter cells via a high affinity (I values in 10-100 nM range) membrane-bound folate-binding proteins that are anchored to the cell membrane via a glycosyl-phosphatidyl-inositol moiety.
- FR- ⁇ folate receptor
- GPI glycosyl- phosphatidyl-inositol
- FBP folate binding protein
- FR- ⁇ The folate receptor-alpha
- filovimses such as Marburg (MGB) and Ebola (EBO) vimses, which cause lethal hemo ⁇ hagic fever (Chan et al., J. Virol. 74:4933-4937, 2000).
- MGB and EBO vimses not only readily infect cells expressing FR- ⁇ receptors, but the FR- ⁇ receptors expressed in infected cells also facilitate MBG and EBO viral glycoprotein (GP)-induced cell-to-cell fusion or syncytia formation.
- GP EBO viral glycoprotein
- FR- ⁇ soluble FBP
- MBG mannose-6-phopshate
- MPR mannose-6-phopshate
- T-CSR T-CSR for the conjugates herein is mannose targeting to mannose- receptors expressed in macrophages, subsets of endothelial cells, smooth muscle cells, retinal pigment epithelium, kidney mesangial cells, myeloid cells, Kaposi sarcoma cells, etc. (reviewed in Stahl & Ezekovitz, Cu ⁇ Opin Immunol.
- Man-PEI-PEG and (M-6-P)-PEI-PEG conjugates are synthesized by a method similar to that described for mannose-polylysine conjugate (Erbacher, et al., Hum. Gene Ther 7:721-729, 1996), and mannose-PEI conjugate (Diebold, et al. J. Biol Chem 274(27): 19087-19094, 1999).
- Synthesis of hetero-bi-functional diblock PEI-PEG-MAL copolymer having branched PEI terminated by NH 2 -PEG-MAL has been ca ⁇ ied out via macrostopper route as described in Petersen et al., J. Am.
- the conjugate has mannose or mannose-6-phosphate linked to free amino groups of the hetero-bi-functional copolymer branched PEI-PEG-MAL via a phenylisothiocyanate bridge (itc) using mannopyranosylphenyl isothiocyanate as coupling agent (Sigma), to obtain Man-itc-PEG or (Man-6-P)-its-PEG.
- Hetero-bi-functional branched (NH 2 ) k -PEG-MAL, k is an integer of 8, with single terminal maleimide (MAL) or vinylsulfone (VS) group and multiple terminal free amino groups NH 2 can be obtained from Nektar Therapeutics, Inc.
- Coupling is performed by reacting 25 mg of (NH 2 ) 8 -PEG-MAL dissolved in 0.33 ml of water with 25 mg of mannopyranosylphenyl dissolved in 0.2 ml of dimethyl sulfoxide for 24 hours, followed by dilution with 4 ml of water and adjustment to 0.5 M sodium chloride, application of the sample to caption exchange chromatography (Bio-Rad Macroprep High S, salt gradient from 0.5 to 3 M NaCl) and dialysis against 150 mM NaCl. Conjugates are analyzed for content of PEG by using the ninhydrin assay (Cotton, et al., Cu ⁇ ent protocols in Human Genetics, pp.
- CSR Cell surface receptors designed to target ligands that are conjugated to carried by polymeric ca ⁇ iers may also comprise various cell surface receptors (CSR) themselves with specific binding affinity to viral glycoproteins expressed on the membrane of infected cells, such as T4 cell receptor CD4, co-receptors CCR5 and CXCR4 with affinity to HIV glycoprotein gpl20/CSX expressed on the membranes of HIV infected cells and many other host cell receptors.
- CSRs include peptide derivatives of folate receptor- ⁇ (FR- ⁇ ) capable of targeting a cell infected with a Marburg (MBG) or an Ebola (EBO) vims, and some peptide derivatives of CI-MPR with high affinity to viral glycoproteins.
- FR- ⁇ folate receptor- ⁇
- MBG Marburg
- EBO Ebola
- T b bi-PEG conjugates with covalently attached targeting moieties
- T b ) r are used to direct multivalent complexes containing one or more
- Example describes preparation of compositions Nuc-P n -H and (T b ) r -P n -H, wherein Nuc is an antiviral nuclease, T are targeting ligands described in Example 3, wherein P n is a hetero-bi-functional hydrophilic polymer, and H is a hydrophobic moiety associated with a hydrophobic core dendrimer D as described in Example 5.
- Antiviral activity of nucleases is enhanced by conjugation with polymers that act to protect antiviral nuclease from proteolytic degradation by endogenous proteases, and to increase solubility, cellular uptake and half-life.
- polymers that act to protect antiviral nuclease from proteolytic degradation by endogenous proteases, and to increase solubility, cellular uptake and half-life.
- hydrophilic polymers are capable of carrying out these functions, including polyethylene glycol(PEG) and other polyalkylene oxides, poly(NH-2-(hydroxypropyl)glutamine (PHEG), poly(n-2-hydroxy- propyl) methacrylamide (HPMA), and others.
- the polymer may contain hydrolyzable linkages to enable hydrolytic degradation within the cell to facilitate release of an active compound.
- Suitable hydrolyzable linkages include, for example, carboxylate and phosphate esters, acetals, imines, orthoesters, amines, enol ethers, diketane acetals, ketals, anhydrides, etc. Formation of such linkages within the polymer may be conducted using routine organic synthesis techniques known to those skilled in the art.
- Nuclease exemplified by wild-type bovine pancreatic RNase A is obtained for Ambion, Austin, TX. RNase preferentially degrades single-stranded viral RNA.
- Other nucleases that could be conjugated with polymers in a similar manner include wild-type, recombinant, or chemically modified nucleases of human, animal, bacterial, plant or artificial origin.
- the selected polymer is a two-arm branched 2x10 kDa hetero-bi-functional PEG with 1 ,2-dipalmitoyl-sn-glycero 3-phosphatidyl ethanolamine (DSPE) on one arm, and propionylaldehyde's CHO-group on another arm, the resulting polymer abbreviated as DSPE-PEG-CHO, obtained from Nektar Co ⁇ .
- DSPE-PEG-CHO the resulting polymer abbreviated as DSPE-PEG-CHO, obtained from Nektar Co ⁇ .
- the lauryl, myristoyl, palmitoyl, stearoyl, oleoyl, and lineoyl analogs of DSPE can be also used.
- the CHO reagent reacts with the N-terminal amino group of Lys(K)l of RNase A at an acidic pH of 5.0-6.0.
- the reaction is ca ⁇ ied out at pH 5.0 at a 1 :1 ratio of the DSPE- PEG-CHO reagent to RNase A.
- These conditions are optimal for obtaining the recovery of the protein with a single PEG per protein, rather than higher molecular weight adducts.
- the unmodified protein can be recycled. Conjugates are fractionated and fractions are assayed for enzymatic activity and other properties. The concentration of the final product is assessed by near-UV absorbance using an extinction coefficient of 1.34.
- T'-P(n)-H conjugates are also analyzed by electrophoresis on a 7.5% SDS-PAGE and stained with Coomassie blue to determine purity.
- the T'-P(n)-H conjugates are obtained in a similar manner. Both N-P(n)-H and T'-P(n)-H conjugates are used in non-covalent complexes with extended hydrophobic core dendrimers described below in Example 5.
- Antiviral composition comprising multiple hetero-bi-functional constructs non-covalently associated with a multivalent hydrophobic "core " dendrimer
- the Example describes preparation of multi-armed/multivalent antiviral complexes [(Nuc a ) q -P f n -H]i-D-[H-P f m -(T b ) r ]k, wherein i and k are integers from 1 to 8.
- the complexes are formed through a non-covalent association of the "arm constmcts" Nuc-P n -H and T-P n -H with a "core" multivalent molecular scaffold D .
- the "arm constructs” comprise hetero-bi-functional hydrophilic polymers P n and P m represented by PEG as described in Example 1 , wherein n and m are integers from 1 to 2000, with one terminal of the polymers P render and P m being covalently attached to either a nuclease Nuc or to a targeting ligand T such as PNA, MPP, NLS, T-CSR or CSR described in Example 4, while the other polymer terminal is covalently attached to a hydrophobic "connective" moiety H exemplified by phospholipids such as dipalmitoyl-sn-glycero 3 -phosphatidyl ethanolamine (DSPE), with lauryl, myristoyl, palmitoyl, stearoyl, oleoyl, and lineoyl analogs of DSPE containing "sticky" hydrophobic fatty acids.
- a targeting ligand T such as PNA, MPP, NLS, T-CSR or
- hydrophobic moiety H mediates formation of multi-armed/multivalent antiviral compositions, where each arm constmct Nuc-P n -H or T- P n -H is associated through a hydrophobic interaction with a hydrophobic molecular scaffold D represented in this example by an extended hydrophobic core PAMAM dendrimer G 0 (C ⁇ 2 ) (Watkins, et al., Langmuir 13: 3136-3141, 1997).
- the "arm constmcts" containing hydrophobic group H are amphiphilic since they are composed of two parts which differ substantially with respect to solubility in water: the hydrophilic parts A-PEG represent the polar "heads” while the hydrophobic "tails” (DSPE) are formed by non-polar chains of fatty acids that are lipophiles. Amphiphilic conjugates may differ significantly in the relative contribution by mass of the hydrophilic A-PEG and hydrophobic DSPE portions of the conjugate.
- HLB hydrophile-lipophile balance
- the amphiphilicity of various conjugates may affect their immunogenic properties.
- the HLB of the amphiphilic compounds can affect immunological response of a subject that has been administered the compound.
- Amphiphilic conjugates with high HBL >20 have been shown to elicit a very low immunologic response (Waltrous-Peltier, et al. Pharm. Res. 9: 1177-1183, 1992), while conjugates with a low HBL ⁇ 2 cause the accumulation of inflammatory cells, most notably macrophages (Hunter, et al. AIDS Res. Hum. Retrovir. 10, S95-S98, 1994).
- the non-polar alkyl groups of DSPE molecules stick together (Finney, "Hydration Processes in Biology", ed. M.C. Bellissent-Funel, IOS Press, 115-124, 1999).
- Conjugation with hydrophilic polymers P n as described in Example 3 results in protecting antiviral nuclease from proteolytic degradation by endogenous proteases, and increasing its solubility, cellular uptake and half-life.
- the amphiphilic nature of(Nuc a ) q -P f n - H and H-P m -(T ) r constmcts also modulates penetration of the antiviral composition through cell membrane and provides additional protection against proteases.
- the nuclease is exemplified by the bovine pancreatic RNase A with preferential hydrolytic activity towards single-stranded viral RNA, although any wild-type, recombinant or chemically modified nuclease of human, animal, bacterial, plant or artificial origin could be conjugated with polymers in a similar manner.
- the prefe ⁇ ed polymer is a hetero-bi-functional PEG with 1,2-dipalmitoyl-sn-glycero 3 -phosphatidyl ethanolamine (DSPE) on one arm, and propionylaldehyde CHO-group, MAL-group or NHS-group on another arm, further abbreviated as DSPE-PEG-CHO, DSPE-PEG-MAL, DSPE-PEG-NHS supplied by Nektar Co ⁇ oration, Inc.
- DSPE 1,2-dipalmitoyl-sn-glycero 3 -phosphatidyl ethanolamine
- the CHO group selectively reacts with the N-terminal of the nuclease-cell targeting peptide at acidic pH; the NHS group reacts with ⁇ -amino group of lysine of K-R8; and MAL reacts with the SH-group of PNA or cell targeting ligand (T-CSF) at neutral or slightly-basic pH as described in Example 1.
- the result is a mixture of multivalent arm-core constmcts with a random distribution of composition as well as a random quantity of heads groups.
- This example describes a sequential attachment procedure, which involves solid phase matrix and results in a multivalent composition comprising four different active moieties: a single nuclease-bovine DNase I, and 3 targeting ligands- PNA, R8 and folic acid (FA) in hydrophobic association with D represented by an extended hydrophobic core poly(amidoamine) dendrimer G 0 (C ⁇ 2 ) (Watkins et al., Langmuir 13:3136-3141, 1997).
- the 656 Da dendrimer Go(C ⁇ 2 ) containing four active surface groups NH 2 and 12 CH 2 groups comprising the internal methylene-based hydrophobic core is obtained from Dendritech, Inc. (Midland, MI).
- the 5 kDa DSPE-PEG-CHO and DSPE-PEG-NHS conjugates are each covalently attached to an A active moiety, resulting in (Nuc a ) q -PEG-DSPE and (T b ) r -PEG-DSPE conjugates, wherein Nuc 1 is DNase I or other nuclease, T 1 is K-PNA, T 2 is K-R8, and T 3 is K-folic acid (FA).
- the NHS terminal of DSPE-PEG-NHS reacts with terminal lysine residues of lysine modified active moieties.
- the G 0 (C 12 ) hydrophobic core dendrimer is then covalently bound via 2 kDa PEG linker to a solid phase "seed" matrix comprising chemically inert PEG-based hydrophilic resin (Gr ⁇ tli, et al., J. Combin. Chem. 2000, 108- 119, 2000; Buchardt and Meldal, Chemically Inert Hydrophilic Resin for Solid Phase Organic Synthesis. Tetrahedron Lett. 39: 8695-8698, 1998).
- a n -PEG-DSPE conjugates are added to allow non-covalent association of hydrophobic DSPE "tails" with the hydrophobic core of the G0(C12) dendrimer, which is covalently bound to the hydrophilic solid phase matrix.
- Each of the (Nuc a ) q -PEG-DSPE and (T b ) r -PEG-DSPE conjugates is introduced at the concentration ratio of 1:1 relative to the concentration of immobilized dendrimers.
- the conjugates remaining unbound are washed out. The procedure is repeated to sequentially attach by hydrophobic interactions conjugates of different or similar function.
- Antiviral composition comprising multiple hetero-bi-functional constructs covalently associated with the multivalent dendrimer
- T is bis-PNA targeted to the REV-gene of HIV-I
- T is an R8 membrane penetrating peptide
- T is a T-CSR described in Example 3 such as Man-6-P, wherein R is a vinylsulfone group (VS), and dendrimer D SH is G-2 PAMAM dendrimer chemically modified to contain reactive terminal SH-groups.
- the Sp-DNase-PEG-VS, SP-PEG-VS, bis- PNA-PEG-VS and R8-PEG-VS constmcts are prepared as described in Examples 1-3.
- the NH 2 -terminated PAMAM G-2 dendrimer was treated with nitrogen-purged 5 mM iminothiolane HC1, and 1 mM EDTA in PBS to convert the dendrimer surface amines to sulfhydryls. After incubation for 60 minutes with constant nitrogen purging, the reaction mixture is dialysed against PBS.
- the SH-modified dendrimer D SH is then immobilized via a 2 kDa PEG linker to a solid phase "seed" matrix comprising chemically inert PEG-based hydrophilic resin as described in Example 4.
- the (Nuc 1 , T b )-PEG-VS conjugates are added sequentially one after another to allow for covalent association of a VS group with an SH-terminal group of the dendrimer immobilized on the hydrophilic solid phase matrix.
- Each of the (Nuc a , T b )- PEG-VS conjugates is introduced at a concentration ratio of 1 :1 relative to the concentration of immobilized dendrimers.
- PAMAM dendrimers supplied by Dow Chemical and Dendritech, Inc. other antiviral dendrimers that are within the scope of and are useful for this invention or its equivalent include polyamidoamine or polylysine dendrimers bonded with sulfonic acid- containing or trimethylammonium-containing moieties (US Patent 6,190,650 to Matthews and Holan, 2003); poly(Lysine) StarburstTM dendrimers by Sta ⁇ harma Ltd.
- SPL- 2999 with the chemical formula BHAlysl51ysl6 (NHCSNHNaphth-3,6-diSO3Na)32 (BHA: benzhydrylamine) and molecular weight of 16,615 Da shown to be active against he ⁇ es simplex vims HSV (Gong et al, Antiviral Research 55:319-329, 2002), SPL-7013 shown to be active against HIV; and dendrimer-like star polymers (Trollsas et al., Polymer Preprints 41(1): 258-259, 2000) and others.
- BHAlysl51ysl6 NHCSNHNaphth-3,6-diSO3Na
- BHA benzhydrylamine
- the PAMAM, PAMAM(EDA) and poly (Lysine) dendrimers have demonstrated activities in vitro against a variety of vimses, including he ⁇ es simplex vims (Bourne, et al., Antimicrobial Agents and Chemotherapy, 44(9): 2471-2474, 2000), influenza vims, measles vims, respiratory syncytial vims (RSV; Barnard, et al, Antivir. Res. 34:A88, 1997), human immunodeficiency vims (HIV; Witrouw, et al., Antiviral Research 41: A25, 1999), etc.
- compositions of this example comprising S-peptide: Sp-DNase-PEG-D-PEG-(T b ) r and S-protein: SP-PEG- D-PEG-(T b ) r may form a non-covalent complex possessing both RNase and DNase nucleolytic activities: (T b ) r -PEG-D-PEG-(RNase S)-DNase-PEG-D-PEG-(T b ) r , which makes them attractive for targeting both genomic ssRNA and intermediate dsDNA of HIV, genomic dsDNA and intermediate ssRNA of HBV, and some other RT dependent vimses.
- the Example describes preparation of chemically modified "core" dendrimer containing multiple sequence-specific oligonucleotides L(.).
- D SH D C -NH-C-(CH 2 ) 3 -SH.
- the dendrimer D S H is immobilized via 2 kDa PEG linker to a solid phase "seed" matrix comprising chemically inert PEG-based hydrophilic resin as described in Example 4.
- the L(.)-PEG-VS conjugates are added sequentially one after another to allow for covalent association of the VS group with the SH-terminal group of the dendrimer immobilized on the hydrophilic solid phase matrix.
- Each of the L ( . ) -PEG- VS conjugates is introduced at the concentration ratio of 1 : 1 relative to the concentration of immobilized dendrimers.
- the unbound conjugates are washed out. The procedure is repeated to covalently attach all three conjugates in a sequential manner.
- the covalent link between the immobilized dendrimers and PEG-based matrix is cleaved by a standard technique.
- each mono-functional "shell" dendrimer is equipped with its own unique LNA (3 '. 5') which is complementary to one of the multiple LNA (5 > -3 ' ) k attached to the "core" G-3 dendrimer, wherein K is an integer from one to about 5.
- the complementary pair LNA( 3 >. 5 >) and LNA (5 ' -3 ' ) undergo Watson- Crick hybridization, and covalent bond formation occurs when the "dormant" group attached to LNA( 5 - -3 ') is activated as described in the next Example 9.
- the Example describes a method for covalent attachment of two complementary oligo- or polynucleotides or oligo-like or polynucleotide-like molecules following Watson-Crick hybridization, to provide a covalent association between multiple multi-armed "shell" dendrimers carrying active antiviral moieties and a "core" dendrimer.
- Each shell dendrimer is equipped with one or more chemically modified oligomers comprising LNA (Locked Nucleic Acid), BNA (Bridged Nucleic Acid), PNA (Peptide Nucleic Acid), etc. which are complementary to one of the multiple oligomers covalently attached to the core dendrimer.
- the complementary oligomers at the core dendrimer are chemically modified with a poly-functional reagent to allow for covalent bond formation between two complementary oligomers subsequent to hybridization.
- the polyfunctional reagent includes two or more highly reactive chemical groups, one of which remains inactive or dormant until activated, others of which groups are permanently active.
- the active groups are used to bind the reagent to the complementary oligomers attached to the core dendrimer. After Watson-Crick hybridization between the core and complementary shell oligomer takes place, the dormant reactive group on the core oligomer is activated, resulting in a covalent between the two complementary oligomers.
- a polyfunctional reagent N,N,N'-tri-( ⁇ -chloroethyl)-N-(p-formylphenyl) propylene diamine-1,3 (TFP) is used to illustrate the proposed technique.
- Two highly reactive aliphatic ( ⁇ - chloroethyl)amino groups are used to attach the reagent to one of the complementary oligomers of the core dendrimer.
- the reactivity of the third dormant or potentially active aromatic ( ⁇ - chloroethyl) amino group is strongly inhibited by the neighboring formyl residue.
- the dormant reactive group on the core oligomer is activated by the reduction with sodium borohydride resulting in a covalent bridge between complementary core and shell oligomers.
- Attachment of the polyfunctional reagent to the core oligomer using two aliphatic groups is carried out in 50% methanol/5 mM Tris-HCl, pH 7.5, at room temperature for 10-15 min.
- the reaction mixture contains 0.8 mM TFP and 50-100 ⁇ g of oligo/polynucleotide per ml.
- the modified oligo/polynucleotide is precipitated with ethanol (2 h at 20°C) and is centrifuged; the pellet is dissolved in 10 mM Tris-HCl (pH 7.5).
- the oligo/polynucleotide solution from the reaction is applied to an equilibrated Sepharose G-50 column and eluted is with 10 mM Tris-HCl (pH 7.5).
- the latter is sample hydrolyzed (1 M NaOH, 18 h, 37°C), and the modified and non-modified nucleotides are analyzed by paper chromatography. Both the modified and unmodified complementary oligomers are then covalently attached to their respective core and shell dendrimers as described in Example 5.
- the dormant chlorethyl group is activated by addition of sodium borohydride to the solution to a final concentration of 10 mM, and the mixture is incubated for 4 h at 40°C.
- the covalently bound shell-core dendrimer complexes obtained by this procedure are used as a multivalent platform for delivery of antiviral nucleases and ligands of this invention.
- the Example describes a covalent complex between multiple shell dendrimers D s , and a single core dendrimer D c modified to include complementary oligonucleotides at each of their terminal groups.
- Each shell dendrimer caries a single sequence of a specific oligonucleotide D s -L ⁇ ) which is complementary to one of the multiple oligonucleotides L a ' b ( . ) -D c , attached to the core dendrimer D C) the n being about 5.
- the complementary oligonucleotide L (+) of each shell dendrimer undergoes Watson-Crick hybridization with its co ⁇ esponding complementary oligonucleotide L(.) of the core dendrimer.
- the complementary oligonucleotide L(.) of the core dendrimer is chemically modified to contain an additional dormant group, which can be chemically activated to allow for the formation of a covalent bond between the two hybridized oligonucleotides.
- LNA Locked Nucleic Acid
- LNA is a novel class of nucleic acid analogs structurally similar to RNA nucleosides.
- the term "locked nucleic acid” has been coined to emphasize the conformational restriction of the furanose ring due to the presence of a methylene linker which connects 2'-O position to the 4"-C position structurally mimicking the standard RNA monomers.
- LNA oligomers conform to Watson-Crick base pairing rules and hybridize to complementary LNA as well as to complementary DNA and to RNA, with substantial thermal stability and selectivity.
- a duplex of complementary LNA/LNA displays greater stability than other nucleic acid duplexes (Koshkin, et al. J. Am. Chem. Soc, 120: 13252-13260, 1998).
- the self-complementary cysteine-terminated LNA 12-mers are synthesized by Proligo, LLC (Boulder, CO) having structures as follows: LNA (+) : 5'-Cys- TAATACGACTCA-3' (SEQ ID NO: 58) and LNA ( .>: 3'-ATTATGCTGAGTCys-5' (SEQ ID NO: 59). Five pairs of self-complementary cysteine-terminated LNA 12-mers with different nucleotide sequences are synthesized, to be attached to core and shell dendrimers.
- Dendrimers are macromolecular nanoscale covalent core-shell assemblies composed of regularly placed atoms, repeat branching units (monomers) and terminal functional groups su ⁇ ounding their the functional group of the focal points or cores (Tomalia et al, Pure Appl. Chem., 72(12): 2343-2358, 2000). Because of this stmcture, dendrimers serve as functional modules or building blocks for precisely designed therapeutics.
- the third generation polyamidoamine (PAMAM) G-3 dendrimer containing 32 surface primary amine groups is chosen as the core dendrimer, and five first generation PAMAM G-l dendrimers each containing 8 surface primary amine groups are used as shell dendrimers (Tomalia et al., Pure and Applied Chemistry 72, 2343-2358, 2000).
- the core dendrimer is tethered to solid hydrophilic resin (Gr ⁇ tli, et al. J. Combi. Chem. 2000, 108 -119, 2000); Buchardt, et al. Tetrahedron Lett. 39: 8695-8698, 1998).
- Hybridization and subsequent covalent bond formation between multiple shell dendrimers and a single core dendrimer is carried out using five mono-functional PAMAM
- Antiviral complex mPEG-RNase I that provides controlled release of RNase
- mPEG-SS soluble degradable methoxy-polyethylene glycol succinyl succinate
- Degradable PEG derivative bearing hydrolytically unstable group is exemplified by succinimidyl succinate (mPEG-SS).
- mPEG-SS active ester reacts rapidly with amino group of proteins and forms an amide linkage (-CO-NH-).
- the linkage is subject to rapid hydrolysis and detachment of mPEG from the nuclease.
- mPEG succinimidyl carbonate is used (see J. M. Ha ⁇ is, U.S. Pat. Application. No. 2001/0021763 Al).
- Wild-type recombinant human RNase I is dissolved to a concentration of 25 mg/ml in distilled water and is applied to a Sephadex G-25 column (1.6 x 14.0 cm) in 10 mM CaCl 2 . During elution, fractions of 2.0 - 2.2 ml are collected and optical density measured at 280 nm. The fractions with high optical density at 280 nm are combined. The protein concentration in the solution is about 6.5 mg/ml.
- the collected fractions are placed in an ice bath and aliquots of the sample having pegylated RNase I (5-15 mg) are diluted in a mixture of 1.5 ml PPB and 0.5 ml of fluorescamine in acetone (0.3 mg/ml) and the fluorescence of the mixture is measured at an excitation wavelength of 475 nm. Amount of primary amino groups in the protein is proportional to the tangent of the angle.
- the measurement by fluorescence of the rate of RNase I pegylation demonstrates that only 1-2 lysine residues are pegylated, and that spatial hindrances are created by the protein stmcture for the remaining lysine residues. Pegylation of human RNase I enhances its antiviral efficacy against ssRNA corona vims.
- the Example shows digestion of high-molecular weight salmon DNA (Sigma Co ⁇ ., St. Louis, MO) with each of the following recombinant versions of multi-charged (mc) mcDNase I, having amino acid substitutions: (1) mcDNase (+2) with substitutions E13R/N74K that contribute two additional charges; (2) mcDNase (+3) with substitutions E13R N74K/T205K that contribute three additional charges; (3) mcDNase (+5) with five substitutions E13R T14K H44R N74K/T205K that contribute five additional charges; (4) actin-resistant version of DNase I [termed herein "arDNase” (+1)] with a substitution that contributes one additional charge Al 14R and providing resistance to an inhibitory effect of actin; and (5) hyperactive/actin-resistant version of mc/arDNase (+6) with substitutions E13R/T14K H44R/N74K/T205K/A114R that contribute six additional charges.
- mcDNase (+2)
- Target dsDNA in phosphate buffer, pH 7.5 at a DNA concentration 5 ng/ml, approximates in vivo peak concentrations of viral DNA within an infected cell. This concentration is orders of magnitude lower than typical concentration of endogenous host
- results performed in triplicate represent time required for 50% solubilization of 5 kbp dsDNA (500 ⁇ g/ml) by each of the mc and mc/ar-DNases (+1 to +6) positively charged variants, compared with the 50%-solubilization time of the same 5 kbp dsDNA samples digested by wild-type human DNase I.
- a number of transition metal complexes are capable of incurring oxidative damage and thus can cleave DNA and RNA through a Fenton-like reaction.
- RNA Similar effects on DNA and RNA have been observed for Fe (II)-EDTA and Cu(II)- glutathione or glycine-glycine-lysine complexes. Some of these complexes, if targeted to viral nucleic acids, may serve as efficient antiviral agents.
- nuclease- and protease-resistant PNA molecules capable of forming hydrogen bonds with complementary nucleotide sequences, provides a mechanism for addressing various ligands to targeted viral DNA and RNA molecules.
- PNA complementary to genomic DNA and forms of intermediate RNA of replicating pathogenic vimses are used herein to deliver nucleases to the target viral DNA and RNA molecules for hydrolysis of these nucleic acids and inhibition of replication of pathogenic vimses.
- Molecules with N-terminal lysine residues of 18-mer bis-PNA complementary to four different nucleotide sequences of vaccinia vims (VV) DNA sterically available for interaction are conjugated with forked 2x20kDa PEG and human DNase I (DNase) as described in Example 1.
- the antiviral efficacy of these constmcts targeted against VV are compared with that of non-modified wild-type human DNase I and DNase I conjugated with PEG.
- the efficacy of PNA targeting is illustrated by the data presented in Table 3.
- R8-PEG-DNase exhibits enhanced antiviral activity against vaccinia virus (W).
- DNase I bovine DNase I
- DNase-PEG DNase-PEG-R8 complex
- HepG2 cell line human hepatocarcinoma cells ATCC, No- HB-8065.
- HepG2 cells were grown at 37°C in 199/Eagle's medium (45% + 45%) with 10% fetal bovine semm (FBS) heat-inactivated at 56°C for 30 min.
- DNase I is labeled with fluorescent rodamine (*) according to the manufacturer's instmction (Pierce, Inc., Rockford, IL).
- Antiviral activity of DNase-derived compositions is determined by analyzing the effect of the enzymes administered in cell culture on the vims replication rate cells inoculated with 100 TCDso/0.1 ml of VV. DNases are administered in amounts of 500 KuU/ml. VV inoculated cells treated with DNase and DNase complexes are incubated for 48 h at 37°C. Thereafter, the cells were frozen and the VV titer is determined and expressed in log TCD/0.1 ml. The antiviral effect of the DNase-complexes is shown in Table 4B.
- HepG2 intact cells HepG2 VV-infected cells
- MPP-PEG-PNA-DNase Since intermediate forms of viral RNA appear during replication of VV DNA, the combined effect of MPP-PEG-PNA-DNase and MPP-PEG-PNA-RNase should result in a stronger inhibitory effect on replication of VV than each of these preparations separately.
- the MPP-PEG-PNA-RNase and MPP-PNA-PEG-DNase complexes are prepared as described in Example 1.
- Vaccinia vims (VV) during replication forms intermediate mRNA molecules that encode viral proteins.
- Replication of HIV is initiated by reverse transcription of viral genomic RNA, to form hybrid RNA-DNA, the RNA susceptible to digestion by RNase H.
- a single-stranded DNA is replicated and dsDNA is integrated into the host genome, to be transcribed by DNA-dependent RNA polymerase.
- the newly appearing mRNA is translated to form reverse transcriptase (RT) and capsid proteins.
- RT reverse transcriptase
- RNA-DNA molecule an RNase H for digesting RNA within the hybrid RNA-DNA molecule
- a ssDNase such as Ser-His-Asp (SHD) for digesting ssDNA that remains after hydrolysis of RNA within RNA-DNA hybrid
- DNase I that can digest dsDNA
- RNase I for digesting RNA
- MT-4 cells are cultured in 96-well microplates in Eagle's medium supplemented by 10% heat-inactivated FBS, 300 ⁇ g/ml L-glutamine and 100 ⁇ g/ml streptomycin, and are infected by mixing the cell suspension (2 x 10 6 cells per ml) with the vims suspension.
- the multiplicity of infection (MOI) is 0.2. The mixture is incubated for lh at 37°C for vims adso ⁇ tion.
- the infected cells are then diluted to a concentration of 5x10 5 cells per ml by adding fresh complete medium, and are cultured at 37 C in a 5% CO 2 atmosphere in the presence or absence of various combinations of nucleases in 96-well microplates, in triplicate for each concentration.
- the control cells are cultured under the same conditions.
- Non-infected MT-4 cells
- DNase-PEG [0;10; 100; 500] n.d. n.d HIV-infected MT-4 cells
- nucleoside analogues starting from AZT, non-nucleoside reverse transcriptase inhibitors (NNRT) and HIV protease inhibitors eventually induce HIV resistance and loose their therapeutic activity.
- NRT non-nucleoside reverse transcriptase inhibitors
- drug-resistance is developed due to the mutations altering the nucleotide sequences of genes encoding the HIV structures such as reverse transcriptase (RT) or HIV protease targeted by anti-HIV dmgs.
- viral nucleic acids dissociate themselves from protecting proteins and, therefore, become susceptible to hydrolytic action of nucleases, leaving little chance of survival of mutants with altered sequences.
- the experiments in this example are designed to demonstrate this conception.
- MT-4 cells are infected with wild-type HIV-1 (HXB2). Infected MT-4 cells are then exposed to low concentrations of AZT or the nucleolytic composition RDP of the present invention, a formulation consisting of human RNase-PEG-PNA-R8 + human DNase-PEG- PNA-R8 + synthetic nucleolytic tri-peptide D-Ser-His-D-Asp (P).
- the nucleases are covalently attached to PEG, R8 and PNA as described in Example 1. Progeny vims was recovered and serially passaged in MT-cells in the presence of increasing concentrations of either AZT or RDP. The sensitivity of vims recovered after each passage to AZT or RDP is assessed by a plaque reduction assay performed in CD4 + HeLa cells.
- Emergence of resistant vims is observed in AZT treated cells, as is shown by the progressive vims growth during each subsequent passage.
- ICso values exceed 50 ⁇ M.
- the ICso values of sixth passage of vims is in excess of 250 ⁇ M, representing a > 1000- fold shift in sensitivity.
- a rise of resistance to RDP is not observed even by the 10 th passage.
- the presented data support the concept that resistance to nucleases does not develop even after very long-term treatment.
- cells are inoculated at a multiplicity of infection (MOI) of 0.1 TCID 50 per cell and distributed into triplicate wells of 96 well plates (10 4 cells per well) containing serial twofold dilutions of dmg. Complete killing of cells that are not dmg-treated occurs on day 7, as determined by the MTT-dye reduction method.
- MOI multiplicity of infection
- Table 7 shows that vims susceptibility to AZT significantly decreases with each passage, while vims remains susceptible to RDP after each consecutive passage.
- HeLa cells expressing CD4 + used in a plaque reduction assay are as described in (Larder et al., Lancet 243, 1731-1734, 1989). Briefly, 24-well culture plates containing cell monolayers are inoculated with vims in various concentrations of antiviral dmg in medium. Duplicate wells are prepared for each dilution, and the percentage plaque reduction is determined based on the value of the control without the drug. The IC 50 is calculated with the median effect plot. As shown in Table 7, HIV-1 infected cell culture is serially passaged with increasing the AZT and RDP concentrations. Dmg concentration is guided by the degree of viral replication of the previous passage. The Table shows that culture with AZT results in appearance of AZT-resistant HIV-1, however, culture with RDP does not cause the appearance of resistant vimses.
- CSR cell surface receptors
- T4 lymphocytes has high affinity for HIV protein gpl20.
- Bovine DNase-PEG-CD4 complex exhibits a higher concentration of the compound inside HIV-infected cells, and has a greater anti-HIV activity compared to DNase-PEG.
- Table 8 Attachment of CD4 CSR to DNase-PEG complex increases anti-HIV activity
- Non-infected MT-4 cells
- Antiviral nucleases are modified to be resistant to gastro-intestinal proteases for application by per oral, intranasal or other non-parenteral routes. Resistance of nucleases to endogenous proteases is achieved by attachment of PEG and hydrophobic entities such as DSPE and/or protease inhibitors.
- PEG and hydrophobic entities such as DSPE and/or protease inhibitors.
- composition of human DNase-PEG-DSPE + human RNase-PEG-DSPE protects volunteers against respiratory diseases caused by infection with DNA adenovims and RNA influenza vims.
- Compositions of other enzymes digesting both RNA and DNA such as (D-Ser-His-D-Asp)-PEG-DSPE, modified to be resistant to gastrointestinal proteases by attachment of PEG and a hydrophobic entity such as DSPE and/or protease inhibitors, can be used for prevention of AIDS by peroral application administered, for example, as pills.
- An alternative route of delivery is inhalation of aerosols of the nucleases formulated for resistance to endogenous proteases as described above.
- Antiviral activity of modified RNase A in mice infected with influenza virus Influenza vims A Aichi/2/68/H3N2 adapted to replication in mouse lungs is used in the experiments of this Example.
- the titer of vims is 5.0 log LDso.
- Mice (body weight 15-17 g) are inoculated by intranasal administration of vims in a dose of 10 LDso in 0.05 ml, 20 mice in each group. After infection mice are treated by intraperitoneal or intranasal administration of bovine RNase A (RNase), RNase-PEG or RNase-PEG-R8 in a dose of 2000 UA/g of body weight.
- RNase bovine RNase A
- RNase-PEG RNase-PEG
- RNase-PEG-R8 a dose of 2000 UA/g of body weight.
- Preparations of RNase are administered on the first, third and fifth days after the infection, and animals are observed for 15 days. Control animals are administered Hanks solution by the same route. Survival of animals and the influenza vims titer in their lungs are determined as described in Example 13.
- Table 9 Antiviral activity of modified RNase in mice inoculated by influenza vims administered by intraperitoneal (i.p.) or intranasal (i.n.) routes.
- PEG-rRNase-PNA against ssRNA WNV is studied.
- WNV and monolayer culture of newborn rabbit kidney cells (RKC) were obtained from ATCC.
- Cell medium consists of 0.5 lactalbumin hydrolysate and Hanks medium (45%+ 45%) and 10% FBS.
- the maintenance medium does not contain FBS.
- Antiviral effect of RNase, prRNase, PEG-prRNase, MPP- PEG-rRNase and PNA-prRNase-PEG- PEG- rRNase-PNA against ssRNA WNV is compared.
- the experimental data in Table 1 demonstrate that prRNase-PEG-PNA-R8 complex has the highest antiviral activity against West Nile vims.
- the doses of the antiviral complexes are expressed in the units of RNase activity (UA). All values are the average of four replicate determinations.
- FMD Foot-and-mouth disease
- FMD is a cause of epizootics in many countries, leading to death or sacrifice of thousands of animals and significant economic losses.
- FMD is caused by a ssRNA vims (FMDV).
- FMDV ssRNA vims
- viral genomic ssRNA is transformed into dsRNA form, which is translated to provide viral proteins and transcribed to synthesize progeny viral ssRNAs, which are assembled into FMD virions.
- Table 1 shows that a combination of bovine RNase A, digesting ssRNA, and bovine RNase III or Benzonase®, for the pu ⁇ ose of digesting dsRNA, exhibits a greater antiviral effect than each of the enzymes applied separately. Attachment of the enzymes to PEG further increases the antiviral effect of the combined treatment.
- FMD foot-and-mouth disease
- FMDV of 0-type is diluted in 0.5% lactalbumin hydrolysate in Earl's medium, and is injected s.c (500 UA of RNase A within 3 hours after s.c inoculation of 1000 LD 50 of FMDV).
- Table 12 shows that a single dose is sufficient to prevent the development of FMD in guinea pigs.
- the preventive effect of RNase lasts for at least 4 hours after a single injection of the enzyme, while a preventive effect of RNase-PEG lasts for at least about 100 hours after the injection.
- Multiply-charged (mc) human DNase I exhibits enhanced antiviral activity against dsDNA herpes simplex virus in vitro
- the example shows that significantly higher antiviral activity is obtained by treatment with multiply-charged recombinant human pancreatic DNase I (mcDNase) against he ⁇ es vims, compared with that obtained with the wild-type recombinant human DNase I (DNase).
- mcDNase multiply-charged recombinant human pancreatic DNase I
- DNase wild-type recombinant human DNase I
- the mcDNase I is characterized by an increased hydrolytic activity towards its prefe ⁇ ed dsDNA substrate, and significantly decreased binding affinity to G- actin, a potent inhibitor of DNase I.
- the recombinant mcDNase I harbors substitutions E13CR 2+ /T14K/H44R/N74K T205K/A114CR 2+ of amino acids at six positions, providing 8 additional positive charges in the amino acid sequence: where T14, H44, N74 and T205 amino acids are replaced by singly-charged positive lysine, and El 3 and A114 amino acids are substituted with Cys (C) residues with subsequent chemical modified by
- He ⁇ es simplex vims, type 1 (HSV-1), infectious titer 5.5 log TCDso/O.l ml, and cell culture HEP-2 were obtained from ATCC.
- Cells are grown in 199/Eagle's medium (45% + 45%) with 10% of inactivated fetal bovine serum (FBS). To maintain the cells the growth medium 199 is used.
- Antiviral activity of enzymes was determined by the effect on the vims replication rate of different doses of enzymes added to a cell culture inoculated with 100 TCDso/O.l ml of HVS-1 on the vims replication rate.
- Each of DNase and mcDNase are administered in amounts of 10, 100, 500 and 1000 UA ml.
- HEP-2 cells pretreated with mcDNase and DNase are inoculated with HSV-1 and incubated for 48 h at 37°C. Thereafter, the cells are frozen and the HVS-1 titer is determined and expressed as log TCD/O.l ml.
- the antiviral effect of DNase and mcDNase(+8) against HSV-1 is shown in Table 13.
- the data show that mcDNase and DNase are effective in reducing the HSV titer, both as a function of concentration. Further, mcDNase was more effective than DNase, at each concentration.
- CMV infectious titer 5.5 log TCDso/O.l ml
- cell culture HEP-2 inactivated fetal bovine semm
- Antiviral activity of enzymes is determined by extent of effect of the nucleases on vims replication rates.
- DNase and arDNase are added to the cell culture inoculated with 100 TCDso/ ⁇ .1 ml of CMV in the amounts of 10, 50, 100 and 500 UA/ml.
- the CMV inoculated HEP-2 cells are treated with DNase and arDNase and incubated for 48 hours at 37°C. Thereafter, the cells are frozen and the CMV titer is determined and expressed as log TCD/0.1 ml as shown in Table 14.
- Table 15 show antiviral activity of the nucleolytic tri-peptide carrying non-natural D-amino acids D-Ser-His-D-Asp, and significantly enhanced antiviral activity of P 3 covalently associated with PEG and membrane penetrating peptide R8: P-PEG-R8 against he ⁇ es vims simplex I (HSV-I) in vitro.
- Bovine RNase A with preferred hydrolytic activity towards ssRNA is more efficacious in inhibition of the replication ofssRNA coronavirus than that ofdsRNA reovirus
- the Example shows that bovine RNase A, which exhibits preferential hydrolytic activity towards an ssRNA substrate, inhibits replication of ssRNA coronavims more efficaciously than it inhibits replication of dsRNA reovims.
- a similar effect is observed comparing resistance to proteases (prRNase) of recombinant bovine RNase A, and its derivatives having a substitution of A20P.
- RNase A 200 UA
- Both vimses are grown in HEP-2 cells in a medium consisting of lactalbumin and 199 medium in equal amounts supplemented with 10% of FBS.
- HEP-2 monolayers in 10 cm plastic dishes are inoculated with 100 TCDso/O.l ml of coronavims or reovims. Nucleases are added to the medium after 60 min of vims adso ⁇ tion.
- Human RNase III inhibits replication ofdsRNA reovirus to a greater extent than that of ssRNA coronavirus
- the Example demonstrates that human RNase III, having preferential hydrolytic activity towards dsRNA compared to ssRNA, inhibits replication of dsRNA reovims to a greater extent than that of ssRNA coronavims (see Table 17).
- the example demonstrates that administration of a therapeutic composition having combined human RNase III and human RNase I results in greater antiviral activity against replication of dsRNA reovims than administration of each of these enzymes separately, in equivalent amounts of enzymatic units of activity (UA/ml) (see Table 18).
- the reovims stock preparation used in this example has a titer of 5.5 log CPDso/0.1 ml.
- Vims is grown in HEP-2 cells in a medium consisting of lactalbumin: 199 medium in equal amounts supplemented with 10% of FBS.
- HEP-2 monolayers in 10 cm plastic dishes are inoculated with 100 CPDso/0.1 ml of reovims. The nucleases are added to the medium after 60 min of vims adso ⁇ tion.
- the Rl-resistant and protease-resistant variant ofhuman RNase I (iprRNase) is more active against ssRNA coronavirus A than wild-type RNase I
- the example shows that the genetically engineered RI- and protease-resistant variant of human RNase I having amino acid substitutions Q11A/A20P/N71A/E111A exhibits significantly higher antiviral activity against ssRNA coronavims compared to that of wild-type (wt) human RNase I (see Table 19). Conditions of the experiment are as described in previous examples.
- Benzonase a nuclease with hydrolytic activity against DNA and RNA, inhibits replication ofssDNA, dsDNA, ssRNA and dsRNA viruses
- bacterial nuclease Benzonase ® a nuclease having high hydrolytic activity with each of single-stranded and double stranded DNA and RNA substrates, effectively inhibits replication of dsDNA vaccinia vims, ssDNA parvovims, dsRNA reovims and ssRNA coronavims (see Table 20). Conditions of cell culture experiments are given in previous examples. Table 20. Benzonase inhibits replication of single-stranded and double stranded
- the genetically-engineered RI- and protease-resistant variant of human RNase I (riprRNase I) having substitutions Q11A/A20P/N71A/E111A and covalently attached to PEG-R8 exhibits much greater antiviral activity against ssRNA corona vims than native RNase I.
- Attachment of 2x10 kDa CHO-PEG-R8 to the N-terminal amine of riprRNase I is ca ⁇ ied out at pH of 5.0 following the procedure described in Example 1.
- the modified iprRNase 25 mg
- 1 ml of distilled water is applied to a Sephadex G-25 column (1.6 x 14.0 cm) in 10 mM CaCl 2 .
- the suspension is centrifuged to clarify, the supernatant solution is applied to a Sephadex G-75 column (1.6 x 3.0 cm), and the product is eluted with 5 mM CaCl 2 (2.0- 2.4 ml fractions).
- the protein content is detected spectrophotometrically at 280 nm6, and the product is stored at 4°C.
- the labeled ipr*RNase-PEG-R8 exhibits stronger antiviral efficacy against ssRNA corona vims compared with ipr ⁇ RNase I and ⁇ RNase I (see Table 21) .
- Table 21 Enhanced antiviral activity ofhuman iprRNase I-pEG-R8 against ssRNA corona vims compared with iprRNase I and RNase I.
- ⁇ indicates fluorescamine label
- Antiviral treatment of plants by modified antiviral nucleases Viral infections are a cause of significant economic losses in agriculture, and most known plant vimses have RNA genomes.
- RNase A-like and RNase Ill-like nucleases exhibit preferential hydrolytic activity towards ssRNA and dsRNA respectively, and non-specific nucleases such as Benzonaze digest both RNA and DNA.
- the nucleases can be chemically and genetically modified as described herein to obtain compositions enhanced hydrolytic activity and protection from endogenous proteases and nuclease inhibitors.
- the example demonstrates that treatment of potato apical meristem with Benzonase (BNase) increases the yield of vims-free plants.
- BNase Benzonase
- PEG and R8 are attached to Benzonase to obtain BNase-PEG-R8 conjugate, which exhibits enhanced antiviral activity towards a number of plant vimses.
- Application of BNase-PEG-R8 to potatoes infected by plant vimses is found to yield vims-free potatoes.
- Dry components of the Murashigo-Scooga medium (MSM), necessary to prepare 100 ml of the medium, are dissolved in 90 ml of distilled water and sterilized by autoclaving. Benzonase is added in amount 100,000 Kunitz units/10 ml of medium.
- MSM Murashigo-Scooga medium
- the sterile lyophilized Benzonase in effective amounts is dissolved in 10 ml of sterile distilled water. When the medium is cooled to about 45°C, the solution of benzonase (10 ml) was added. To 100 ml of nutritive medium 0.5 ml of 20% sterile solution of MgSO4 is added. Polyethylene glycol (mPEG-NHS, MW 10 kDa) and K-R8 are covalently attached to Benzonase following the procedure described in Example 1.
- RNA and DNA avian viruses such as avian influenza A, avian adenovims, fowl pox and other poultry vimses are responsible for highly contagious viral diseases causing epizootics which cannot be effectively prevented or treated.
- DNase-like and RNase- like native and modified nucleases of this invention including Benzonase, oligopeptides such as Ser-His and Ser-His-Asp, and chemical nucleases such as transition metal compounds with nucleolytic properties, are applied for treatment of vimses in chicken, turkey and other birds.
- a group of 20 chickens is treated with aerosol of di-peptide D-Ser- His or tri-peptide D-Ser-His-FD-Asp dissolved in saline, twice per day for 3 days, while 20 control chickens are treated with saline. All chickens are infected with avian adenovims. All control chickens develop bronchitis and succumb while 18 and 19 chickens out of 20 treated with D-Ser-His and D-Ser-His-D-Asp, respectively, survive.
- modified nucleases for protecting honeybees from virus causing epizootics of honeybee viral paralysis
- Infectious titer of HBVP is 10 " per ml.
- the honeybees are infected by feeding the viral emulsion.
- Insects are sprayed by an aerosol of enzyme diluted in physiological solution 3 hours before the inoculation of vims.
- Table 23 shows that the enzymes penetrate the body fluids and cells through respiratory pores. Treatment of insects 6 hours after inoculation of vims still protected them from development of disease.
- RNase A [200,500,1000,1500] 100 [4, 11, 67, 100] RNase A-PEG [200,500,1000,1500] 100 [28, 46, 100, 100] BNase [200,500,1000,1500] 100 [12, 21, 72, 100] BNase-PEG [200,500,1000,1500] 100 [32, 78, 100, 100] EXAMPLE 38
- Nuclear polyhedrosis is a viral disease with a devastating effect on this field of agriculture. Selection for resistance as well as radiation treatment are not used widely in view of low efficacy of these methods of protection against this disease.
- Spraying silkworms with 500 UA/ml Benzonase (BNase) is herein found to be non-toxic and protective from the development of the nuclear polyhedrosis.
- BNase-PEG complex exhibits enhanced antiviral efficacy compared with that of wild-type BNase (see Table 24).
- Leukemia in AKR mice is known to be promoted by mouse leukemia vims.
- the lymphoid tissues of AKR mice contain mouse leukemia vims, and spontaneously develop leukemia, at the age of 6-8 months.
- Administration of bovine DNase I and bovine TDNase to AKR mice s.c. in amounts of 5,000 KuU/g body weight every second day for a month is found herein to preclude the development of leukemia.
- the experiment is ca ⁇ ied out on 9-10 month old AKR mice with manifestations of lymphoid leukemia.
- the treated groups include 24 mice in each while the control group includes 19 mice.
- the example demonstrates enhanced efficacy of combined RNase and DNase for treatment of ssRN A equine encephalitis vims.
- the enzymes are pegylated, and RNase-PEG and DNase-PEG are applied.
- Complementary viral ssDNA production may involve endogenous reverse transcriptase (RT) in cells infected by RNA vimses such as lymphocytic choriomeningitis vims (LCMV; Klenerman, et al., Letters to Nature, 390: 298-301, 1997), polio, and measles vimses (Zhdanov, Nature 256: 471-473, 1975).
- RNA vimses such as lymphocytic choriomeningitis vims (LCMV; Klenerman, et al., Letters to Nature, 390: 298-301, 1997), polio, and measles vimses (Zhdanov, Nature 256: 471-4
- endogenous RT may reverse-transcribe RNA derived from other infectious vimses (Zhdanov, Nature 256: 471-473, 1975).
- the source of the endogenous RT could be an endogenous retrovirus or another interspersed element (Wiener et al., A. Rev. Biochem. 55, 631-661, 1986), wherein reverse transcripts from such endogenous sources may account for 10-20% of the mammalian genome (Coffin, in Reverse Transcriptase, pp.445-479, 1993, Eds. Skalka and Gough, Cold Spring Harbor Lab Press, NY).
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Chemical & Material Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Medicinal Chemistry (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Organic Chemistry (AREA)
- Epidemiology (AREA)
- Virology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Immunology (AREA)
- Oncology (AREA)
- Communicable Diseases (AREA)
- Gastroenterology & Hepatology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Biochemistry (AREA)
- General Engineering & Computer Science (AREA)
- Genetics & Genomics (AREA)
- Wood Science & Technology (AREA)
- Zoology (AREA)
- Molecular Biology (AREA)
- Biotechnology (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
- Enzymes And Modification Thereof (AREA)
- Peptides Or Proteins (AREA)
Priority Applications (8)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| AU2005247298A AU2005247298B8 (en) | 2004-04-14 | 2005-04-14 | Compositions with modified nucleases targeted to viral nucleic acids and methods of use for prevention and treatment of viral diseases |
| US11/578,716 US9592277B2 (en) | 2004-04-14 | 2005-04-14 | Compositions with modified nucleases targeted to viral nucleic acids and methods of use for prevention and treatment of viral diseases |
| EP05780021A EP1734991A4 (en) | 2004-04-14 | 2005-04-14 | COMPOSITIONS COMPRISING MODIFIED NUCLEASES DIRECTED AGAINST VIRAL NUCLEIC ACIDS AND METHODS OF USE FOR THE PREVENTION AND TREATMENT OF VIRAL DISEASES |
| JP2007508498A JP2007532666A (ja) | 2004-04-14 | 2005-04-14 | ウイルス核酸を対象とした修飾ヌクレアーゼを用いた組成物及びウイルス性疾患の予防並びに治療方法 |
| CA2604243A CA2604243C (en) | 2004-04-14 | 2005-04-14 | Compositions with modified nucleases targeted to viral nucleic acids and methods of use for prevention and treatment of viral diseases |
| IL178802A IL178802A0 (en) | 2004-04-14 | 2006-10-22 | Compositions with modified nucleases targeted to viral nucleic acids and methods of use for prevention and treatment of viral diseases |
| AU2011200602A AU2011200602A1 (en) | 2004-04-14 | 2011-02-11 | Compositions with modified nucleases targeted to viral nucleic acids and methods of use for prevention and treatment of viral diseases |
| US15/455,574 US10335372B2 (en) | 2004-04-14 | 2017-03-10 | Compositions with modified nucleases targeted to viral nucleic acids and methods of use for prevention and treatment of viral diseases |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US56193404P | 2004-04-14 | 2004-04-14 | |
| US60/561,934 | 2004-04-14 |
Related Child Applications (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US11/578,716 A-371-Of-International US9592277B2 (en) | 2004-04-14 | 2005-04-14 | Compositions with modified nucleases targeted to viral nucleic acids and methods of use for prevention and treatment of viral diseases |
| US15/455,574 Continuation US10335372B2 (en) | 2004-04-14 | 2017-03-10 | Compositions with modified nucleases targeted to viral nucleic acids and methods of use for prevention and treatment of viral diseases |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2005115444A2 true WO2005115444A2 (en) | 2005-12-08 |
| WO2005115444A3 WO2005115444A3 (en) | 2006-12-14 |
Family
ID=35451407
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2005/012532 Ceased WO2005115444A2 (en) | 2004-04-14 | 2005-04-14 | Compositions with modified nucleases targeted to viral nucleic acids and methods of use for prevention and treatment of viral diseases |
Country Status (7)
| Country | Link |
|---|---|
| US (2) | US9592277B2 (https=) |
| EP (1) | EP1734991A4 (https=) |
| JP (1) | JP2007532666A (https=) |
| AU (2) | AU2005247298B8 (https=) |
| CA (1) | CA2604243C (https=) |
| IL (1) | IL178802A0 (https=) |
| WO (1) | WO2005115444A2 (https=) |
Cited By (21)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2007091958A1 (en) * | 2006-02-10 | 2007-08-16 | Dermagen Ab | Novel antimicrobial peptides and use thereof |
| EP2095825A4 (en) * | 2006-11-28 | 2009-12-30 | Dmitry Dmitrievich Genkin | METHOD FOR TREATING DISEASES OF HUMANS IN CONNECTION WITH AN INCREASED DESOXYRIBONUCLEIC ACIDITY IN EXTRACELLULAR SPACES OF FABRICS AND MEDICINAL PREPARATION FOR CARRYING OUT THE METHOD |
| WO2010040023A3 (en) * | 2008-10-03 | 2010-07-22 | Government Of The United States Of America, As Represented By The Secretary, Department Of Health & Human Services | Methods and compositions for protein delivery |
| EP2044097A4 (en) * | 2006-06-23 | 2010-10-06 | Quintessence Biosciences Inc | Modified ribonucleases |
| EP2490021A1 (en) * | 2011-02-18 | 2012-08-22 | Biotempt B.V. | Modulators of PRR and GPCR signalling |
| US8388951B2 (en) | 2003-07-14 | 2013-03-05 | Cls Therapeutics Limited | Method for treating systemic DNA mutation disease |
| US8431123B2 (en) | 2003-07-14 | 2013-04-30 | Cls Therapeutics Limited | Method for treating systemic bacterial, fungal and protozoan infection |
| US20130122054A1 (en) * | 2010-04-21 | 2013-05-16 | National University Corporation Hokkaido University | Lipid membrane structure having intranuclear migrating property |
| EP2076257A4 (en) * | 2006-09-15 | 2014-04-16 | Belrose Pharma Inc | POLYMER CONJUGATES WITH POSITIVELY LOADED PARTS |
| US8710012B2 (en) | 2003-07-14 | 2014-04-29 | Cls Therapeutics Limited | Method for treating oncological diseases |
| US8916151B2 (en) | 2005-04-25 | 2014-12-23 | Cls Therapeutics Limited | Method for treating a reduction of fertility |
| US9248166B2 (en) | 2003-07-14 | 2016-02-02 | Cls Therapeutics Limited | Method for treating oncological diseases |
| US10538743B2 (en) | 2012-03-26 | 2020-01-21 | The Usa, As Represented By The Secretary, Dept. Of Health And Human Services | Delivery of packaged RNA to mammalian cells |
| US10617743B2 (en) | 2014-06-19 | 2020-04-14 | Cls Therapeutics Limited | Method to improve safety and efficacy of anti-cancer therapy |
| US10743538B2 (en) | 2014-10-01 | 2020-08-18 | Plant Health Care, Inc. | Elicitor peptides having disrupted hypersensitive response box and use thereof |
| US10856547B2 (en) | 2014-10-01 | 2020-12-08 | Plant Health Care, Inc. | Hypersensitive response elicitor peptides and use thereof |
| US11701410B2 (en) | 2015-05-22 | 2023-07-18 | Cls Therapeutics Limited | Extracellular DNA as a therapeutic target in neurodegeneration |
| US11718861B2 (en) | 2013-12-16 | 2023-08-08 | The Usa, As Represented By The Secretary, Dept. Of Health And Human Services | Cancer immunotherapy by delivering class II MHC antigens using a VLP-replicon |
| US11905522B2 (en) | 2018-01-16 | 2024-02-20 | Cls Therapeutics Limited | Treatment of diseases by liver expression of an enzyme which has a deoxyribonuclease (DNase) activity |
| US12139617B2 (en) | 2017-12-22 | 2024-11-12 | North Carolina State University | Polymeric fluorophores, compositions comprising the same, and methods of preparing and using the same |
| EP4203968A4 (en) * | 2020-08-31 | 2025-07-30 | Starpharma Pty Ltd | DENDRIMER-DRUG CONJUGATE |
Families Citing this family (29)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US9592277B2 (en) * | 2004-04-14 | 2017-03-14 | Avirid, Inc. | Compositions with modified nucleases targeted to viral nucleic acids and methods of use for prevention and treatment of viral diseases |
| WO2007133812A2 (en) * | 2005-12-30 | 2007-11-22 | Philadelphia Health & Education Corporation, D/B/A Drexel University College Of Medicine | Improved carriers for delivery of nucleic acid agents to cells and tissues |
| WO2011031467A1 (en) * | 2009-08-25 | 2011-03-17 | Wayne State University | Anti-cancer therapeutic strategy to overcome cancer resistance and to enable tailoring treatment to patients |
| GB0922066D0 (en) | 2009-12-17 | 2010-02-03 | Univ Belfast | Modulator |
| CA2787260A1 (en) * | 2010-01-18 | 2011-07-21 | Zhi-Min Yuan | Methods and compositions for nanoparticle-mediated cancer cell-targeted delivery |
| KR101341640B1 (ko) * | 2010-02-05 | 2013-12-16 | 한국전자통신연구원 | 단백질 미세 구조 분석 방법 및 단백질 미세 구조 분석용 어레이 |
| WO2013126872A1 (en) * | 2012-02-24 | 2013-08-29 | Wayne State University | Anti-cancer therapeutic strategy to overcome cancer resistance and to enable tailoring treatment to patients |
| CA2898184A1 (en) | 2013-01-16 | 2014-07-24 | Emory University | Cas9-nucleic acid complexes and uses related thereto |
| WO2014197091A2 (en) * | 2013-03-15 | 2014-12-11 | Techulon Inc. | Rapidly adaptable nano therapeutics for treatment of infectious disease |
| US11306326B2 (en) | 2013-08-23 | 2022-04-19 | Rutgers, The State University Of New Jersey | Biologically active synthetic nanoparticle constructs and methods of use thereof |
| WO2015027243A2 (en) * | 2013-08-23 | 2015-02-26 | Rutgers The State University Of New Jersey | Biologically active synthetic nanoparticle constructs and mehtods of use therof |
| US10117911B2 (en) | 2015-05-29 | 2018-11-06 | Agenovir Corporation | Compositions and methods to treat herpes simplex virus infections |
| CN116082457A (zh) | 2016-02-01 | 2023-05-09 | 堪培拉大学 | 蛋白化合物及其用途 |
| WO2019090390A1 (en) | 2017-11-08 | 2019-05-16 | University Of Canberra | Immunogenic compositions and uses therefor |
| WO2019099685A1 (en) | 2017-11-15 | 2019-05-23 | Rutgers, The State University Of New Jersey | Biodegradable hybrid inorganic nanoscaffolding materials and methods of use and manufacture thereof |
| EP3821003A4 (en) * | 2018-07-09 | 2022-07-20 | Gro Biosciences Inc. | Non-standard amino acid containing compositions and uses thereof |
| WO2020106709A1 (en) * | 2018-11-19 | 2020-05-28 | Gro Biosciences Inc. | Human dnase for lung disease |
| JP7469318B2 (ja) * | 2019-01-28 | 2024-04-16 | マイクロベンション インコーポレイテッド | コーティング |
| US12478684B2 (en) * | 2019-04-11 | 2025-11-25 | Northeastern University | Oligonucleotide-polymer miktoarm conjugates and methods of use |
| WO2021046307A1 (en) * | 2019-09-04 | 2021-03-11 | North Carolina State University | Hybridized poly(amidoamine)-amino acid dendrimers |
| WO2021150867A1 (en) * | 2020-01-24 | 2021-07-29 | Sarepta Therapeutics, Inc. | Designing antisense oligonucleotide delivery peptides by interpretable machine learning |
| WO2021231499A2 (en) * | 2020-05-11 | 2021-11-18 | Revir, Inc. | Compositions and methods for treating viral infections |
| CA3178744C (en) | 2020-05-13 | 2023-11-14 | Ardythe L. Morrow | Fucosylated oligosaccharides for prevention of coronavirus infection |
| WO2021231750A1 (en) * | 2020-05-13 | 2021-11-18 | Glycosyn LLC | 2'-fucosyllactose for the prevention and treatment of coronavirus-induced inflammation |
| WO2022026689A1 (en) | 2020-07-30 | 2022-02-03 | Microvention, Inc. | Antimicrobial coatings |
| US20220040315A1 (en) | 2020-08-09 | 2022-02-10 | Fulu Labs Corporation | Nuclease-dendrimer formulations for covid-19 and broad-spectrum antiviral therapy and prophylaxis |
| CN117651550A (zh) * | 2021-07-02 | 2024-03-05 | 奥古尔·米尔扎尤索夫娜·穆萨哈诺娃 | 用于预防SARS-CoV-2感染的药物 |
| CN114250208B (zh) * | 2021-12-22 | 2023-07-25 | 武汉瀚海新酶生物科技有限公司 | 耐高盐高活性DNase I突变体的制备及应用 |
| WO2024092230A2 (en) * | 2022-10-28 | 2024-05-02 | The Regents Of The University Of California | Recombinant enhanced antiviral restrictors |
Family Cites Families (36)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5115096A (en) | 1988-04-15 | 1992-05-19 | Oncogen | Amphiregulin: a bifunctional growth modulating glycoprotein |
| WO1990010015A1 (en) * | 1989-02-23 | 1990-09-07 | Seragen, Inc. | Chimeric toxin |
| US5629173A (en) * | 1990-08-09 | 1997-05-13 | Genentech, Inc. | Methods of use of serine protease variants having peptide ligase activity |
| US5989886A (en) * | 1991-01-02 | 1999-11-23 | The Johns Hopkins University | Method for the inhibition and prevention of viral replication using fusions of a virus protein and a destructive enzyme |
| US5792640A (en) | 1992-04-03 | 1998-08-11 | The Johns Hopkins University | General method to clone hybrid restriction endonucleases using lig gene |
| US5484589A (en) | 1992-04-20 | 1996-01-16 | Rufeld, Inc. | Anti-viral methods using RNAse and DNAse |
| US5503973A (en) | 1992-05-29 | 1996-04-02 | The Regents Of The University Of California | Method for inhibition of viral morphogenesis |
| AU7212694A (en) | 1993-06-24 | 1995-01-17 | Rufeld, Inc. | Inhibition of human immunodeficiency virus reproduction by deoxyribonuclease i |
| RU2066551C1 (ru) | 1994-03-23 | 1996-09-20 | Институт нефтехимического синтеза РАН | Способ получения инсулинсодержащих полимерных гидрогелей |
| US20030053982A1 (en) | 1994-09-26 | 2003-03-20 | Kinstler Olaf B. | N-terminally chemically modified protein compositions and methods |
| US5997861A (en) * | 1994-10-31 | 1999-12-07 | Burstein Laboratories, Inc. | Antiviral supramolecules containing target-binding molecules and therapeutic molecules bound to spectrin |
| US6348343B2 (en) * | 1995-02-24 | 2002-02-19 | Genentech, Inc. | Human DNase I variants |
| US5690942A (en) * | 1995-06-02 | 1997-11-25 | American Home Products Corporation | Adjuvants for viral vaccines |
| US7432048B2 (en) * | 1996-11-29 | 2008-10-07 | Third Wave Technologies, Inc. | Reactions on a solid surface |
| US5739512A (en) | 1996-05-30 | 1998-04-14 | Sun Microsystems, Inc. | Digital delivery of receipts |
| US6391607B1 (en) * | 1996-06-14 | 2002-05-21 | Genentech, Inc. | Human DNase I hyperactive variants |
| US6214966B1 (en) * | 1996-09-26 | 2001-04-10 | Shearwater Corporation | Soluble, degradable poly(ethylene glycol) derivatives for controllable release of bound molecules into solution |
| US6280991B1 (en) | 1997-10-15 | 2001-08-28 | Wisconsin Alumni Research Foundation | Engineered cytotoxic ribonclease |
| US6017537A (en) * | 1998-12-18 | 2000-01-25 | Connaught Laboratories, Inc. | Formyl methionyl peptide vaccine adjuvant |
| AU2200100A (en) | 1998-12-21 | 2000-07-12 | Genencor International, Inc. | Chemically modified enzymes with multiple charged variants |
| US6485718B1 (en) | 1999-04-13 | 2002-11-26 | Pharmacia Corporation | Site specific ligation of proteins to synthetic particles |
| ATE340592T1 (de) | 1999-04-23 | 2006-10-15 | Alza Corp | Konjugate enthaltend eine spaltbare bindung zur anwendung in einem liposom |
| US6669951B2 (en) | 1999-08-24 | 2003-12-30 | Cellgate, Inc. | Compositions and methods for enhancing drug delivery across and into epithelial tissues |
| US6593292B1 (en) | 1999-08-24 | 2003-07-15 | Cellgate, Inc. | Compositions and methods for enhancing drug delivery across and into epithelial tissues |
| US20010053521A1 (en) * | 1999-09-27 | 2001-12-20 | Kreimer David I. | Amplification of analyte detection by substrates having particle structures with receptors |
| US6312956B1 (en) | 1999-10-01 | 2001-11-06 | Vanderbilt University | Nuclear targeted peptide nucleic acid oligomer |
| US6962906B2 (en) | 2000-03-14 | 2005-11-08 | Active Motif | Oligonucleotide analogues, methods of synthesis and methods of use |
| EP2213743A1 (en) | 2000-04-12 | 2010-08-04 | Human Genome Sciences, Inc. | Albumin fusion proteins |
| US7091026B2 (en) | 2001-02-16 | 2006-08-15 | University Of Iowa Research Foundation | Artificial endonuclease |
| AU2002317437A1 (en) * | 2001-05-18 | 2002-12-03 | Cureon A/S | Therapeutic uses of lna-modified oligonucleotides in infectious diseases |
| US6913903B2 (en) | 2001-09-07 | 2005-07-05 | Nobex Corporation | Methods of synthesizing insulin polypeptide-oligomer conjugates, and proinsulin polypeptide-oligomer conjugates and methods of synthesizing same |
| GB0126251D0 (en) * | 2001-11-01 | 2002-01-02 | Imp College Innovations Ltd | Methods |
| BR0314236A (pt) | 2002-09-13 | 2005-08-09 | Replicor Inc | Formulação de oligonucleotìdeo, composição farmacêutica, kit, composto antiviral, preparação de oligonucleotìdeo e métodos para seleção de um oligonucleotìdeo antiviral para uso como um agente antiviral, para profilaxia ou tratamento de uma infecção viral em um paciente, para tratamento profilático de câncer causado por oncovìrus, para identificação de um composto que altera a ligação de um oligonucleotìdeo a pelo menos um componente viral, para purificação da ligação de oligonucleotìdeos a pelo menos um componente viral e para enriquecimento de oligonucleotìdeos a partir de um agrupamento de oligonucleotìdeos |
| US20040147027A1 (en) * | 2003-01-28 | 2004-07-29 | Troy Carol M. | Complex for facilitating delivery of dsRNA into a cell and uses thereof |
| JP2008505853A (ja) * | 2004-04-13 | 2008-02-28 | クインテセンス バイオサイエンシーズ インコーポレーティッド | 細胞傷害性薬剤としての非天然のリボヌクレアーゼ複合体 |
| US9592277B2 (en) * | 2004-04-14 | 2017-03-14 | Avirid, Inc. | Compositions with modified nucleases targeted to viral nucleic acids and methods of use for prevention and treatment of viral diseases |
-
2005
- 2005-04-14 US US11/578,716 patent/US9592277B2/en active Active - Reinstated
- 2005-04-14 JP JP2007508498A patent/JP2007532666A/ja active Pending
- 2005-04-14 WO PCT/US2005/012532 patent/WO2005115444A2/en not_active Ceased
- 2005-04-14 CA CA2604243A patent/CA2604243C/en not_active Expired - Lifetime
- 2005-04-14 EP EP05780021A patent/EP1734991A4/en not_active Withdrawn
- 2005-04-14 AU AU2005247298A patent/AU2005247298B8/en not_active Ceased
-
2006
- 2006-10-22 IL IL178802A patent/IL178802A0/en unknown
-
2011
- 2011-02-11 AU AU2011200602A patent/AU2011200602A1/en not_active Abandoned
-
2017
- 2017-03-10 US US15/455,574 patent/US10335372B2/en not_active Expired - Lifetime
Cited By (43)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US9248166B2 (en) | 2003-07-14 | 2016-02-02 | Cls Therapeutics Limited | Method for treating oncological diseases |
| US9463223B2 (en) | 2003-07-14 | 2016-10-11 | Cls Therapeutics Limited | Method for monitoring development of somatic mosaicism |
| US9770492B2 (en) | 2003-07-14 | 2017-09-26 | Cls Therapeutics Limited | Method for treating systemic DNA mutation disease |
| US9072733B2 (en) | 2003-07-14 | 2015-07-07 | Cls Therapeutics Limited | Method for treating systemic bacterial, fungal and protozoan infection |
| US8796004B2 (en) | 2003-07-14 | 2014-08-05 | Cls Therapeutics Limited | Method for treating systemic DNA mutation disease |
| US8710012B2 (en) | 2003-07-14 | 2014-04-29 | Cls Therapeutics Limited | Method for treating oncological diseases |
| US8388951B2 (en) | 2003-07-14 | 2013-03-05 | Cls Therapeutics Limited | Method for treating systemic DNA mutation disease |
| US8431123B2 (en) | 2003-07-14 | 2013-04-30 | Cls Therapeutics Limited | Method for treating systemic bacterial, fungal and protozoan infection |
| US9845461B2 (en) | 2003-07-14 | 2017-12-19 | Cls Therapeutics Limited | Method for treating oncological diseases |
| US8535663B2 (en) | 2003-07-14 | 2013-09-17 | Cls Therapeutics Limited | Method for treating delayed-type hypersensitivity |
| US8916151B2 (en) | 2005-04-25 | 2014-12-23 | Cls Therapeutics Limited | Method for treating a reduction of fertility |
| WO2007091958A1 (en) * | 2006-02-10 | 2007-08-16 | Dermagen Ab | Novel antimicrobial peptides and use thereof |
| EP2044097A4 (en) * | 2006-06-23 | 2010-10-06 | Quintessence Biosciences Inc | Modified ribonucleases |
| EP2076257A4 (en) * | 2006-09-15 | 2014-04-16 | Belrose Pharma Inc | POLYMER CONJUGATES WITH POSITIVELY LOADED PARTS |
| US8871200B2 (en) | 2006-11-28 | 2014-10-28 | Cls Therapeutics Limited | Method for treating human diseases associated with an increased deoxyribonucleic acid content in extracellular spaces of tissues and a medicinal preparation for carrying out said method |
| JP2010511039A (ja) * | 2006-11-28 | 2010-04-08 | ドミトリーヴィッチ ジェンキン ドミトリー | 組織の細胞外間隙においてデオキシリボ核酸の量が増量することに関連するヒトの病気の治療方法及び該方法を実施するための医薬製剤 |
| EP2095825A4 (en) * | 2006-11-28 | 2009-12-30 | Dmitry Dmitrievich Genkin | METHOD FOR TREATING DISEASES OF HUMANS IN CONNECTION WITH AN INCREASED DESOXYRIBONUCLEIC ACIDITY IN EXTRACELLULAR SPACES OF FABRICS AND MEDICINAL PREPARATION FOR CARRYING OUT THE METHOD |
| US10040830B2 (en) | 2008-10-03 | 2018-08-07 | The United States Of America, As Represented By The Secretary, Dept. Of Health And Human Services | Methods and compositions for protein delivery |
| US10577397B2 (en) | 2008-10-03 | 2020-03-03 | The Usa, As Represented By The Secretary, Dept. Of Health And Human Services | Methods and compositions for protein delivery |
| US9296790B2 (en) | 2008-10-03 | 2016-03-29 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Methods and compositions for protein delivery |
| WO2010040023A3 (en) * | 2008-10-03 | 2010-07-22 | Government Of The United States Of America, As Represented By The Secretary, Department Of Health & Human Services | Methods and compositions for protein delivery |
| EP2572706A4 (en) * | 2010-04-21 | 2014-02-26 | Univ Hokkaido Nat Univ Corp | Lipid membrane structure with nucleic acid transportability |
| US8981044B2 (en) | 2010-04-21 | 2015-03-17 | National University Corporation Hokkaido University | Lipid membrane structure having intranuclear migrating property |
| JP5794541B2 (ja) * | 2010-04-21 | 2015-10-14 | 国立大学法人北海道大学 | 核内移行性を有する脂質膜構造体 |
| US20130122054A1 (en) * | 2010-04-21 | 2013-05-16 | National University Corporation Hokkaido University | Lipid membrane structure having intranuclear migrating property |
| WO2012112048A1 (en) | 2011-02-18 | 2012-08-23 | Biotempt B.V. | Modulators of prr and gpcr signalling |
| EP2490021A1 (en) * | 2011-02-18 | 2012-08-22 | Biotempt B.V. | Modulators of PRR and GPCR signalling |
| US10538743B2 (en) | 2012-03-26 | 2020-01-21 | The Usa, As Represented By The Secretary, Dept. Of Health And Human Services | Delivery of packaged RNA to mammalian cells |
| US12049639B2 (en) | 2013-12-16 | 2024-07-30 | The Usa, As Represented By The Secretary, Dept. Of Health And Human Services | Cancer immunotherapy by delivering class II MHC antigens using a VLP-replicon |
| US11718861B2 (en) | 2013-12-16 | 2023-08-08 | The Usa, As Represented By The Secretary, Dept. Of Health And Human Services | Cancer immunotherapy by delivering class II MHC antigens using a VLP-replicon |
| US10617743B2 (en) | 2014-06-19 | 2020-04-14 | Cls Therapeutics Limited | Method to improve safety and efficacy of anti-cancer therapy |
| US10897900B2 (en) | 2014-10-01 | 2021-01-26 | Plant Health Care, Inc. | Hypersensitive response elicitor peptides and use thereof |
| US10856546B2 (en) | 2014-10-01 | 2020-12-08 | Plant Health Care, Inc. | Hypersensitive response elicitor peptides and use thereof |
| AU2015325013B2 (en) * | 2014-10-01 | 2021-01-28 | PI AgSciences Inc. | Hypersensitive response elicitor peptides and use thereof |
| US10918104B2 (en) | 2014-10-01 | 2021-02-16 | Plant Health Care, Inc. | Elicitor peptides having disrupted hypersensitive response box and use thereof |
| US10856547B2 (en) | 2014-10-01 | 2020-12-08 | Plant Health Care, Inc. | Hypersensitive response elicitor peptides and use thereof |
| US11820797B2 (en) | 2014-10-01 | 2023-11-21 | Plant Health Care, Inc. | Elicitor peptides having disrupted hypersensitive response box and use thereof |
| US11820992B2 (en) | 2014-10-01 | 2023-11-21 | Plant Health Care, Inc. | Hypersensitive response elicitor peptides and use thereof |
| US10743538B2 (en) | 2014-10-01 | 2020-08-18 | Plant Health Care, Inc. | Elicitor peptides having disrupted hypersensitive response box and use thereof |
| US11701410B2 (en) | 2015-05-22 | 2023-07-18 | Cls Therapeutics Limited | Extracellular DNA as a therapeutic target in neurodegeneration |
| US12139617B2 (en) | 2017-12-22 | 2024-11-12 | North Carolina State University | Polymeric fluorophores, compositions comprising the same, and methods of preparing and using the same |
| US11905522B2 (en) | 2018-01-16 | 2024-02-20 | Cls Therapeutics Limited | Treatment of diseases by liver expression of an enzyme which has a deoxyribonuclease (DNase) activity |
| EP4203968A4 (en) * | 2020-08-31 | 2025-07-30 | Starpharma Pty Ltd | DENDRIMER-DRUG CONJUGATE |
Also Published As
| Publication number | Publication date |
|---|---|
| AU2011200602A2 (en) | 2011-05-26 |
| AU2011200602A1 (en) | 2011-03-03 |
| US20090047272A1 (en) | 2009-02-19 |
| EP1734991A4 (en) | 2012-10-24 |
| AU2005247298B8 (en) | 2011-03-10 |
| CA2604243C (en) | 2015-11-24 |
| AU2005247298A1 (en) | 2005-12-08 |
| AU2005247298B2 (en) | 2010-11-11 |
| US9592277B2 (en) | 2017-03-14 |
| EP1734991A2 (en) | 2006-12-27 |
| IL178802A0 (en) | 2007-03-08 |
| US10335372B2 (en) | 2019-07-02 |
| WO2005115444A3 (en) | 2006-12-14 |
| CA2604243A1 (en) | 2005-12-08 |
| JP2007532666A (ja) | 2007-11-15 |
| US20170209376A1 (en) | 2017-07-27 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US10335372B2 (en) | Compositions with modified nucleases targeted to viral nucleic acids and methods of use for prevention and treatment of viral diseases | |
| US20260092292A1 (en) | Rna and dna base editing via engineered adar recruitment | |
| US20240011007A1 (en) | Genome editing compositions and methods for treatment of chronic granulomatous disease | |
| AU763339B2 (en) | Stabilized nucleic acid compositions and methods of preparation and use thereof | |
| JP2024544012A (ja) | 核酸プログラマブル融合タンパク質を送達するためのセルフアセンブルウイルス様粒子ならびにその作製方法および使用方法 | |
| US12129478B1 (en) | Engineered adenosine deaminases and base editors thereof | |
| US20240424138A1 (en) | Genome editing compositions and method for treatment of retinitis pigmentosa | |
| KR20180023911A (ko) | Hiv 감염의 rna-가이드된 치료를 위한 방법 및 조성물 | |
| US9382525B2 (en) | Site-directed pegylation of arginases and the use thereof as anti-cancer and anti-viral agents | |
| CA3014795A1 (en) | Compositions and methods for treatment of cystic fibrosis | |
| US12318485B2 (en) | Methods and compositions for targeted delivery by polymersomes | |
| US20240301405A1 (en) | Guide rnas for crispr/cas editing systems | |
| CN107614515A (zh) | 用于抗hiv(人免疫缺陷病毒)疗法和/或疫苗的t20构建体 | |
| US20250325661A1 (en) | Vaccine composition | |
| Kang et al. | Cas9 conjugate complex delivering donor DNA for efficient gene editing by homology-directed repair | |
| US12472262B2 (en) | Peptide for use in the reduction of side effects in the form of immunostimulatory reactions/effects | |
| KR20220092764A (ko) | 세포 번역이 가능한 구조를 갖는 rna 발현카세트를 유효성분으로 하는 복합입자 및 이의 용도 | |
| EP1966376B1 (en) | Prevention of retroviral infectivity through interference with ppt | |
| CN117838832B (zh) | Rbm25及其相关物质在抗病毒感染中的应用 | |
| US20240156958A1 (en) | Self-adjuvanting multi-protein complexes for modular vaccine production | |
| EP4686481A1 (en) | Dna molecules with methylated and unmethylated regions | |
| KR20230135353A (ko) | 세포 번역이 가능한 구조를 갖는 rna 발현카세트를 유효성분으로 하는 복합입자 및 이의 용도 | |
| EP2468303A1 (en) | Functionalized nucleic acids and particles comprising them for the treatment of HIV infections | |
| WO2025090637A2 (en) | Genome editing compositions and methods for treatment of retinitis pigmentosa |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| AK | Designated states |
Kind code of ref document: A2 Designated state(s): AE AG AL AM AT AU AZ BA BB BG BR BW BY BZ CA CH CN CO CR CU CZ DE DK DM DZ EC EE EG ES FI GB GD GE GH GM HR HU ID IL IN IS JP KE KG KM KP KR KZ LC LK LR LS LT LU LV MA MD MG MK MN MW MX MZ NA NI NO NZ OM PG PH PL PT RO RU SC SD SE SG SK SL SM SY TJ TM TN TR TT TZ UA UG US UZ VC VN YU ZA ZM ZW |
|
| AL | Designated countries for regional patents |
Kind code of ref document: A2 Designated state(s): BW GH GM KE LS MW MZ NA SD SL SZ TZ UG ZM ZW AM AZ BY KG KZ MD RU TJ TM AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HU IE IS IT LT LU MC NL PL PT RO SE SI SK TR BF BJ CF CG CI CM GA GN GQ GW ML MR NE SN TD TG |
|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application | ||
| WWE | Wipo information: entry into national phase |
Ref document number: 2007508498 Country of ref document: JP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 11578716 Country of ref document: US |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| WWW | Wipo information: withdrawn in national office |
Ref document number: DE |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 178802 Country of ref document: IL |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2005247298 Country of ref document: AU |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2005780021 Country of ref document: EP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 6353/DELNP/2006 Country of ref document: IN |
|
| ENP | Entry into the national phase |
Ref document number: 2005247298 Country of ref document: AU Date of ref document: 20050414 Kind code of ref document: A |
|
| WWP | Wipo information: published in national office |
Ref document number: 2005247298 Country of ref document: AU |
|
| WWP | Wipo information: published in national office |
Ref document number: 2005780021 Country of ref document: EP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2604243 Country of ref document: CA |