WO2005055936A2 - Methods of killing tumor cells by targeting internal antigens exposed on apoptotic tumor cells - Google Patents
Methods of killing tumor cells by targeting internal antigens exposed on apoptotic tumor cells Download PDFInfo
- Publication number
- WO2005055936A2 WO2005055936A2 PCT/US2004/040573 US2004040573W WO2005055936A2 WO 2005055936 A2 WO2005055936 A2 WO 2005055936A2 US 2004040573 W US2004040573 W US 2004040573W WO 2005055936 A2 WO2005055936 A2 WO 2005055936A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- antibody
- region
- ras
- hours
- antibodies
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/30—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/34—Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/565—Complementarity determining region [CDR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
Definitions
- the present invention provides a method of killing cancer cells by administering an effective amount of an apoptosis-inducing therapy, and administering an effective amount of an antibody conjugate or antibody complex that binds a cancer-associated antigen which is expressed intracellularly in cancer cells, but which becomes exposed on the cell surface in cancer cells that are undergoing apoptosis.
- the timing of administration of the apoptosis-inducing therapy and the antibody conjugate or antibody complex is planned such that the antibody reaches the cancer cell at the time that apoptosis is being or has been induced.
- the cancer associated antigen is a prenylated protein which, although normally expressed intracellulary, become exposed on tlie cell surface in tumor cells that are undergoing apoptosis.
- the prenylated protein is the C35 antigen.
- the antibody is conjugated to or complexed with a toxin, which insures that the cell to which the antibody binds will be killed, and or surrounding cancer cells that are exposed to the toxin are killed.
- the toxin is a radioisotope.
- the method involves administering a chemotherapeutic agent followed by or simultaneous with an antibody or fragment or variant thereof that is conjugated to a radioactive agent.
- the method involves administering an antibody that is not conjugated to or complexed with a toxin, and cells which bind the antibody die.
- the method of the invention may be performed in vitro or in vivo, and may be used as a therapeutic in a patient, including a mammal such as a human.
- the present mention also provides antibodies that bind C35 polypeptides.
- the present invention encompasses antibodies (including molecules comprising, or alternatively consisting of, antibody fragments or variants thereof) that immunospecifically bind to a C35 polypeptide or polypeptide fragment or variant of a C35 polypeptide such as that of SEQ ID NO:2.
- the present inventors have generated mouse and human antibodies that immunospecifically bind one or more C35 polypeptides (e.g., SEQ ID NO:2) and polynucleotides encoding VH and VL regions from these antibodies.
- the invention encompasses these polynucleotides, inlcuding those set forth in SEQ LD NO:s 56, 58, and 60, and those listed in Tables 2 and 3 below, which were deposited with the American Type Culture Collection ("ATCC") on the dates listed in Tables 2 and 3 and given the ATCC Deposit Numbers identified in Tables 2 and 3.
- ATCC American Type Culture Collection
- the ATCC is located at 10801 University Boulevard, Manassas, VA 20110- 2209, USA.
- the ATCC deposit was made pursuant to the terms of the Budapest Treaty on the international recognition of the deposit of microorganisms for purposes of patent procedure.
- the present invention also encompasses the deposited polynucleotide clones that encode VH and VL regions that immunospecifically bind one or more C35 polypeptides (e.g., SEQ ID NO:2), cells comprising the deposited polynucleotides, antibodies comprising VH and/or VL regions encoded by the deposited polynucleotides, polynucleotides encoding such antibodies, and cells comprising such polynucleotides.
- C35 polypeptides e.g., SEQ ID NO:2
- the present invention also encompasses cells comprising the polynucleotides of SEQ ID NO:s 56, 58, and 60, antibodies comprising VH and/or VL regions encoded by SEQ ID NO:s 56, 58, and 60, polynucleotides encoding such antibodies, and cells comprising such polynucleotides.
- Such antibodies may or may not have the same epitope specificity as the original antibodies comprising the VH and VL regions encoded by the deposited polynucleotides, and may or may not have an affinity for C35 the same as or higher than the affinity of the original antibodies, hi one embodiment , the antibodies of the present invention bind the epitope representing residues 105 to 115 of the native C35 sequence.
- the present invention encompasses antibodies comprising, or alternatively consisting of, fragments or variants of these antibodies (e.g., scFvs, diabodies, triabodies, tetrabodies, minibodies, heavy chains, VH regions, VH CDRs (Complementarity Determining Regions), light chains, VL regions, or VL CDRs) having an amino acid sequence of any one of the VH, VH CDRs, VLs, VL CDRs encoded by a polynucleotide of the invention.
- scFvs fragments or variants of these antibodies
- Such antibodies may or may not have the same epitope specificity as the original antibodies comprising the VH and VL regions encoded by the deposited polynucleotides, and may or may not have an affinity for C35 the same as or higher than the affinity of the original antibodies.
- the present invention also provides antibodies or fragments or variants thereof that bind one or more C35 polypeptides, and which are coupled to a detectable label, such as an enzyme, a fluorescent label, a luminescent label, or a bioluminescent label.
- the present invention also provides antibodies or fragments or variants thereof that bind one or more C35 polypeptides, and which are coupled to a therapeutic or a toxin, e.g., a radioactive material.
- the antibodies of the present invention are coupled to a radioisotope.
- the present invention also provides for a nucleic acid molecule(s), generally isolated, encoding an antibody (including molecules, such as scFvs, diabodies, triabodies, tetrabodies, minibodies, VH regions, or VL regions, that comprise, or alternatively consist of, an antibody fragment or variant thereof) of the invention.
- the present invention also provides a host cell transfo ⁇ ned with a nucleic acid molecule encoding an antibody (including molecules, such as scFvs, diabodies, triabodies, tetrabodies, minibodies, VH regions, or VL regions, that comprise, or alternatively consist of, an antibody fragment or variant thereof) of the invention and progeny thereof.
- the present invention also provides a method for the production of an antibody (including a molecule comprising, or alternatively consisting of, an antibody fragment or variant thereof) of the invention.
- the present invention further provides a method of expressing an antibody (including a molecule comprising, or alternatively consisting of, an antibody fragment or variant thereof) of the invention from a nucleic acid molecule.
- the present invention relates to methods and compositions for treating cancer comprising administering to a mammal, preferably a human, an effective amount of one or more antibodies or fragments or variants thereof, or related molecules, that immunospecifically bind a C35 polypeptide or a fragment or variant thereof.
- the present invention relates to antibody-based methods and compositions for treating breast cancer, ovarian cancer, bladder cancer, lung cancer, prostate cancer, pancreatic cancer, colon cancer, and melanoma.
- the present invention relates to a combination therapy for treating cancer comprising administering to a mammal, preferably a human, an effective amount of a chemotherapeutic and an effective amount of one or more antibodies, or fragments or variants thereof, that are conjugated with a toxin, e.g., a radioactive material.
- the present invention also encompasses methods and compositions for detecting, diagnosing, or prognosing cancer comprising administering to a mammal, preferably a human, an effective amount of one or more antibodies or fragments or variants thereof, or related molecules, that immunospecifically bind to C35 or a fragment or variant thereof.
- the present invention relates to antibody-based methods and compositions for detecting, diagnosing, or prognosing breast cancer, ovarian cancer, bladder cancer, lung cancer, prostate cancer, pancreatic cancer, colon cancer, and melanoma.
- Another embodiment of the present invention includes the use of the antibodies of the invention as a diagnostic tool to monitor the expression of C35 or in cancer.
- the method may also be employed as a diagnostic to confirm the efficacy of an apoptosis inducing regimen.
- Figure 1 shows C35 surface staining of breast tumor cells following radiation induced apoptosis in 21MT1 breast tumor cells that express the C35 tumor antigen.
- Fig. 1A shows that untreated live cells (PI negative), that are not undergoing apoptosis (Annexin V negative) do not express C35 on the surface membrane as evidenced by absence of differential staining with anti-C35 antibody and the isotype control antibody.
- Fig. IB shows, similarly, that radiated tumor cells that remain viable (PI negative) and have not been induced to undergo apoptosis (Annexin V negative) also do not express C35 on the tumor cell surface membrane.
- Fig. IC shows, in contrast, that irradiated tumor cells that are viable (PI negative), but undergoing apoptosis (Annexin V positive), are clearly differentially stained with anti-C35 antibodies as compared to isotype control antibody.
- FIG. 2 shows C35 surface staining of breast tumor cells following mitomycin C drug induced apoptosis.
- Fig. 2 A shows that untreated live cells (PI negative), that are not undergoing apoptosis (Annexin V negative), do not express C35 on the surface membrane as evidenced by absence of differential staining with anti-C35 antibody and the isotype control antibody.
- Fig. 2B shows, similarly, that mitomycin C treated tumor cells that remain viable (PI negative) and have not been induced to undergo apoptosis (Annexin V negative) also do not express C35 on the tumor cell surface membrane.
- Fig. 2C shows, in contrast, that mitomycin C treated tumor cells that are viable (PI negative), but undergoing apoptosis (Annexin V positive), are clearly differentially stained with anti-C35 antibodies as compared to isotype control antibody.
- FIGs 3A-3C show that TaxolTM induces apoptosis, resulting in exposure of C35 on the surface of apoptotic tumor cells.
- 24 hours following treatment with 0.5 uM TaxolTM 21MT1 tumor cells were stained with annexin V-FITC, propidium iodide, and with either 100 ng anti-C35 antibody 1F2 (dark line) or isotype control (grey fill) antibody. Both antibodies were directly conjugated to Alexa-647. Histograms were gated on the cells undergoing apoptosis (annexinV positive/PI negative).
- Antibodies were pre-incubated with PAB buffer (Fig. 3 A), 100-fold molar excess recombinant C35 protein (Fig. 3B), or 100-fold molar excess ⁇ - galactosidase protein (Fig. 3C).
- FIG. 4 shows that anti-C35 monoclonal antibody localizes to necrotic regions of a C35+ tumor.
- BALB/c mice were engrafted on opposite flanks with syngeneic non-small cell lung cancer derived Line 1 tumor cells that either had or had not been transfected with human C35.
- C35 protein expression was confirmed by immunohistochemical staining with anti-C35 antibodies.
- animals received intravenous injection of 1251-labeled anti-C35 antibody. Animals were sacrificed 120 hrs after injection of radiolabeled antibodies and the concentration of anti- C35 antibodies in C35-positive and C35-negative tumors was determined by exposure of a tumor section to film.
- Figure 4A shows that radiolabeled anti-C35 antibodies concentrate only in the C35-positive and not the C35- negative tumors.
- Figures 4B and 4C compare the distribution of label and an H&E stain for intact cells within the tumors, confirming that under these conditions the labeled anti-C35 antibodies concentrated specifically in the necrotic regions of the C35-positive tumor.
- Figure 5 shows the effect on tumor volume of combination radioimmunotherapy with I-labeled 1B3 anti-C35 munne monoclonal antibody and chemotherapy (fluorouracil, 150 mg/kg; leucovorin, 100 mg/kg) in Swiss nude mice grafted with Colau.C35 tumor cells.
- Chemotherapy was initiated on day 11 after tumor graft and 300 ⁇ Ci of 131 I-labeled 1B3 anti-C35 antibody was administered on day 14. Tumor growth was followed for up to 8 weeks.
- Figure 6 shows the effects on tumor volume of the combined modality treatment of chemotherapy and radioimmunotherapy.
- Swiss nude mice were grafted with Colau.C35 cells on day 0.
- Chemotherapy Cisplatin administered at 2 mg/kg i.v. on days 15 & 18; 5FU/LV administered at 180/120 mg/kg i.v. on day 18.
- Radioimmunotherapy 300 ⁇ Ci (-50 ⁇ g) of 131 I-labeled murine 1B3 anti-C35 IgG was administered on day 21.
- Figure 7 shows equivalent expression in naturally-expressing and C35- transfected human breast and colon tumors.
- Cells were stained with Alexa- 647 conjugated anti-C35 MAb 1F2 or isotype control.
- MFI X is the ratio of the mean fluorescence intensity of lF2/mean fluorescence intensity of isotype control.
- H16N2, derived from normal breast epithelium, and MDAMB231, a breast tumor, and Colau, a colon tumor express low basal levels of C35.
- 21MT1 derived from breast carcinoma, naturally expresses high levels of C35.
- Colau and MDA231 were transduced with empty vector (null) or human C35 recombinant vector. All tumors were grown in vivo, tumors were excised, dissociated and stained.
- Figure 8 shows toxicity of chemotherapy, radioimmunotherapy, and combination therapy in Swiss nude mice as determined by weight loss.
- Figure 9 shows the expected peptide fragments following complete digestion of 6x His-tagged recombinant human C35 (rhC35) with Lys-C endoprotease.
- the full sequence of rhC35, including the amino terminal 6x His tag addition is shown.
- Amino acid poistions are numbered relative to the amino terminal methionine (bold M) of the native human C35 sequence.
- the asterisks by the first and third lysine (K) residues indicate that digestion at these positions is inefficient, and some longer fragments may be generated.
- Figure 10 shows a comparison of 1B3 (Mabll) or 1F2 and anti-6x His tag staining of Western blots indicating the fragment of C35 to which each antibody binds.
- FIG. 11 shows that MAb 165 is C35-specific.
- 141D10 recombinant vaccinia virus was co-infected into HeLa cells with UH8 recombinant vaccinia virus.
- the resulting secreted antibody was tested for binding to C35 or control protein A27L (vaccinia virus protein) by ELISA.
- CD3, CD69 and CD25 have been shown to be unregulated on the surface membrane of apoptotic thymocytes (Kishimoto, H., et al, J. Exp. Med. 181:649-655 (1995)). hi each instance these are surface markers of apoptosis in normal cells and tissues.
- the present inventors have determined that there is a subset of intracellular tumor-specific or tumor-associated antigens that become exposed on the tumor cell membrane under conditions of chemotherapy or radiation induced apoptosis and could be effective targets for concentrating antibody conjugated radioisotopes or toxins within the tumor. Methods using antibodies against such antigens would be particularly effective because they could enhance the therapeutic benefits of standard apoptosis- inducing chemotherapy and radiation therapy in treating cancer.
- the present invention identifies tumor-specific antigens that are associated with internal cell membranes ⁇ in particular, differentially expressed molecules such as the C35 cancer-specific antigen that express a prenylation motif — as a class of intracellular tumor antigens that become exposed on the surface membrane of tumor cells that have been induced to undergo apoptosis by radiation and/or chemotherapy.
- the present invention describes a method that acts in conjunction with the induction of apoptosis (preferably large scale apoptosis) by chemotherapy or radiation therapy to enhance the eradication of tumors. It is based on the novel observation that a class of intracellular markers differentially expressed in tumor cells becomes exposed on the surface of apoptotic cells where it can be targeted by specific antibodies conjugated to a toxic payload. The benefits of this method of treatment are several- fold. For example, this method permits delivery to the tumor environment of a toxic payload that can destroy other non-apoptotic tumor cells in the vicinity of the apoptotic target.
- this method can prevent otherwise viable cells that have initiated the apoptotic process, as evidenced by alterations in surface membrane constituents, from reversing the apoptotic progression and resuming growth (Hammill, A.K., et al, Exp. Cell Res. 251:16-21 (1999)).
- the present invention targeting apoptotic cells should be distinguished from prior inventions targeting necrotic cells (U.S. Patent number: 6,071,491, "Detection of Necrotic Malignant Tissue and Associated Therapy", Filed: Aug. 9, 1999; Issued, Jun. 6, 2000).
- necrotic cells results in release of intracellular contents into the extracellular tumor environment. Some of these intracellular antigens accumulate in that environment and could be targeted by specific antibodies.
- necrosis is associated with hypoxic regions of larger tumors that, because of the absence of oxygen radicals, are relatively resistant to radiation therapy and possibly radio-immunotherapy. Although there may be some increase in necrosis following treatment with chemotherapeutic agents (Desrues B., et al., Br. J.
- the present invention is directed to a method of killing cancer cells (also refened to herein as tumor cells) by first administering an effective amount of an apoptosis-inducing therapy (e.g., a chemotherapeutic agent and/or radiation), and subsequently administering an effective amount of an antibody conjugate or antibody complex that binds a cancer-associated antigen which is expressed intracellularly in tumor cells, but which becomes exposed on the cell surface in tumor cells that are undergoing apoptosis.
- an apoptosis-inducing therapy e.g., a chemotherapeutic agent and/or radiation
- an antibody conjugate or antibody complex that binds a cancer-associated antigen which is expressed intracellularly in tumor cells, but which becomes exposed on the cell surface in tumor cells that are undergoing apoptosis.
- the antibody is conjugated to or complexed with a toxin, as described below.
- the method involves the combined use of chemotherapy and radioimmunotherapy.
- combination chemotherapy and radioimmunotherapy posed a problem due to cumulative dose-limiting bone marrow toxicity.
- the present invention provides for administration of such combination therapy in that chemotherapy results in exposure of an intracellular antigen to antibodies.
- Optimal timing of administration can be precisely determined employing the methods described herein and in the Examples.
- the method involves administering an antibody that is not conjugated to or complexed with a toxin, and cells which bind the antibody are killed.
- a toxin is not needed to be conjugated to or complexed with the antibody in order to kill the cells that bind the antibody. Binding of the antibody itself kills the cell or insures that it dies.
- apoptosis is preferably induced in most or nearly all of the cancer cells, e.g., most or nearly all of the cells of a tumor or metastasis.
- the antibody, conjugated antibody or complexed antibody is administered within the time period during which apoptosis is being induced or is ongoing in the tumor cells that have been treated with the apoptosis-inducing therapy (e.g., chemotherapeutic agent and/or radiation).
- apoptosis-inducing therapy e.g., chemotherapeutic agent and/or radiation.
- Chemotherapeutic agents generally induce apoptosis 24- 72 hours after administration.
- Antibodies (e.g., complexed and conjugated antibodies) against cancer-associated antigens generally accumulate at the site of a tumor(s) 24-48 hours after administration. Whole antibodies generally take longer to accumulate than antibody fragments.
- antibodies e.g., complexed and conjugated antibodies
- a chemotherapeutic agent for antibody fragments
- a chemotherapeutic agent for whole antibodies
- the antibody, or conjugated or complexed antibody is administered 0-6 hours, or 6-12 hours, or 6-24 hours, or 6-36 hours, or 6-48 hours, or 6-72 hours, or 6-96 hours, or 6-120 hours, or 12-24 hours, or 12-36 hours, or 12-48 hours, or 12-72 hours, or 12-96 hours, or 12-120 hours, or 24-36 hours, or 24-48 hours, or 24-72 hours, or 24-96 hours, or 24-120 hours, or 36-48 hours, or 36-72 hours, or 36-96 hours, or 36-120 hours or 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69
- Apoptosis-inducing therapies useful in the method of the invention are discussed below.
- tumor or “cancer” or “hyperproliferative disease” is meant all neoplastic cell growth and proliferation, whether malignant or benign, incuding all transformed cells and tissues and all cancerous cells and tissues.
- cancers include, but are not limited to, carcinoma, lymphoma, blastoma, sarcoma, and leukemia or lymphoid malignancies. More particular examples of such cancers include squamous cell cancer (e.g.
- lung cancer including small-cell lung cancer, non-small cell lung cancer, adenocarcinoma of the lung and squamous carcinoma of the lung, cancer of the peritoneum, hepatocellular cancer, gastric or stomach cancer including gastrointestinal cancer, pancreatic cancer, glioblastoma, cervical cancer, ovarian cancer, liver cancer, bladder cancer, hepatoma, breast cancer, colon cancer, rectal cancer, colorectal cancer, endometrial cancer or uterine carcinoma, salivary gland carcinoma, kidney or renal cancer, prostate cancer, vulval cancer, thyroid cancer, hepatic carcinoma, anal carcinoma, penile carcinoma, as well as head and neck cancer.
- Other examples of cancer are listed under "Hyperproliferative Diseases," below.
- cancer cell(s) sufficiently close as to be killed by the toxin conjugated to or complexed with the antibody.
- the method of the invention may be performed in vitro or in vivo, and may be used as a therapeutic in a patient, including a mammal such as a human.
- the method of the invention is directed to the administration of antibodies (e.g., complexed and conjugated antibodies) against cancer- associated, intracellular antigens at a time such that the antibodies accumulate at the cancer site during or after apoptosis has been induced by the administration of an apoptosis-inducing therapy.
- antibodies e.g., complexed and conjugated antibodies
- epitope includes any protein determinant capable of specific binding to an immunoglobulin.
- Epitopic determinants usually consist of chemically active surface groupings of molecules such as amino acids or sugar side chains and usually have specific three dimensional structural characteristics, as well as specific charge characteristics.
- cancer-associated antigen or “tumor-associated antigen” is meant an antigen that is expressed preferentially by cancer cells relative to non- cancerous cells of the same cell type or non-cancerous cells from the same tissue. Cancer-associated antigens may not be exclusively expressed by cancer cells (i.e., other normal cells may still express these antigens). However, the expression of cancer-associated antigens is generally consistently upregulated in cancers of a particular type or types. Cancer- associated antigens are antigens, preferably proteins, that may elicit specific immune responses in animals having particular types of cancer and thus, include cancer-associated antigens and fragments of cancer- associated antigens.
- a tumor-associated antigen may be one found in nature, or may be a synthetic version of a TAA found in nature, or may be a variant of a naturally-occurring TAA, e.g., a variant that has enhanced immunogenic properties.
- cancer-associated antigens are known in the art, and routine methods for determining whether a newly identified gene or protein is associated with a type of cancer or tumor are known. Such methods include northern blot analysis, differential display, SAGE, two dimensional protein gel electrophoresis or tandem mass spectrometry, Southern blot analysis, and other methods to detect an increased level of mRNA or protein expression or specific gene amplification in cancer cells from a particular type of cancer or tumor, in comparison with normal (non- cancerous or non-transformed) cells from the tissue of origin of the cancer or tumor, or in comparison to normal cells from other tissues. Other methods include analysis by tandem mass spectrometry of peptides differentially expressed in association with MHC molecules of tumor vs. normal cells.
- an "intracellular" cancer-associated antigen is meant a cancer- associated antigen that is expressed on an intracellular membrane of a tumor cell (a cancerous or transformed cell) that is not undergoing apoptosis.
- Internal membranes on which "intracellular" cancer-associated antigens may be expressed include the endoplasmic reticulum (ER), other cytoplasmic membrane bound vesicles including endosomal and lysosomal vesicles, mitochondrial membranes, and the nuclear membrane
- Preferred "internally expressed" cancer-associated antigens include prenylated proteins expressed on the endoplasmic reticulum and/or membranes of endosomal or lysosomal vesicles.
- prenylated cancer-associated proteins examples include C35 or any individual protein listed in Table 1, or any combination thereof.
- prenylated cancer-associated proteins may exclude CENP-F kinetochore protein, CAAX box protein 1, DnaJ homolog subfamily A member 1 or 2, or Guanine nucleotide-binding protein G(I)/G(S)/G(O) gamma-5 subunit.
- routine methods to determine whether it is prenylated include searching for a string of nucleotides at the 3' end of the gene/protein sequence that conesponds to a prenylation motif.
- a number of eukaryotic proteins are post-translationally modified by the attachment of either a farnesyl or a geranyl-geranyl group to a Cysteine residue (Glomset, J.A., et al, Trends Biochem. Sci.
- Aliphatic amino acids include isoleucine, valine, leucine, alanine, and proline. The last four amino acids of C35 are CVLL. The leucine at the terminal position indicates that this is a substrate for the prenyltransferase GGTase I which results in addition of a geranyl-geranyl group (Moomaw and Casey, J Biol. Chem. 267, 17438-17443 (1992)).
- the method of the invention also provides for determining whether a cancer-associated protein is an intracellular protein which becomes exposed at the cell surface in cells undergoing apoptosis, prior to administering the antibody (e.g., complexed and conjugated antibodies) or apoptosis-inducing agent.
- a determination may encompass analyzing the amino acid sequence of a candidate protein for the CAAX box at its C- terminus by computer or manually, and/or performing assays to determine whether the candidate protein is expressed extracellularly after induction of apoptosis in cells expressing that protein.
- assays are know in the art and described herein (see, e.g. Examples 1 and 2) and include inducing apoptosis in cells expressing a candidate protein and using antibodies (e.g., labelled antibodies) specific for the candidate protein to detect the protein on the cell surface of the apoptotic cells.
- prenylated proteins are treated as a single class with closely related properties relative to translocation to the surface exposed membrane of cells undergoing apoptosis.
- the method described above for killing cancer cells can be used in vivo, as a method of treating a mammalian subject.
- subject or “individual” or “patient” or “mammal,” which terms are used interchangeably herein, is meant any subject, particularly a mammalian subject, for whom diagnosis or therapy is desired.
- Mammalian subjects include humans, domestic animals, farm animals, and zoo, sports, or pet animals such as dogs, cats, guinea pigs, rabbits, rats, mice, horses, cattle, cows, and so on.
- treat or “treatment” refer to both therapeutic treatment and prophylactic or preventative measures, wherein the object is to prevent or slow down (lessen) an undesired physiological change or disorder, such as the development or spread of cancer.
- beneficial or desired clinical results include, but are not limited to, alleviation of symptoms, diminishment of extent of disease, stabilized (i.e., not worsening) state of disease, delay or slowing of disease progression, amelioration or palliation of the disease state, and remission (whether partial or total), whether detectable or undetectable.
- Treatment can also mean prolonging survival as compared to expected survival if not receiving treatment.
- Those in need of treatment include those already with the condition or disorder as well as those prone to have the condition or disorder or those in which the condition or disorder is to be prevented. Any of these treatment types or types of patients may also be excluded.
- Preferred in the method of the invention are the combinations shown in Table 1, in which an antibody (e.g., complexed and conjugated antibodies) specific for a listed prenylated protein, is used to treat a cancer type listed for that prenylated protein.
- an antibody specific for CENP-F kinetochore may be used in the method of the invention to treat colon, kidney, liver, nervous, and skin cancers;
- an antibody specific for CAAX box protein 1 may be used to treat breast and pancreatic cancers;
- an antibody specific for DNAJ homolog subfamily A member 1 may be used to treat gastrointestinal tract, pancreatic, stomach, and prostate cancers, and so on.
- antibodies specific for C35 protein may be used to treat, diagnose, or detect, breast cancer, ovarian cancer, bladder cancer, lung cancer, prostate cancer, pancreatic cancer, colon cancer, and melanoma.
- a combination chemotherapy/radioimmunotherapy for treating cancer comprising administering to a mammal, preferably a human, an effective amount of a chemotherapeutic, followed by or simultaneous with an antibody of the invention that is conjugated to a toxin, preferably a radioactive material.
- an antibody of the invention that is conjugated with a toxin, preferably a radioactive material, is administered alone.
- antibodies refers to antibodies comprised of two immunoglobulin heavy chains and two immunoglobulin light chains as well as a variety of forms besides antibodies; including, for example, Fv, Fab, and F(ab')2 as well as bifunctional hybrid antibodies (e.g., Lanzavecchia et al., Eur. J. Immunol 17, 105 (1987)) and single chains (e.g., Huston et al, Proc. Natl. Acad. Sci. U.S.A., 85, 5879-5883 (1988) and Bird et al, Science 242, 423-426 (1988), which are incorporated herein by reference).
- bifunctional hybrid antibodies e.g., Lanzavecchia et al., Eur. J. Immunol 17, 105 (1987)
- single chains e.g., Huston et al, Proc. Natl. Acad. Sci. U.S.A., 85, 5879-5883 (1988) and Bird et
- Antibodies of the invention include, but are not limited to, polyclonal, monoclonal, multispecific, human, humanized or chimeric antibodies, single chain antibodies, Fab fragments, F(ab')2 fragments, fragments produced by a Fab expression library, domain-deleted antibodies (including, e.g., CH2 domain-deleted antibodies), anti-idiotypic (anti-Id) antibodies (including, e.g., anti-Id antibodies to antibodies of the invention), and epitope-binding fragments of any of the above.
- antibody refers to immunoglobulin molecules and immunologically active portions of immunoglobulin molecules, i.e., molecules that contain an antigen binding site that immunospecifically binds an antigen.
- the immunoglobulin molecules of the invention can be of any type (e.g., IgG, IgE, IgM, IgD, IgA and IgY), class (e.g., IgGl, IgG2, IgG3, IgG4, IgAl and IgA2) or subclass of immunoglobulin molecule.
- Antibodies of the invention also include, but are not limited to, engineered forms of antibodies and antibody fragments such as diabodies, triabodies, tetrabodies, and higher multimers of scFvs, as well as minibodies, such as two scFv fragments joined by two constant (C) domains. See, e.g., Hudson, P.J. and Couriau, C, Nature Med. 9: 129-134 (2003); U.S. Publication No. 20030148409; U.S. Patent No. 5,837,242.
- the antibodies of the invention may be from any animal origin including birds and mammals.
- the antibodies are human, murine (e.g., mouse and rat), donkey, ship rabbit, goat, guinea pig, camel, horse, or chicken.
- "human” antibodies include antibodies having the amino acid sequence of a human immunoglobulin and include antibodies isolated from human immunoglobulin libraries or from animals transgenic for one or more human immunoglobulin and that do not express endogenous immunoglobulins, as described infra and, for example in, U.S. Pat. No. 5,939,598 by Kucherlapati et al.
- nucleic acids or polypeptides refers to two or more sequences or subsequences that have at least about 80%, most preferably 90-95% or higher nucleotide or amino acid residue identity, when compared and aligned for maximum co ⁇ espondence, as measured using the following sequence comparison method and/or by visual inspection.
- sequence comparison method e.g., a sequence comparison method for aligning a C35 antibody or the amino acid sequence of the C35 antibody
- substantially identical in the context of two nucleic acids or polypeptides (e.g., DNAs encoding a C35 antibody or the amino acid sequence of the C35 antibody) refers to two or more sequences or subsequences that have at least about 80%, most preferably 90-95% or higher nucleotide or amino acid residue identity, when compared and aligned for maximum co ⁇ espondence, as measured using the following sequence comparison method and/or by visual inspection.
- Such "substantially identical" sequences are typically considered to be homologous.
- the "substantial identity” exists over a region of the sequences that is at least about 50 residues in length, more preferably over a region of at least about 100 residues, and most preferably the sequences are substantially identical over at least about 150 residues, or over the full length of the two sequences to be compared.
- any two antibody sequences can only be aligned in one way, by using the numbering scheme in Kabat. Therefore, for antibodies, percent identity has a unique and well-defined meaning.
- Hx and Lx Amino acids from the variable regions of the mature heavy and light chains of immunoglobulins are designated Hx and Lx respectively, where x is a number designating the position of an amino acid according to the scheme of Kabat, Sequences of Proteins of hnmunological Interest (National Institutes of Health, Bethesda, Md., 1987 and 1991). Kabat lists many amino acid sequences for antibodies for each subgroup, and lists the most commonly occurring amino acid for each residue position in that subgroup to generate a consensus sequence. Kabat uses a method for assigning a residue number to each amino acid in a listed sequence, and this method for assigning residue numbers has become standard in the field.
- Kabat's scheme is extendible to other antibodies not included in his compendium by aligning the antibody in question with one of the consensus sequences in Kabat by reference to conserved amino acids.
- the use of the Kabat numbering system readily identifies amino acids at equivalent positions in different antibodies. For example, an amino acid at the L50 position of a human antibody occupies the equivalent position to an amino acid position L50 of a mouse antibody.
- the basic antibody structural unit is known to comprise a tetramer. Each tetramer is composed of two identical pairs of polypeptide chains, each pair having one "light" (about 25 kDa) and one "heavy" chain (about 50-70 kDa).
- each chain includes a variable region of about 100 to 110 or more amino acids primarily responsible for antigen recognition.
- the carboxy-terminal portion of each chain defines a constant region primarily responsible for effector function.
- the variable regions of each light/heavy chain pair form the antibody binding site. Thus, an intact antibody has two binding sites.
- Light chains are classified as either kappa or lambda.
- Heavy chains are classified as gamma, mu, alpha, delta, or epsilon, and define the antibody's isotype as IgG, IgM, IgA, IgD and IgE, respectively.
- the variable and constant regions are joined by a "J" region of about 12 or more amino acids, with the heavy chain also including a "D" region of about 10 more amino acids.
- both light and heavy chain variable regions comprise alternating framework and complementarity determining regions (CDRs): FR, CDR, FR, CDR, FR, CDR and FR.
- CDRs alternating framework and complementarity determining regions
- framework region refers to those portions of antibody light and heavy chain variable regions that are relatively conserved (i.e., other than the CDRs) among different immunoglobulins in a single species, as defined by Kabat, et al., op. cit.
- a "human framework region” is a framework region that is substantially identical (about 85% or more) to the framework region of a naturally occurring human antibody.
- the antibodies are human or humanized antigen-binding antibody fragments of the present invention and include, but are not limited to, Fab, Fab' and F(ab')2, Fd, single-chain Fvs (scFv), diabodies, triabodies, tetrabodies, minibodies, domain-deleted antibodies, single-chain antibodies, disulfide-linked Fvs (sdFv) and fragments comprising either a VL or VH region.
- Antigen-binding antibody fragments, including single-chain antibodies may comprise the variable region(s) alone or in combination with the entirety or a portion of the following: hinge region, CHI, CH2, and CH3 domains. Also included in the invention are antigen-binding fragments also comprising any combination of variable region(s) with a hinge region, CHI, CH2, and CH3 domains.
- Prefened antibodies in the therapeutic methods of the invention are those containing a deletion of the CH2 domain.
- the term "humanized” immunoglobulin or “humanized” antibody refers to an immunoglobulin comprising a human framework, at least one CDR from a non-human antibody, and in which any constant region present is substantially identical to a human immunoglobulin constant region, i.e., at least about 85-90%, preferably at least 95%o identical.
- all parts of a humanized immunoglobulin, except possibly the CDRs are substantially identical to conesponding parts of one or more native human immunoglobulin sequences.
- a humanized immunoglobulin would not encompass a chimeric mouse variable region/human constant region antibody.
- chimeric antibody refers to an antibody whose heavy and light chains have been constructed, typically by genetic engineering, from immunoglobulin gene segments belonging to different species.
- V variable
- C constant
- a typical therapeutic or diagnostic chimeric antibody is thus a hybrid protein comprising at least one V region (e.g., VH or VL) or the entire antigen-binding domain (i.e., VH and VL) from a mouse antibody and at least one C (effector) region (e.g., CH (CHI, CH2, CH3, or CH4) or CL (CL1, CL2, CL3, or CL4)) or the entire C domain (i.e., CH and CL) from a human antibody, although other mammalian species may be used.
- chimeric antibodies contain no CH2 domain.
- the antibodies of the present invention may be monospecific, bispecific, trispecific or of greater multispecificity. Multispecific antibodies may be specific for different epitopes of a polypeptide of the present invention or may be specific for both a polypeptide of the present invention as well as for a heterologous epitope, such as a heterologous polypeptide or solid support material. See, e.g., PCT publications WO 93/17715; WO 92/08802; WO 91/00360; WO 92/05793; Tutt, et al., J. Immunol. 147:60-69 (1991); U.S. Pat. Nos. 4,474,893; 4,714,681; 4,925,648; 5,573,920; 5,601,819; Kostelny et al., J. Immunol. 148:1547- 1553 (1992).
- C35 antibodies and to other antibodies useful in the method of the invention.
- Such antibodies may be conjugated to or complexed with a toxin, as described herein, or may be unconjugated or uncomplexed.
- C35 is an antigen differentially expressed in breast cancer and certain other tumor types including melanoma, colon carcinoma, ovarian cancer, and pancreatic cancer.
- the C35 protein has been shown to be prenylated and to associate with internal cell membranes but is not detectable on the surface membrane of viable tumor cells.
- the inventors have produced a number of antibodies, including mouse monoclonal antibodies and human antibodies, that immunospecifically recognize C35 epitopes.
- the inventors have also demonstrated that induction of apoptosis in tumor cells by treatment either with a chemotherapeutic agent or inadiation results in surface membrane exposure of C35 that permits intact tumor cells to be recognized by C35-specific antibodies.
- SEQ ID NOs:l and 2 Polynucleotide and amino acid sequences
- this invention also relates to antibodies against C35, polynucleotides encoding such antibodies, methods of treating C35- associated cancers using C35 antibodies and polynucleotides, and methods of detection and diagnosis using C35 antibodies and polynucleotides. Also provided are vectors and host cells comprising C35 antibody polynucleotides, and methods of producing C35 antibodies. As described in more detail herein, the invention also relates to methods using C35 antibodies for cancer treatment, detection, and diagnosis. The description above under the "Antibodies" section also applies to C35 antibodies described herein.
- the present invention is further directed to antibody-based treatment methods which involve administering C35 antibodies of the invention to a subject, preferably a mammal, and most preferably a human, for treating one or more C35 cancers.
- Therapeutic compounds of the invention include, but are not limited to, antibodies of the invention (including fragments, analogs and derivatives thereof as described herein) and nucleic acids encoding antibodies of the invention (including fragments, analogs and derivatives thereof as described herein).
- the antibodies of the invention can be used to treat, detect or diagnose C35-associated cancers, including breast, ovarian, colon, pancreatic, and bladder cancers, and melanoma.
- C35 antibodies of the invention may be provided in pharmaceutically acceptable compositions as known in the art or as described herein.
- Antibodies of the invention include, but are not limited to, polyclonal, monoclonal, multispecific, human, humanized or chimeric antibodies, single chain antibodies, scFvs, diabodies, triabodies, tetrabodies, minibodies, domain-deleted antibodies, Fab fragments, F(ab')2 fragments, fragments produced by a Fab expression library, anti-idiotypic (anti-Id) antibodies (including, e.g., anti-Id antibodies to antibodies of the invention), and epitope-binding fragments of any of the above.
- antibody refers to immunoglobulin molecules and immunologically active portions of immunoglobulin molecules, i.e., molecules that contain an antigen binding site that immunospecifically binds an antigen.
- the immunoglobulin molecules of the invention can be of any type (e.g., IgG, IgE, IgM, IgD, IgA and IgY), class (e.g., IgGl, IgG2, IgG3, IgG4, IgAl and IgA2) or subclass of immunoglobulin molecule.
- Hybridoma cell lines 1F2.4.1 and 1B3.6.1, specific for C35 polypeptides were prepared using hybridoma technology. (Kohler et al., Nature 256:495 (1975); Kohler et al., Eur. J. Immunol. 6:511 (1976); Kohler et al., Eur. J. Immunol. 6:292 (1976); Hammerling et al., in: Monoclonal Antibodies and T-Cell Hybridomas, Elsevier, N.Y., pp. 571- 681 (1981)).
- hybridoma cell lines were generated using standard PEG fusion to the non-secreting myeloma cell line NS-1 (P3/NS1/1-AG4- 1, ATCC #TL3-18) of splenocytes from BALB/c mice immunized with syngeneic BCA34 fibroblast tumor cells transduced to overexpress C35. Following PEG fusion to NS-1, the hybridomas were grown in methylcellulose semi-solid media. Approximately 2 weeks later, hybridoma colonies were isolated into 96 well plates and individual supernatants were tested for reactivity with C35 by ELISA, Western blot, and immunohistochemistry. Positive hybridomas colonies were subcloned and screened for reactivity twice to ensure clonality.
- NS-1 P3/NS1/1-AG4- 1, ATCC #TL3-18
- Antibodies were isolated from hybridoma supernatants by protein G affinity purification using standard methods. Antibodies from two hybridoma cell lines, 1F2 and 1B3, specifically bind recombinant C35 protein in ELISA and Western Blot assays. Antibodies from hybridoma cell line 1F2 also specifically stain formalin fixed, paraffin embedded C35 positive tumors and cell lines by immunohistochemistry. In addition, we have developed intracellular staining flow cytometry assays for quantitative analysis using antibodies from hybridoma cell line 1F2 conjugated to Alexa-647 flourochrome. Each of these antibodies is distinct, yet both are specific for C35 protein. It is possible to immunoprecipitate C35 protein from cell lysates with either of these antibodies and detect with the other. Competitive binding ELISA assays suggest that the monoclonal antibodies produced by hybridoma cell lines 1F2 and 1B3 bind different epitopes of the C35 protein.
- C35 antibodies of the invention include antibodies which immunospecifically bind a C35 polypeptide, polypeptide fragment, or variant of SEQ ID NO:2, and/or an epitope, of the present invention (as determined by immunoassays well known in the art for assaying specific antibody-antigen binding).
- isolated is meant to describe a compound of interest (e.g., a C35 antibody) that is in an environment different from that in which the compound naturally occurs. "Isolated” is meant to include compounds that are within samples that are substantially enriched for the compound of interest and/or in which the compound of interest is partially or substantially purified.
- the terms “substantially enriched” and “substantially purified” refers to a compound that is removed from its natural environment and is at least 60% free, preferably 75% free, and most preferably 90% free from other components with which it is naturally associated.
- an antibody having the "same specificity" as a reference antibody means the antibody binds the same epitope as the reference antibody. The determination of whether an antibody binds the same epitope as a reference antibody may be performed using the assays described in the "Assays For Antibody Binding" section below.
- the antibodies derived from mouse hybridoma cell lines discussed herein are 1F2 and 1B3. Polynucleotides encoding the VL and VH regions of these antibodies were cloned into TOPO vectors as described in Example 6, which were deposited with the American Type Culture Collection ("ATCC") on the date listed in Table 2, and given ATCC Deposit Numbers listed in Table 2.
- ATCC American Type Culture Collection
- the ATCC is located at 10801 University Boulevard, Manassas, VA 20110-2209, USA.
- the ATCC deposits were made pursuant to the terms of the Budapest Treaty on the international recognition of the deposit of microorganisms for purposes of patent procedure.
- Clone 1F2G was deposited at the ATCC on November 11, 2003 and given ATCC Deposit Number PTA-5639.
- Clone 1F2K was deposited at the ATCC on November 11, 2003 and given ATCC Deposit Number PTA- 5640.
- Clone 1B3G was deposited at the ATCC on November 11, 2003 and given ATCC Deposit Number PTA-5637.
- Clone 1B3K was deposited at the ATCC on November 11, 2003 and given ATCC Deposit Number PTA-5638.
- 1F2 murine anti-C35 kappa V gene polynucleotide sequence (from clone 1F2K) CGCGAATTCGCCCTITcgactggagcacgagga ⁇ agctagggaccaaaattcaaagacaga TGGATTTTCAGGTGCAGATTTTCAGCTTCCTGCTA ATCAGTGCCTCAGTCAGAATGTCCAGAGGACAAATTGTTCTCACCCAGTCTCCAGCAATCATG TCTGCATCTCCAGGGGAGAAGGTCACCATATCCTGCAGTGCCAGCTCAAGTGTAAGTTACATG CDR1 AACTGGTACCAGCAGAAGCCAGGATCCTCCCCCAAACCCTGGA TTTATCACACATCCAACCTGGCTTCTGGAGTCCCTGCTCGCTTCAGTGGCAGTGGGTCT CDR2 GGGACCTCTTACTCTCTCACAATCAGCAGCATGGAGGCTGAAGATGCTGCCACTTATTACTGC CAACAGTATCATAGTTACCCACCCA
- the present inventors have also produced two C35 antibodies, MAb 165 and MAb 171, using the method disclosed in US 2002 0123057 Al, published 5 September 2002.
- the heavy chain variable regions of MAb 165 and MAb 171 comprise the same CDR3 region as the the 1B3 antibody heavy chain variable region described above.
- the remainders of MAbs 165 and 171 are of human origin.
- the present invention is directed to antibodies that immunospecifically bind C35 polypeptides, comprising any one of the VH or VL regions of SEQ ID NO:56, SEQ ID NO:58, or SEQ ID NO:60, or a combination of either VH region encoded by SEQ ID NO:56 or SEQ ID NO:60 and the VL region encoded by SEQ ID NO:58, and preferably the C35-specific antibodies MAb 165 or MAb 171. Both MAb 165 and MAb 171 comprise the same kappa light chain, UH8 VK L120.
- MAb 165 VH (141D10 VH H732) nucleotide sequence: CAGGTGCAGCTGCAGGAGTCGGGCCCAGGACTGGTGAAGCCTCCGGAGACCCTGT CCCTCACCTGCAATGTCTCTGGTGGCTCTATCGGTAGATACTATTGGAACTGGATC CDR1 CGACAGTCCCCAGGGAAGGGGCTGGAGTGGATTGGCCATATCCATTACAGTGGGA GCACCATCTACCATCCCTCCCTCAAGAGTCGAGTCAGCATATCGCTGGACACGTCC CDR2 AAGAACCAGGTCTCCCTGAAGTTGAGTTCTGTGACCGCTGCGGACACGGCCGTGT ATTACTGTGCACGAGGTGCTTACTACGGGGGGGCCTTTTTTCCTTACTTCGATGTC CDR3 TGGGGCCAAGGGACCA CGGTCACCGTCCTCA (SEQ ID NO:56) [0097] MAb 165 VH (141D10 VH H732) amino acid sequence: QVOLOESGP
- MAb 171 VH (MSH3 VH H835) nucleotide sequence:
- UH8 VK L120 nucleotide sequence GACATCCAGATGACCCAGTCTCCATCCTCCCTGTCTGCATCTATGGGAGACAGAGT CACCATCACTTGCCGGGCGAGTCAGGGCATTAGGAATCATTTAGCCTGGTATCAG CDR1 CAGAAACCAGGGAAAGCTCCTAATCTCCTGATCTCTGCTGCATCCACTTTGCAAT CDR2 CAGGGGTCCCAACTCGATTCAGTGGCAGTGGATCTGGAACAGATTTCACTCTCAC CATCAGCAGCCTGCAGCCTGAAGACTCTGCAACTTATTACTGCCAACAGTATAATC GGTACCCCCTCACTTTCGGCCAA GGGACCAAGCTCGAGATCAAA (SEQ ID NO:58) CDR3
- the present inventors have also produced a human C35 antibody, MAbc009, using the method disclosed in US 2002 0123057 Al.
- the present invention is directed to antibodies that immunospecifically bind C35 polypeptides, comprising the VH and VL regions encoded by the polynucleotide clones that are listed in Table 3, preferably the fully human C35-s ⁇ ecific antibody MAbc009.
- Polynucleotides encoding the VL and VH regions of this antibody were cloned into TOPO vectors as described in Example 6, which were deposited with the American Type Culture Collection ("ATCC") on the date listed in Table 3, and given ATCC Deposit Numbers listed in Table 3.
- the ATCC is located at 10801 University Boulevard, Manassas, VA 20110-2209, USA.
- the ATCC deposit was made pursuant to the terms of the Budapest Treaty on the international recognition of the deposit of microorganisms for purposes of patent procedure.
- Clone H0009 was deposited at the ATCC on November 11, 2003 and given ATCC Deposit Number PTA-5641.
- Clone L0010 was deposited at the ATCC on November 11, 2003 and given ATCC Deposit Number PTA-5542.
- Table 3. Deposited Polynucleotide Clones Encoding Human Anti-C35 Variable Regions
- the mouse C35 antibodies have heavy and light chain variable regions designated SEQ ID Nos:3-10.
- the mouse antibodies 1F2 and 1B3 have gammal isotype and kappa light chains.
- the antibodies MAb 165 and MAb 171 that have the same heavy chain variable region CDR3 as 1B3 mouse antibody have heavy and light chain variable regions designated SEQ ID NOs:56-60.
- the antibodies MAb 165 and MAb 171 have kappa light chains.
- the human antibody MAbc009 has heavy and light chain variable regions designated SEQ ID Nos: 11-14.
- the human antibody MAbc009 has gammal isotype and kappa light chains.
- the present invention encompasses antibodies (including molecules comprising, or alternatively consisting of, antibody fragments or variants thereof) that immunospecifically bind to a C35 polypeptide or a fragment, variant, or fusion protein thereof.
- a C35 polypeptide includes, but is not limited to, the C35 polypeptide of SEQ ID NO:2.
- C35 polypeptides may be produced through recombinant expression of nucleic acids encoding the polypeptide of SEQ ID NO:2. (See WO 01/74859 for epitope-containing fragments of C35.)
- analogs of exemplified antibodies differ from exemplified antibodies by conservative amino acid substitutions.
- amino acids may be grouped as follows: Group I (hydrophobic sidechains): met, ala, val, leu, ile; Group II (neutral hydrophilic side chains): cys, ser, thr; Group HI (acidic side chains): asp, glu; Group IV (basic side chains): asn, gin, his, lys, arg; Group V (residues influencing chain orientation): gly, pro; and Group VI (aromatic side chains): trp, tyr, phe.
- Conservative substitutions involve substitutions between amino acids in the same class. Non-conservative substitutions constitute exchanging a member of one of these classes for a member of another.
- antibodies that immunospecifically bind to a C35 polypeptide or a fragment or variant thereof comprise a polypeptide having the amino acid sequence of SEQ ID NO:57 or 61, or any one of the VH regions encoded by at least one of the polynucleotides refened to in Tables 2 or 3 and/or SEQ ID NO:59 or any one of the VL regions encoded by at least one of the polynucleotides referred to in Tables 2 or 3.
- antibodies of the present invention comprise the amino acid sequence of SEQ ID NO:57 or SEQ ID NO:61 and the amino acid sequence of SEQ ID NO:59.
- antibodies of the present invention comprise the amino acid sequence of a VH region encoded by clone H0009 and a VL region encoded by clone LOO 10, refened to in Table 3.
- antibodies of the present invention comprise the amino acid sequence of a VH region encoded by clone 1F2G and a VL region encoded by clone 1F2K, or a VH region encoded by clone 1B3G and a VL region encoded by clone 1B3K of Table 2.
- antibodies of the present invention comprise the amino acid sequence of a VH region encoded by clone H0009 of Table 3, the amino acid sequence of SEQ ID NO:57, or the amino acid sequence of SEQ ID NO:61 and a VL region encoded by clone 1F2K or 1B3K of Table 2; or a VH region encoded by clone 1F2G or 1B3G of Table 2, the amino acid sequence of SEQ ID NO:57, or the amino acid sequence of SEQ ID NO:61 and a VL region encoded by clone LOO 10 of Table 3; or a VH region encoded by clone 1F2G or 1B3G of Table 2 or clone H009 of Table 3 and the amino acid sequence of SEQ ID NO:59.
- antibodies of the present invention comprise the amino acid sequence of a VH region encoded by clone 1F2G and a VL region encoded by clone 1B3K of Table 2, or a VH region encoded by clone 1B3G and a VL region encoded by clone 1F2K of Table 2.
- Molecules comprising, or alternatively consisting of, antibody fragments or variants of the VH and/or VL regions encoded by at least one of the polynucleotides refened to in Tables 2 or 3 that immunospecifically bind to a C35 polypeptide are also encompassed by the invention, as are nucleic acid molecules encoding these VH and VL regions, molecules, fragments and/or variants.
- the present invention also provides antibodies that immunospecifically bind to a polypeptide, or polypeptide fragment or variant of a C35 polypeptide, wherein said antibodies comprise, or alternatively consist of, a polypeptide having an amino acid sequence of any one, two, three, or more of the VH CDRs contained in VH regions encoded by one or more polynucleotides of SEQ ID NOs:56 or 60 or refened to in Tables 2 or 3.
- antibodies that immunospecifically bind a C35 polypeptide comprising, or alternatively consisting of, a polypeptide having the amino acid sequence of a VH CDR1 contained in a VH region encoded by one or more polynucleotides of SEQ ID NOs:56 or 60 or refened to in Tables 2 or 3.
- antibodies that immunospecifically bind a C35 polypeptide comprise, or alternatively consist of, a polypeptide having the amino acid sequence of a VH CDR2 contained in a VH region encoded by one or more polynucleotides of SEQ ID NOs: 56 or 60 or refened to in Tables 2 or 3.
- antibodies that immunospecifically bind a C35 polypeptide comprise, or alternatively consist of a polypeptide having the amino acid sequence of a VH CDR3 contained in a VH region encoded by one or more polynucleotides of SEQ ID NOs:56 or 60 or refened to in Tables 2 or 3.
- Molecules comprising, or alternatively consisting of, these antibodies, or antibody fragments or variants thereof, that immunospecifically bind to C35 polypeptide or a C35 polypeptide fragment or variant thereof are also encompassed by the invention, as are nucleic acid molecules encoding these antibodies, molecules, fragments and/or variants.
- the present invention also provides antibodies that immunospecifically bind to a polypeptide, or polypeptide fragment or variant of a C35 polypeptide, wherein said antibodies comprise, or alternatively consist of, a polypeptide having an amino acid sequence of any one, two, three, or more of the VL CDRs contained in a VL region encoded by one or more polynucleotides of SEQ ID NO:58 or refened to in Tables 2 or 3.
- antibodies that immunospecifically bind a C35 polypeptide comprising, or alternatively consisting of, a polypeptide having the amino acid sequence of a VL CDR1 contained in a VL region encoded by one or more polynucleotides of SEQ ID NO:58 or refened to in Tables 2 or 3.
- antibodies that immunospecifically bind a C35 polypeptide comprise, or alternatively consist of, a polypeptide having the amino acid sequence of a VL CDR2 contained in a VL region encoded by one or more polynucleotides of SEQ ID NO:58 or refened to in Tables 2 or 3.
- antibodies that immunospecifically bind a C35 polypeptide comprise, or alternatively consist of a polypeptide having the amino acid sequence of a VL CDR3 contained in a VL region encoded by one or more polynucleotides of SEQ ID NO:58 or refened to in Tables 2 or 3.
- Molecules comprising, or alternatively consisting of, these antibodies, or antibody fragments or variants thereof, that immunospecifically bind to C35 polypeptide or a C35 polypeptide fragment or variant thereof are also encompassed by the invention, as are nucleic acid molecules encoding these antibodies, molecules, fragments and/or variants.
- the present invention also provides antibodies (including molecules comprising, or alternatively consisting of, antibody fragments or variants) that immunospecifically bind to a C35 polypeptide or polypeptide fragment or variant of a C35 polypeptide, wherein said antibodies comprise, or alternatively consist of, one, two, three, or more VH CDRs and one, two, three or more VL CDRs, as contained in a VH region or VL region encoded by one or more polypeptides of SEQ ID NOs:57, 59, or 61 or refened to in Tables 2 or 3.
- the invention provides for antibodies that immunospecifically bind to a polypeptide or polypeptide fragment or variant of a C35 polypeptide, wherein said antibodies comprise, or alternatively consist of, a VH CDR1 and a VL CDR1, a VH CDR1 and a VL CDR2, a VH CDR1 and a VL CDR3, a VH CDR2 and a VL CDR1, VH CDR2 and VL CDR2, a VH CDR2 and a VL CDR3, a VH CDR3 and a VH CDR1, a VH CDR3 and a VL CDR2, a VH CDR3 and a VL CDR3, or any combination thereof, of the VH CDRs and VL CDRs contained in a VH region or VL region encoded by one or more polynucleotides of SEQ ID NOs:56, 58, or 60 or refened to in Tables 2 or 3.
- the one, two, three, or more VH CDRs and one, two, three, or more VL CDRs may be from clones H0009 and L0010, clones H0009 and 1F2K, clones H0009 and 1B3K, clone H009 and SEQ ID NO:58, clones 1F2G and 1F2K, clones 1F2G and 1B3K, clones 1F2G and L0010, clone 1F2G and SEQ ID NO:58, clones 1B3G and 1B3K, clones 1B3G and 1F2K, clones 1B3G and L0010, clone 1B3G and SEQ ID NO:58, SEQ ID NO:56 and SEQ ID NO:58, SEQ ID NO:56 and clone L0010, SEQ ID NO:56 and clone 1F2K, SEQ ID NO:56 and clone 1B3K, SEQ ID NO
- Molecules comprising, or alternatively consisting of, fragments or variants of these antibodies, that immunospecifically bind to C35 polypeptide are also encompassed by the invention, as are nucleic acid molecules encoding these antibodies, molecules, fragments or variants.
- the antibodies are human, chimeric (e.g., human.mouse chimeric), or humanized antibodies or antigen-binding antibody fragments of the present invention, including, but not limited to, Fab, Fab' and F(ab')2, Fd, single-chain Fvs (scFv), diabodies, triabodies, tetrabodies, minibodies, single-chain antibodies, disulfide-linked Fvs (sdFv), and intrabodies, and fragments comprising either a VL or VH region.
- Antigen- binding antibody fragments may comprise the variable region(s) alone or in combination with the entirety or a portion of the following: hinge region, CHI, CH2, and CH3 domains. Also included in the invention are antigen-binding fragments also comprising any combination of variable region(s) with a hinge region, CHI, CH2, and CH3 domains. Prefened C35 antibodies in the therapeutic methods of the invention are those containing a deletion of the CH2 domain.
- Antibodies of the present invention may be described or specified in terms of the epitope(s) or portion(s) of a polypeptide of the present invention which they recognize or specifically bind.
- the epitope(s) or polypeptide portion(s) may be specified as described herein, e.g., by N-terminal and C- terminal positions, or by size in contiguous amino acid residues.
- Antibodies which specifically bind any epitope or polypeptide of the present invention may also be excluded. Therefore, the present invention includes antibodies that specifically bind polypeptides of the present invention, and allows for the exclusion of the same.
- Antibodies of the present invention may also be described or specified in terms of their binding affinity to a polypeptide of the invention.
- Prefened binding affinities include those with a dissociation constant or Kd less than 5 X 10(-7) M, 10(-7) M, 5 X 10(-8) M, 10(-8) M, 5 X 10(-9) M, 10(-9) M, 5 X 10(-10) M, 10(-10) M, 5 X l ⁇ (-ll) M, l ⁇ (-ll) M, 5 X 10(-12) M, 10(-12) M, 5 X 10(-13) M, 10(-13) M, 5 X 10(-14) M, 10(-14) M, 5 X 10(-15) M, or 10(- 15) M.
- Antibodies of the invention have an affinity for C35 the same as or similar to the affinity of the antibodies 1F2, 1B3, MAb 165, MAb 171, or MAbc009.
- the antibodies of the invention have an affinity for C35 that is higher than the affinity of the antibodies 1F2, 1B3, MAb 165, MAb 171, orMAbc009.
- the invention also provides antibodies that competitively inhibit binding of an antibody to a C35 epitope as determined by any method known in the art for determining competitive binding, for example, the immunoassays and antibody binding assays described herein, hi prefened embodiments, the antibody competitively inhibits binding to the epitope by at least 95%, at least 90%, at least 85%, at least 80%, at least 75%, at least 70%, at least 60%, or at least 50%.
- Antibodies of the present invention may also be described or specified in terms of their cross-reactivity. Antibodies that do not bind any other analog, ortholog, or homolog of a polypeptide of the present invention are included. Antibodies that bind polypeptides with at least 95%, at least 90%, at least 85%, at least 80%, at least 75%, at least 70%, at least 65%, at least 60%, at least 55%, and at least 50% identity (as calculated using methods known in the art and described herein) to a polypeptide of the present invention are also included in the present invention. In specific embodiments, antibodies of the present invention cross-react with murine, rat and/or rabbit homologs of human proteins and the conesponding epitopes thereof.
- Antibodies that do not bind polypeptides with less than 95%, less than 90%, less than 85%, less than 80%, less than 75%, less than 70%, less than 65%, less than 60%, less than 55%, and less than 50% identity (as calculated using methods known in the art and described herein) to a polypeptide of the present invention are also included in the present invention, h a specific embodiment, the above- described cross-reactivity is with respect to any single specific antigenic or immunogenic polypeptide, or combination(s) of 2, 3, 4, 5, or more of the specific antigenic and/or immunogenic polypeptides disclosed herein.
- Further included in the present invention are antibodies which bind polypeptides encoded by polynucleotides which hybridize to a polynucleotide of the present invention under stringent hybridization conditions (as described herein).
- Antibodies of the present invention may be described or specified in terms of the epitope(s) or portion(s) of a polypeptide of the present invention which they recognize or specifically bind.
- the epitope(s) or polypeptide portion(s) may be specified as described herein, e.g., by N-terminal and C- terminal positions, by size in contiguous amino acid residues, or listed in the Tables and Figures.
- Antibodies which specifically bind any epitope or polypeptide of the present invention may also be excluded. Therefore, the present invention includes antibodies that specifically bind polypeptides of the present invention, and allows for the exclusion of the same. Excluded from the invention are antibodies against C35 disclosed in US 2002/0052308 and/or WO 01/74859, and/or antibodies that specifically bind an epitope disclosed therein.
- antibodies of the present invention bind to an epitope contained within the fragment represented by residues 105 to 115 of the native C35 sequence. In another embodiment, antibodies of the present invention bind to an epitope contained within the fragment represesnted by residues 53-104 of the native C35 sequence.
- Antibodies of the present invention may also be described or specified in terms of their cross-reactivity, or lack thereof. Antibodies that do not bind any other analog, ortholog, or homolog of a polypeptide of the present invention are included. Antibodies that bind polypeptides with at least 95%, at least 90%, at least 85%, at least 80%, at least 75%, at least 70%, at least 65%, at least 60%, at least 55%, and at least 50% identity (as calculated using methods known in the art and described herein) to a polypeptide of the present invention are also included in the present invention, hi specific embodiments, antibodies of the present invention cross-react with murine, monkey, rat and/or rabbit homologs of human proteins and the conesponding epitopes thereof.
- Antibodies that do not bind polypeptides with less than 95%), less than 90%, less than 85%, less than 80%, less than 75%, less than 70%, less than 65%, less than 60%, less than 55%, and less than 50% identity (as calculated using metliods known in the art and described herein) to a polypeptide of the present invention are also included in the present invention. Lh a specific embodiment, the above-described cross-reactivity is with respect to any single specific antigenic or immunogenic polypeptide, or combination(s) of 2, 3, 4, 5, or more of the specific antigenic and/or immunogenic polypeptides disclosed herein. Further included in the present invention are antibodies which bind polypeptides encoded by polynucleotides which hybridize to a polynucleotide of the present invention under stringent hybridization conditions (as described herein).
- the antibodies of the present invention (including molecules comprising, or alternatively consisting of, antibody fragments or variants thereof), immunospecifically bind to C35 polypeptide and do not cross-react with any other antigens.
- antibodies of the invention preferentially bind C35 polypeptide (SEQ ID NO:2), or fragments and variants thereof relative to their ability to bind other antigens.
- an antibody may be considered to bind a first antigen preferentially if it binds said first antigen with a dissociation constant (KD) that is less than the antibody's KD for the second antigen.
- KD dissociation constant
- an antibody may be considered to bind a first antigen preferentially if it binds said first antigen with an affinity that is at least one order of magnitude less than the antibody's KD for the second antigen.
- an antibody may be considered to bind a first antigen preferentially if it binds said first antigen with an affinity that is at least two orders of magnitude less than the antibody's KD for the second antigen.
- an antibody may be considered to bind a first antigen preferentially if it binds said first antigen with an off rate (k(off)) that is less than the antibody's k(off) for the second antigen.
- an antibody may be considered to bind a first antigen preferentially if it binds said first antigen with an affinity that is at least one order of magnitude less than the antibody's k(off) for the second antigen,
- an antibody may be considered to bind a first antigen preferentially if it binds said first antigen with an affinity that is at least two orders of magnitude less than the antibody's k(off) for the second antigen.
- antibodies of the invention bind C35 polypeptides or fragments or variants thereof with an off rate (k(off)) of less than or equal to 5 X 10(-2) sec-1, 10(-2) sec-1, 5 X 10(-3) sec-1 or 10(-3) sec-1. More preferably, antibodies of the invention bind C35 polypeptides or fragments or variants thereof with an off rate (k(off)) less than or equal to 5 X 10(-4) sec-1, 10(-4) sec-1, 5 X 10(-5) sec-1, or 10(-5) sec-1 5 X 10(-6) sec-1, 10(-6) sec-1, 5 X 10(-7) sec-1 or 10(-7) sec-1.
- antibodies of the invention bind C35 polypeptides or fragments or variants thereof with an on rate (k(on)) of greater than or equal to 10(3) M-l sec-1, 5 X 10(3) M-l sec-1, 10(4) M-l sec-1 or 5 X 10(4) M-l sec-1. More preferably, antibodies of the invention bind C35 polypeptides or fragments or variants thereof with an on rate (k(on)) greater than or equal to 10(5) M-l sec-1, 5 X 10(5) M-l sec-1, 10(6) M-l sec-1, or 5 X 10(6) M-l sec-1 or 10(7) M-l sec-1.
- the present invention also provides antibodies that comprise, or alternatively consist of, variants (including derivatives) of the antibody molecules (e.g., the VH regions and/or VL regions) described herein, which antibodies immunospecifically bind to a C35 polypeptide or fragment or variant thereof.
- Standard techniques known to those of skill in the art can be used to introduce mutations in the nucleotide sequence encoding a molecule of the invention, including, for example, site-directed mutagenesis and PCR- mediated mutagenesis which result in amino acid substitutions.
- the variants encode less than 50 amino acid substitutions, less than 40 amino acid subsitutions, less than 30 amino acid substitutions, less than 25 amino acid substitutions, less than 20 amino acid substitutions, less than 15 amino acid substitutions, less than 10 amino acid substitutions, less than 5 amino acid substitutions, less than 4 amino acid substitutions, less than 3 amino acid substitutions, or less than 2 amino acid substitutions relative to the reference VH region, VHCDR1, VHCDR2, VHCDR3, VL region, VLCDR1, VLCDR2, or VLCDR3.
- a "conservative amino acid substitution” is one in which the amino acid residue is replaced with an amino acid residue having a side chain with a similar charge.
- Families of amino acid residues having side chains with similar charges have been defined in the art. These families include amino acids with basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan), beta-branched side chains ( e.g., threonine, valine, isoleucine) and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, histidine).
- basic side chains e.g., lysine, arginine, histidine
- acidic side chains e
- mutations can be introduced randomly along all or part of the coding sequence, such as by saturation mutagenesis, and the resultant mutants can be screened for biological activity to identify mutants that retain activity (e.g., the ability to bind a C35 polypeptide).
- mutations only in framework regions or only in CDR regions of an antibody molecule. Introduced mutations may be silent or neutral missense mutations, i.e., have no, or little, effect on an antibody's ability to bind antigen. These types of mutations may be useful to optimize codon usage, or improve a hybridoma' s antibody production.
- non-neutral missense mutations may alter an antibody's ability to bind antigen.
- the location of most silent and neutral missense mutations is likely to be in the framework regions, while the location of most non-neutral missense mutations is likely to be in CDR, though this is not an absolute requirement.
- One of skill in the art would be able to design and test mutant molecules with desired properties such as no alteration in antigen binding activity or alteration in binding activity (e.g., improvements in antigen binding activity or change in antibody specificity).
- the encoded protein may routinely be expressed and the functional and/or biological activity of the encoded protein, (e.g., ability to immunospecifically bind a C35 polypeptide) can be determined using techniques described herein or by routinely modifying techniques known in the art.
- an antibody of the invention (including a molecule comprising, or alternatively consisting of, an antibody fragment or variant thereof), that immunospecifically binds C35 polypeptides or fragments or variants thereof, comprises, or alternatively consists of, an amino acid sequence encoded by a nucleotide sequence that hybridizes to a nucleotide sequence that is complementary to that encoding one of the VH or VL regions encoded by one or more of the nucleic acids of SEQ ID NOs:56, 58, or 60 or refened to in Tables 2 or 3 under stringent conditions, e.g., hybridization to filter-bound DNA in 6X sodium chloride/sodium citrate (SSC) at about 45° C followed by one or more washes in 0.2xSSC/0.1% SDS at about 50-65° C, under highly stringent conditions, e.g., hybridization to filter-bound nucleic acid in 6xSSC at about 45° C followed by one or more washes in O.l
- SSC sodium
- nucleic acid molecules encoding these antibodies are also encompassed by the invention. [0134] It is well known within the art that polypeptides, or fragments or variants thereof, with similar amino acid sequences often have similar structure and many of the same biological activities.
- an antibody (including a molecule comprising, or alternatively consisting of, an antibody fragment or variant thereof), that immunospecifically binds to a C35 polypeptide or fragments or variants of a C35 polypeptide, comprises, or alternatively consists of, a VH region having an amino acid sequence that is at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 99% identical, to the amino acid sequence of a VH region encoded by a nucleic acid of SEQ ID NOs: 56 or 60 or refened to in Tables 2 or 3.
- an antibody (including a molecule comprising, or alternatively consisting of, an antibody fragment or variant thereof), that immunospecifically binds to a C35 polypeptide or fragments or variants of a C35 polypeptide, comprises, or alternatively consists of, a VL region having an amino acid sequence that is at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 99% identical, to the amino acid sequence of a VL region encoded by a nucleic acid of SEQ ID NO:58 or refened to in Tables 2 or 3.
- the invention also encompasses antibodies (including molecules comprising, or alternatively consisting of, antibody fragments or variants thereof) that have one or more of the same biological characteristics as one or more of the antibodies described herein.
- biological characteristics is meant, the in vitro or in vivo activities or properties of the antibodies, such as, for example, the ability to bind to C35 polypeptide (e.g., C35 polypeptide expressed on a cell surface during apoptosis); the ability to substantially inhibit or abolish C35 polypeptide mediated biological activity; the ability to kill C35- associated cancer cells (e.g., treat or diagnose C35 -associated cancer), or detect C35; the ability to inhibit or abolish C35 polypeptide mediated biological activity.
- the antibodies of the invention will bind to the same epitope as at least one of the antibodies specifically refened to herein. Such epitope binding can be routinely determined using assays known in the art.
- Humanized immunoglobulins and human antibody variants of the invention have variable framework regions substantially from a human immunoglobulin (termed an acceptor immunoglobulin), and CDRs substantially from the mouse C35 VH and VL regions encoded by the clones in Table 2 or from the human C35 VH and VL regions encoded by the clones in Table 3 (refened to as the donor immunoglobulin).
- the constant region(s), if present, are also substantially from a human immunoglobulin.
- the humanized antibodies and human antibody variants exhibit a specific binding affinity for C35 of at least 10(2), 10(3), 10(4), 10(5), 10(6), 10(7), 10(8), 10(9), or 10(10) M(-l).
- the upper limit of binding affinity of the humanized antibodies and human antibody variants for human C35 is within a factor of 3, 4, 5 or 10 of that of the mouse antibodies 1F2 or 1B3 or the human antibody MAbc009, or of antibodies MAb 165 or MAb 171.
- the lower limit of binding affinity is also within a factor of 3, 4, 5 or 10 of that of the mouse antibodies in 1F2 or 1B3 or human antibody MAbc009, or of antibodies MAb 165 or MAb 171.
- Prefened humanized immunoglobulins and human antibody variants compete with the mouse antibodies 1F2 or 1B3 or human antibody MAbc009, or antibodies MAb 165 or MAb 171 for binding to C35 and prevent C35 from binding to the respective mouse or human antibody.
- the heavy and light chain variable regions of possible human acceptor antibodies are described by Kabat, Sequences of Proteins of hnmunological Interest (National Institutes of Health, Bethesda, Md., 1987 and 1991).
- the human acceptor antibody is chosen such that its variable regions exhibit a high degree of sequence identity with those of the mouse C35 antibody.
- the heavy and light chain variable framework regions can be derived from the same or different human antibody sequences.
- the human antibody sequences can be the sequences of naturally occurring human antibodies or can be consensus sequences of several human antibodies.
- humanized immunoglobulins can be carried out as follows. When an amino acid falls under the following category, the framework amino acid of a human immunoglobulin to be used (acceptor immunoglobulin) is replaced by a framework amino acid from a CDR- providing non-human immunoglobulin (donor immunoglobulin):
- the CDR regions in humanized antibodies and human antibody variants are substantially identical, and more usually, identical to the conesponding CDR regions in the mouse or human antibody from which they were derived. Although not usually desirable, it is sometimes possible to make one or more conservative amino acid substitutions of CDR residues without appreciably affecting the binding affinity of the resulting humanized immunoglobulin or human antibody variant. Occasionally, substitutions of CDR regions can enhance binding affinity.
- the framework regions of humanized immunoglobulins and human antibody variants are usually substantially identical, and more usually, identical to the framework regions of the human antibodies from which they were derived (acceptor immunoglobulin).
- analogs of HuZAF show substantial amino acid sequence identity with HuZAF.
- Heavy and light chain variable regions of analogs are encoded by nucleic acid sequences that hybridize with the nucleic acids encoding the heavy or light chain variable regions of HuZAF, or degenerate forms thereof, under stringent conditions.
- Phage-display technology offers powerful techniques for selecting such analogs while retaining binding affinity and specificity (see, e.g., Dower et al., WO 91/17271; McCafferty et al., WO 92/01047; and Huse, WO 92/06204 (each of which is incorporated by reference in its entirety for all purposes).
- VH and VL genes in the nucleic acid clones in Tables 2 or 3 or SEQ ID NO:s 56, 58, or 60 can be employed to select fully human antibodies specific for C35 according to the method taught by US 2002 0123057A1, "In vitro methods of producing and identifying immunoglobulin molecules in eukaryotic cells," published 5 September 2002. Briefly, the mouse (or human) VH linked to a human CH is employed to select fully human immunoglobulin light chains from a library of such light chains that when paired with the mouse (or human) VH confers specificity for C35.
- the selected fully human immunoglobulin light chains are then employed to select fully human immunoglobulin heavy chains from a library of such heavy chains that when paired with the fully human light chain confer specificity for C35.
- the mouse (or human) VL linked to a human CL may be employed to select fully human immunoglobulin heavy chains from a library of such heavy chains that when paired with the mouse (or human) VL confers specificity for C35.
- the selected fully human immunoglobulin heavy chains are then employed to select fully human immunoglobulin light chains from a library of such light chains that when paired with the fully human heavy chain confer specificity for C35.
- the fully human antibody selected in this fashion has epitope specificity that is identical or closely related to that of the original mouse (or human) C35-specific antibody.
- each member of the library comprises a CDR3 region derived from an isolated murine monoclonal antibody specific for C35, e.g., lF2 or lB3.
- All fully human antibodies or antibodies having one or more non-human (e.g., mouse) CDRs including molecules comprising, or alternatively consisting of, antibody fragments or variants thereof) selected through use of the method of US 2002 0123057 Al starting with immunoglobulin heavy or light chain variable regions encoded by the nucleic acids of SEQ ID NO:s 56, 58, or 60 or refened to in Tables 2 or 3 are encompassed in the present invention.
- variable segments of humanized antibodies or human antibody variants produced as described supra are typically linked to at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin.
- Fc immunoglobulin constant region
- Human constant region DNA sequences can be isolated in accordance with well-known procedures from a variety of human cells, such as immortalized B-cells (see Kabat et al., supra, and WO 87/02671).
- the antibody may contain both light chain and heavy chain constant regions.
- the heavy chain constant region may include CHI, hinge, CH2, CH3, and, sometimes, CH4 regions. For therapeutic purposes, the CH2 domain may be deleted or omitted.
- the humanized antibody or human antibody variants include antibodies having all types of constant regions, including IgM, IgG, IgD, IgA and IgE, and any isotype, including IgGl, IgG2, IgG3 and IgG4.
- the constant domain is usually a complement-fixing constant domain and the class is typically IgGl .
- the constant domain can be of the IgG2 class.
- the humanized antibody or human antibody variants may comprise sequences from more than one class or isotype.
- Chimeric antibodies are also encompassed in the present invention. Such antibodies may comprise the VH region and/or VL region encoded by the nucleic acids of SEQ ID NOs:56, 58, or 60 or in Tables 2 or 3 fused to the CH region and/or CL region of a another species, such as human or mouse or horse, etc.
- a chimeric antibody comprises the VH and/or VL region encoded by the nucleic acids of Table 2 fused to human C regions.
- the human CH2 domain may be deleted when antibodies are used in therapeutic purposes.
- Chimeric antibodies encompass antibody fragments, as described above.
- variable segments of chimeric antibodies are typically linked to at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin.
- Fc immunoglobulin constant region
- Human constant region DNA sequences can be isolated in accordance with well-known procedures from a variety of human cells, such as immortalized B-cells (see Kabat et al., supra, and WO 87/02671).
- the antibody may contain both light chain and heavy chain constant regions.
- the heavy chain constant region may include CHI, hinge, CH2, CH3, and, sometimes, CH4 regions. For therapeutic purposes, the CH2 domain may be deleted or omitted.
- variable segments of chimeric antibodies produced as described supra are typically linked to at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin.
- Fc immunoglobulin constant region
- Human constant region DNA sequences can be isolated in accordance with well-known procedures from a variety of human cells, such as immortalized B-cells (see Kabat et al., supra, and WO 87/02671).
- the antibody may contain both light chain and heavy chain constant regions.
- the heavy chain constant region may include CHI, hinge, CH2, CH3, and, sometimes, CH4 regions. For therapeutic purposes, the CH2 domain may be deleted or omitted.
- Chimeric antibodies include antibodies having all types of constant regions, including IgM, IgG, IgD, IgA and IgE, and any isotype, including IgGl, IgG2, IgG3 and IgG4.
- the constant domain is usually a complement-fixing constant domain and the class is typically IgGl.
- the constant domain can be of the IgG2 class.
- the chimeric antibody may comprise sequences from more than one class or isotype.
- a variety of methods are available for producing such immunoglobulins. Because of the degeneracy of the genetic code, a variety of nucleic acid sequences encode each immunoglobulin amino acid sequence.
- the desired nucleic acid sequences can be produced by de novo solid-phase DNA synthesis or by PCR mutagenesis of an earlier prepared variant of the desired polynucleotide. All nucleic acids encoding the antibodies described in this application are expressly included in the invention.
- the whole antibodies, their dimers, individual light and heavy chains, or other immunoglobulin forms of the present invention can be purified according to standard procedures in the art, including ammonium sulfate precipitation, affinity columns, column chromatography, gel electrophoresis and the like (see, generally, Scopes, R., Protein Purification, Springer- Verlag, N.Y. (1982), which is incorporated herein by reference).
- Substantially pure immunoglobulins of at least about 90 to 95% homogeneity are prefened, and 98 to 99% or more homogeneity most prefened, for pharmaceutical uses.
- the polypeptides may then be used therapeutically (including extracorporeally), in developing and performing assay procedures, immunofluorescent stainings, and the like.
- therapeutically including extracorporeally
- immunofluorescent stainings and the like.
- detect C35 or diagnose a C35-associated cancer or detect C35 or diagnose a C35-associated cancer.
- the present invention also provides for fusion proteins comprising, or alternatively consisting of, an antibody (including molecules comprising, or alternatively consisting of, antibody fragments or variants thereof), that immunospecifically binds to C35 polypeptide, and a heterologous polypeptide.
- the heterologous polypeptide to which the antibody is fused is useful for function or is useful to target the C35 polypeptide expressing cells, including but not limited to breast, ovarian, bladder, colon, and pancreatic cancer cells, and melanoma cells, hi an alternative prefened embodiment, the heterologous polypeptide to which the antibody is fused is useful for T cell, macrophage, and/or monocyte cell function or is useful to target the antibody to a T cell, macrophage, or monocyte.
- a fusion protein of the invention comprises, or alternatively consists of, a polypeptide having the amino acid sequence of any one or more of the VH regions of an antibody of the invention or the amino acid sequence of any one or more of the VL regions of an antibody of the invention or fragments or variants thereof, and a heterologous polypeptide sequence
- a fusion protein of the present invention comprises, or alternatively consists of, a polypeptide having the amino acid sequence of any one, two, three, or more of the VH CDRs of an antibody of the invention, or the amino acid sequence of any one, two, three, or more of the VL CDRs of an antibody of the invention, or fragments or variants thereof, and a heterologous polypeptide sequence.
- the fusion protein comprises, or alternatively consists of, a polypeptide having the amino acid sequence of a VH CDR3 of an antibody of the invention, or fragment or variant thereof, and a heterologous polypeptide sequence, which fusion protein immunospecifically binds to C35 polypeptide.
- a fusion protein comprises, or alternatively consists of a polypeptide having the amino acid sequence of at least one VH region of an antibody of the invention and the amino acid sequence of at least one VL region of an antibody of the invention or fragments or variants thereof, and a heterologous polypeptide sequence.
- a fusion protein of the invention comprises, or alternatively consists of a polypeptide having the amino acid sequence of any one, two, three or more of the VH CDRs of an antibody of the invention and the amino acid sequence of any one, two, three or more of the VL CDRs of an antibody of the invention, or fragments or variants thereof, and a heterologous polypeptide sequence.
- VHCDR(s) or VLCDR(s) conespond to single antibody (or scFv or Fab fragment) of the invention Preferably, two, three, four, five, six, or more of the VHCDR(s) or VLCDR(s) conespond to single antibody (or scFv or Fab fragment) of the invention. Nucleic acid molecules encoding these fusion proteins are also encompassed by the invention.
- the antibodies of the present invention may be used either alone or in combination with other compositions.
- the antibodies may further be recombinantly fused to a heterologous polypeptide at the N- or C-terminus or chemically conjugated (including covalent and non-covalent conjugations) to polypeptides or other compositions.
- antibodies of the present invention may be recombinantly fused or conjugated to molecules useful as labels in detection assays and effector molecules such as heterologous polypeptides, drugs, radionuclides, or toxins. See, e.g., PCT publications WO 92/08495; WO 91/14438; WO 89/12624; U.S. Patent No. 5,314,995; and EP 396,387.
- antibodies of the invention may be administered to individuals as a form of passive immunization.
- antibodies of the present invention may be used for epitope mapping to identify the epitope(s) bound by the antibody.
- Epitopes identified in this way may, in turn, for example, be used as vaccine candidates, i.e., to immunize an individual to elicit antibodies against the naturally occurring forms of C35 for therapeutic methods.
- Antibodies of the present invention may act as agonists or antagonists of the C35 polypeptides.
- Antibodies of the present invention may be used, for example, but not limited to, to purify, detect, and target the polypeptides of the present invention, including both in vitro and in vivo diagnostic and therapeutic methods.
- the antibodies have use in immunoassays for qualitatively and quantitatively measuring levels of the polypeptides of the present invention in biological samples. See, e.g., Harlow et al., Antibodies: A Laboratory Manual, (Cold Spring Harbor Laboratory Press, 2nd ed. 1988) (incorporated by reference herein in its entirety).
- the antibodies of the invention include derivatives that are modified, i.e, by the covalent attachment of any type of molecule to the antibody such that covalent attachment does not prevent the antibody from generating an anti-idiotypic response or binding C35.
- the antibody derivatives include antibodies that have been modified, e.g., by glycosylation, acetylation, pegylation, phosphylation, phosphorylation, amidation, derivatization by known protecting/blocking groups, proteolytic cleavage, linkage to a cellular ligand or other protein, etc. Any of numerous chemical modifications may be carried out by known techniques, including, but not limited to specific chemical cleavage, acetylation, formylation, metabolic synthesis of tunicamycin, etc. Additionally, the derivative may contain one or more non-classical amino acids.
- Antibodies of the invention can be composed of amino acids joined to each other by peptide bonds or modified peptide bonds, i.e., peptide isosteres, and may contain amino acids other than the 20 gene-encoded amino acids.
- the C35 antibodies may be modified by natural processes, such as posttranslational processing, or by chemical modification techniques which are well known in the art. Such modifications are well described in basic texts and in more detailed monographs, as well as in a voluminous research literature. Modifications can occur anywhere in the C35 antibody, including the peptide backbone, the amino acid side-chains and the amino or carboxyl termini. It will be appreciated that the same type of modification may be present in the same or varying degrees at several sites in a given C35 antibody.
- C35 antibodies may contain many types of modifications.
- C35 antibodies may be branched, for example, as a result of ubiquitination, and they may be cyclic, with or without branching. Cyclic, branched, and branched cyclic C35 antibodies may result from posttranslation natural processes or may be made by synthetic methods.
- Modifications include acetylation, acylation, ADP-ribosylation, amidation, covalent attachment of flavin, covalent attachment of a heme moiety, covalent attachment of a nucleotide or nucleotide derivative, covalent attachment of a lipid or lipid derivative, covalent attachment of phosphotidylinositol, cross-linking, cyclization, disulfide bond formation, demethylation, formation of covalent cross-links, formation of cysteine, formation of pyroglutamate, formylation, gamma-carboxylation, glycosylation, GPI anchor formation, hydroxylation, iodination, methylation, myristoylation, oxidation, pegylation, proteolytic processing, phosphorylation, prenylation, racemization, selenoylation, sulfation, transfer-RNA mediated addition of amino acids to proteins such as arginylation, and ubiquitination.
- a further embodiment of the invention relates to a polypeptide which comprises the amino acid sequence of a C35 antibody sequence having an amino acid sequence which contains at least one amino acid substitution, but not more than 50 amino acid substitutions, even more preferably, not more than 40 amino acid substitutions, still more preferably, not more than 30 amino acid substitutions, and still even more preferably, not more than 20 amino acid substitutions.
- a polypeptide in order of ever-increasing preference, it is highly preferable for a polypeptide to have an amino acid sequence which comprises a C35 antibody sequence, which contains at least one, but not more than 10, 9, 8, 7, 6, 5, 4, 3, 2 or 1 amino acid substitutions, hi specific embodiments, the number of additions, substitutions, and/or deletions in the C35 antibody sequence is 1-5, 5-10, 5-25, 5-50, 10-50 or 50-150. For substitutions, conservative amino acid substitutions are preferable. The substitutions may be within the framework regions or the CDRs or both. [0166] The description in this section applies to C35 antibodies and to other antibodies useful in the method of the invention. Such antibodies may be conjugated to or complexed with a toxin, as described herein, or may be unconjugated or uncomplexed.
- the present invention also provides for nucleic acid molecules encoding a C35 antibody of the invention (including molecules comprising, or alternatively consisting of, antibody fragments or variants thereof).
- the invention also encompasses polynucleotides that hybridize under stringent or alternatively, under lower stringency hybridization conditions, e.g., as defined supra, to polynucleotides that encode an antibody, preferably, that specifically binds to a C35 polypeptide.
- a nucleic acid molecule of the invention encodes an antibody (including molecules comprising, or alternatively consisting of, antibody fragments or variants thereof), comprising, or alternatively consisting of, a VH region having an amino acid sequence of any one of the VH regions encoded by a nucleic acid of the invention and a VL region having an amino acid sequence of any one of the VL regions encoded by a nucleic acid of the invention.
- a nucleic acid molecule of the invention encodes an antibody (including molecules comprising, or alternatively consisting of, antibody fragments or variants thereof), comprising, or alternatively consisting of, a VH region having an amino acid sequence of any one of the VH regions encoded by a nucleic acid of the invention or a VL region having an amino acid sequence of any one of the VL regions encoded by a nucleic acid of the invention.
- the polynucleotides may be obtained, and the nucleotide sequence of the polynucleotides determined, by any method known in the art.
- a polynucleotide encoding the antibody may be assembled from chemically synthesized oligonucleotides (e.g., as described in Kutmeier et al., BioTechniques 17:242 (1994)), which, briefly, involves the synthesis of overlapping oligonucleotides containing portions of the sequence encoding the antibody, annealing and ligating of those oligonucleotides, and then amplification of the ligated oligonucleotides by PCR.
- a polynucleotide encoding an antibody may be generated from nucleic acid from a suitable source. If a clone containing a nucleic acid encoding a particular antibody is not available, but the sequence of the antibody molecule is known, a nucleic acid encoding the immunoglobulin may be chemically synthesized or obtained from a suitable source (e.g., an antibody cDNA library, or a cDNA library generated from, or nucleic acid, preferably poly A+RNA, isolated from, any tissue or cells expressing the antibody, such as hybridoma cells selected to express an antibody of the invention) by PCR amplification using synthetic primers hybridizable to the 3' and 5' ends of the sequence or by cloning using an oligonucleotide probe specific for the particular gene sequence to identify, e.g., a cDNA clone from a cDNA library that encodes the antibody. Amplified nucleic acids generated by PCR
- nucleotide sequence and conesponding amino acid sequence of the antibody may be manipulated using methods well known in the art for the manipulation of nucleotide sequences, e.g., recombinant DNA techniques, site directed mutagenesis, PCR, etc. (see, for example, the techniques described in Sambrook et al., 1990, Molecular Cloning, A Laboratory Manual, 2d Ed., Cold Spring Harbor Laboratory, Cold Spring Harbor, N.Y.
- the amino acid sequence of the heavy and/or light chain variable domains may be inspected to identify the sequences of the complementarity determining regions (CDRs) by methods that are well know in the art, e.g., by comparison to known amino acid sequences of other heavy and light chain variable regions to determine the regions of sequence hypervariability.
- CDRs complementarity determining regions
- one or more of the CDRs may be inserted within framework regions, e.g., into human framework regions to humanize a non-human antibody, as described supra.
- the framework regions may be naturally occurring or consensus framework regions, and preferably human framework regions (see, e.g., Chothia et al., J. Mol. Biol.
- the polynucleotide generated by the combination of the framework regions and CDRs encodes an antibody that specifically binds C35.
- one or more amino acid substitutions may be made within the framework regions, and, preferably, the amino acid substitutions improve binding of the antibody to its antigen. Additionally, such methods may be used to make amino acid substitutions or deletions of one or more variable region cysteine residues participating in an intrachain disulfide bond to generate antibody molecules lacking one or more intrachain disulfide bonds.
- Other alterations to the polynucleotide are encompassed by the present invention and within the skill of the art.
- a chimeric antibody is a molecule in which different portions are derived from different animal species, such as those having a variable region derived from a murine mAb and a human immunoglobulin constant region, e.g., humanized antibodies.
- Single chain antibodies are formed by linking the heavy and light chain fragments of the Fv region via an amino acid bridge, resulting in a single chain polypeptide.
- Techniques for the assembly of functional Fv fragments in E. coli may also be used (Skena et al, Science 242:1038-1041 (1988)).
- the present invention also provides for nucleic acid molecules encoding an antibody of the invention (including molecules comprising, or alternatively consisting of, antibody fragments or variants thereof).
- a nucleic acid molecule of the invention encodes an antibody (including molecules comprising, or alternatively consisting of, antibody fragments or variants thereof), comprising, or alternatively consisting of, a VH region having an amino acid sequence of any one of the VH regions encoded by a nucleic acid of S ⁇ Q ID NO:s 56 or 60 or refened to in Table 2 or 3 and a VL region having an amino acid sequence of any one of the VL regions encoded by a nucleic acid of S ⁇ Q JD NO:58 or refened to in Table 2 or 3.
- a nucleic acid molecule of the invention encodes an antibody (including molecules comprising, or alternatively consisting of, antibody fragments or variants thereof), comprising, or alternatively consisting of, a VH region having an amino acid sequence of any one of the VH regions encoded by a nucleic acid of S ⁇ Q ID NOs:56 or 60 or refened to in Table 2 or 3 or a VL region having an amino acid sequence of any one of the VL regions encoded by a nucleic acid of S ⁇ Q JD NO:58 or refened to in Table 2 or 3.
- the present invention also provides antibodies that comprise, or alternatively consist of, variants (including derivatives) of the antibody molecules (e.g., the VH regions and/or VL regions) described herein, which antibodies immunospecifically bind to a C35 polypeptide or fragment or variant thereof.
- Standard techniques known to those of skill in the art can be used to introduce mutations in the nucleotide sequence encoding a molecule of the invention, including, for example, site-directed mutagenesis and PCR- mediated mutagenesis which result in amino acid substitutions.
- the variants encode less than 50 amino acid substitutions, less than 40 amino acid subsitutions, less than 30 amino acid substitutions, less than 25 amino acid substitutions, less than 20 amino acid substitutions, less than 15 amino acid substitutions, less than 10 amino acid substitutions, less than 5 amino acid substitutions, less than 4 amino acid substitutions, less than 3 amino acid substitutions, or less than 2 amino acid substitutions relative to the reference VH region, VHCDR1, VHCDR2, VHCDR3, and/or VL region, VLCDR1, VLCDR2, or VLCDR3.
- a "conservative amino acid substitution” is one in which the amino acid residue is replaced with an amino acid residue having a side chain with a similar charge.
- Families of amino acid residues having side chains with similar charges have been defined in the art. These families include amino acids with basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan), beta-branched side chains ( e.g., threonine, valine, isoleucine) and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, histidine).
- basic side chains e.g., lysine, arginine, histidine
- acidic side chains e
- mutations can be introduced randomly along all or part of the coding sequence, such as by saturation mutagenesis, and the resultant mutants can be screened for biological activity to identify mutants that retain activity (e.g., the ability to bind a C35 polypeptide).
- mutations can be introduced only in framework regions or only in CDR regions, or both regions, of an antibody molecule. Introduced mutations may be silent or neutral missense mutations, i.e., have no, or little, effect on an antibody's ability to bind antigen. These types of mutations may be useful to optimize codon usage, or improve a hybridoma' s antibody production.
- non-neutral missense mutations may alter an antibody's ability to bind antigen.
- the location of most silent and neutral missense mutations is likely to be in the framework regions, while the location of most non-neutral missense mutations is likely to be in CDR, though this is not an absolute requirement.
- One of skill in the art would be able to design and test mutant molecules with desired properties such as no alteration in antigen binding activity or alteration in binding activity (e.g., improvements in antigen binding activity or change in antibody specificity).
- the encoded protein may routinely be expressed and the functional and/or biological activity of the encoded protein, (e.g., ability to immunospecifically bind a C35 polypeptide) can be determined using techniques described herein or by routinely modifying techniques known in the art.
- an antibody of the invention (including a molecule comprising, or alternatively consisting of, an antibody fragment or variant thereof), that immunospecifically binds C35 polypeptides or fragments or variants thereof, comprises, or alternatively consists of, an amino acid sequence encoded by a nucleotide sequence that hybridizes to a nucleotide sequence that is complementary to that encoding one of the VH or VL regions encoded by a nucleic acid of SEQ TD NO:s 56, 58, or 60 or refened to in Table 2 or 3 under stringent conditions, e.g., hybridization to filter-bound DNA in 6X sodium chloride/sodium citrate (SSC) at about 45° C followed by one or more washes in 0.2xSSC/0.1% SDS at about 50-65° C, under highly stringent conditions, e.g., hybridization to filter-bound nucleic acid in 6xSSC at about 45° C followed by one or more washes in O.
- SSC sodium chloride/s
- nucleic acid molecules encoding these antibodies are also encompassed by the invention.
- blocking reagents include Denhardt's reagent, BLOTTO, heparin, denatured salmon sperm DNA, and commercially available proprietary formulations.
- the inclusion of specific blocking reagents may require modification of the hybridization conditions described above, due to problems with compatibility.
- polynucleotide which hybridizes only to polyA+ sequences, or to a complementary stretch of T (or U) residues, would not be included in the definition of "polynucleotide,” since such a polynucleotide would hybridize to any nucleic acid molecule containing a poly (A) stretch or the complement thereof (e.g., practically any double-stranded cDNA clone generated using oligo dT as a primer).
- the C35 antibody polynucleotide can be composed of any polyribonucleotide or polydeoxribonucleotide, which may be unmodified RNA or DNA or modified RNA or DNA.
- C35 antibody polynucleotides can be composed of single- and double-stranded DNA, DNA that is a mixture of single- and double-stranded regions, single- and double- stranded RNA, and RNA that is mixture of single- and double-stranded regions, hybrid molecules comprising DNA and RNA that may be single- stranded or, more typically, double-stranded or a mixture of single- and double-stranded regions, hi addition, the C35 antibody polynucleotides can be composed of triple-stranded regions comprising RNA or DNA or both RNA and DNA.
- C35 antibody polynucleotides may also contain one or more modified bases or DNA or RNA backbones modified for stability or for other reasons.
- Modified bases include, for example, tritylated bases and unusual bases such as inosine.
- polynucleotide embraces chemically, enzymatically, or metabolically modified forms.
- Antibodies of the invention can be produced by any method known in the art. For example, it will be appreciated that antibodies in accordance with the present invention can be expressed in cell lines other than hybridoma cell lines. Sequences encoding the cDNAs or genomic clones for the particular antibodies can be used for transformation of a suitable mammalian or nonmammalian host cells or to generate phage display libraries, for example. Additionally, polypeptide antibodies of the invention may be chemically synthesized or produced through the use of recombinant expression systems.
- One way to produce the antibodies of the invention would be to clone the VH and/or VL regions encoded by any one or more of the nucleic acids of SEQ ID NOs: 56, 58, or 60 or refened to in Table 2 or 3.
- PCR primers including VH or VL nucleotide sequences may be used to amplify the VH and VL sequences contained in the vectors containing the nucleic acids of SEQ ID NOs: 56, 58, or 60 or Table 2 or 3.
- the PCR products may then be cloned using vectors, for example, which have a PCR product cloning site consisting of a 5' and 3' single T nucleotide overhang, that is complementary to the overhanging single adenine nucleotide added onto the 5' and 3' end of PCR products by many DNA polymerases used for PCR reactions.
- the VH and VL regions can then be sequenced using conventional methods known in the art.
- the cloned VH and VL genes may be placed into one or more suitable expression vectors.
- PCR primers including VH or VL nucleotide sequences, a restriction site, and a flanking sequence to protect the restriction site may be used to amplify the VH or VL sequences.
- the PCR amplified VH regions may be cloned into vectors expressing the appropriate immunoglobulin constant region, e.g., the human IgGl or IgG4 constant region for VH regions, and the human kappa or lambda constant regions for kappa and lambda VL regions, respectively.
- the vectors for expressing the VH or VL regions comprise a promoter suitable to direct expression of the heavy and light chains in the chosen expression system, a secretion signal, a cloning site for the immunoglobulin variable domain, immunoglobulin constant domains, and a selection marker such as neomycin.
- the VH and VL regions may also be cloned into a single vector expressing the necessary constant regions.
- the heavy chain conversion vectors and light chain conversion vectors are then co-transfected into cell lines to generate stable or transient cell lines that express full-length antibodies, e.g., IgG, using techniques known to those of skill in the art (See, for example, Guo et al., J. Clin. Endocrinol. Metab. 82:925-31 (1997), and Ames et al., J. Immunol. Methods 184:177-86 (1995) which are herein inco ⁇ orated in their entireties by reference).
- the invention further provides polynucleotides comprising a nucleotide sequence encoding an antibody of the invention and fragments thereof.
- the invention also encompasses polynucleotides that hybridize under stringent or lower stringency hybridization conditions, e.g., as defined supra, to polynucleotides that encode an antibody, preferably, that specifically binds to a polypeptide of the invention, preferably, an antibody that binds to a polypeptide having the amino acid sequence of SEQ ID NO:2 or a polypeptide encoded by the deposited clone.
- VH and VL regions of the heavy and light chains of one or more antibodies of the invention may be useful to express as single chain antibodies or Fab fragments in a phage display library.
- the cDNAs encoding the VH and VL regions of one or more antibodies of the invention may be expressed in all possible combinations using a phage display library, allowing for the selection of VH/VL combinations that bind a C35 polypeptides with prefened binding characteristics such as improved affinity or improved off rates.
- VH and VL segments, the CDR regions of the VH and VL regions of one or more antibodies of the invention in particular, may be mutated in vitro.
- VH and VL regions with "mutant" CDRs in a phage display library allows for the selection of VH/VL combinations that bind a C35 polypeptide receptor polypeptides with prefened binding characteristics such as improved affinity or improved off rates.
- functional antibody domains are displayed on the surface of phage particles which carry the polynucleotide sequences encoding them.
- DNA sequences encoding VH and VL regions are amplified from animal cDNA libraries (e.g., human or murine cDNA libraries of lymphoid tissues) or synthetic cDNA libraries.
- the DNA encoding the VH and VL regions are joined together by an scFv linker by PCR and cloned into a phagemid vector (e.g., p CANTAB 6 or pComb 3 HSS).
- a phagemid vector e.g., p CANTAB 6 or pComb 3 HSS.
- the vector is electroporated in E. coli and the E. coli is infected with helper phage.
- Phage used in these methods are typically filamentous phage including fd and Ml 3 and the VH and VL regions are usually recombinantly fused to either the phage gene HI or gene VHI.
- Phage expressing an antigen binding domain that binds to an antigen of interest can be selected or identified with antigen, e.g., using labeled antigen or antigen bound or captured to a solid surface or bead.
- Examples of phage display methods that can be used to make the antibodies of the present invention include, but are not limited to, those disclosed in Brinkman et al., J. Immunol. Methods 182:41-50 (1995); Ames et al., J. Immunol. Methods 184:177-186 (1995); Kettleborough et al., Eur. J. Immunol.
- a chimeric antibody is a molecule in which different portions are derived from different animal species, such as those having a variable region derived from a murine mAb and a human immunoglobulin constant region, e.g., humanized antibodies.
- Single chain antibodies are formed by linking the heavy and light chain fragments of the Fv region via an amino acid bridge, resulting in a single chain polypeptide.
- Techniques for the assembly of functional Fv fragments in E. coli may also be used (Skena et al, Science 242:1038- 1041 (1988)).
- the antibodies of the invention may be assayed for immunospecific binding by any method known in the art.
- the immunoassays which can be used include but are not limited to competitive and non-competitive assay systems using techniques such as western blots, radioimmunoassays, ELISA (enzyme linked immunosorbent assay), "sandwich” immunoassays, immunoprecipitation assays, precipitin reactions, gel diffusion precipitin reactions, immunodiffusion assays, agglutination assays, complement-fixation assays, immunoradiometric assays, fluorescent immunoassays, protein A immunoassays, to name but a few.
- Immunoprecipitation protocols generally comprise lysing a population of cells in a lysis buffer such as RLPA buffer (1% NP-40 or Triton X-100, 1% sodium deoxycholate, 0.1% SDS, 0.15 M NaCl, 0.01 M sodium phosphate at pH 7.2, 1% Trasylol) supplemented with protein phosphatase and/or protease inhibitors (e.g., EDTA, PMSF, aprotinin, sodium vanadate), adding the antibody of interest to the cell lysate, incubating for a period of time (e.g., 1-4 hours) at 4.degree.
- a lysis buffer such as RLPA buffer (1% NP-40 or Triton X-100, 1% sodium deoxycholate, 0.1% SDS, 0.15 M NaCl, 0.01 M sodium phosphate at pH 7.2, 1% Trasylol
- protein phosphatase and/or protease inhibitors e.g.
- Western blot analysis generally comprises preparing protein samples, electrophoresis of the protein samples in a polyacrylamide gel (e.g., 8%-20% SDS-PAGE depending on the molecular weight of the antigen), transferring the protein sample from the polyacrylamide gel to a membrane such as nitrocellulose, PVDF or nylon, blocking the membrane in blocking solution (e.g., PBS with 3% BSA or non-fat milk), washing the membrane in washing buffer (e.g., PBS-Tween 20), blocking the membrane with primary antibody (the antibody of interest) diluted in blocking buffer, washing the membrane in washing buffer, blocking the membrane with a secondary antibody (which recognizes the primary antibody, e.g., an anti-human antibody) conjugated to an enzymatic substrate (e.g., horseradish peroxidase or alkaline phosphatase) or radioactive molecule (e.g., 32P or 1251) diluted in blocking buffer, washing the membrane in wash buffer, and detecting the presence of the antigen
- ELISAs comprise preparing antigen, coating the well of a 96 well microtiter plate with the antigen, adding the antibody of interest conjugated to a detectable compound such as an enzymatic substrate (e.g., horseradish peroxidase or alkaline phosphatase) to the well and incubating for a period of time, and detecting the presence of the antigen.
- a detectable compound such as an enzymatic substrate (e.g., horseradish peroxidase or alkaline phosphatase)
- a detectable compound such as an enzymatic substrate (e.g., horseradish peroxidase or alkaline phosphatase)
- the antibody may be coated to the well, hi this case, a second antibody conjugated to a detectable compound may be added following the addition of the antigen of interest to the coated well.
- ELISAs see, e.g., Ausubel et al, eds, 1994, Cunent Protocols in Molecular Biology, Vol. 1, John Wiley & Sons, Inc., New York at 11.2.1.
- the binding affinity of an antibody to an antigen and the off-rate of an antibody-antigen interaction can be determined by competitive binding assays.
- a competitive binding assay is a radioimmunoassay comprising the incubation of labeled antigen (e.g., 3H or 1251) with the antibody of interest in the presence of increasing amounts of unlabeled antigen, and the detection of the antibody bound to the labeled antigen.
- the affinity of the antibody of interest for a particular antigen and the binding off- rates can be determined from the data by scatchard plot analysis. Competition with a second antibody can also be determined using radioimmunoassays.
- the antigen is incubated with antibody of interest conjugated to a labeled compound (e.g., 3H or 1251) in the presence of increasing amounts of an unlabeled second antibody.
- SPR Surface plasmon reasonance
- BIAcore offers a number of advantages over conventional methods of measuring the affinity of antibody-antigen interactions: (i) no requirement to label either antibody or antigen; (ii) antibodies do not need to be purified in advance, cell culture supernatant can be used directly; (ii ⁇ ) real-time measurements, allowing rapid semi-quantitative comparison of different monoclonal antibody interactions, are enabled and are sufficient for many evaluation purposes; (iv) biospecific surface can be regenerated so that a series of different monoclonal antibodies can easily be compared under identical conditions; (v) analytical procedures are fully automated, and extensive series of measurements can be performed without user intervention.
- BIAapplications Handbook version AB (reprinted 1998), BIACORE code No. BR-1001-86; BIAtechnology Handbook, version AB (reprinted 1998), BIACORE code No. BR-1001-84.
- SPR based binding studies require that one member of a binding pair be immobilized on a sensor surface.
- the binding partner immobilized is refened to as the ligand.
- the binding partner in solution is refened to as the analyte.
- the ligand is attached indirectly to the surface through binding to another immobilized molecule, which is refened as the capturing molecule.
- SPR response reflects a change in mass concentration at the detector surface as analytes bind or dissociate.
- the resulting sensorgram can be divided into three essential phases: (i) Association of analyte with ligand during sample injection; (ii) Equilibrium or steady state during sample injection, where the rate of analyte binding is balanced by dissociation from the complex; (iii) Dissociation of analyte from the surface during buffer flow.
- the equilibrium phase provides information on the affinity of the analyte-ligand interaction (K D ).
- BIAevaluation software provides comprehensive facilities for curve fitting using both numerical integration and global fitting algorithms. With suitable analysis of the data, separate rate and affinity constants for interaction can be obtained from simple BIAcore investigations. The range of affinities measurable by this technique is very broad ranging from mM to pM.
- Epitope specificity is an important characteristic of a monoclonal antibody. Epitope mapping with BIAcore, in contrast to conventional techniques using radioimmunoassay, ELISA or other surface adsorption methods, does not require labeling or purified antibodies, and allows multi-site specificity tests using a sequence of several monoclonal antibodies. Additionally, large numbers of analyses can be processed automatically. [0206] Pair-wise binding experiments test the ability of two MAbs to bind simultaneously to the same antigen. MAbs directed against separate epitopes will bind independently, whereas MAbs directed against closely related epitopes will interfere with each other's binding. These binding experiments with BIAcore are straightforward to carry out.
- Peptide inhibition is another technique used for epitope mapping. This method can complement pair-wise antibody binding studies, and can relate functional epitopes to structural features when the primary sequence of the antigen is known. Peptides or antigen fragments are tested for inhibition of binding of different MAbs to immobilized antigen. Peptides which interfere with binding of a given MAb are assumed to be structurally related to the epitope defined by that MAb.
- the antibodies of the invention can be produced by any method known in the art for the synthesis of antibodies, in particular, by chemical synthesis or preferably, by recombinant expression techniques.
- Recombinant expression of an antibody of the invention, or fragment, derivative or analog thereof, may require construction of an expression vector containing a polynucleotide that encodes the antibody.
- an expression vector containing a polynucleotide that encodes the antibody Once a polynucleotide encoding an antibody molecule or a heavy or light chain of an antibody, or portion thereof (preferably containing the heavy or light chain variable domain), of the invention has been obtained, the vector for the production of the antibody molecule may be produced by recombinant DNA technology using techniques well known in the art.
- Such vectors may include the nucleotide sequence encoding the constant region of the antibody molecule (see, e.g., PCT Publication WO 86/05807; PCT Publication WO 89/01036; and U.S. Pat. No. 5,122,464) and the variable domain of the antibody may be cloned into such a vector for expression of the entire heavy or light chain.
- the expression vector is transfened to a host cell by conventional techniques and the transfected cells are then cultured by conventional techniques to produce an antibody of the invention.
- the invention includes host cells containing a polynucleotide encoding an antibody of the invention, or a heavy or light chain thereof, or a single chain antibody of the invention, operably linked to a heterologous promoter.
- vectors encoding both the heavy and light chains may be co-expressed in the host cell for expression of the entire immunoglobulin molecule, as detailed below.
- host-expression vector systems may be utilized to express the antibody molecules of the invention.
- Such host-expression systems represent vehicles by which the coding sequences of interest may be produced and subsequently purified, but also represent cells which may, when transformed or transfected with the appropriate nucleotide coding sequences, express an antibody molecule of the invention in situ.
- These include but are not limited to microorganisms such as bacteria (e.g., E. coli, B.
- subtilis transformed with recombinant bacteriophage DNA, plasmid DNA or cosmid DNA expression vectors containing antibody coding sequences; yeast (e.g., Saccharomyces, Pichia) transformed with recombinant yeast expression vectors containing antibody coding sequences; insect cell systems infected with recombinant virus expression vectors (e.g., baculovirus) containing antibody coding sequences; plant cell systems infected with recombinant virus expression vectors (e.g., cauliflower mosaic virus, CaMV; tobacco mosaic virus, TMV) or transformed with recombinant plasmid expression vectors (e.g., Ti plasmid) containing antibody coding sequences; or mammalian cell systems (e.g., COS, CHO, BIK, 293, 3T3 cells) harboring recombinant expression constructs containing promoters derived from the genome of mammalian cells (e.g., metallothionein promoter) or from ma
- bacterial cells such as Escherichia coli, and more preferably, eukaryotic cells, especially for the expression of whole recombinant antibody molecule, are used for the expression of a recombinant antibody molecule.
- mammalian cells such as Chinese hamster ovary cells (CHO)
- CHO Chinese hamster ovary cells
- a vector such as the major intermediate early gene promoter element from human cytomegalovirus is an effective expression system for antibodies (Foecking et al., Gene 45:101 (1986); Cockett et al., Bio/Technology 8:2 (1990)).
- a number of expression vectors may be advantageously selected depending upon the use intended for the antibody molecule being expressed.
- vectors which direct the expression of high levels of fusion protein products that are readily purified may be desirable.
- Such vectors include, but are not limited, to the E. coli expression vector pUR278 (Ruther et al., EMBO J. 2:1791 (1983)), in which the antibody coding sequence may be ligated individually into the vector in frame with the lac Z coding region so that a fusion protein is produced; pIN vectors (Inouye & iouye, Nucleic Acids Res. 13:3101-3109 (1985); Van Heeke & Schuster, J. Biol. Chem.
- pGEX vectors may also be used to express foreign polypeptides as fusion proteins with glutathione S-transferase (GST).
- GST glutathione S-transferase
- fusion proteins are soluble and can easily be purified from lysed cells by adsorption and binding to matrix glutathione-agarose beads followed by elution in the presence of free glutathione.
- the pGEX vectors are designed to include thrombin or factor Xa protease cleavage sites so that the cloned target gene product can be released from the GST moiety.
- Autographa califomica nuclear polyhedrosis virus (AcNPV) is used as a vector to express foreign genes.
- the virus grows in Spodoptera frugiperda cells.
- the antibody coding sequence may be cloned individually into non-essential regions (for example the polyhedrin gene) of the virus and placed under control of an AcNPV promoter (for example the polyhedrin promoter).
- a number of viral-based expression systems may be utilized.
- the antibody coding sequence of interest may be ligated to an adenovirus transcription/translation control complex, e.g., the late promoter and tripartite leader sequence.
- This chimeric gene may then be inserted in the adenovirus genome by in vitro or in vivo recombination. Insertion in a non- essential region of the viral genome (e.g., region El or E3) will result in a recombinant virus that is viable and capable of expressing the antibody molecule in infected hosts, (e.g., see Logan & Shenk, Proc. Natl.
- Specific initiation signals may also be required for efficient translation of inserted antibody coding sequences. These signals include the ATG initiation codon and adjacent sequences. Furthermore, the initiation codon must be in phase with the reading frame of the desired coding sequence to ensure translation of the entire insert. These exogenous translational control signals and initiation codons can be of a variety of origins, both natural and synthetic. The efficiency of expression may be enhanced by the inclusion of appropriate transcription enhancer elements, transcription te ⁇ ninators, etc. (see Biftner et al., Methods in Enzymol. 153:51-544 (1987)).
- a host cell strain may be chosen which modulates the expression of the inserted sequences, or modifies and processes the gene product in the specific fashion desired. Such modifications (e.g., glycosylation) and processing (e.g., cleavage), of protein products may be important for the function of the protein.
- Different host cells have characteristic and specific mechanisms for the post-translational processing and modification of proteins and gene products. Appropriate cell lines or host systems can be chosen to ensure the conect modification and processing of the foreign protein expressed.
- eukaryotic host cells which possess the cellular machinery for proper processing of the primary transcript, glycosylation, and phosphorylation of the gene product may be used.
- Such mammalian host cells include but are not limited to CHO, VERY, BHK, Hela, COS, MDCK, 293, 3T3, W138, and in particular, breast cancer cell lines such as, for example, BT483, Hs578T, HTB2, BT20 and T47D, and normal mammary gland cell line such as, for example, CRL7030 and Hs578Bst.
- cell lines which stably express the antibody molecule may be engineered.
- host cells can be transformed with DNA controlled by appropriate expression control elements (e.g., promoter, enhancer, sequences, transcription terminators, polyadenylation sites, etc.), and a selectable marker.
- appropriate expression control elements e.g., promoter, enhancer, sequences, transcription terminators, polyadenylation sites, etc.
- engineered cells may be allowed to grow for 1-2 days in an enriched media, and then are switched to a selective media.
- the selectable marker in the recombinant plasmid confers resistance to the selection and allows cells to stably integrate the plasmid into their chromosomes and grow to form foci which in turn can be cloned and expanded into cell lines.
- This method may advantageously be used to engineer cell lines which express the antibody molecule.
- Such engineered cell lines may be particularly useful in screening and evaluation of compounds that interact directly or indirectly with the antibody molecule.
- a number of selection systems may be used, including but not limited to the herpes simplex virus thymidine kinase (Wigler et al., Cell 11:223 (1977)), hypoxanthine-guanine phosphoribosyltransferase (Szybalska & Szybalski, Proc. Natl. Acad. Sci. USA 48:202 (1992)), and adenine phosphoribosyltransferase (Lowy et al., Cell 22:817 (1980)) genes can be employed in tk-, hgprt- or aprt- cells, respectively.
- antimetabolite resistance can be used as the basis of selection for the following genes: dhfr, which confers resistance to methotrexate (Wigler et al., Natl. Acad. Sci. USA 77:357 (1980); O'Hare et al., Proc. Natl. Acad. Sci. USA 78:1527 (1981)); gpt, which confers resistance to mycophenolic acid (Mulligan & Berg, Proc. Natl. Acad. Sci.
- the expression levels of an antibody molecule can be increased by vector amplification (for a review, see Bebbington and Hentschel, The use of vectors based on gene amplification for the expression of cloned genes in mammalian cells in DNA cloning, Vol.3. (Academic Press, New York, 1987)).
- vector amplification for a review, see Bebbington and Hentschel, The use of vectors based on gene amplification for the expression of cloned genes in mammalian cells in DNA cloning, Vol.3. (Academic Press, New York, 1987)).
- a marker in the vector system expressing antibody is amplifiable
- increase in the level of inhibitor present in culture of host cell will increase the number of copies of the marker gene. Since the amplified region is associated with the antibody gene, production of the antibody will also increase (Crouse et al, Mol. Cell. Biol. 3:257 (1983)).
- the host cell may be co-transfected with two expression vectors of the invention, the first vector encoding a heavy chain derived polypeptide and the second vector encoding a light chain derived polypeptide.
- the two vectors may contain identical selectable markers which enable equal expression of heavy and light chain polypeptides.
- a single vector may be used which encodes, and is capable of expressing, both heavy and light chain polypeptides. hi such situations, the light chain should be placed before the heavy chain to avoid an excess of toxic free heavy chain (Proudfoot, Nature 322:52 (1986); Kohler, Proc. Natl Acad. Sci. USA 77:2197 (1980)).
- the coding sequences for the heavy and light chains may comprise cDNA or genomic DNA.
- Antibodies can be developed against the entire C35 polypeptide or portions thereof, or sites that . are prenylated, glycosylated, phosphorylated, myristoylated, or amidated.
- Fragments which function as epitopes may be produced by any conventional means. (See, e.g., Houghten, Proc. Natl. Acad. Sci. USA 52:5131-5135 (1985), further described in U.S. Patent No. 4,631,211).
- immunogenic epitopes can be used to induce antibodies according to methods well known in the art. (See, for instance, Sutcliffe et al., supra; Wilson et al, supra; Chow et al, Proc. Natl. Acad. Sci. USA 52:910- 914; and Bittle et al, J. Gen. Virol 55:2347-2354 (1985).
- Prefened immunogenic epitopes include the immunogenic epitopes disclosed herein, as well as any combination of two, three, four, five or more of these immunogenic epitopes.
- the polypeptides comprising one or more immunogenic epitopes may be presented for eliciting an antibody response together with a carrier protein, such as an albumin, to an animal system (such as rabbit or mouse), or, if the polypeptide is of sufficient length (at least about 25 amino acids), the polypeptide may be presented without a carrier.
- a carrier protein such as an albumin
- immunogenic epitopes comprising as few as 8 to 10 amino acids have been shown to be sufficient to raise antibodies capable of binding to, at the very least, linear epitopes in a denatured polypeptide (e.g., in Western blotting), hi a specific embodiment, epitopes of the present invention include those set forth in Table 11, infra.
- Epitope-bearing polypeptides of the present invention may be used to induce antibodies according to methods well known in the art including, but not limited to, in vivo immunization, in vitro immunization, and phage display methods. See, e.g., Sutcliffe et al, supra; Wilson et al, supra, and Bittle et al, J. Gen. Virol, 55:2347-2354 (1985).
- animals may be immunized with free peptide; however, anti-peptide antibody titer may be boosted by coupling the peptide to a macromolecular carrier, such as keyhole limpet hemacyanin (KLH) or tetanus toxoid.
- KLH keyhole limpet hemacyanin
- peptides containing cysteine residues may be coupled to a carrier using a linker such as maleimidobenzoyl- N-hydroxysuccinimide ester (MBS), while other peptides may be coupled to carriers using a more general linking agent such as glutaraldehyde.
- Epitope bearing peptides of the invention may also be synthesized as multiple antigen peptides (MAPs), first described by J. P. Tarn in Proc. Natl Acad. Sci. U.S.A. 55:5409 which is incorporated by reference herein in its entirety.
- MAPs consist of multiple copies of a specific peptide attached to a non-immunogenic lysine core.
- Map peptides usually contain four or eight copies of the peptide often refened to as MAP-4 or MAP-8 peptides.
- MAPs may be synthesized onto a lysine core matrix attached to a polyethylene glycol-polystyrene (PEG-PS) support.
- PEG-PS polyethylene glycol-polystyrene
- the peptide of interest is synthesized onto the lysine residues using 9- fluorenylmethoxycarbonyl (Fmoc) chemistry.
- Fmoc 9- fluorenylmethoxycarbonyl
- Applied Biosystems Foster City, CA
- MAP resins such as, for example, the Fmoc Resin 4 Branch and the Fmoc Resin 8 Branch which can be used to synthesize MAPs.
- Cleavage of MAPs from the resin is performed with standard trifloroacetic acid (TFA)-based cocktails known in the art. Purification of MAPs, except for desalting, is not necessary.
- MAP peptides may be used as an immunizing vaccine which elicits antibodies that recognize both the MAP and the native protein from which the peptide was derived.
- Epitope bearing peptides of the invention may also be incorporated into a coat protein of a virus which can then be used as an immunogen or a vaccine with which to immunize animals, including humans, in order encourage the production of anti-epitope antibodies.
- the V3 loop of the gpl20 glycoprotein of the human immunodeficiency virus type 1 (HIV-1) has been engineered to be expressed on the surface of rhinovirus. Immunization with this rhinovirus displaying the V3 loop peptide yielded apparently effective mimics of the HIV-1 immunogens (as measured by their ability to be neutralized by anti-HIV-1 antibodies as well as their ability to elicit the production of antibodies capable of neutralizing HIV-1 in cell culture).
- Animals such as rabbits, rats and mice are immunized with either free or carrier- coupled peptides or MAP peptides, for instance, by intraperitoneal and/or intradermal injection of emulsions containing about 100 ⁇ g of peptide or carrier protein and Freund's adjuvant or any other adjuvant known for stimulating an immune response.
- booster injections may be needed, for instance, at intervals of about two weeks, to provide a useful titer of anti- peptide antibody which can be detected, for example, by ELISA assay using free peptide adsorbed to a solid surface.
- the titer of anti-peptide antibodies in serum from an immunized animal may be increased by selection of anti- peptide antibodies, for instance, by adsorption to the peptide on a solid support and elution of the selected antibodies according to methods well known in the art.
- an antibody molecule of the invention may be purified by any method known in the art for purification of an immunoglobulin molecule, for example, by chromatography (e.g., ion exchange, affinity, particularly by affinity for the specific antigen after Protein A, and sizing column chromatography), centrifugation, differential solubility, or by any other standard technique for the purification of proteins.
- chromatography e.g., ion exchange, affinity, particularly by affinity for the specific antigen after Protein A, and sizing column chromatography
- centrifugation e.g., ion exchange, affinity, particularly by affinity for the specific antigen after Protein A, and sizing column chromatography
- differential solubility e.g., differential solubility
- the antibodies of the present invention or fragments thereof can be fused to heterologous polypeptide sequences described herein or otherwise known in the art, to facilitate purification.
- the antibodies of the present invention may be generated by any suitable method known in the art.
- Polyclonal antibodies to an antigen-of- interest can be produced by various procedures well known in the art.
- a polypeptide of the invention can be administered to various host animals including, but not limited to, rabbits, mice, rats, etc. to induce the production of sera containing polyclonal antibodies specific for the antigen.
- adjuvants may be used to increase the immunological response, depending on the host species, and include but are not limited to, Freund's (complete and incomplete), mineral gels such as aluminum hydroxide, surface active substances such as lysolecithin, pluronic polyols, polyanions, peptides, oil emulsions, keyhole limpet hemocyanins, dinitrophenol, and potentially useful human adjuvants such as BCG (bacille Calmette-Guerin) and corynebacterium parvum. Such adjuvants are also well known in the art.
- Monoclonal antibodies can be prepared using a wide variety of techniques known in the art including the use of hybridoma, recombinant, and phage display technologies, or a combination thereof.
- monoclonal antibodies can be produced using hybridoma techniques including those known in the art and taught, for example, in Harlow et al., Antibodies: A Laboratory Manual, (Cold Spring Harbor Laboratory Press, 2nd ed. 1988); Hammerling, et al., in: Monoclonal Antibodies and T-Cell Hybridomas 563- 681 (Elsevier, N.Y., 1981) (said references incorporated by reference in their entireties).
- the term “monoclonal antibody” as used herein is not limited to antibodies produced through hybridoma technology.
- the term “monoclonal antibody” refers to an antibody that is derived from a single clone, including any eukaryotic, prokaryotic, or phage clone, and not the method by which it is produced.
- mice can be immunized with a polypeptide of the invention or a cell expressing such peptide.
- an immune response e.g., antibodies specific for the antigen are detected in the mouse serum
- the mouse spleen is harvested and splenocytes isolated.
- the splenocytes are then fused by well known teclmiques to any suitable myeloma cells, for example cells from cell line SP20 available from the ATCC.
- Hybridomas are selected and cloned by limited dilution.
- hybridoma clones are then assayed by methods known in the art for cells that secrete antibodies capable of binding a polypeptide of the invention.
- Ascites fluid which generally contains high levels of antibodies, can be generated by immunizing mice with positive hybridoma clones.
- the present invention provides methods of generating monoclonal antibodies as well as antibodies produced by the method comprising culturing a hybridoma cell secreting an antibody of the invention wherein, preferably, the hybridoma is generated by fusing splenocytes isolated from a mouse immunized with an antigen of the invention with myeloma cells and then screening the hybridomas resulting from the fusion for hybridoma clones that secrete an antibody able to bind a polypeptide of the invention.
- Antibody fragments which recognize specific epitopes may be generated by known techniques.
- Fab and F(ab')2 fragments of the invention may be produced by proteolytic cleavage of immunoglobulin molecules, using enzymes such as papain (to produce Fab fragments) or pepsin (to produce F(ab')2 fragments).
- F(ab')2 fragments contain the variable region, the light chain constant region and the CHI domain of the heavy chain.
- the antibodies of the present invention can also be generated using various phage display methods known in the art.
- phage display methods functional antibody domains are displayed on the surface of phage particles which carry the polynucleotide sequences encoding them.
- phage can be utilized to display antigen binding domains expressed from a repertoire or combinatorial antibody library (e.g., human or murine).
- Phage expressing an antigen binding domain that binds the antigen of interest can be selected or identified with antigen, e.g., using labeled antigen or antigen bound or captured to a solid surface or bead.
- Phage used in these methods are typically filamentous phage including fd and Ml 3 binding domains expressed from phage with Fab, Fv or disulfide stabilized Fv antibody domains recombinantly fused to either the phage gene III or gene VHI protein.
- Examples of phage display methods that can be used to make the antibodies of the present invention include those disclosed in Brinkman et al, J. Immunol. Methods 182:41-50 (1995); Ames et al, J. Immunol. Methods 184:177-186 (1995); Ketfleborough et al, Eur. J. Immunol.
- the antibody coding regions from the phage can be isolated and used to generate whole antibodies, including human antibodies, or any other desired antigen binding fragment, and expressed in any desired host, including mammalian cells, insect cells, plant cells, yeast, and bacteria, e.g., as described in detail below.
- a chimeric antibody is a molecule in which different portions of the antibody are derived from different animal species, such as antibodies having a variable region derived from a murine monoclonal antibody and a human immunoglobulin constant region.
- Methods for producing chimeric antibodies are known in tlie art. See e.g., Morrison, Science 229:1202 (1985); Oi et al, BioTechniques 4:214 (1986); Gillies et al, J. Immunol. Methods 125:191-202 (1989); U.S. Pat. Nos. 5,807,715; 4,816,567; and 4,816397, which are incorporated herein by reference in their entirety.
- Humanized antibodies are antibody molecules from non-human species antibody that binds the desired antigen having one or more complementarity determining regions (CDRs) from the non-human species and a framework regions from a human immunoglobulin molecule.
- CDRs complementarity determining regions
- framework residues in the human framework regions will be substituted with the conesponding residue from the CDR donor antibody to alter, preferably improve, antigen binding.
- These framework substitutions are identified by methods well known in the art, e.g., by modeling of the interactions of the CDR and framework residues to identify framework residues important for antigen binding and sequence comparison to identify unusual framework residues at particular positions. (See, e.g., Queen et al, U.S. Pat. No.
- Antibodies can be humanized using a variety of techniques known in the art including, for example, CDR-grafting (EP 239,400; PCT publication WO 91/09967; U.S. Pat. Nos. 5,225,539; 5,530,101; and 5,585,089), veneering or resurfacing (EP 592,106; EP 519,596; Padlan, Molecular Immunology 28(4/5):489-498 (1991); Studnicka et al, Protein Engineering 7f5J:805-814 (1994); Roguska. et al, PNAS 91:969-973 (1994)), and chain shuffling (U.S. Pat. No. 5,565,332).
- Human antibodies are particularly desirable for therapeutic treatment of human patients.
- Human antibodies can be made by a variety of methods known in the art including phage display methods described above using antibody libraries derived from human immunoglobulin sequences, and the methods disclosed in US 2002 0123057 Al. See also, U.S. Pat. Nos. 4,444,887 and 4,716,111; and PCT publications WO 98/46645, WO 98/50433, WO 98/24893, WO 98/16654, WO 96/34096, WO 96/33735, and WO 91/10741; each of which is incorporated herein by reference in its entirety.
- Human antibodies can also be produced using transgenic mice which are incapable of expressing functional endogenous immunoglobulins, but which can express human immunoglobulin genes.
- the human heavy and light chain immunoglobulin gene complexes may be introduced randomly or by homologous recombination into mouse embryonic stem cells.
- the human variable region, constant region, and diversity region may be introduced into mouse embryonic stem cells in addition to the human heavy and light chain genes.
- the mouse heavy and light chain immunoglobulin genes may be rendered non-functional separately or simultaneously with the introduction of human immunoglobulin loci by homologous recombination. In particular, homozygous deletion of the JH region prevents endogenous antibody production.
- the modified embryonic stem cells are expanded and microinjected into blastocysts to produce chimeric mice.
- the chimeric mice are then bred to produce homozygous offspring which express human antibodies.
- the transgenic mice are immunized in the normal fashion with a selected antigen, e.g., all or a portion of a polypeptide of the invention.
- Monoclonal antibodies directed against the antigen can be obtained from the immunized, transgenic mice using conventional hybridoma technology.
- the human immunoglobulin transgenes harbored by the transgenic mice reanange during B cell differentiation, and subsequently undergo class switching and somatic mutation.
- Completely human antibodies which recognize a selected epitope can be generated using a technique refened to as "guided selection.”
- a selected non-human monoclonal antibody e.g., a mouse antibody, is used to guide the selection of a completely human antibody recognizing the same epitope. (Jespers et al, Bio/technology 72:899-903 (1988)).
- antibodies to the polypeptides of the invention can, in turn, be utilized to generate anti-idiotype antibodies that "mimic" polypeptides of the invention using teclmiques well known to those skilled in the art. (See, e.g., Greenspan & Bona, FASEB J. 7(5):437-444; (1989) and Nissinoff, J. Immunol. 147 (8):2429-2438 (1991)).
- antibodies which bind to and competitively inhibit polypeptide multimerization and/or binding of a polypeptide of the invention to a ligand can be used to generate anti-idiotypes that "mimic" the polypeptide multimerization and/or binding domain and, as a consequence, bind to and neutralize polypeptide and/or its ligand.
- anti-idiotypes or Fab fragments of such anti-idiotypes can be used in therapeutic regimens to neutralize polypeptide ligand.
- anti-idiotypic antibodies can be used to bind a polypeptide of the invention and/or to bind its ligands/receptors, and thereby block its biological activity.
- the invention provides a method for the specific destruction of cells (e.g., the destruction of abenant cells, including, but not limited to, tumor cells) by administering antibodies against cancer- associated, intracellular antigens in association with toxins or cytotoxic prodrugs.
- toxin compounds that bind and activate endogenous cytotoxic effector systems, radioisotopes, holotoxins, modified toxins, catalytic subunits of toxins, cytotoxins (cytotoxic agents), or any molecules or enzymes not normally present in or on the surface of a cell that under defined conditions cause the cell's death.
- Toxins that may be used according to the methods of the invention include, but are not limited to, radioisotopes known in the art, compounds such as, for example, antibodies (or complement fixing containing portions thereof) that bind an inherent or induced endogenous cytotoxic effector system, thymidine kinase, endonuclease, RNAse, alpha toxin, ricin, abrin, Pseudomonas exotoxin A, diphtheria toxin, saporin, momordin, gelonin, pokeweed antiviral protein, alpha-sarcin and cholera toxin.
- radioisotopes known in the art
- compounds such as, for example, antibodies (or complement fixing containing portions thereof) that bind an inherent or induced endogenous cytotoxic effector system, thymidine kinase, endonuclease, RNAse, alpha toxin, ricin, abrin, Pseu
- Toxin also includes a cytostatic or cytocidal agent, a therapeutic agent or a radioactive metal ion, e.g., alpha-emitters such as, for example, 213 Bi, or other radioisotopes such as, for example, 103 Pd, 133 Xe, 131 I, 68 Ge, 57 Co, 65 Zn, 85 Sr, 32 P, 35 S, 90 Y, 153 Sm, 153 Gd, 169 Yb, 51 Cr, 54 Mn, 75 Se, 113 Sn, 90 Yttrium, 117 Tin, 186 Rhenium, 166 Holmium, and 188 Rhenium and those listed in the "Complex” section below; luminescent labels, such as luminol; and fluorescent labels, such as fluorescein and rhodamine, and biotin.
- alpha-emitters such as, for example, 213 Bi
- radioisotopes such as, for example, 103 Pd, 133
- antibodies of the present invention are conjugated with a radioisotope, e.g., I. hi a prefened embodiment, the radioisotope-conjugated antibody is adminstered for radioimmunotherapy in combination with chemotherapy.
- a cytotoxin or cytotoxic agent includes any agent that is detrimental to cells. Examples include paclitaxol, cytochalasin B, gramicidin D, ethidium bromide, emetine, mitomycin, etoposide, tenoposide, vincristine, vinblastine, colchicin, doxorubicin, daunorubicin, dihydroxy anthracin dione, mitoxantrone, mithramycin, actinomycin D, 1-dehydrotestosterone, glucocorticoids, procaine, tetracaine, lidocaine, propranolol, and puromycin and analogs or homologs thereof.
- Cytotoxin or cytotoxic agents include, but are not limited to, antimetabohtes (e.g., methotrexate, 6-mercaptopurine, 6- thioguanine, cytarabine, 5-fluorouracil decarbazine), alkylating agents (e.g., mechlorethamine, thioepa chlorambucil, melphalan, carmustine (BSNU) and lomustine (CCNU), cyclothosphamide, busulfan, dibromomannitol, streptozotocin, mitomycin C, and cis- dichlorodiamine platinum (H) (DDP) cisplatin), anthracyclines (e.g., daunorubicin (formerly daunomycin) and doxorubicin), antibiotics (e.g., dactinomycin (formerly actinomycin), bleomycin, mithramycin, and anthramycin (AMC)), and anti
- cytotoxic prodrug is meant a non-toxic compound that is converted by an enzyme, normally present in the cell, into a cytotoxic compound.
- Cytotoxic prodrugs that may be used according to the methods of the invention include, but are not limited to, glutamyl derivatives of benzoic acid mustard alkylating agent, phosphate derivatives of etoposide or mitomycin C, cytosine arabinoside, daunorubisin, and phenoxyacetamide derivatives of doxorubicin.
- the present invention also encompasses antibodies recombinantly fused or chemically conjugated (including both covalently and non-covalently conjugations) to a polypeptide (or portion thereof, preferably at least 10, 20, 30, 40, 50, 60, 70, 80, 90 or 100 amino acids of the polypeptide) to generate fusion proteins.
- the fusion does not necessarily need to be direct, but may occur through linker sequences.
- the antibodies may be specific for antigens other than C35 polypeptides (or portion thereof, preferably at least 10, 20, 30, 40, 50, 60, 70, 80, 90 or 100 amino acids of the polypeptide).
- antibodies may be specific for other cancer-associated, intracellular antigens, h a prefened embodiment, such intracellular antigens are prenylated proteins.
- Antibodies of the present invention may be fused to either the N- or C-terminal end of the heterologous protein (e.g., immunoglobulin Fc polypeptide or human serum albumin polypeptide).
- Antibodies of the invention may also be fused to albumin (including but not limited to recombinant human serum albumin (see, e.g., U.S. Patent No. 5,876,969, issued March 2, 1999, EP Patent 0 413 622, and U.S. Patent No. 5,766,883, issued June 16, 1998, herein incorporated by reference in their entirety)), resulting in chimeric polypeptides.
- antibodies of the present invention are fused with the mature form of human serum albumin (i.e., amino acids 1 - 585 of human serum albumin as shown in Figures 1 and 2 of EP Patent 0 322 094) which is herein incorporated by reference in its entirety.
- antibodies of the present invention are fused with polypeptide fragments comprising, or alternatively consisting of, amino acid residues 1-z of human serum albumin, where z is an integer from 369 to 419, as described in U.S. Patent 5,766,883 herein incorporated by reference in its entirety.
- fusion proteins of the invention are also encompassed by the invention. Such fusion proteins may, for example, facilitate purification and may increase half-life in vivo.
- Antibodies fused or conjugated to polypeptides may also be used in in vitro immunoassays and purification methods using methods known in the art. See e.g., Harbor et al, supra, and PCT publication WO 93/21232; EP 439,095; Naramura et al, Immunol. Lett. 39:91-99 (1994); U.S. Patent 5,474,981; Gillies et al, PNAS 89: 1428-1432 (1992); Fell et al, J. Immunol. 146:2446-2452(1991), which are incorporated by reference in their entireties.
- the antibodies or fragments thereof of the present invention can be fused to marker sequences, such as a peptide to facilitate purification.
- the marker amino acid sequence is a hexa-histidine peptide, such as the tag provided in a pQE vector (QIAGEN, Inc., 9259 Eton Avenue, Chatsworth, Calif, 91311), among others, many of which are commercially available.
- a pQE vector QIAGEN, Inc., 9259 Eton Avenue, Chatsworth, Calif, 91311
- hexa-histidine provides for convenient purification of the fusion protein.
- peptide tags useful for purification include, but are not limited to, the "HA” tag, which conesponds to an epitope derived from the influenza hemagglutinin protein (Wilson et al, Cell 37:767 (1984)) and the "flag" tag.
- the present invention further encompasses antibodies, such as C35 antibodies or fragments thereof, conjugated to a diagnostic or therapeutic agent.
- the antibodies can be used diagnostically to, for example, monitor the development or progression of a tumor as part of a clinical testing procedure to, e.g., determine the efficacy of a given treatment regimen. Detection can be facilitated by coupling the antibody to a detectable substance. Examples of detectable substances include various enzymes, prosthetic groups, fluorescent materials, luminescent materials, bioluminescent materials, radioactive materials, positron emitting metals using various positron emission tomographies, and nonradioactive paramagnetic metal ions.
- the detectable substance may be coupled or conjugated either directly to the antibody (or fragment thereof) or indirectly, through an intermediate (such as, for example, a linker known in the art) using techniques known in the art. See, for example, U.S. Pat. No. 4,741,900 for metal ions which can be conjugated to antibodies for use as diagnostics according to the present invention.
- suitable enzymes include horseradish peroxidase, alkaline phosphatase, beta- galactosidase, or acetylcholinesterase;
- suitable prosthetic group complexes include streptavidin/biotin and avidin/biotin;
- suitable fluorescent materials include umbelliferone, fluorescein, fluorescein isothiocyanate, rhodamine, dichlorotriazinylamine fluorescein, dansyl chloride or phycoerythrin;
- an example of a luminescent material includes luminol;
- bioluminescent materials include luciferase, luciferin, and aequorin;
- suitable radioactive material include 1251, 1311,
- the therapeutic agent is not to be construed as limited to classical chemical therapeutic agents.
- the therapeutic agent may be a protein or polypeptide possessing a desired biological activity.
- proteins may include, for example, a toxin such as abrin, ricin A, pseudomonas exotoxin, or diphtheria toxin; a protein such as tumor necrosis factor, alpha- interferon, beta-interferon, nerve growth factor, platelet derived growth factor, tissue plasminogen activator, an apoptotic agent, e.g., TNF-alpha, TNF-beta, AIM I (See, International Publication No. WO 97/33899), AIM H (See, International Publication No.
- WO 97134911 Fas Ligand (Takahashi et al., hit. hnmunol., 6:1567-1574 (1994)), VEGI (See, International Publication No. WO 99/23105), a thrombotic agent or an anti- angiogenic agent, e.g., angiostatin or endostatin; or, biological response modifiers such as, for example, lymphokines, interleukin-1 ("IL-1”), interleukin-2 (“JX-2”), interleukin-6 (“IL-6”), granulocyte macrophage colony stimulating factor (“GM-CSF”), granulocyte colony stimulating factor (“G-CSF”), or other growth factors.
- IL-1 interleukin-1
- JX-2 interleukin-2
- IL-6 interleukin-6
- GM-CSF granulocyte macrophage colony stimulating factor
- G-CSF granulocyte colony stimulating factor
- Antibodies may also be attached to solid supports, which are particularly useful for immunoassays or purification of the target antigen.
- solid supports include, but are not limited to, glass, cellulose, polyacrylamide, nylon, polystyrene, polyvinyl chloride or polypropylene.
- an antibody can be conjugated to a second antibody to form an antibody heteroconjugate as described by Segal in U.S. Pat. No. 4,676,980, which is incorporated herein by reference in its entirety.
- An antibody, with or without a toxin or therapeutic agent conjugated to it, administered alone or in combination with cytotoxic factor(s) and/or cytokine(s) can be used as a therapeutic.
- Chelator molecules are known in the art. For example, see Subramanian, R. and Meares, C.F., "Bifunctional Chelating Agents for Radiometal-labeled monoclonal Antibodies,” in Cancer Imaging with Radiolabeled Antibodies (D. M. Goldenberg, Ed.) Kluwer Academic Publications, Boston; Saji, H., “Targeted delivery of radiolabeled imaging and therapeutic agents: bifunctional radiopharmaceuticals.” Crit. Rev. Ther. Drug Carrier Syst. 16:209-244 (1999); Srivastava S.C. and Mease R.C., "Progress in research on ligands, nuclides and techniques for labeling monoclonal antibodies.” Int. J. Rad.
- chelator which can be covalently bound to said antibody may be used according to the present invention.
- the chelator may further comprise a linker moiety that connects the chelating moiety to the antibody.
- Bifunctional chelators based on macrocyclic ligands in which conjugation is via an activated a ⁇ n attached to the carbon backbone of the ligand can be employed as described by M. Moi et al, J. Amer. Chem. Soc. 49:2639 (1989) (2-p-nitrobenzyl-l, 4,7,10-tetraazacyclododecane-N,N',N",N'"- tetraacetic acid); S. V. Deshpande et al, J. Nucl Med. 31:473 (1990); G. Ruser et al, Bioconj. Chem. 1:345 (1990); C. J. Broan et al, J. C. S. Chem. Comm. 23:1739 (1990); and C. J. Anderson et al, J. Nucl. Med. 35:850 (1995).
- the chelator is a macrocyclic chelator, such as polyazamacrocyclic chelators, optionally containing one or more carboxy, phosphonate, or phosphate groups, hi another embodiment, the chelator is a chelator selected from the group consisting of DOT A, analogues of DOT A, and derivatives of DOT A.
- suitable chelator molecules include DOXA (1- oxa-4,7,10-triazacyclododecanetriacetic acid), NOTA (1,4,7- triazacyclononanetriacetic acid), TETA (1,4,8,11- tetraazacyclotetradecanetetraacetic acid), and THT (4'-(3-amino-4-methoxy- phenyl)-6,6"-bis(N',N'-dicarboxymethyl-N-methylhydra zino)-2,2":6',2"- terpyridine), and analogs and derivatives thereof. See, e.g., Ohmono et al, J. Med. Chem.
- Suitable chelators include chelating agents disclosed in U.S. Patent Nos. 4,647,447; 4,687,659; 4,885,363; EP-A-71564; WO89/00557; and EP-A-232751.
- suitable macrocyclic carboxylic acid chelators which can be used in the present invention include 1,4,7,10- tetraazacyclododecane-N,N , ,N",N'"-tetraacetic acid (DOTA); 1,4,8,12- tetraazacyclopentadecane-N,N',N",N'"-tetraacetic acid (15N4); 1,4,7- triazacyclononane-N,N',N"-triacetic acid (9N3); 1,5,9-triazacyclododecane- N,N',N"-triacetic acid (12N3); and 6-bromoacetamido-benzyl-l,4,8,l l- tetraazacyclotetadecane- N,N',N",N'"-tetraacetic acid (BAT).
- DOTA 1,4,7,10- tetraazacyclododecane-N,N , ,N",N'"-
- the antibody conjugate may contain more than an average of one chelator molecule. In one embodiment, the antibody conjugate contains about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, or 35 chelator molecules. In another embodiment, the antibody conjugate contains about 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 chelator molecules. In another embodiment, the antibody conjugate contains about 1, 2, 3, 4, or 5 chelator molecules, hi another embodiment, the antibody conjugate contains an average of about 1 chelator molecule.
- the antibody conjugate as described above, comprises an antibody and a chelator molecule covalently bonded together.
- the covalent bond between the protein and chelator is formed between an atom of the protein and an atom of the chelator.
- the atom of the protein that forms the covalent bond can be any suitable atom of the protein, such as a carbon, nitrogen, oxygen, and sulfur. Certain functional groups on the protein are prefened to fonn the covalent bond with the chelator.
- Such groups include an amino group at the terminus of the protein; a carboxy group at the terminus of the protein; an amino group on a lysine residue; a carboxy group on an aspartame or glutamate residue; a guanidino group on an arginine residue; a thiol group on a cysteine residue; a hydroxy group on a serine residue or threonine residue; a imidazole group of a histidine residue; a hydroxy group of a tyrosine; a hydroxy group of a tryptophan group; and an amide group of an asparagine or glutamine residue.
- An additional aspect of the present invention is directed to a method of preparing an antibody conjugate.
- the general procedure for preparing an antibody conjugate comprises reacting an antibody with a chelator.
- a suitable chelator will be able to react with the antibody to form a covalent bond between the chelator and the antibody.
- a chelator that can form part of the conjugate is known in the art, and methods of preparing such a chelator are known. Any chelator which is able to form a covalent bond with the antibody may be used to form the antibody conjugate. Such chelators are described below.
- a chelator to be used in the method according to the present invention is an activated chelator.
- the activated chelator contains a functional group that will readily react with a functional group on the protein, thereby forming a covalent bond between the protein and the chelator.
- Such functional groups are well known in the art.
- a suitable reactive functional group is a group that will react directly with carboxy, aldehyde, amine, alcohol, or sulfhydryl group on the antibody.
- a chelator which can be used in the present method includes any specific chelator as described herein for the antibody conjugate.
- the chelator used in the method of the invention is a chelator which can be used to prepare any specific antibody conjugate as described above.
- the chelator is an activated chelator selected from the group consisting of DOTA, analogues of DOTA, and derivatives of DOTA, wherein each of said DOTA, analogues of DOTA, and derivatives of DOTA contains a suitable activating group which enables the chelator molecule to be covalently bonded to the antibody.
- the activated chelator for use in preparing a conjugate according to the present invention is a-(5-isothiocyanato- 2- methoxyphenyl)- 1 ,4,7, 10-tetraazacyclododecane- 1 ,4,7, 10-tetraacetic acid, which is also known as MeO-DOTA-NCS.
- a salt or ester of a-(5- isothiocyanato- 2-mefhoxyphenyl)- 1 ,4,7, 10-tetraazacyclododecane- 1 ,4,7, 10- tetraacetic acid may also be used.
- the method of preparing an antibody conjugate comprises mixing, agitating, or preparing a solution, said solution comprising an antibody and a chelator.
- the method of preparing an antibody conjugate comprises mixing, agitating, or preparing a solution comprising an antibody, a chelator, citrate buffer, HEPES buffer, and sterile water.
- the solution further comprises NaOH.
- the solution has a pH of about 8.5.
- the method of preparing the conjugate comprises a) mixing, agitating, or preparing a solution comprising an antibody and a chelator, at a temperature of about 0 °C to about 50 °C for about 0.5 hours to about 24 hours, wherein said solution has a pH of about 8.0 to about 9.0; and b) optionally adding a quenching agent.
- the solution is mixed, agitated or prepared at a temperature of about 0 °C to about 50 °C. In another embodiment of the above process, the solution is mixed, agitated or prepared at a temperature of about 20 °C to about 30 °C.
- the temperature at which the solution is mixed, agitated, or prepared can be about 0, 5, 10, 15, 20, 25, 20, 35, 40, 45, or 50 °C.
- Any suitable chelator as described above may be used in the present process.
- the molar ratio of antibody to chelator used in the preparation of the conjugate can vary.
- the molar ratio of antibody to chelator can be from about 1000:1 to about 1:1000, from about 1 to about 100, from about 5 to about 20, from about 10 to about 15, about 12.
- the molar ratio of antibody to chelator refers to the ratio of the number of antibody molecules to the number of chelator molecules in the reaction solution.
- the solution can be mixed, agitated, or allowed to stand for a variable number of hours, depending upon a number of variables, such factors including the identity of the chelator, the identity of the antibody, the temperature of the reaction, the pH, the identity of the buffer, the molar ratio of the reactants, the purity of the available reagents, the presence of a catalyst or activator, and other factors which would be evident to one of skill in the art.
- the solution comprising an antibody and a chelator is mixed, agitated, or allowed to stand for about 0.5 hours to about 24 hours, hi another embodiment, the solution is mixed, agitated, or allowed to stand for about 1 hour to about 20 hours.
- the solution is mixed, agitated, or allowed to stand for about 2 hour to about 10 hours. In another embodiment, the solution is mixed, agitated, or allowed to stand for about 3 hour to about 5 hours, hi another embodiment, the solution is mixed, agitated, or allowed to stand for about 4 hours. In other embodiments, the solution is mixed, agitated, or allowed to stand for about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14 ,15, 16, 17, 18, 19, 20, 21, 22, 23, or 24 hours.
- the pH of the solution used to prepare the antibody conjugate can vary. In one embodiment, the pH will be about 6, 7, 8, 9, or 10. In another embodiment, said solution has a pH of about 7 to about 10. In another embodiment, said solution has a pH of about 7.5 to about 9.5. In another embodiment, said solution has a pH of about 8 to about 9. hi another embodiment, said solution has apH of about 8.5.
- the solution used to prepare the antibody conjugate may further comprise a buffer.
- Buffers are well-known in the art. Suitable buffers for use in the preparation of an antibody are described below for the method of preparing an antibody conjugate, hi one embodiment, the buffer is a citrate buffer or an acetate buffer.
- the buffer includes an acetate buffer having a concentration of about 1 to about 50 mM and having a NaCl concentration of about 1 to about 500 mM.
- the buffer includes an acetate buffer having a concentration of about about 10 mM and having a NaCl concentration of about about 140 mM.
- Suitable acetate buffers include acetate buffers havaing a concentration of about 1, 5, 10, 15, 20, 25, 20, 35, 40, 45, or 55 mM.
- Suitable buffers and solutions include those having a NaCl concentration of about 1, 50, 75, 100, 125, 140, 150, 175, 200, 225, 250, 275, 300, 350, 400, 450, or 500 mM.
- An additional suitable buffer is a HEPES buffer, in particular a HEPES buffer having a concentration of about 100, 200, 300, 400, 500, 600, 700, 800, 900, or 1000 mM.
- the solution comprises a HEPES buffer having a concentration of about 500 mM.
- the concentration of the antibody used in the method of the invention may vary.
- the concentration of antibody in the solution is from about 0.1 mg/mL to about 10 mg/mL.
- the antibody concentration is about 0.5 mg/mL to about 5 mg/mL.
- the antibody concentration is about 0.1, 0.2, 0.3, 0.4, 0.5, 0.6, 0.7, 0.8, 0.9, 1.0, 1.1, 1.2, 1.3, 1.4, 1.5, 1.6, 1.7, 1.8, 1.9, 2.0, 2..1, 2.2, 2.3, 2.4, or 2.5 mg/mL.
- the concentration of antibody in the solution is about 1 mg/mL to about 2 mg/mL.
- a reagent which facilitates the formation of the conjugate can also be used.
- Such reagents typically activate a chelator to react more readily with a protein.
- the reagent may activate the protein to react more readily with the chelator.
- Examples of such reagents are known in the art and include dicyclohexylcarbodiimide (DCC), diethylazodicarboxylate (DEAD), and diisopropylazodicarboxylate (DIAD).
- a quencing agent may optionally be added to the reaction solution after the antibody conjugate is prepared to a sufficient degree. Suitable quencing agents are known in the art.
- the quenching agent is glycine.
- a solution comprising a glycine buffer is used as a quenching example.
- a solution comprising a glycine buffer is added to the reaction solution to stop the reaction.
- the reaction solution is then allowed to stand for an additional amount of time, e.g., about 0.25, 0.5, 0.75, 1, or 1.5 hours.
- the method of preparing an antibody conjugate may comprise mixing, agitating, or preparing a solution comprising: an antibody has a concentration of about 1 to about 2 mg/mL; a MeO-DOTA-NCS in an amount such that the ratio of antibody to MeO-DOTA-NCS is about 1 to 12; a citrate buffer having a concentration of about 0.5 to about 20 mM; NaCl haing a concentration of about 1 to about 200 mM; HEPES buffer having a concentration of about 10 to about 500 mM; and sterile water.
- the method may comprise: preparing a first solution comprising an antibody and a citrate buffer; adding a second solution comprising a HEPES buffer to said first solution; adding a third solution comprising a chelator and NaOH to said first solution; optionally adjusting the pH of said first solution to about 8.5; mixing, agitating, or allowing to stand said first solution at about 25 °C for about 3 to about 5 hours; and optionally adding quencing agent to said first solution.
- the method of preparing an antibody conjugate according to the present invention further optionally comprises a process of purifying said conjugate. A number of known methods may be used to purifying said protein conjugate.
- the purifying step uses normal flow filtration or tangential flow filtration.
- the process for purifying the conjugate according to the present invention is a diafiltration method. Antibody Complexes
- An additional aspect of the present invention is directed to an antibody complex comprising an antibody conjugate and a metal ion, wherein said metal ion is noncovalently associated with the chelator moiety of said antibody conjugate.
- Specific embodiments of an antibody complex of the invention include a complex comprising an antibody conjugate, as set forth herein, and a metal ion
- Any metal ion that noncovalently associates with the chelating moiety of said antibody conjugate may be used.
- a metal ion includes a metal ion selected from the group consisting of Ac, Ag, At, Au, Bi, Ce, Co, Cr, Cu, Dy, Er, Eu, Fe, Ga, Gd, Hg, Ho, hi, La, Lu, Mn, Mo, Nd, Ni, Os, Pb, Pd, Pm, Pr, Pt, Rb, Re, Rh, Ru, Sb, Sc, Si, Sm, Sn, Sr, Tb, Tc, TI, Tm, V, W, Y, and Yb.
- the metal ion of the complex is a radionuclide.
- Radionuclides useful in the antibody complex are known in the art.
- the radionuclides useful in the present invention include gamma-emitters, positron-emitters, x-ray emitters, fluorescence-emitters, beta- emitters, alpha-emitters, and electron and neutron-capturing agents.
- gamma-emitters, positron-emitters, x-ray emitters, and fluorescence-emitters are suitable for localization and/or therapy, while beta and alpha-emitters and electron and neutron-capturing agents, such as boron and uranium, also can be used for therapy.
- the radionuclide used in the complex of the present invention may be suitable for therapeutic, diagnostic, or both therapeutic and diagnostic purposes.
- appropriate metals include Ag, At, Au, Bi, Cu, Ga, Ho, hi, Lu, Pb, Pd, Pm, Pr, Rb, Re, Rh, Sc, Sr, Tc, TI, Y, and Yb.
- the radionuclide used for diagnostic purposes are Fe, Gd, 11 Hn, 67Ga, or 68Ga. In another embodiment, the radionuclide used for diagnostic purposes is lllln, or 67Ga.
- radionuclide used for therapeutic purposes examples include 166Ho, 165Dy, 90Y, 115rnh ⁇ , 52Fe, or 72Ga.
- the radionuclide used for diagnostic purposes is I66H0 or 90Y.
- the radionuclides used for both therapeutic and diagnostic purposes include 153Sm, 177Lu, 159Gd, 175Yb, or 47Sc. In one embodiment, the radionuclide is 153Sm, 177Lu, 175Yb, or 159Gd.
- Prefened metal radionuclides include 90Y, 99mTc, 11 Hn, 47Sc, 67Ga, 51Cr, 177mSn, 67Cu, 167Tm, 97Ru, 188Re, 177Lu, 199Au, 47Sc, 67Ga, 51Cr, 177mSn, 67Cu, 167Tm, 95Ru, 188Re, 177Lu, 199Au, 203Pb and 141Ce.
- the metal ion of the antibody complex is selected from the group consisting of 90Y, 11 Hn, 177Lu, 166Ho, 215Bi, and 225Ac.
- gamma-emitting radionuclides such as 99mTc, ll lln, 67Ga, and 169Yb have been approved or under investigation for diagnostic imaging, while complexes of beta-emitters, such as 67Cu, lllAg, 186Re, and 90Y are useful for the applications in tumor therapy.
- radionuclides include gamma-emitters, such as 99mTc, lllln, 67Ga, and 169Yb, and beta-emitters, such as 67Cu, lllAg, 186Re, 188Re and 90Y, as well as other radionuclides of interest such as 211 At, 212Bi, 177Lu, 86Rb , 105Rh, 153Sm, 198Au, 149Pm, 85Sr, 142Pr, 214Pb, 109Pd, 166Ho, 208T1, and 44Sc.
- gamma-emitters such as 99mTc, lllln, 67Ga, and 169Yb
- beta-emitters such as 67Cu, lllAg, 186Re, 188Re and 90Y
- other radionuclides of interest such as 211 At, 212Bi, 177Lu, 86Rb , 105Rh, 153S
- paramagnetic metal ions include ions of transition and lanthanide metal, such as metals having atomic numbers of 21- 29, 42, 43, 44, or 57-71, in particular ions of Cr, V, Mn, Fe, Co, Ni, Cu, La, Ce, Pr, Nd, Pm, Sm, Eu, Gd, Tb, Dy, Ho, Er, Tm, Yb, and Lu.
- the paramagnetic metals used in the composition for magnetic resonance imaging include the elements having atomic numbers of 22 to 29, 42, 44 and 58-70.
- fluorescent metal ions include lanthanides, in particular La, Ce, Pr, Nd, Pm, Sm, Eu, Gd, Tb, Dy, Ho, Er, Tm, Yb, and Lu.
- heavy metal-containing reporters may include atoms of Mo, Bi, Si, and W.
- an antibody complex of the present invention comprises an antibody conjugate and a metal ion, wherein the antibody of said conjugate is a human antibody.
- the chelator of the conjugate of the invention is a macrocyclic chelator, such as polyazamacrocychc chelators, optionally containing one or more carboxy, phosphonate, or phosphate groups.
- the chelator of the conjugate of the invention is a chelator selected from the group consisting of DOTA, analogues of DOTA, and derivatives of DOTA.
- suitable chelator molecules include DOXA (1- oxa-4,7,10-triazacyclododecanetriacetic acid), NOTA (1,4,7- triazacyclononanetriacetic acid), TETA (1,4,8,11- tetraazacyclotetradecanetetraacetic acid), and THT (4'-(3-amino-4-methoxy- phenyl)-6,6"-bis(N',N'-dicarboxymethyl-N-methylhydra zino)-2,2':6',2"- terpyridine), and analogs and derivatives thereof. See, e.g., Ohmono et al., J. Med. Chem.
- Suitable chelators include chelating agents disclosed in U.S. Patent Nos. 4,647,447; 4,687,659; 4,885,363; EP-A-71564; WO89/00557; and EP-A-232751.
- suitable macrocyclic carboxylic acid chelators which can be used in the present invention include 1,4,7,10- tetraazacyclododecane-N,N',N",N'"-tetraacetic acid (DOTA); 1,4,8,12- tetraazacyclopentadecane-N,N',N",N” , -tetraacetic acid (15N4); 1,4,7- triazacyclononane-N,N',N"-triacetic acid (9N3); 1,5,9-triazacyclododecane- N,N',N"-triacetic acid (12N3); and 6-bromoacetamido-benzyl-l,4,8,l l- tetraazacyclotetadecane- N,N',N",N'"-tetraacetic acid (BAT).
- DOTA 1,4,7,10- tetraazacyclododecane-N,N',N",N'"-te
- an additional aspect of the present invention is directed to a method of preparing an antibody complex.
- an antibody complex may be prepared by reacting an antibody conjugate, as described herein, with a metal ion, such as a radionuclide, which is able to associate noncovalently with the conjugate.
- a metal ion such as a radionuclide
- the metal ion associates noncovalently with the chelator moiety of said antibody conjugate.
- the reaction between the antibody complex and the metal ion may occur in solution, such as in a suitable buffered solution.
- a method for preparing an antibody complex comprises reacting an antibody conjugate with a radionuclide. Such a method comprises mixing, agitating, or preparing a solution comprising an antibody conjugate and a radionuclide. In one embodiment, said solution further comprises a buffer.
- a method for preparing an antibody complex comprises reacting an antibody conjugate with a chelator complexed with a metal ion.
- a chelator is first complexed with a metal ion according to known procedures in the art. For example, see U.S. Patent No. 5,654,361.
- the chelator can be an activated chelator as described above.
- the antibody is reacted with the chelator-metal ion complex, using a procedure as described above for preparing an antibody conjugate or using another procedure known in the art.
- the solution comprising the antibody and the chelator-metal ion complex is mixed, agitated, or prepared, thereby forming said antibody compex.
- the solution can be mixed, agitated, or allowed to stand for a variable number of hours, depending upon a number of variables, such factors including the identity of the chelator, the identity of the antibody, the identity of the metal ion, the temperature of the reaction, the pH, the identity of the buffer, the molar ratio of the reactants, the purity of the available reagents, the presence of a catalyst, or activator, and other factors which would be evident to one of skill in the art.
- the solution comprising an antibody conjugate and a metal ion can be mixed, agitated, or allowed to stand for any amount of time that permits sufficient formation of the antibody complex.
- the solution is mixed, agitated, or allowed to stand for about 0.5 minutes to about about 24 hours. In another embodiment, the solution is mixed, agitated, or allowed to stand for about 1 hour to about 20 hours, hi another embodiment, the solution is mixed, agitated, or allowed to stand for about 2 hour to about 10 hours, hi another embodiment, the solution is mixed, agitated, or allowed to stand for about 1 minute to about 1 hour, hi another embodiment, the solution is mixed, agitated, or allowed to stand for about 1 minute to about 30 minutes, hi another embodiment, the solution is mixed, agitated, or allowed to stand for about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35, 40, 45, 50, or 55 minutes.
- the pH of the solution used to prepare the antibody complex can vary. In one embodiment, the pH will be about 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10. In another embodiment, said solution has a pH of about 4 to about 8. In another embodiment, said solution has a pH of about 5 to about 7. hi another embodiment, said solution has a pH of about 5.5 to about 7. In another embodiment, said solution has a pH of about 6.5.
- the solution used to prepare the antibody complex may further comprise a buffer.
- Buffers are well-known in the art. Suitable buffers for use in the preparation of an antibody complex may include, but are not limited to, citrate, acetate, phosphate, carbonate, diphosphate, glycyl-glycfne-piperazine- 2HCl-NaOH; MES-NaOH-NaCl; TRIS-malic acid-NaOH; MES-NaOH; ADA-NaOH-NaCl; ACES-NaOH-NaCl; ACES-NaOH-NaCl; BES-NaOH- NaCl; MOPS-NaOH-NaCl; TES-NaOH-NaCl; MOPS-KOH; HEPES-NaOH- NaCl; TRIS-HC1; HEPPSO-NaOH; BICINE-NaOH-NaCl; TAPS-NaOH- NaCl; H
- the molar ratio of the antibody conjugate to the metal ion may vary, hi one embodiment, the ratio of antibody conjugate to metal ion is from about 1:1000 to about 1000:1. In another embodiment, the ratio of antibody conjugate to metal ion is from about 1:100 to about 100:1, in another embodiment, from about 1:10 to about 10:1, in another embodiment, from about 1:5 to about 5:1, in another embodiment about 1:2, in another embodiment about 1:3, in another embodiment about 2:1, in another embodiment about 1:1. In other embodiments, the ratio of antibody conjugate to metal ion is about 1:2, 1:3, 1:4, 1:5, 1:6, 1:7, 1:8, 1:9, or 1:10.
- the ratio of the antibody and the chelator-metal ion complex may vary. In one embodiment, the ratio of antibody to chelator-metal ion complex is from about 1:1000 to 1000:1.
- Radionuclides which can be used in the present invention are described and listed above and are well known and available commercially. Additionally, several, known methods can be used to prepare the radionuclides for use in the present invention.
- the metal ion is in the form of a salt, for example a chloride salt. Such salts are known in the art.
- the metal ion salt is yttrium chloride or yttrium acetate.
- the term significant amount refers to an amount or concentration which significantly intereferes, retards, delays, inhibits, or prevents preparation of the antibody complex.
- the method of preparing an antibody complex may further comprise a step of removing excess metal ion from the reaction solution and/or the antibody complex.
- a step comprises adding a secondary chelating agent which is able to complex with excess metal ion in the solution.
- a secondary chelating agent may include one or more known chelating agents, for example, DTPA, EDTA, and MeO-DOTA- glycine.
- MeO-DOTA-glycine is used as a secondary chelating agent.
- the method of preparing an antibody complex may further comprise a step of removing excess metal ion from the reaction solution comprising the chelator-metal ion complex.
- a secondary chelating agent which is able to complex with excess metal ion is added.
- the solution is then eluted through a DEAE-cellulose anion exhange resin (Sigma Chemical Co., St. Louis, MO), which has been converted to acetate form to purify the neutral species chelator-metal ion complex from the charged species, i.e., secondary chelator-metal ion complex.
- the purified chelator-metal ion complex is then used to prepared the antibody complex as described herein.
- the secondary chelating agent can be added to the reaction mixture as a solid or as a solution.
- the seconary chelating agent is added in a buffered solution.
- a buffer comprising an acetate buffer having a concentration of about 1 to about 50 mM, preferably about 10 mM, having a NaCl concentration of about 1 to about 500 mM, preferably about 140 mM, having a HSA concentration of about 1% to about 20%, preferably about 7% to about 8%, more preferably about 7.5%, having a pH of about 3-8, preferably about 6, and having a MeO- DOTA-glycine concentration of about 0.01 mM to about 100 mM, preferably about 1 mM, is added to the reaction solution after the antibody complex is formed to a satisfactory level of completion.
- the secondary chelating agent is added about 5 minutes after the formation of the antibody complex. In other embodiments, the secondary chelating agent is added about 1, 2, 3, 4, 5, 6, 7 ,8, 9, 10, 15, 20, 25, 30, 35, 40, 45, 50 55, or 60 minutes after formation of the antibody complex.
- the step of removing excess metal ion from the reaction solution and/or the antibody complex comprises subjecting the reaction solution and/or the antibody complex to centrifugation. Subjecting the reaction solution and/or the antibody complex to centrifugation can remove non-chelated metal ions.
- the step of removing excess metal ion from the reaction solution and/or the antibody complex comprises washing the excess metal ion from the reaction solution and/or the antibody complex with a buffered solution.
- the washing may be repeated one or more times, as is necessary. In one embodiment, the washing is repeated two or three times.
- two or more methods of removing excess metal ion are used in combination to remove excess metal ion from the step of removing excess metal ion from the reaction solution and/or the antibody complex.
- the antibody complex is prepared from a metal in an oxidation state different from that of the desired complex.
- a reducing agent or an oxidizing agent depending on the oxidation state of the metal used and the oxidation state of the desired final product, is added to the reaction mixture to bring the metal to the desired oxidation state.
- the oxidant or reductant can be used to form an intermediate complex in the desired oxidation state but with labile ligands.
- labile ligands can then be displaced by the desired chelating moiety of the present invention, hi another embodiment, the labile ligands are added to the reaction mixture along with the reductant or oxidant and the desired ligand to achieve the change to the desired oxidation state and chelation to the desired metal in a single step.
- the method of preparing an antibody complex comprises: preparing a first solution comprising an antibody conjugate; adding to said first solution a second solution comprising a metal ion capable of complexing with said antibody conjugate; mixing, agitating, or allowing to stand said first solution; and optionally adding a secondary chelating agent, such as EDTA, to complex with uncomplexed metal ion.
- the method of preparing an antibody complex comprises: combining a first solution, second solution, and a third solution, wherein said first solution comprises an antibody conjugate, said second solution comprises an acetate buffer, and said third solution comprises 90YC13; mixing, agitating, or allowing to stand the combined solutions; and adding to the combined solution a fourth solution, said fourth solution comprising MeO-DOTA-NCS, human serum albumin (HSA), acetate buffer, and NaCl.
- the antibodies such as the C35 antibodies of the invention may be utilized for immunophenotyping of cell lines and biological samples.
- C35 is useful as a tumor specific marker.
- Monoclonal antibodies directed against a specific epitope, or combination of epitopes, will allow for the diagnosis of cancer and screening of cellular populations.
- Various techniques can be utilized using monoclonal antibodies to screen for cellular populations expressing the marker(s), and include magnetic separation using antibody- coated magnetic beads, "panning" with antibody attached to a solid matrix (i.e., plate), and flow cytometry (See, e.g., U.S. Pat. No. 5,985,660; and Morrison et al, Cell, 96:737-49 (1999)).
- These techniques allow for the screening of particular populations of cells, such as might be found with hematological malignancies (e.g., C35- associated cancers such as breast, ovarian, bladder, and colon cancers, and melanoma).
- Labeled C35 antibodies, and derivatives and analogs thereof, which specifically bind to a polypeptide of interest can be used for diagnostic purposes to detect, diagnose, or monitor diseases, disorders, and/or conditions associated with the abenant expression and/or activity of a polypeptide of the invention (e.g., C35-associated cancers such as breast, ovarian, bladder, and colon cancers, and melanoma).
- a polypeptide of the invention e.g., C35-associated cancers such as breast, ovarian, bladder, and colon cancers, and melanoma.
- the invention provides for the detection of abenant expression of a polypeptide of interest, comprising (a) assaying the expression of the polypeptide of interest in cells or body fluid of an individual using one or more antibodies specific to the polypeptide interest and (b) comparing the level of gene expression with a standard gene expression level, whereby an increase or decrease in the assayed polypeptide gene expression level compared to the standard expression level is indicative of abenant expression.
- the invention provides a diagnostic assay for diagnosing a disorder, comprising (a) assaying the expression of the polypeptide of interest in cells or body fluid of an individual using one or more antibodies specific to the polypeptide interest and (b) comparing the level of gene expression with a standard gene expression level, whereby an increase or decrease in the assayed polypeptide gene expression level compared to the standard expression level is indicative of a particular disorder.
- a diagnostic assay for diagnosing a disorder comprising (a) assaying the expression of the polypeptide of interest in cells or body fluid of an individual using one or more antibodies specific to the polypeptide interest and (b) comparing the level of gene expression with a standard gene expression level, whereby an increase or decrease in the assayed polypeptide gene expression level compared to the standard expression level is indicative of a particular disorder.
- the presence of a relatively high amount of transcript in biopsied tissue from an individual may indicate a predisposition for the development of the disease, or may provide a means for detecting the disease prior
- Antibodies of the invention can be used to assay protein levels in a biological sample using classical immunohistological methods known to those of skill in the art (e.g., see Jalkanen, et al., J. Cell. Biol. 101:976-985 (1985); Jalkanen, et al., J. Cell Biol. 105:3087-3096 (1987)).
- Other antibody-based methods useful for detecting protein gene expression include immunoassays, such as the enzyme linked immunosorbent assay (ELISA) and the radioimmunoassay (RIA).
- Suitable antibody assay labels include enzyme labels, such as, glucose oxidase; radioisotopes, such as iodine (1251, 1211), carbon (14C), sulfur (35S), tritium (3H), indium (112h ⁇ ), and technetium (99Tc); luminescent labels, such as luminol; and fluorescent labels, such as fluorescein and rhodamine, and biotin.
- enzyme labels such as, glucose oxidase
- radioisotopes such as iodine (1251, 1211), carbon (14C), sulfur (35S), tritium (3H), indium (112h ⁇ ), and technetium (99Tc)
- luminescent labels such as luminol
- fluorescent labels such as fluorescein and rhodamine, and biotin.
- One aspect of the invention is the detection and diagnosis of a disease or disorder associated with abenant expression of a polypeptide of interest in an animal, preferably a mammal and most preferably a human, hi one embodiment, diagnosis comprises: a) administering (for example, parenterally, subcutaneously, or intraperitoneally) to a subject an effective amount of a labeled molecule which specifically binds to the polypeptide of interest; b) waiting for a time interval following the administering for permitting the labeled molecule to preferentially concentrate at sites in the subject where the polypeptide is expressed (and for unbound labeled molecule to be cleared to background level); c) determining background level; and d) detecting the labeled molecule in the subject, such that detection of labeled molecule above the background level indicates that the subject has a particular disease or disorder associated with abenant expression of the polypeptide of interest.
- Background level can be determined by various methods including, comparing the amount of labeled molecule detected to a standard value previously
- the size of the subject and the imaging system used will detennine the quantity of imaging moiety needed to produce diagnostic images.
- the quantity of radioactivity injected will normally range from about 5 to 20 millicuries of 99mTc.
- the labeled antibody or antibody fragment will then preferentially accumulate at the location of cells which contain the specific protein.
- In vivo tumor imaging is described in S.W. Burchiel et al., "Immunopharmacokinetics of Radiolabeled Antibodies and Their Fragments.” (Chapter 13 in Tumor Imaging: The Radiochemical Detection of Cancer, S. W. Burchiel and B. A. Rhodes, eds., Masson Publishing Inc. (1982).
- the time interval following the administration for permitting the labeled molecule to preferentially concentrate at sites in the subject and for unbound labeled molecule to be cleared to background level is 6 to 48 hours or 6 to 24 hours or 6 to 12 hours, hi another embodiment the time interval following administration is 5 to 20 days or S to 10 days.
- monitoring of the disease or disorder is carried out by repeating the method for diagnosing the disease or disease, for example, one month after initial diagnosis, six months after initial diagnosis, one year after initial diagnosis, etc.
- Presence of the labeled molecule can be detected in the patient using methods known in the art for in vivo scanning. These methods depend upon the type of label used. Skilled artisans will be able to determine the appropriate method for detecting a particular label. Methods and devices that may be used in the diagnostic methods of the invention include, but are not limited to, computed tomography (CT), whole body scan such as position emission tomography (PET), magnetic resonance imaging (MRI), and sonography.
- CT computed tomography
- PET position emission tomography
- MRI magnetic resonance imaging
- sonography sonography
- the molecule is labeled with a radioisotope and is detected in the patient using a radiation responsive surgical instrument (Thurston et al., U.S. Pat. No. 5,441,050).
- the molecule is labeled with a fluorescent compound and is detected in the patient using a fluorescence responsive scanning instrument.
- the molecule is labeled with a positron emitting metal and is detected in the patent using positron emission-tomography.
- the molecule is labeled with a paramagnetic label and is detected in a patient using magnetic resonance imaging (MRI).
- MRI magnetic resonance imaging
- the antibodies of the present invention are useful for diagnosis, treatment, prevention and/or prognosis of cancer disorders in mammals, preferably humans.
- cancer disorders include, but are not limited to, cancer, neoplasms, tumors and/or as described under "Hyperproliferative Disorders" below, especially C35 -associated cancers such as breast, ovarian, bladder, and colon cancers, and melanoma.
- cancer associated polypeptide express significantly enhanced or reduced levels of normal or altered cancer antigen expression and mRNA encoding the cancer associated polypeptide when compared to a conesponding "standard" level. Further, it is believed that enhanced or depressed levels of the cancer associated polypeptide can be detected in certain body fluids (e.g., sera, plasma, urine, and spinal fluid) or cells or tissue from mammals with such a cancer when compared to sera from mammals of the same species not having the cancer.
- body fluids e.g., sera, plasma, urine, and spinal fluid
- C35 expression is associated with certain cancers (e.g., breast, ovarian, bladder, colon, and pancreatic cancers, and melanoma).
- cancers e.g., breast, ovarian, bladder, colon, and pancreatic cancers, and melanoma
- antibodies (and antibody fragments) directed against C35 may be used to quantitate or qualitate concentrations of cells expressing C35.
- These antibodies additionally have diagnostic applications in detecting abnormalities in the level of C35 expression, or abnormalities in the structure and/or temporal, tissue, cellular, or subcellular location of C35.
- These diagnostic assays may be performed in vivo or in vitro, such as, for example, on blood samples, biopsy tissue or autopsy tissue.
- the invention provides a diagnostic method useful during diagnosis of a cancers, which involves measuring the expression level of the cancer antigen polypeptide in tissue or other cells or body fluid from an individual and comparing the measured expression level with a standard cancer antigen expression level, whereby an increase in the expression level compared to the standard is indicative of a disorder.
- the present invention is useful as a prognostic indicator, whereby patients exhibiting enhanced cancer antigen gene expression will experience a worse clinical outcome relative to patients expressing the gene at a level nearer the standard level.
- the expression level of the cancer associated polypeptide is intended qualitatively or quantitatively measuring or estimating the level of the cancer antigen polypeptide in a first biological sample either directly (e.g., by determining or estimating absolute protein level) or relatively (e.g., by comparing to the cancer associated polypeptide level in a second biological sample).
- the cancer antigen polypeptide expression level in the first biological sample is measured or estimated and compared to a standard cancer antigen polypeptide level, the standard being taken from a second biological sample obtained from an individual not having the disorder or being determined by averaging levels from a population of individuals not having the disorder.
- a standard cancer antigen polypeptide level is known, it can be used repeatedly as a standard for comparison.
- biological sample any biological sample obtained from an individual, cell line, tissue culture, or other source containing cancer antigen polypeptides (including portions thereof).
- biological samples include body fluids (such as sera, plasma, urine, synovial fluid and spinal fluid) which contain cells expressing cancer antigen polypeptides, and other tissue sources found to express the full length or fragments thereof of a cancer antigen. Methods for obtaining tissue biopsies and body fluids from mammals are well known in the art.
- the present invention also relates to diagnostic assays such as quantitative and diagnostic assays for detecting levels of cancer antigen polypeptides, in a biological sample (e.g., cells and tissues), including determination of normal and abnormal levels of polypeptides.
- a diagnostic assay in accordance with the invention for detecting over-expression of cancer antigens compared to normal control tissue samples may be used to detect the presence of tumors.
- Assay techniques that can be used to determine levels of a polypeptide, such as a cancer antigen polypeptide of the present invention in a sample derived from a host are well-known to those of skill in the art. Such assay methods include radioimmunoassays, competitive-binding assays, Western Blot analysis and ELISA assays. Assaying cancer antigen polypeptide levels in a biological sample can occur using any art-known method.
- Cancer antigen polypeptide expression in tissues can also be studied with classical immunohistological methods (Jalkanen et al., J. Cell. Biol. 101:976-985 (1985); Jalkanen, M., et al., J. Cell . Biol. 105:3087-3096 (1987)).
- Other antibody-based methods useful for detecting cancer antigen polypeptide gene expression include immunoassays, such as the enzyme linked immunosorbent assay (ELISA) and the radioimmunoassay (RIA).
- Suitable antibody assay labels include enzyme labels, such as, glucose oxidase, and radioisotopes, such as iodine (1251, 1211), carbon (14C), sulfur (35S), tritium (3H), indium (112In), and technetium (99mTc), and fluorescent labels, such as fluorescein and rhodamine, and biotin.
- enzyme labels such as, glucose oxidase, and radioisotopes, such as iodine (1251, 1211), carbon (14C), sulfur (35S), tritium (3H), indium (112In), and technetium (99mTc)
- fluorescent labels such as fluorescein and rhodamine, and biotin.
- the tissue or cell type to be analyzed will generally include those which are known, or suspected, to express the cancer antigen gene.
- the protein isolation methods employed herein may, for example, be such as those described in Harlow and Lane (Harlow, E. and Lane, D., 1988, “Antibodies: A Laboratory Manual", Cold Spring Harbor Laboratory Press, Cold Spring Harbor, New York), which is incorporated herein by reference in its entirety.
- the isolated cells can be derived from cell culture or from a patient.
- the analysis of cells taken from culture may be a necessary step in the assessment of cells that could be used as part of a cell-based gene therapy technique or, alternatively, to test the effect of compounds on the expression of the cancer antigen gene.
- antibodies, or fragments of antibodies directed to a conformational epitope of a cancer antigen may be used to quantitatively or qualitatively detect the presence of cancer antigen gene products or conserved variants or peptide fragments thereof. This can be accomplished, for example, by immunofluorescence techniques employing a fluorescently labeled antibody coupled with light microscopic, flow cytometric, or fluorimetric detection.
- the antibodies (or fragments thereof), and/or cancer antigen polypeptides of the present invention may, additionally, be employed histologically, as in immunofluorescence, immunoelectron microscopy or non- immunological assays, for in situ detection of cancer antigen gene products or conserved variants or peptide fragments thereof.
- In situ detection may be accomplished by removing a histological specimen from a patient, and applying thereto a labeled antibody or cancer antigen polypeptide of the present invention.
- the antibody (or fragment thereof) or cancer antigen polypeptide is preferably applied by overlaying the labeled antibody (or fragment) onto a biological sample.
- Immunoassays and non-immunoassays for cancer antigen gene products or conserved variants or peptide fragments thereof will typically comprise incubating a sample, such as a biological fluid, a tissue extract, freshly harvested cells, or lysates of cells which have been incubated in cell culture, in the presence of a detectably labeled antibody capable of binding cancer antigen gene products or conserved variants or peptide fragments thereof, and detecting the bound antibody by any of a number of techniques well-known in the art.
- the biological sample may be brought in contact with and immobilized onto a solid phase support or carrier such as nitrocellulose, or other solid support which is capable of immobilizing cells, cell particles or soluble proteins.
- a solid phase support or carrier such as nitrocellulose, or other solid support which is capable of immobilizing cells, cell particles or soluble proteins.
- the support may then be washed with suitable buffers followed by treatment with the detectably labeled anti-cancer antigen antibody or detectable cancer antigen polypeptide.
- the solid phase support may then be washed with the buffer a second time to remove unbound antibody or polypeptide.
- the antibody is subsequently labeled.
- the amount of bound label on solid support may then be detected by conventional means.
- solid phase support or carrier any support capable of binding an antigen or an antibody.
- supports or carriers include glass, polystyrene, polypropylene, polyethylene, dextran, nylon, amylases, natural and modified celluloses, polyacrylamides, gabbros, and magnetite.
- the nature of the carrier can be either soluble to some extent or insoluble for the purposes of the present invention.
- the support material may have virtually any possible structural configuration so long as the coupled molecule is capable of binding to an antigen or antibody.
- the support configuration may be spherical, as in a bead, or cylindrical, as in the inside surface of a test tube, or the external surface of a rod.
- the surface may be flat such as a sheet, test strip, etc.
- Prefened supports include polystyrene beads. Those skilled in the art will know many other suitable carriers for binding antibody or antigen, or will be able to ascertain the same by use of routine experimentation.
- binding activity of a given lot of anti-cancer antigen antibody or cancer antigen polypeptide may be determined according to well known methods. Those skilled in the art will be able to determine operative and optimal assay conditions for each determination by employing routine experimentation.
- cancer antigen polypeptide or polynucleotide can also be detected in vivo by imaging.
- cancer antigen polypeptide and/or anti-cancer antigen antibodies are used to image diseased cells, such as neoplasms.
- cancer antigen polynucleotides of the invention e.g., polynucleotides complementary to all or a portion of cancer antigen mRNA
- anti-cancer antigen antibodies e.g., antibodies directed to any one or a combination of the epitopes of cancer antigens, antibodies directed to a conformational epitope of cancer antigens, antibodies directed to the full length polypeptide expressed on the cell surface of a mammalian cell
- Antibody labels or markers for in vivo imaging of cancer antigen polypeptides include those detectable by X-radiography, NMR, MRI, CAT- scans or ESR.
- suitable labels include radioisotopes such as barium or cesium, which emit detectable radiation but are not overtly harmful to tlie subject.
- Suitable markers for NMR and ESR include those with a detectable characteristic spin, such as deuterium, which may be incorporated into the antibody by labeling of nutrients for the relevant hybridoma.
- in vivo imaging is used to detect enhanced levels of cancer antigen polypeptides for diagnosis in humans, it may be preferable to use human antibodies or "humanized" chimeric monoclonal antibodies.
- Such antibodies can be produced using techniques described herein or otherwise known in the art. For example methods for producing chimeric antibodies are known in the art. See, for review, Morrison, Science 229:1202 (1985); Oi et al., BioTechniques 4:214 (1986); Cabilly et al., U.S. Pat. No. 4,816,567; Taniguchi et al., EP 171496; Morrison et al., EP 173494; Neuberger et al., WO 8601533; Robinson et al., WO 8702671; Boulianne et al., Nature 312:643 (1984); Neuberger et al., Nature 314:268 (1985).
- cancer antigen polypeptides whose presence can be detected, can be administered.
- cancer antigen polypeptides labeled with a radio-opaque or other appropriate compound can be administered and visualized in vivo, as discussed, above for labeled antibodies. Further such cancer antigen polypeptides can be utilized for in vitro diagnostic procedures.
- a cancer antigen polypeptide-specific antibody or antibody fragment which has been labeled with an appropriate detectable imaging moiety such as a radioisotope (for example, 1311, 112h ⁇ , 99mTc), a radio-opaque substance, or a material detectable by nuclear magnetic resonance, is introduced (for example, parenterally, subcutaneously or intraperitoneally) into the mammal to be examined for a disorder.
- an appropriate detectable imaging moiety such as a radioisotope (for example, 1311, 112h ⁇ , 99mTc), a radio-opaque substance, or a material detectable by nuclear magnetic resonance.
- the labeled antibody or antibody fragment will then preferentially accumulate at the location of cells which contain cancer antigen protein.
- In vivo tumor imaging is described in S. W. Burchiel et al., "Immunopharmacokinetics of Radiolabeled Antibodies and Their Fragments" (Chapter 13 in Tumor Imaging: The Radiochemical Detection of Cancer, S. W. Burchiel and B. A. Rhodes, eds., Masson Publishing Inc. (1982)).
- one of the ways in which the anti-cancer antigen antibody can be detectably labeled is by linking the same to an enzyme and using the linked product in an enzyme immunoassay (EIA) (Voller, A., "The Enzyme Linked Immunosorbent Assay (ELISA)", 1978, Diagnostic Horizons 2:1-7, Microbiological Associates Quarterly Publication, Walkersville, Md.); Voller et al., J. Clin. Pafhol. 31:507-520 (1978); Butler, J. E., Meth. Enrymol. 73:482-523 (1981); Maggio, E.
- EIA enzyme immunoassay
- the enzyme which is bound to the antibody will react with an appropriate substrate, preferably a chromogenic substrate, in such a manner as to produce a chemical moiety which can be detected, for example, by spectrophotometric, fluorimetric or by visual means.
- Enzymes which can be used to detectably label the antibody include, but are not limited to, malate dehydrogenase, staphylococcal nuclease, delta-5 -steroid isomerase, yeast alcohol dehydrogenase, alpha-glycerophosphate, dehydrogenase, triose phosphate isomerase, horseradish peroxidase, alkaline phosphatase, asparaginase, glucose oxidase, beta-galactosidase, ribonuclease, urease, catalase, glucose-6-phosphate dehydrogenase, glucoamylase and acetylcholinesterase. Additionally, the detection can be accomplished by colorimetric methods which employ a chromogenic substrate for the enzyme. Detection may also be accomplished by visual comparison of the extent of enzymatic reaction of a substrate in comparison with similarly prepared standards.
- Detection may also be accomplished using any of a variety of other immunoassays.
- a radioimmunoassay RIA
- the radioactive isotope can be detected by means including, but not limited to, a gamma counter, a scintillation counter, or autoradiography.
- fluorescent labeling compounds fluorescein isothiocyanate, rhodamine, phycoerythrin, phycocyanin, allophycocyanin, ophthaldehyde and fluorescamine.
- the antibody can also be detectably labeled using fluorescence emitting metals such as 152Eu, or others of the lanthanide series. These metals can be attached to the antibody using such metal chelating groups as diethylenetriaminepentacetic acid (DTP A) or ethylenediaminetetraacetic acid (EDTA).
- DTP A diethylenetriaminepentacetic acid
- EDTA ethylenediaminetetraacetic acid
- the antibody also can be detectably labeled by coupling it to a chemilummescent compound.
- the presence of the chemiluminescent-tagged antibody is then determined by detecting the presence of luminescence that arises during the course of a chemical reaction.
- chemilummescent labeling compounds are luminol, isoluminol, theromatic acridinium ester, imidazole, acridinium salt and oxalate ester.
- a bioluminescent compound may be used to label the antibody of the present invention.
- Bioluminescence is a type of chemiluminescence found in biological systems in, which a catalytic protein increases the efficiency of the chemilummescent reaction. The presence of a bioluminescent protein is determined by detecting the presence of luminescence.
- Important bioluminescent compounds for purposes of labeling are luciferin, luciferase and aequorin.
- cancer may be detected in a patient based on the presence of one or more cancer antigen proteins of the invention and/or polynucleotides encoding such proteins in a biological sample (for example, blood, sera, urine, and/or tumor biopsies) obtained from the patient, hi other words, such proteins and/or polynucleotides may be used as markers to indicate the presence or absence of cancer.
- a biological sample for example, blood, sera, urine, and/or tumor biopsies
- cancers that may be diagnosed, and/or prognosed using the compositions of the invention include but are not limited to, colorectal cancer, breast cancer, ovarian cancer, prostate cancer, pancreatic cancer, lung cancer, liver cancer, uterine cancer, and/or skin cancer.
- the binding agents provided herein generally permit detection of the level of antigen that binds to the agent in the biological sample.
- Polynucleotide primers and probes may be used to detect the level of MRNA encoding cancer antigen polypeptides, which is also indicative of the presence or absence of cancer, hi general, cancer antigen polypeptides should be present at a level that is at least three fold higher in diseased tissue than in normal tissue.
- assay formats known to those of ordinary skill in the art for using a binding agent to detect polypeptide markers in a sample. See, e.g., Harlow and Lane, supra.
- the presence or absence of a disease in a patient may be determined by (a) contacting a biological sample obtained from a patient with a binding agent; (b) detecting in the sample a level of polypeptide that binds to the binding agent; and (c) comparing the level of polypeptide with a predetermined cut-off value.
- the assay involves the use of binding agent immobilized on a solid support to bind to and remove the cancer antigen polypeptide of the invention from the remainder of the sample.
- the bound polypeptide may then be detected using a detection reagent that contains a reporter group and specifically binds to the binding agent/polypeptide complex.
- detection reagents may comprise, for example, a binding agent that specifically binds to the polypeptide or an antibody or other agent that specifically binds to the binding agent, such as an anti-immunoglobulin, protein G, protein A or a lectin.
- a competitive assay may be utilized, in which a polypeptide is labeled with a reporter group and allowed to bind to the immobilized binding agent after incubation of the binding agent with the sample.
- the extent to which components of the sample inhibit the binding of the labeled polypeptide to the binding agent is indicative of the reactivity of the sample with the immobilized binding agent.
- Suitable polypeptides for use within such assays include cancer antigen polypeptides and portions thereof, or antibodies, to which the binding agent binds, as described above.
- the solid support may be any material known to those of skill in the art to which cancer antigen polypeptides of the invention may be attached.
- the solid support may be a test well in a microtiter plate or a nitrocellulose or other suitable membrane.
- the support may be a bead or disc, such as glass fiberglass, latex or a plastic material such as polystyrene or polyvinylchloride.
- the support may also be a magnetic particle or a fiber optic sensor, such as those disclosed, for example, in U.S. Pat. No. 5,359,681.
- the binding agent maybe immobilized on the solid support using a variety of techniques known to those of skill in the art, which are amply described in the patent and scientific literature, hi the context of the present invention, the term “immobilization” refers to both noncovalent association, such as adsorption, and covalent attachment (which may be a direct linkage between the agent and functional groups on the support or may be a linkage by way of a cross-linking agent). Immobilization by adsorption to a well in a microtiter plate or to a membrane is prefened. In such cases, adsorption may be achieved by contacting the binding agent, in a suitable buffer, with the solid support for the suitable amount of time.
- the contact time varies with temperature, but is typically between about 1 hour and about 1 day.
- contacting a well of plastic microtiter plate such as polystyrene or polyvinylchloride
- an amount of binding agent ranging from about 10 ng to about 10 ug, and preferably about 100 ng to about 1 ug, is sufficient to immobilize an adequate amount of binding agent.
- Covalent attachment of binding agent to a solid support may generally be achieved by first reacting the support with a bifunctional reagent that will react with both the support and a functional group, such as a hydroxyl or amino group, on the binding agent.
- the binding agent may be covalently attached to supports having an appropriate polymer coating using benzoquinone or by condensation of an aldehyde group on the support with an amine and an active hydrogen on the binding partner (see, e.g., Pierce Immunotechnology Catalog and Handbook, 1991, at A12-A13).
- the entire antibody dose is provided in a single bolus.
- the dose can be provided by multiple administrations, such as an extended infusion method or by repeated injections administered over a span of hours or days, for example, a span of about 2 to about 4 days. Also see Examples 5, 9 and 10, and Tables 6-9. [0361] Formulations and methods of administration that can be employed when the compound comprises a nucleic acid or an immunoglobulin are described above; additional appropriate formulations and routes of administration can be selected from among those described herein below.
- Various delivery systems are known and can be used to administer a compound of the invention, e.g., encapsulation in liposomes, microparticles, microcapsules, recombinant cells capable of expressing the compound, receptor-mediated endocytosis (see, e.g., Wu and Wu, J. Biol. Chem. 262:4429-4432 (1987)), construction of a nucleic acid as part of a retroviral or other vector, etc.
- Methods of introduction include but are not limited to intradermal, intramuscular, intraperitoneal, intravenous, subcutaneous, intranasal, epidural, and oral routes.
- the compounds or compositions may be administered by any convenient route, for example by infusion or bolus injection, by abso ⁇ tion through epithelial or mucocutaneous linings (e.g., oral mucosa, rectal and intestinal mucosa, etc.) and may be administered together with other biologically active agents. Administration can be systemic or local.
- Pulmonary administration can also be employed, e.g., by use of an inhaler or nebulizer, and formulation with an aerosolizing agent.
- the pharmaceutical compounds or compositions of the invention may be desirable to administer the pharmaceutical compounds or compositions of the invention locally to the area in need of treatment; this may be achieved by, for example, and not by way of limitation, local infusion during surgery, topical application, e.g., in conjunction with a wound dressing after surgery, by injection, by means of a catheter, by means of a suppository, or by means of an implant, said implant being of a porous, non-porous, or gelatinous material, including membranes, such as sialastic membranes, or fibers.
- a protein including an antibody
- care must be taken to use materials to which the protein does not absorb.
- the compound or composition can be delivered in a vesicle, in particular a liposome (see Langer, Science 249:1527-1533 (1990); Treat et al., in Liposomes in the Therapy of Infectious Disease and Cancer, Lopez-Berestein and Fidler (eds.), Liss, New York, pp. 353-365 (1989); Lopez-Berestein, ibid., pp. 317-327; see generally ibid.)
- the compound or composition can be delivered in a controlled release system.
- a pump may be used (see Langer, supra; Sefton, CRC Grit. Ref Biomed. Eng. 14:201 (1987); Buchwald et al., Surgery 88:507 (1980); Saudek et al, N. Engl. J. Med. 321 :574 (1989)).
- polymeric materials can be used (see Medical Applications of Controlled Release, Langer and Wise (eds.), CRC Pres., Boca Raton, Florida (1974); Controlled Drug Bioavailability, Drug Product Design and Performance, Smolen and Ball (eds.), Wiley, New York (1984); Ranger and Peppas, J., Macromol. Sci. Rev. Macromol. Chem. 23:61 (1983); see also Levy et al., Science 228:190 (1985); During et al, Ann. Neurol. 25:351 (1989); Howard et al, J.Neurosurg. 71:105 (1989)).
- a controlled release system can be placed in proximity of the therapeutic target, i.e., the brain, thus requiring only a fraction of the systemic dose (see, e.g., Goodson, in Medical Applications of Controlled Release, supra, vol. 2, pp. 115-138 (1984)).
- the nucleic acid can be administered in vivo to promote expression of its encoded protein, by constructing it as part of an appropriate nucleic acid expression vector and administering it so that it becomes intracellular, e.g., by use of a retroviral vector (see U.S. Pat. No.
- a nucleic acid can be introduced intracellularly and incorporated within host cell DNA for expression, by homologous recombination.
- the present invention also provides pharmaceutical compositions.
- compositions comprise a therapeutically effective amount of a compound, and a pharmaceutically acceptable carrier, hi a specific embodiment, the term “pharmaceutically acceptable” means approved by a regulatory agency of the Federal or a state government or listed in the U.S. Pharmacopeia or other generally recognized pharmacopeia for use in animals, and more particularly in humans.
- carrier refers to a diluent, adjuvant, excipient, or vehicle with which the therapeutic is administered.
- Such pharmaceutical carriers can be sterile liquids, such as water and oils, including those of petroleum, animal, vegetable or synthetic origin, such as peanut oil, soybean oil, mineral oil, sesame oil and the like. Water is a prefened carrier when the pharmaceutical composition is administered intravenously.
- Saline solutions and aqueous dextrose and glycerol solutions can also be employed as liquid carriers, particularly for injectable solutions.
- suitable pharmaceutical excipients include starch, glucose, lactose, sucrose, gelatin, malt, rice, flour, chalk, silica gel, sodium stearate, glycerol monostearate, talc, sodium chloride, dried skim milk, glycerol, propylene, glycol, water, ethanol and the like.
- the composition if desired, can also contain minor amounts of wetting or emulsifying agents, or pH buffering agents. These compositions can take the form of solutions, suspensions, emulsion, tablets, pills, capsules, powders, sustained-release formulations and the like.
- composition can be formulated as a suppository, with traditional binders and carriers such as triglycerides.
- Oral formulation can include standard carriers such as pharmaceutical grades of mannitol, lactose, starch, magnesium stearate, sodium saccharine, cellulose, magnesium carbonate, etc. Examples of suitable pharmaceutical carriers are described in "Remington's Pharmaceutical Sciences” by E. W. Martin.
- Such compositions will contain a therapeutically effective amount of the compound, preferably in purified form, together with a suitable amount of carrier so as to provide the form for proper administration to the patient.
- the formulation should suit the mode of administration.
- the composition is formulated in accordance with routine procedures as a pharmaceutical composition adapted for intravenous administration to human beings.
- compositions for intravenous administration are solutions in sterile isotonic aqueous buffer.
- the composition may also include a solubilizing agent and a local anesthetic such as lignocaine to ease pain at the site of the injection.
- the ingredients are supplied either separately or mixed together in unit dosage form, for example, as a dry lyophilized powder or water free concentrate in a hermetically sealed container such as an ampoule or sachette indicating the quantity of active agent.
- composition is to be administered by infusion, it can be dispensed with an infusion bottle containing sterile pharmaceutical grade water or saline.
- an ampoule of sterile water for injection or saline can be provided so that the ingredients may be mixed prior to administration.
- the compounds of the invention can be formulated as neutral or salt forms.
- Pharmaceutically acceptable salts include those formed with anions such as those derived from hydrochloric, phosphoric, acetic, oxalic, tartaric acids, etc., and those formed with cations such as those derived from sodium, potassium, ammonium, calcium, ferric hydroxides, isopropylamine, triethylamine, 2-ethylamino ethanol, histidine, procaine, etc.
- the amount of the compound of the invention which will be effective in the treatment, inhibition and prevention of a disease or disorder associated with abenant expression and/or activity of a polypeptide of the invention can be determined by standard clinical techniques.
- in vitro assays may optionally be employed to help identify optimal dosage ranges.
- the precise dose to be employed in the formulation will also depend on the route of administration, and the seriousness of the disease or disorder, and should be decided according to the judgment of the practitioner and each patient's circumstances. Effective doses may be extrapolated from dose-response curves derived from in vitro or animal model test systems.
- the dosage administered to a patient is typically 0.1 mg/kg to 100 mg/kg of the patient's body weight.
- the dosage administered to a patient is between 0.1 mg/kg and 20 mg/kg of the patient's body weight, more preferably 1 mg/kg to 10 mg/kg of the patient's body weight.
- human antibodies have a longer half-life within the human body than antibodies from other species due to the immune response to the foreign polypeptides. Thus, lower dosages of human antibodies and less frequent administration is often possible.
- the dosage and frequency of administration of antibodies of the invention may be reduced by enhancing uptake and tissue penetration (e.g., into the brain) of the antibodies by modifications such as, for example, lipidation. Also see Example 5.
- the invention also provides a pharmaceutical pack or kit comprising one or more containers filled with one or more of the ingredients of the pharmaceutical compositions of the invention.
- a pharmaceutical pack or kit comprising one or more containers filled with one or more of the ingredients of the pharmaceutical compositions of the invention.
- Optionally associated with such container(s) can be a notice in the form prescribed by a governmental agency regulating the manufacture, use or sale of pharmaceuticals or biological products, which notice reflects approval by the agency of manufacture, use or sale for human administration.
- Antibodies can be used to assay levels of polypeptides encoded by polynucleotides of the invention in a biological sample using classical immunohistological methods known to those of skill in the art (e.g., see Jalkanen, et al., J. Cell. Biol. 101:976-985 (1985); Jalkanen, et al, J. Cell. Biol. 105:3087-3096 (1987)).
- Other antibody-based methods useful for detecting protein gene expression include immunoassays, such as the enzyme linked immunosorbent assay (ELISA) and the radioimmunoassay (RIA).
- Suitable antibody assay labels include enzyme labels, such as, glucose oxidase; radioisotopes, such as iodine ( 131 I, 125 I, 123 I, 121 I), carbon ( 14 C), sulfur ( 35 S), tritium ( 3 H), indium ( 115 mln, 113 h ⁇ , 112 fr ⁇ , ⁇ h ⁇ ), and technetium ( 99 Tc, 99 mTc), thallium ( 201 Ti), gallium ( 68 Ga, 67 Ga), palladium ( 103 Pd), molybdenum ( 99 Mo), xenon ( 133 Xe), fluorine ( 18 F), 153 Sm, 177 Lu, 159 Gd, 149 Pm, 140 La, 175 Yb, 166 Ho, 90 Y, 47 Sc, 186 Re, 88 Re, 142 Pr, 105 Rh, 97 Ru; luminescent labels, such as luminol; and fluorescent labels, such as fluorescein and
- proteins can also be detected in vivo by imaging.
- Antibody labels or markers for in vivo imaging of protein include those detectable by X-radiography, NMR or ESR.
- suitable labels include radioisotopes such as barium or cesium, which emit detectable radiation but are not overtly harmful to the subject.
- suitable markers for NMR and ESR include those with a detectable characteristic spin, such as deuterium, which may be incorporated into the antibody by labeling of nutrients for the relevant hybridoma.
- a protein-specific antibody or antibody fragment which has been labeled with an appropriate detectable imaging moiety such as a radioisotope (for example, 131 I, l 12 In, 99 mTc, ( 131 1, 125 1, 123 1, 121 I), carbon ( 14 C), sulfur (35S), tritium ( 3 H), indium ( 115 mh ⁇ , 113 mhi, ⁇ 2 h ⁇ , U 1 h ⁇ ), and technetium ( 99 Tc, 99 mTc), thallium ( 201 Ti), gallium ( 68 Ga, 67 Ga), palladium ( 103 Pd), molybdenum ( 99 Mo), xenon ( 133 Xe), fluorine ( 18 F, 153 Sm, 177 Lu, 59 Gd, 149 Pm, 140 La, 175 Yb, 166 Ho, 90 Y, 47 Sc, 186 Re, 188 Re, 142 Pr, 105 Rh, 97 Ru), a radio-opaque substance
- the size of the subject and the imaging system used will determine the quantity of imaging moiety needed to produce diagnostic images.
- the quantity of radioactivity injected will normally range from about 5 to 20 millicuries of 99 mTc.
- the labeled antibody or antibody fragment will then preferentially accumulate at the location of cells which express the polypeptide encoded by a polynucleotide of the invention, hi vivo tumor imaging is described in S.W. Burchiel et al., "Immunopharmacokinetics of Radiolabeled Antibodies and Their Fragments" (Chapter 13 in Tumor Imaging: The Radiochemical Detection of Cancer, S. W. Burchiel and B. A. Rhodes, eds., Masson Publishing Inc. (1982)).
- the invention provides a method for the specific delivery of compositions of the invention to cells by administering polypeptides of the invention (e.g., polypeptides encoded by polynucleotides of the invention and/or antibodies) that are associated with heterologous polypeptides or nucleic acids, hi one example, the invention provides a method for delivering a therapeutic protein into the targeted cell. In another example, the invention provides a method for delivering a single stranded nucleic acid (e.g., antisense or ribozymes) or double stranded nucleic acid (e.g., DNA that can integrate into the cell's genome or replicate episomally and that can be transcribed) into the targeted cell.
- polypeptides of the invention e.g., polypeptides encoded by polynucleotides of the invention and/or antibodies
- the invention provides a method for delivering a therapeutic protein into the targeted cell.
- the invention provides a method for delivering a single stranded nu
- nucleic acids comprising sequences encoding antibodies such as C35 antibodies, or functional derivatives thereof, are administered to treat, inhibit or prevent a disease or disorder associated with abenant expression and/or activity of C35, by way of gene therapy.
- Gene therapy refers to therapy performed by the administration to a subject of an expressed or expressible nucleic acid, hi this embodiment of the invention, the nucleic acids produce their encoded protein that mediates a therapeutic effect.
- Any of the methods for gene therapy available in the art can be used according to the present invention. Exemplary methods are described below.
- the compound comprises nucleic acid sequences encoding an antibody, said nucleic acid sequences being part of expression vectors that express the antibody or fragments or chimeric proteins or heavy or light chains thereof in a suitable host.
- nucleic acid sequences have promoters operably linked to the antibody coding region, said promoter being inducible or constitutive, and, optionally, tissue-specific.
- nucleic acid molecules are used in which the antibody coding sequences and any other desired sequences are flanked by regions that promote homologous recombination at a desired site in the genome, thus providing for intrachromosomal expression of the antibody encoding nucleic acids (Roller and Smithies, Proc. Natl.
- the expressed antibody molecule is a single chain antibody; alternatively, the nucleic acid sequences include sequences encoding both the heavy and light chains, or fragments thereof, of the antibody.
- nucleic acids into a patient may be either direct, in which case the patient is directly exposed to the nucleic acid or nucleic acid- carrying vectors, or indirect, in which case, cells are first transformed with the nucleic acids in vitro, then transplanted into the patient. These two approaches are known, respectively, as in vivo or ex vivo gene therapy.
- the nucleic acid sequences are directly administered in vivo, where it is expressed to produce the encoded product.
- microparticle bombardment e.g., a gene gun; Biolistic, Dupont
- coating lipids or cell-surface receptors or transfecting agents, encapsulation in liposomes, microparticles, or microcapsules, or by administering them in linkage to a peptide which is known to enter the nucleus, by administering it in linkage to a ligand subject to receptor-mediated endocytosis (see, e.g., Wu and Wu, J. Biol. Chem. 262:4429-4432 (1987)) (which can be used to target cell types specifically expressing the receptors), etc.
- nucleic acid-ligand complexes can be formed in which the ligand comprises a fusogenic viral peptide to disrupt endosomes, allowing the nucleic acid to avoid lysosomal degradation.
- the nucleic acid can be targeted in vivo for cell specific uptake and expression, by targeting a specific receptor (see, e.g., PCT Publications WO 92/06180; WO 92/22635; WO92/20316; WO93/14188, WO 93/20221).
- the nucleic acid can be introduced intracellularly and incorporated within host cell DNA for expression, by homologous recombination (Roller and Smithies, Proc. Natl. Acad. Sci. USA 86:8932-8935 (1989); Zijlstra et al, Nature 342:435-438 (1989)).
- viral vectors that contains nucleic acid sequences encoding an antibody of the invention are used.
- a retroviral vector can be used (see Miller et al., Me h. Enzymol. 217:581-599 (1993)). These retroviral vectors contain the components necessary for the conect packaging of the viral genome and integration into the host cell DNA.
- the nucleic acid sequences encoding the antibody to be used in gene therapy are cloned into one or more vectors, which facilitates delivery of the gene into a patient.
- retroviral vectors More detail about retroviral vectors can be found in Boesen et al., Biotherapy 6:291-302 (1994), which describes the use of a retroviral vector to deliver the mdrl gene to hematopoietic stem cells in order to make the stem cells more resistant to chemotherapy.
- Other references illustrating the use of retroviral vectors in gene therapy are: Clowes et al., J. Clin. Invest. 93:644-651 (1994); Kiem et al, Blood 83:1467-1473 (1994); Salmons and Gunzberg, Human Gene Therapy 4:129-141 (1993); and Grossman and Wilson, Cun. Opin. in Genetics and Devel. 3:110-114 (1993).
- Adenoviruses are other viral vectors that can be used in gene therapy. Adenoviruses are especially attractive vehicles for delivering genes to respiratory epithelia. Adenoviruses naturally infect respiratory epithelia where they cause a mild disease. Other targets for adenovirus-based delivery systems are liver, the central nervous system, endothelial cells, and muscle. Adenoviruses have the advantage of being capable of infecting non-dividing cells. Kozarsky and Wilson, Cunent Opinion in Genetics and Development 3:499-503 (1993) present a review of adenovirus-based gene therapy.
- Adeno-associated virus has also been proposed for use in gene therapy (Walsh et al., Proc. Soc. Exp. Biol. Med. 204:289-300 (1993); U.S. Pat. No. 5,436,146).
- Another approach to gene therapy involves transferring a gene to cells in tissue culture by such methods as electroporation, lipofection, calcium phosphate mediated transfection, or viral infection.
- the method of transfer includes the transfer of a selectable marker to the cells. The cells are then placed under selection to isolate those cells that have taken up and are expressing the transfe ⁇ ed gene. Those cells are then delivered to a patient.
- the nucleic acid is introduced into a cell prior to administration in vivo of the resulting recombinant cell.
- introduction can be carried out by any method known in the art, including but not limited to transfection, electroporation, microinjection, infection with a viral or bacteriophage vector containing the nucleic acid sequences, cell fusion, chromosome-mediated gene transfer, microcell-mediated gene transfer, spheroplast fusion, etc.
- Numerous techniques are known in the art for the introduction of foreign genes into cells (see, e.g., Loeffler and Behr, Meth. Enzymol. 217:599-618 (1993); Cohen et al., Meth. Enzymol.
- the technique should provide for the stable transfer of the nucleic acid to the cell, so that the nucleic acid is expressible by the cell and preferably heritable and expressible by its cell progeny.
- the resulting recombinant cells can be delivered to a patient by various methods known in the art.
- Recombinant blood cells e.g., hematopoietic stem or progenitor cells
- the amount of cells envisioned for use depends on the desired effect, patient state, etc., and can be determined by one skilled in the art.
- Cells into which a nucleic acid can be introduced for purposes of gene therapy encompass any desired, available cell type, and include but are not limited to epithelial cells, endothelial cells, keratinocytes, fibroblasts, muscle cells, hepatocytes; blood cells such as Tlymphocytes, Blymphocytes, monocytes, macrophages, neutrophils, eosinophils, megakaryocytes, granulocytes; various stem or progenitor cells, in particular hematopoietic stem or progenitor cells, e.g., as obtained from bone manow, umbilical cord blood, peripheral blood, fetal liver, etc.
- the cell used for gene therapy is autologous to the patient.
- nucleic acid sequences encoding an antibody are introduced into the cells such that they are expressible by the cells or their progeny, and the recombinant cells are then administered in vivo for therapeutic effect.
- stem or progenitor cells are used. Any stem and/or progenitor cells which can be isolated and maintained in vitro can potentially be used in accordance with this embodiment of the present invention (see e.g. PCT Publication WO 94/08598; Stemple and Anderson, Cell 71:973-985 (1992); Rheinwald, Meth. Cell Bio. 21A:229 (1980); and Pittelkow and Scott, Mayo Clinic Proc. 61:771 (1986)).
- the nucleic acid to be introduced for purposes of gene therapy comprises an inducible promoter operably linked to the coding region, such that expression of the nucleic acid is controllable by controlling the presence or absence of the appropriate inducer of transcription.
- the method of the invention can be used to treat hyperproliferative diseases, disorders, and/or conditions, including neoplasms.
- hyperproliferative diseases, disorders, and/or conditions examples include, but are not limited to neoplasms located in the: prostate, colon, abdomen, bone, breast, digestive system, liver, pancreas, peritoneum, endocrine glands (adrenal, parathyroid, pituitary, testicles, ovary, thymus, thyroid), eye, head and neck, nervous (central and peripheral), lymphatic system, pelvic, skin, soft tissue, spleen, thoracic, and urogenital.
- neoplasms located in the: prostate, colon, abdomen, bone, breast, digestive system, liver, pancreas, peritoneum, endocrine glands (adrenal, parathyroid, pituitary, testicles, ovary, thymus, thyroid), eye, head and neck, nervous (central and peripheral), lymphatic system, pelvic, skin, soft tissue, spleen, thoracic, and urogenital.
- hyperproliferative disorders include, but are not limited to: Acute Childhood Lymphoblastic Leukemia, Acute Lymphoblastic Leukemia, Acute Lymphocytic Leukemia, Acute Myeloid Leukemia, Adrenocortical Carcinoma, Adult (Primary) Hepatocellular Cancer, Adult (Primary) Liver Cancer, Adult Acute Lymphocytic Leukemia, Adult Acute Myeloid Leukemia, Adult Hodgkin's Disease, Adult Hodgkin's Lymphoma, Adult Lymphocytic Leukemia, Adult Non-Hodgkin's Lymphoma, Adult Primary Liver Cancer, Adult Soft Tissue Sarcoma, AEDS-Related Lymphoma, AJDS-Related Malignancies, Anal Cancer, Astrocytoma, Bile Duct Cancer, Bladder Cancer, Bone Cancer, Brain Stem Glioma, Brain Tumors, Breast Cancer, Cancer of the Renal Pelvis and Ure
- Osteosarcoma/Malignant Fibrous Histiocytoma of Bone Ovarian Epithelial Cancer, Ovarian Germ Cell Tumor, Ovarian Low Malignant Potential Tumor, Pancreatic Cancer, Paraproteinemias, Purpura, Parathyroid Cancer, Penile Cancer, Pheochromocytoma, Pituitary Tumor, Plasma Cell Neoplasm/Multiple Myeloma, Primary Central Nervous System Lymphoma, Primary Liver Cancer, Prostate Cancer, Rectal Cancer, Renal Cell Cancer, Renal Pelvis and Ureter Cancer, Retinoblastoma, Rhabdomyosarcoma, Salivary Gland Cancer, Sarcoidosis Sarcomas, Sezary Syndrome, Skin Cancer, Small Cell Lung Cancer, Small Intestine Cancer, Soft Tissue Sarcoma, Squamous Neck Cancer, Stomach Cancer, Supratentorial Primitive Neuroectodermal and Pineal Tumors, T-Cell Lymphoma, Testicular Cancer, Thymo
- the method of the present invention may be used to treat premalignant conditions and to prevent progression to a neoplastic or malignant state, including but not limited to those disorders described above.
- Such uses are indicated in conditions known or suspected of preceding progression to neoplasia or cancer, in particular, where non-neoplastic cell growth consisting of hype ⁇ lasia, metaplasia, or most particularly, dysplasia has occu ⁇ ed (for review of such abnormal growth conditions, see Robbins and Angell, 1976, Basic Pathology, 2d Ed., W. B. Saunders Co., Philadelphia, pp. 68-79.)
- Hype ⁇ lasia is a form of controlled cell proliferation, involving an increase in cell number in a tissue or organ, without significant alteration in structure or function.
- Hype ⁇ lastic disorders which can be treated by the method of the invention include, but are not limited to, angiofoUicular mediastinal lymph node hype ⁇ lasia, angiolymphoid hype ⁇ lasia with eosinophilia, atypical melanocytic hype ⁇ lasia, basal cell hype ⁇ lasia, benign giant lymph node hype ⁇ lasia, cementum hype ⁇ lasia, congenital adrenal hype ⁇ lasia, congenital sebaceous hype ⁇ lasia, cystic hype ⁇ lasia, cystic hype ⁇ lasia of the breast, denture hype ⁇ lasia, ductal hype ⁇ lasia, endometrial hype ⁇ lasia, fibromuscular hype ⁇ lasia, focal epithelial hype ⁇ lasia, gingival hype ⁇ lasia, inflammatory fibrous hype ⁇ lasia, inflammatory papillary hype ⁇ lasia, intravascular pa
- Metaplasia is a form of controlled cell growth in which one type of adult or fully differentiated cell substitutes for another type of adult cell.
- Metaplastic disorders which can be treated by the method of the invention include, but are not limited to, agnogenic myeloid metaplasia, apocrine metaplasia, atypical metaplasia, autoparenchymatous metaplasia, connective tissue metaplasia, epithelial metaplasia, intestinal metaplasia, metaplastic anemia, metaplastic ossification, metaplastic polyps, myeloid metaplasia, primary myeloid metaplasia, secondary myeloid metaplasia, squamous metaplasia, squamous metaplasia of amnion, and symptomatic myeloid metaplasia.
- Dysplasia is frequently a forerunner of cancer, and is found mainly in the epithelia; it is the most disorderly form of non-neoplastic cell growth, involving a loss in individual cell uniformity and in the architectural orientation of cells. Dysplastic cells often have abnormally large, deeply stained nuclei, and exhibit pleomo ⁇ hism. Dysplasia characteristically occurs where there exists chronic irritation or inflammation.
- Dysplastic disorders which can be treated by the method of the invention include, but are not limited to, anhidrotic ectodermal dysplasia, anterofacial dysplasia, asphyxiating thoracic dysplasia, atriodigital dysplasia, bronchopulmonary dysplasia, cerebral dysplasia, cervical dysplasia, chondroectodermal dysplasia, cleidocranial dysplasia, congenital ectodermal dysplasia, craniodiaphysial dysplasia, cranioca ⁇ otarsal dysplasia, craniometaphysial dysplasia, dentin dysplasia, diaphysial dysplasia, ectodermal dysplasia, enamel dysplasia, encephalo-ophthalmic dysplasia, dysplasia epiphysialis hemimelia, dysplasia epiphysialis multiplex, dysplasia epiphysi
- Additional pre-neoplastic disorders which can be treated by the method of the invention include, but are not limited to, benign dysproliferative disorders (e.g., benign tumors, fibrocystic conditions, tissue hypertrophy, intestinal polyps, colon polyps, and esophageal dysplasia), leukoplakia, keratoses, Bowen's disease, Farmer's Skin, solar cheilitis, and solar keratosis.
- benign dysproliferative disorders e.g., benign tumors, fibrocystic conditions, tissue hypertrophy, intestinal polyps, colon polyps, and esophageal dysplasia
- leukoplakia keratoses
- Bowen's disease keratoses
- Farmer's Skin Farmer's Skin
- solar cheilitis solar cheilitis
- the method of the invention is used to inhibit growth, progression, and/or metastasis of cancers, in particular those listed above.
- Additional diseases or conditions associated with increased cell survival include, but are not limited to, progression, and/or metastases of malignancies and related disorders such as leukemia (including acute leukemias (e.g., acute lymphocytic leukemia, acute myelocytic leukemia (includmg myeloblastic, promyelocytic, myelomonocytic, monocytic, and erythroleukemia)) and chronic leukemias (e.g., chronic myelocytic (granulocytic) leukemia and chronic lymphocytic leukemia)), polycythemia vera, lymphomas (e.g., Hodgkin's disease and non- Hodgkin's disease), multiple myeloma, Waldenstrom's macroglobulinemia, heavy chain disease, and solid tumors including, but not limited to, sarcomas and carcinomas such as fibrosarcoma, myacytic leukemia, and erythroleuk
- Hype ⁇ roliferative diseases and/or disorders that could be treated by the method of the invention, include, but are not limited to, neoplasms located in the liver, abdomen, bone, breast, digestive system, pancreas, peritoneum, endocrine glands (adrenal, parathyroid, pituitary, testicles, ovary, thymus, thyroid), eye, head and neck, nervous system (central and peripheral), lymphatic system, pelvis, skin, soft tissue, spleen, thorax, and urogenital tract.
- neoplasms located in the liver, abdomen, bone, breast, digestive system, pancreas, peritoneum, endocrine glands (adrenal, parathyroid, pituitary, testicles, ovary, thymus, thyroid), eye, head and neck, nervous system (central and peripheral), lymphatic system, pelvis, skin, soft tissue, spleen, thorax, and urogenital tract.
- hype ⁇ roliferative disorders can also be treated by the method of the invention.
- hype ⁇ roliferative disorders include, but are not limited to: hypergammaglobulinemia, lymphoproliferative disorders, paraproteinemias, pu ⁇ ura, sarcoidosis, Sezary Syndrome, Waldenstron's macroglobulinemia, Gaucher's Disease, histiocytosis, and any other hype ⁇ roliferative disease, besides neoplasia, located in an organ system listed above.
- in vitro assays to demonstrate the therapeutic or prophylactic utility of a compound or pharmaceutical composition include the effect of a compound on a cell line or a patient tissue sample.
- the effect of the compound or composition on the cell line and/or tissue sample can be determined utilizing techniques known to those of skill in the art including, but not limited to, rosette formation assays and cell lysis assays.
- in vitro assays which can be used to determine whether administration of a specific compound is indicated, include in vitro cell culture assays in which a patient tissue sample is grown in culture, and exposed to or otherwise administered a compound, and the effect of such compound upon the tissue sample is observed.
- kits that can be used in the above methods.
- a kit comprises an antibody of the invention, preferably a purified antibody, in one or more containers.
- the kits of the present invention contain a substantially isolated polypeptide comprising an epitope which is specifically immunoreactive with an antibody included in the kit.
- kits of the present invention further comprise a control antibody which does not react with the polypeptide of interest
- the kits of the present invention contain a means for detecting the binding of an antibody to a polypeptide of interest (e.g., the antibody may be conjugated to a detectable substrate such as a fluorescent compound, an enzymatic substrate, a radioactive compound or a luminescent compound, or a second antibody which recognizes the first antibody may be conjugated to a detectable substrate).
- a detectable substrate such as a fluorescent compound, an enzymatic substrate, a radioactive compound or a luminescent compound, or a second antibody which recognizes the first antibody may be conjugated to a detectable substrate.
- the kit is a diagnostic kit for use in screening serum containing antibodies specific against proliferative and/or cancerous polynucleotides and polypeptides.
- a kit may include a control antibody that does not react with the polypeptide of interest.
- a kit may include a substantially isolated polypeptide antigen comprising an epitope which is specifically immunoreactive with at least one anti-polypeptide antigen antibody.
- a kit includes means for detecting the binding of said antibody to the antigen (e.g., the antibody may be conjugated to a fluorescent compound such as fluorescein or rhodamine which can be detected by flow cytometry).
- the kit may include a recombinantly produced or chemically synthesized polypeptide antigen.
- the polypeptide antigen of the kit may also be attached to a solid support.
- the detecting means of the above- described kit includes a solid support to which said polypeptide antigen is attached.
- a kit may also include a non-attached reporter-labeled anti- human antibody.
- binding of the antibody to the polypeptide antigen can be detected by binding of the said reporter-labeled antibody.
- the invention includes a diagnostic kit for use in screening samples containing antigens of the polypeptide of the invention.
- the diagnostic kit includes a substantially isolated antibody specifically immunoreactive with polypeptide or polynucleotide antigens, and means for detecting the binding of the polynucleotide or polypeptide antigen to the antibody.
- the antibody is attached to a solid support, hi a specific embodiment, the antibody may be a monoclonal antibody.
- the detecting means of the kit may include a second, labeled monoclonal antibody. Alternatively, or in addition, the detecting means may include a labeled, competing antigen.
- test sample is reacted with a solid phase reagent having a surface-bound antigen obtained by the methods of the present invention.
- the reagent After binding with specific antigen antibody to the reagent and removing unbound sample components by washing, the reagent is reacted with reporter-labeled anti-human antibody to bind reporter to the reagent in proportion to the amount of bound anti-antigen antibody on the solid support.
- the reagent is again washed to remove unbound labeled antibody, and the amount of reporter associated with the reagent is determined.
- the reporter is an enzyme which is detected by incubating the solid phase in the presence of a suitable fluorometric, luminescent or calorimetric substrate (Sigma, St. Louis, Mo.).
- the solid surface reagent in the above assay is prepared by known techniques for attaching protein material to solid support material, such as polymeric beads, dip sticks, 96-well plate or filter material. These attachment methods generally include non-specific adso ⁇ tion of the protein to the support or covalent attachment of the protein, typically through a free amine group, to a chemically reactive group on the solid support, such as an activated carboxyl, hydroxyl, or aldehyde group. Alternatively, streptavidin coated plates can be used in conjunction with biotinylated antigen(s). [0414] Thus, the invention provides an assay system or kit for carrying out this diagnostic method.
- the kit generally includes a support with surface- bound recombinant antigens, and a reporter-labeled anti-human antibody for detecting surface-bound anti-antigen antibody.
- Apoptosis-inducing therepies include chemotherapeutic agents (also known as antineoplastic agents), radiation therapy, and combination radiotherapy and chemotherapy.
- chemotherapeutic agents are vinca alkaloids, epipodophyllotoxins, anthracycline antibiotics, actinomycin D, plicamycin, puromycin, gramicidin D, paclitaxel (Taxol.RTM., Bristol Myers Squibb), colchicine, cytochalasin B, emetine, maytansine, and amsacrine (or "mAMSA").
- the vinca alkaloid class is described in Goodman and Gilman's The Pharmacological Basis of Therapeutics (7th ed.), (1985), pp. 1277-1280.
- Exemplary of vinca alkaloids are vincristine, vinblastine, and vindesine.
- the epipodophyllotoxin class is described in Goodman and Gilman's The Pharmacological Basis of Therapeutics (7th ed.), (1985), pp. 1280-1281.
- Exemplary of epipodophyllotoxins are etoposide, etoposide orthoquinone, and teniposide.
- the anthracycline antibiotic class is described in Goodman and Gilman's The Pharmacological Basis of Therapeutics (7th ed.), (1985), pp. 1283-1285.
- Exemplary of anthracycline antibiotics are daunorubicin, doxorubicin, mitoxantraone, and bisanthrene.
- Actinomycin D also called Dactinomycin
- Plicamycin also called mithramycin
- Actinomycin D is described in Goodmand and Gilman's The Pharmacological Basis of Therapeutics (7th ed), (1985), p ⁇ .1287-1288.
- Additional chemotherapeutic agents include cisplatin (Platinol.RTM., Bristol Myers Squibb), carboplatin (Paraplatin.RTM., Bristol Myers Squibb), mitomycin (Mutamycin.RTM., Bristol Myers Squibb), altretamine (Hexalen.RTM., U.S. Bioscience, Inc.), cyclophosphamide (Cytoxan.RTM., Bristol Myers Squibb), lomustine (CCNU) (CeeNU.RTM., Bristol Myers Squibb), carmustine (BCNU) (BiCNU.RTM., Bristol Myers Squibb).
- chemotherapeutic agents also include aclacinomycin A, aclarubicin, acronine, acronycine, adriamycin, aldesleukin (interleukin-2), altretamine (hexamiethylmelamine), aminoglutethimide, aminoglutethimide (cytadren), aminoimidazole carboxamide, amsacrine (m-AMSA; amsidine), anastrazole (arimidex), ancitabine, anthracyline, anthramycin, asparaginase (elspar), azacitdine, azacitidine (ladakamycin), azaguanine, azaserine, azauridine, l, , '-phosphinothioylidynetris aziridine, azirino(2',
- Prefened therapeutic agents and combinations that may be administered as an apoptosis-inducing therapy include Doxorubicin and Doxetaxel, Topotecan, Paclitaxel, Carboplatin and Taxol, Taxol, Cisplatin and Radiation, 5-fluorouracil (5-FU), 5-FU and Radiation, Toxotere, Fludarabine, Ara C, Etoposide, Vincristine, and Vinblastin.
- Exemplary chemotherapeutic agents also include doxetaxel (TOXOTERE) and to potecan (HYCAM ⁇ N).
- TOXOTERE doxetaxel
- HYCAM ⁇ N to potecan
- Chemotherapeutic agents that may be administered in the method of the invention include, but are not limited to, antibiotic derivatives (e.g., doxorubicin, bleomycin, daunorubicin, and dactinomycin); antiestrogens (e.g., tamoxifen); antimetabohtes (e.g., fluorouracil, 5-FU, methotrexate, floxuridine, interferon alpha-2b, glutamic acid, plicamycin, mercaptopurine, and 6-thioguanine); cytotoxic agents (e.g., carmustine, BCNU, lomustine, CCNU, cytosine arabinoside, cyclophosphamide, estramustine, hydroxyurea, procarbazine, mitomycin, busulfan, cis-platin, and vincristine sulfate); hormones (e.g., medroxyprogesterone, estramustine phosphate
- antibodies of the invention are administered in combination with CHOP (cyclophosphamide, doxorubicin, vincristine, and prednisone) or any combination of the components of CHOP, hi another embodiment, antibodies of the invention are administered in combination with Rituximab. In a further embodiment, antibodies of the invention are administered with Rituxmab arid CHOP, or Rituxmab and any combination of the components of CHOP.
- CHOP cyclophosphamide, doxorubicin, vincristine, and prednisone
- Colon cancer 5-FU plus leucovorin, irinotecan (camptosar), oxaliplatin, and capecitabine.
- Lung cancer Cisplatin, carboplatin, paclitaxel, docetaxel, gemcitabine, vinorelbine.
- Prostate cancer Docetaxel, estramustine, mitoxantrone (Novantrone), and prednisone.
- Non-Hodgkin's Lymphoma Cyclophosphamide, doxorubicin, vincristine (Oncovin), and prednisone.
- Therapeutic radiation includes, for example, fractionated radiotherapy, nonfractionated radiotherapy and hyperfractionated radiotherapy, and combination radiation and chemotherapy. Types of radiation also include ionizing (gamma) radiation, particle radiation, low energy transmission (LET), high energy transmission (HET), ultraviolet radiation, infrared radiation, visible light, and photosensitizing radiation.
- chemotherapy includes treatment with a single chemotherapeutic agent or with a combination of agents. In a subject in need of treatment, chemotherapy may be combined with surgical treatment or radiation therapy, or with other antineoplastic treatment modalities.
- Other Therapeutics include, for example, fractionated radiotherapy, nonfractionated radiotherapy and hyperfractionated radiotherapy, and combination radiation and chemotherapy.
- Types of radiation also include ionizing (gamma) radiation, particle radiation, low energy transmission (LET), high energy transmission (HET), ultraviolet radiation, infrared radiation, visible light, and photosensitizing radiation.
- LET low energy transmission
- HET high energy transmission
- ultraviolet radiation infrared radiation
- visible light visible
- the antibodies of the invention are administered in combination with an antiviral agent.
- Antiviral agents that may be admimstered with the antibodies of the invention include, but are not limited to, acyclovir, ribavirin, amantadine, and remantidine.
- Antibodies of the invention may also be administered with antiemetics such as 2-(ethylthio)-10-(3-(4-methyl-l-piperazinyl) propyl)-10H- phenothiazine (ethylthioperazine), 1 -(p-chloro-alpha-phenylbenzyl)-4-(m- methylbenzyl)-piperazine (meclozine, meclizine), etc., and combinations thereof.
- Polynucleotides and polypeptides of the invention may also be administered with other therapeutic agents, and combinations thereof, disclosed herein or known in the art.
- the antibodies of the invention are administered in combination with an antibiotic agent.
- Antibiotic agents that may be administered with the antibodies of the invention include, but are not limited to, amoxicillin, beta-lactamases, aminoglycosides, beta-lactam (glycopeptide), beta-lactamases, Clindamycin, chloramphenicol, cephalosporins, ciprofloxacin, ciprofloxacin, erythromycin, fluoroquinolones, macrolides, metronidazole, penicillins, quinolones, rifampin, streptomycin, sulfonamide, tetracyclines, trimethoprim, trimethoprim-sulfamthoxazole, and vancomycin.
- Conventional nonspecific immunosuppressive agents that may be administered in combination with the antibodies of the invention include, but are not limited to, steroids, cyclosporine, cyclosporine analogs, cyclophosphamide methylprednisone, prednisone, azathioprine, FK-506, 15- deoxyspergualin, and other immunosuppressive agents that act by suppressing the function of responding T cells.
- antibodies of the invention are administered in combination with immunosuppressants.
- immunosuppressants preparations that may be administered with the antibodies of the invention include, but are not limited to, ORTHOCLONE.TM. (OKT3), SANDIMMUNE.TM./NEORAL.TM./SANGDYA.TM. (cyclosporin), PROGRAF.TM. (tacrolimus), CELLCEPT.TM. (mycophenolate), Azathioprine, glucorticosteroids, and RAPAMUNE.TM. (sirolimus).
- immunosuppressants may be used to prevent rejection of organ or bone manow transplantation.
- antibodies of the invention are administered alone or in combination with one or more intravenous immune globulin preparations.
- Intravenous immune globulin preparations that may be administered with the antibodies of the invention include, but not limited to, GAMMAR.TM., IVEEGAM.TM., SANDOGLOBULIN.TM., GAMMAGARD S/D.TM., and GAMEVIUNE.TM..
- antibodies of the invention are administered in combination with intravenous immune globulin preparations in transplantation therapy (e.g., bone manow transplant).
- the antibodies of the invention are administered alone or in combination with an anti-inflammatory agent.
- Anti- inflammatory agents that may be administered with the antibodies of the invention include, but are not limited to, glucocorticoids and the nonsteroidal anti-inflammatories, aminoarylcarboxylic acid derivatives, arylacetic acid derivatives, arylbutyric acid derivatives, arylcarboxylic acids, arylpropionic acid derivatives, pyrazoles, pyrazolones, salicylic acid derivatives, thiazinecarboxamides, e-acetamidocaproic acid, S-adenosylmefhionine, 3- amino-4-hydroxybutyric acid, amixetrine, bendazac, benzydamine, bucolome, difenpiramide, ditazol, emorfazone, guaiazulene, nabumetone, nimesulide, orgotein, oxaceprol, par
- antibodies of the invention are administered in combination with a chemotherapeutic agent.
- Chemotherapeutic agents that may be administered with the antibodies of the invention include, but are not limited to, antibiotic derivatives (e.g., doxorubicin, bleomycin, daunorubicin, and dactinomycin); antiestrogens (e.g., tamoxifen); antimetabohtes (e.g., fluorouracil, 5-FU, methotrexate, floxuridine, interferon alpha-2b, glutamic acid, plicamycin, mercaptopurine, and 6-thioguanine); cytotoxic agents (e.g.
- estramustine hydroxyurea, procarbazine, mitomycin. busulfan, cis-platin, and vincristine sulfate
- hormones e.g medroxyprogesterone, estramustine phosphate sodium, ethinyl estradiol, estradiol, megestrol acetate, methyltestosterone, diethylstilbestrol diphosphate chlorotrianisene, and testolactone
- nitrogen mustard derivatives e.g.
- mephalen, chorambucil, mechlorethamine (nitrogen mustard) and thiotepa) steroids and combinations e.g., bethamethasone sodium phosphate
- others e.g., dicarbazine, asparaginase, mitotane, vincristine sulfate, vinblastine sulfate, and etoposide.
- antibodies of the invention are administered in combination with CHOP (cyclophosphamide, doxorubicin, vincristine, and prednisone) or any combination of the components of CHOP.
- CHOP cyclophosphamide, doxorubicin, vincristine, and prednisone
- antibodies of the invention are administered in combination with Rituximab.
- antibodies of the invention are administered with Rituxmab arid CHOP, or Rituxmab and any combination of the components of CHOP.
- the antibodies of the invention are administered in combination with cytokines.
- Cytokines that may be administered with the antibodies of the invention include, but are not limited to, TL2, JL3, UA, E 5, IL6, JL7, IL10, J 12, IL13, IL15, anti-CD40, CD40L, EFN-gamma and TNF-alpha.
- antibodies of the invention may be administered with any interleukin, including, but not limited to, E -lalpha, D -lbeta, E -2, D -3, IL-4, IL-5, ⁇ -6, D -7, IL-8, IL-9, DL-10, IX- 11, E -12, IL-13, E -14, IL-15, IL-16, IL-17, E -18, E -19, IL-20, and IL-21.
- interleukin including, but not limited to, E -lalpha, D -lbeta, E -2, D -3, IL-4, IL-5, ⁇ -6, D -7, IL-8, IL-9, DL-10, IX- 11, E -12, IL-13, E -14, IL-15, IL-16, IL-17, E -18, E -19, IL-20, and IL-21.
- the antibodies of the invention are administered in combination with angiogenic proteins.
- Angiogenic proteins that may be administered with the antibodies of the invention include, but are not limited to, Glioma Derived Growth Factor (GDGF), as disclosed in European Patent Number EP-399816; Platelet Derived Growth Factor-A (PDGF-A), as disclosed in European Patent Number EP-6821 10; Platelet Derived Growth Factor-B (PDGF-B), as disclosed in European Patent Number EP-282317; Placental Growth Factor (PIGF), as disclosed in International Publication Number WO 92/06194; Placental Growth Factor-2 (PIGF-2), as disclosed in Hauser et al., Gorwth Factors, 4:259-268 (1993); Vascular Endothelial Growth Factor (VEGF), as disclosed in International Publication Number WO 90/13649; Vascular Endothelial Growth Factor-A (VEGF-A), as disclosed in European Patent Number EP-506477; Vas
- the antibodies of the invention are administered in combination with hematopoietic growth factors.
- Hematopoietic growth factors that may be administered with the antibodies of the invention include, but are not limited to, LEUKTNE.TM. (SARGRAMOSTIMTM.) and NEUPOGEN.TM. (FE GRASTEV TM.).
- the antibodies of the invention are administered in combination with Fibroblast Growth Factors.
- Fibroblast Growth Factors that may be administered with the antibodies of the invention include, but are not limited to, FGF-1, FGF-2, FGF-3, FGF-4, FGF-5, FGF-6, FGF-7, FGF-8, FGF-9, FGF-10, FGF-11, FGF-12, FGF-13, FGF-14, and FGF- 15. EXAMPLE 1
- a line of continuously growing breast tumor cells that express the C35 tumor antigen was either inadiated with 300 Gy or left untreated. After continued in vitro culture for several days to allow apoptosis to develop, cells were harvested, washed and stained with 50 ng of 1F2 monoclonal anti-C35 antibody or a mouse IgG antibody control each conjugated to the fluorescent dye Alexa 647. Following 50 minutes incubation at 25C, cells were stained with Annexin V and propidium iodide (PI) using a standard commercial kit (Pharmingen). Cells were analyzed for staining with Annexin V, propidium iodide and Alexa 647 by flow cytometry employing standard protocols.
- PI propidium iodide
- a line of continuously growing breast tumor cells that express the C35 tumor antigen was either treated with 6ug/ml mitomycin C or left untreated. After continued in vitro culture for 48 hours to allow apoptosis to develop, cells were harvested, washed and stained with 50 ng of 1F2 monoclonal anti- C35 antibody or a mouse IgG antibody control each conjugated to the fluorescent dye Alexa 647. Following 50 minutes incubation at 25C, cells were stained with Annexin V and propidium iodide (PI) using a standard commercial kit (Pharmingen). Cells were analyzed for staining with Annexin V, propidium iodide and Alexa 647 by flow cytometry employing standard protocols.
- PI propidium iodide
- the polypeptide of the present invention can be expressed in a mammalian cell.
- a typical mammalian expression vector contains a promoter element, which mediates the initiation of transcription of mRNA, a protein coding sequence, and signals required for the termination of transcription and polyadenylation of the transcript. Additional elements include enhancers, Kozak sequences and intervening sequences flanked by donor and acceptor sites for RNA splicing. Highly efficient transcription is achieved with the early and late promoters from SV40, the long terminal repeats (LTRs) from Retroviruses, e.g., RSV, HTLVI, HF/I and the early promoter of the cytomegalovirus (CMV). However, cellular elements can also be used (e.g., the human actin promoter).
- Suitable expression vectors for use in practicing the present invention include, for example, vectors such as pSVL and pMSG (Pharmacia, Uppsala, Sweden), pRSVcat (ATCC 37152), pSV2dhfr (ATCC 37146), pBC12MI (ATCC 67109), pCMVSport 2.0, and pCMVSport 3.Q.
- Mammalian host cells that could be used include, human Hela, 293, H9 and Jurkat cells, mouse NIH3T3 and C127 cells, Cos 1, Cos 7 and CVl, quail QCl-3 cells, mouse L cells and Chinese hamster ovary (CHO) cells.
- the polypeptide can be expressed in stable cell lines containing the polynucleotide integrated into a chromosome.
- a selectable marker such as DHFR, gpt, neomycin, hygromycin allows the identification and isolation of the transfected cells.
- the transfected gene can also be amplified to express large amounts of the encoded protein.
- the DHFR (dihydrofolate reductase) marker is useful in developing cell lines that carry several hundred or even several thousand copies of the gene of interest. (See, e.g., Alt, F. W., et al., J. Biol. Chem. 253:1357-1370 (1978); Hamlin, J. L. and Ma, C, Biochem. et Biophys. Acta, 1097:107-143 (1990); Page, M. J. and Sydenham, M.
- Another useful selection marker is the enzyme glutamine synthase (GS) (Murphy et al, Biochem J. 227:277-279 (1991); Bebbington et al., Bio/Technology 10:169-175 (1992).
- GS glutamine synthase
- the mammalian cells are grown in selective medium and the cells with the highest resistance are selected.
- These cell lines contain the amplified gene(s) integrated into a chromosome.
- Chinese hamster ovary (CHO) and NSO cells are often used for the production of proteins.
- Derivatives of the plasmid pSV2-dhfr (ATCC Accession No. 37146), the expression vectors ⁇ C4 (ATCC Accession No. 209646) and ⁇ C6 (ATCC Accession No.209647) contain the strong promoter (LTR) of the Rous Sarcoma Virus (Cullen et al., Molecular and Cellular Biology, 438-447 (March, 1985)) plus a fragment of the CMV-enhancer (Boshart et al., Cell 41:521-530 (1985).) Multiple cloning sites, e.g., with the restriction enzyme cleavage sites BamHI, Xbal and Asp718, facilitate the cloning of the gene of interest.
- the vectors also contain the 3' nitron, the polyadenylation and termination signal of the rat preproinsulin gene, and the mouse DHFR gene under control of the SV40 early promoter.
- the plasmid pC6, for example, is digested with appropriate restriction enzymes and then dephosphorylated using calf intestinal phosphates by procedures known in the art.
- the vector is then isolated from a 1% agarose gel.
- a polynucleotide of the present invention is amplified according to protocols known in the art. If a naturally occurring signal sequence is used to produce the polypeptide of the present invention, the vector does not need a second signal peptide. Alternatively, if a naturally occurring signal sequence is not used, the vector can be modified to include a heterologous signal sequence. (See, e.g., WO 96/34891.)
- the amplified fragment is isolated from a 1% agarose gel using a commercially available kit ("Geneclean,” BIO 101 Inc., La Jolla, Calif). The fragment then is digested with appropriate restriction enzymes and again purified on a 1% agarose gel.
- the amplified fragment is then digested with the same restriction enzyme and purified on a 1% agarose gel.
- the isolated fragment and the dephosphorylated vector are then ligated with T4 DNA ligase.
- E. coli HB101 or XL-1 Blue cells are then transformed and bacteria are identified that contain the fragment inserted into plasmid pC6 using, for instance, restriction enzyme analysis.
- Chinese hamster ovary cells lacking an active DHFR gene is used for transfection.
- Five .mu.g of the expression plasmid pC6 or pC4 is cotransfected with 0.5 .mu.g of the plasmid pSVneo using lipofectin (Feigner et al., supra).
- the plasmid pSV2-neo contains a dominant selectable marker, the neo gene from Tn5 encoding an enzyme that confers resistance to a group of antibiotics including G418.
- the cells are seeded in alpha minus MEM supplemented with 1 mg/ml G418.
- the cells are trypsinized and seeded in hybridoma cloning plates (Greiner, Germany) in alpha minus MEM supplemented with 10, 25, or 50 ng/ml of metothrexate plus 1 mg/ml G418. After about 10-14 days single clones are trypsinized and then seeded in 6-well petri dishes or 10 ml flasks using different concentrations of methotrexate (50 nM, 100 nM, 200 nM, 400 nM, 800 nM).
- methotrexate 50 nM, 100 nM, 200 nM, 400 nM, 800 nM.
- Clones growing at the highest concentrations of methotrexate are then transfened to new 6-well plates containing even higher concentrations of methotrexate (1 uM, 2 uM, 5 uM, 10 mM, 20 mM). The same procedure is repeated until clones are obtained which grow at a concentration of 100-200 uM. Expression of the desired gene product is analyzed, for instance, by SDS-PAGE and Western blot or by reversed phase HPLC analysis.
- RADIOLABELED C35-SPECIFIC ANTIBODIES CONCENTRATE IN NECROTIC REGIONS OF VIABLE TUMORS EXPRESSING C35 BALB/c mice were engrafted on opposite flanks with syngeneic non- small cell lung cancer derived Line 1 tumor cells that either had or had not been transfected with human C35. C35 protein expression was confirmed by immunohistochemical staining with anti-C35 antibodies. After 14 days in vivo growth, animals received intravenous injection of I-labeled anti-C35 antibody. Animals were sacrificed 120 hrs after injection of radiolabeled antibodies and the concentration of anti-C35 antibodies in C35-positive and C35-negative tumors was determined by exposure of a tumor section to film.
- the radiolabeled antibody (or antibody fragment) compositions which include both the dosimetric radiolabeled antibody and the therapeutic radiolabeled antibody, are administered intravenously or intraarterially in the form of an injection.
- the injectable radiolabeled antibody compositions will be infused into a vein or artery over the course of 5 minutes to about 60 minutes, preferably from 15 minutes to 30 minutes. Where the tumor is supplied by a known artery, intraarterial administration is prefened for the therapeutic radiolabeled antibody compositions.
- Both the dosimetric radiolabeled antibody and the therapeutic radiolabeled antibody will be administered as sterile aqueous solutions typically in physiologic phosphate- buffered saline or other vehicle suitable for parenteral injection.
- the initial dosimetric radiolabeled antibody dose will be approximately 5-100mg of antibody which will deliver approximately 5-50mCi radiation.
- the therapeutic radiolabeled antibody will be administered at a dose of approximately 10-500 mg which will deliver as much as 300 mCi radiation for each therapeutic dose. This dosimetric/therapeutic regimen may be repeated. See also, US 5,057,313 and US 5,120,525.
- the immunoglobulin heavy and light chain variable regions were cloned into the TOPO vector (Invitrogen) by PCR amplification of the V region and TA cloning into the TOPO vector.
- This ligation system does not require restriction enzyme digestion (although the TOPO vector does inco ⁇ orate EcoRI sites to allow subsequent excision of inserts).
- TA cloning takes advantage of naturally added 3' A overhangs in the PCR amplification product of Taq polymerase which can then pair with 5' T overhangs in the linearized vector provided in the TOPO cloning kit (Invitrogen).
- variable region genes for insertion into TOPO, we employed a downstream primer complementary to the 5' end of the constant region sequence (different for heavy and liglit chains and for mouse and human) and a known fixed primer sequence added at the 5' end of the variable region by 5' RACE using the Invitrogen GeneRacer kit. These methods are well known to those skilled in the art.
- the expression cassettes from Notl to Sail, were excised from these vaccinia transfer plasmids and cloned into the pCMV-Script vector (whose Xhol site in the vector multiple cloning site was destroyed by fill-in and blunt end ligation), resulting in the generation of pCMV-VH, pCMV-VK and pCMV-VL vectors.
- These expression cassettes contain the signal peptide, cloning sites for the V genes and the constant regions from the membrane- bound ⁇ heavy chain and the K light chain genes.
- the cassette contains the signal peptide from amino acid position -19 relative to the start codon [aa(-19)] to aa(-3), followed by aa(109 to 113) of the VH genes and the whole heavy chain constant region.
- the selected VH genes, from aa(-4) to aa(ll ⁇ ) can be cloned into pCMV-VH at BssHfl [aa(-4 to -3)] and BstEII [aa(109-110)] sites.
- the cassette contains the signal peptide from aa(-19) to aa(-2), followed by aa(104 to 107) of the VK genes and the whole kappa chain constant region.
- the selected VK genes, from aa(-3) to aa(105) can be cloned into pCMV-VK at ApaLI [aa(-3 to -2)] and Xhol [aa(104-105)] sites.
- the cassette contains the signal peptide from aa(-19) to aa(-2), followed by aa(103 to 107) of the VL genes and the whole kappa chain constant region.
- the selected VL genes, from aa(-3) to aa(104) can be cloned into pCMV-VL at ApaLI [aa(-3 to -2)] and Hindlfl [aa(103- 104)] sites.
- the resulting lambda light chain will exhibit the V ⁇ Q chimeric structure.
- the constant region of IgGl was cloned from B cells or bone manow cells by RT- PCR.
- the primer set used was: 5' forward primer: 5'-ATTAGGATCCGGTCACCGTCTCCTCAGCC-3' (SEQ ID NO:15) 3' reverse primer: 5'-ATTAGTCGACTCATTTACCCGGAGACAGGGA-3' (SEQ ID NO:16)
- the resulting PCR product exhibits the following structure: BaniHI- BstE ⁇ (aal09-110)-(aalll-113)-C ⁇ 1 -TGA-SalI.
- the PCR product was subcloned into pBluescriptH/KS at BamHI and Sail sites to carry out site directed mutagenesis employing standard protocols to remove the internal BstEII located at the CHI region via silent mutation.
- the resulting C ⁇ i was then subcloned into pCMV-VH at BstEII and Sail to generate pCMV-C ⁇ i to direct the expression of secreted IgGl heavy chain, once a VH gene is subcloned into this vector at BssHD/BstEiI.
- Gtctccgggtaaatgagtcgac (SEQIDNO:17) The sequence of human light chain leader and kappa constant region cassette for insertion ofVK genes follows. Not 1 Ncol gcggccgcaaaccatgggatggagctgtatcatcctcttcttggtagcaacagctacag ApaLI Xhol gcgtgcacttgactcgagatcaaacgaactgtggctgcaccatctgtcttcatcttcccgcca tctgatgagcagttgaaatctggaactgcctctgttgtgtgcctgctgaataacttctatcccc agagaggccaaagtacagtggaaggtggataacgccctccaatcgggtaactcccaggagagt gtcacaga
- IgG2-F 5'-ATTAGGATCCGGTCACCGTCTCCTCAGCC-3' (SEQ ID NO:20)
- IgG2-R 5'-ATTAGTCGACTCATTTACCCGGAGACAGGGA-3' (SEQ ID NO:21)
- IgG3-F 5'-ATTAGGATCCGGTCACCGTCTCCTCAGCT-3' (SEQ ID NO:22)
- IgG3-R 5'-ATTAGTCGACTCATTTACCCGGAGACAGGGA-3'
- IgG4-F 5'-ATTAGGATCCGGTCACCGTCTCCTCAGCT-3' (SEQ ID NO:24)
- IgG4-R 5'-ATTAGTCGACTCATTTACCCAGAGACAGGGA-3'
- Step 1 Generation of V-gene fragments.
- A. Human v-genes MMH1 1. Digest MMH1 plasmid DNA (clone H0009) with BssHfl (GCGCGC(SEQ ID NO:36)) and Bstefl (GGTCACC (SEQ ID NO:37)) using standard protocols. 2. Resolve DNA on agarose gel using standard protocols. 3. Excise 357 bp fragment from gel and isolate DNA using standard protocols.
- MMK1 1. Digest MMK1 plasmid DNA (clone LOOlO) with ApaLI (GTGCAC(SEQ ID NO:38)) and Xhol (CTCGAG (SEQ ID NO:39)) using standard protocols. 2. Resolve DNA on agarose gel using standard protocols. 3. Excise 343 bp fragment from gel and isolate DNA using standard protocols.
- Mouse hybridoma v-genes 1F2 VK 1.
- the mouse hybridoma v-gene must be PCR amplified from the ATCC deposited clone 1F2K using the following primers. This is necessary to create a chimeric antibody of the mouse v-gene with human constant region in the human kappa light chain constant region expression cassette.
- 1F2VK forward primer 5' - tatccgtgcactccCAAATTGTTCTCACCCAGTCTCCAG - 3' (SEQ ID NO:40)
- 1F2VK reverse primer 5' - atattctcgAGCTTGGTCCCCCCTCCGAA - 3' (SEQ ID NO:41)
- (Lowercase non-homologous to mouse 1F2 VK sequence, includes restriction site.
- CAPITALS homologous to mouse 1F2 VK sequence) 2.
- 1F2VH forward primer 5' - tataagcgcgcactccGATGTACAGCTTCAGGAGTCAGGAC (SEQ ID NO:44)
- 1F2VH reverse primer 5'-atattgGTGACCAGAGTCCCTTGGCCCC-3* (SEQ ID NO:45)
- 1B3VK forward primer 5' - tatccgtgcactccGATGTCCAGATAACCCAGTCTCCATC - 3' (SEQ ID NO:46)
- 1B3VH forward primer 5'- tataagcgcgcactccGAGGTGCAGCTTCAGGAGTCAGGAC - 3' (SEQ ID NO:48)
- 1B3VH reverse primer 5' -atattGGTGACCGTGGTCCCAGCG -3 ' (SEQ ID NO:49)
- (Lowercase non-homologous, contains restriction sites.
- CAPITALS homologous
- 4. Excise gel slice containing 366 bp digested DNA fragment and isolate DNA using standard protocols.
- Step 2 Assembly of expression constructs 1. Digest pCMV-VH and pCMV-VK expression vectors with the appropriate enzymes using standard protocols: a. pCMV-VH - Bstefl and BssHII b. pCMV-VK- ApaLI and Xho I 2. Resolve DNA on agarose gel and excise linearized vector using standard protocols. 3. Isolate DNA from gel slice using standard protocols. 4. Ligate light chain v-genes into pCMV-VK and heavy chain v- genes into pCMV-VH using standard protocols. 5. Transform ligated DNA into competent cells and isolate plasmid DNA using standard protocols.
- H. sapiens G2 gene for immunoglobulin constant region (IgG2 (n+) allotype) (GenBank No. Z49801) (SEQ ID NO:51) 1 tcttctctct gcagagcgca aatgttgtgt cgagtgccca ccgtgcccag gtaagccagc 61 ccaggcctcg ccctccagct caaggcggga caggtgccct agagtagcct gcatccaggg 121 acaggcccca gctgggtgct gacacgtcca cctccatctctcagca ccacctgtgg 181 caggaccgtc agtcttcctc tcccccaa aacccaagga caccctcatg atctccgga 241
- Homo sapiens CH gene encoding immunoglobulin, constant region, heavy chain, al ⁇ ha-2 subunit (GenBank No. AJ012264) (SEQ JD NO:52) 1 ctcgaggacc tgctcttagg ttcagaagcg aacctcacgt gcacactgac cggcctgaga 61 gatgcctctg gtgccacctt cacctggacg ccctcaagtg ggaagagcgc tgtcaagga 121 ccacctgagc gtgacctctg tggctgctac agcgtgtcca gtgtcctgcc tggctgtgcc 181 cagccatgga accatgggga gaccttcacc tgcactgctg ccaccccgg
- CAC20453.1) (SEQ ID NO:55) ASLTSPKVFPLSLCSTQPDGNWIACLVQGFFPQEPLSVTWSESGQGVT ARNFPPSQDASGDLYTTSSQLTLPATQCLAGKSVTCHVKHYTNPSQDV
- TDD Tumor Doubling Delay
- TVDT Tumor Volume Doubling Time of Control ⁇ during exponential growth phase ⁇
- T-C difference in time for treated (T) and control (C) tumors to reach a given volume (1200 mm 3 )
- FIG. 7 shows that C35 expression was very similar in tumors such as 21MT1 that naturally express C35, and in C35 -transduced tumors such as Colau.C35 and MDA231.C35.
- Cells were stained with Alexa-647 conjugated anti-C35 MAb 1F2 or isotype control.
- MFI X is the ratio of the mean fluorescence intensity of lF2/mean fluorescence intensity of isotype control.
- H16N2 derived from normal breast epithelium, and MDAMB231, a breast tumor, and Colau, a colon tumor, express low basal levels of C35.
- 21MT1 derived from breast carcinoma, naturally expresses high levels of C35.
- Colau and MDA231 were transduced with empty vector (null) or human C35 recombinant vector. All tumors were grown in vivo, tumors were excised, dissociated and stained.
- MTD MAXIMUM TOLERATED DOSE
- a CHEMOTHERAPEUTIC AGENT Because of concerns regarding cumulative dose-limiting bone manow toxicity when combining chemotherapy and radioimmunotherapy, it is necessary to detennine the Maximum Tolerated Dose (MTD) of combination therapy and, where toxicity of the two therapeutic agents is additive, adopt strategies that will permit administration of both toxic agents. MTD is established by regulatory criteria related to the time required for platelet and white cell recovery in peripheral circulation. Such standards are familiar to those skilled in the art. hi the case of murine models, an often employed sunogate definition of MTD is the maximum dose that results in an average of less than 20 % weight loss or less than 10% mortality. Cunently established MTD for the most common chemotherapeutic agents employed in standard clinical protocols or in animal models are shown in Tables 6 to 9, below.
- TBD To be determined MTD confirmed by present inventors. Maximum Tolerated Dose is defined as > 20% average weight loss and/or > 10% lethality.
- Non-toxic dose at indicated schedule. 3.
- Effective strategies to reduce the combined MTD of treatment with chemotherapy and radioimmunotherapy include: reducing the dose of chemotherapeutic agent administered to a level which does not result in additive toxicity when administered in conjunction with radioimmunotherapy at its MTD. (see Example 10A, below); selecting a chemotherapeutic agent that does not contribute additive toxicity when employed in combination with radioimmunotherapy. (see Example 10B, below); and reducing the bone manow toxicity of the radioimmunotherapeutic agent (see Example 10C, below).
- Chemotherapeutic agent does not contribute to additive toxicity.
- An alternative strategy is to reduce the bone manow toxicity of the radioimmunotherapeutic by biochemical modifications that result in accelerated clearance of radiolabeled antibody from peripheral circulation.
- Appropriate modifications include use of different antibody isotypes such as IgG3, IgA, IgD or IgE as indicated in Table 10 or deletion of the CH2 domain of IgG, which is responsible for its extended serum half life (See Mueller BM, RA Reisfeld, and SD Gillies, Proc. Natl Acad. Sci. USA 87:5702-5705 (1990); Slavin-Chiorini DC, et al, Int. J. Cancer 53:97-103 (1993)).
- rhC35 recombinant human C35 synthesized with a 6x His tag in E. coli was digested with Lys-C endoproteinase. This enzyme cuts after lysine (K) residues in the protein sequence.
- Figure 9 shows the expected peptide fragments following complete digestion of rhC35 with Lys-C. The full sequence of rhC35, including the amino terminal 6x His tag addition is shown. Amino acid positions are numbered relative to the amino terminal methionine (M) of the native human sequence. Note that digestion at the first and third lysine followed by negatively charged residues is inefficient and some longer combination fragments may be generated.
- Lys-C endoproteinase was added to purified rhC35 at a 50:1 weight ratio and incubated for 18 hours at 37°C in 25mM Tris, pH 8.0.
- the digest was ethanol precipitated and resolubilized in reducing Tricine sample buffer. After heating 5 minutes at 100°C, samples were separated by electrophoresis on a 16% Tricine gel (Invitrogen).
- Peptides were transfened to PVDF membranes and the blots depicted in Figure 10 were either stained with Coomassie blue (lanes 1-3 of both left and right panels) to detect all peptides or processed with one of the following: 1 ⁇ g/ml of the murine 1F2 anti-C35 antibody followed by alkaline phosphatase conjugated goat anti-mouse antibody (lane 4 of left panel); 1 ⁇ g/ml of the 1B3 anti-C35 immunoglobulin variable regions linked to human constant regions (MAb 11) followed by alkaline phosphatase conjugated goat anti-human antibody (lane 5 of left panel); or anti-6x His tag mouse antibody (Amersham) followed by alkaline phosphatase conjugated goat anti-mouse antibody (lane 4 and 5 of right panel).
- 1 ⁇ g/ml of the murine 1F2 anti-C35 antibody followed by alkaline phosphatase conjugated goat anti-mouse antibody
- BCIP/NBT substrate was added and developed to detect the secondary reagents. Molecular weight markers are indicated in the flanking lanes of both panels. hi Figure 10, the indicated band A migrates at the position of undigested rhC35. Note that band B stains with 1F2 but not MAb 11 (1B3) anti-C35 antibody while band C stains with neither 1F2 nor MAbll (1B3) antibody. Since bands B and C both do stain with anti-6x His tag antibody to the 6x His tag at the amino terminus of rhC35, it may be concluded that both fragments lack C-terminal peptide fragments.
- MAb 165 comprises the 141D10 VH H732 heavy chain variable region (SEQ ID NOS: 56 and 57), and the UH8 VK L120 kappa light chain variable region (SEQ ID NOS: 58 and 59). As shown in Figure 11, MAb 165 is C35- specific. 141D10 recombinant vaccinia virus was co-infected into HeLa cells with UH8 recombinant vaccinia virus. The resulting secreted antibody was tested for binding to C35 or control protein A27L (vaccinia virus protein) by ELISA.
- MAb 171 comprises the MSH3 VH H835 heavy chain variable region (SEQ ID NOS:60 and 61) and the UH8 VK L120 kappa light chain variable region (SEQ ID NOS: 58 and 59).
- Plates were blocked with "blocking buffer” (PBS, pH7.2 and 10% FBS) at room temperature for 2 hours, followed by washing each plate 3 times on plate washer.
- the primary antibody, rabbit anti-human C35 polyclonal antibody (made by Bethyl, 62902 batch) was diluted into "assay diluent" (PBS, pH7.2 plus 0.05% Tween 20 and 10% FBS) and added to the plates, 100 ⁇ l/well. Plates were incubated at room temperature for 2 hours. For 14 ⁇ g/ml peptide coated plates, 100 ng/ml of primary antibody was added. For 40 ⁇ g/ml peptide coated plates, 1 ⁇ g/ml of primary antibody was added. Plates were washed 5 times on a plate washer.
- blocking buffer PBS, pH7.2 and 10% FBS
- HRP horseradish peroxidase conjugated goat anti- rabbit Fc polyclonal antibody from Zymed
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Organic Chemistry (AREA)
- Immunology (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Molecular Biology (AREA)
- Cell Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Genetics & Genomics (AREA)
- Biophysics (AREA)
- Biochemistry (AREA)
- Veterinary Medicine (AREA)
- General Chemical & Material Sciences (AREA)
- Pharmacology & Pharmacy (AREA)
- Public Health (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Animal Behavior & Ethology (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Peptides Or Proteins (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
Priority Applications (8)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| NZ547591A NZ547591A (en) | 2003-12-04 | 2004-12-06 | Methods of killing tumor cells by targeting internal antigens exposed on apoptotic tumor cells |
| JP2006542802A JP5042631B2 (ja) | 2003-12-04 | 2004-12-06 | アポトーシス腫瘍細胞上に露出した細胞内抗原をターゲッティングすることによって腫瘍細胞を死滅させる方法 |
| CN2004800413850A CN1913921B (zh) | 2003-12-04 | 2004-12-06 | 通过靶定暴露在细胞凋亡肿瘤细胞上的内部抗原杀死肿瘤细胞的方法 |
| EP04812982A EP1708751B1 (en) | 2003-12-04 | 2004-12-06 | Methods of killing tumor cells by targeting internal antigens exposed on apoptotic tumor cells |
| AU2004296184A AU2004296184B2 (en) | 2003-12-04 | 2004-12-06 | Methods of killing tumor cells by targeting internal antigens exposed on apoptotic tumor cells |
| CA2548180A CA2548180C (en) | 2003-12-04 | 2004-12-06 | Methods of killing tumor cells by targeting internal antigens exposed on apoptotic tumor cells |
| AT04812982T ATE526037T1 (de) | 2003-12-04 | 2004-12-06 | Verfahren zum abtöten von tumorzellen mittels targeting von auf apoptotischen tumorzellen exponierten internen antigenen |
| IL176007A IL176007A (en) | 2003-12-04 | 2006-05-30 | Antibodies specific to c35 and pharmaceutical compositions containing the same |
Applications Claiming Priority (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US52657203P | 2003-12-04 | 2003-12-04 | |
| US60/526,572 | 2003-12-04 | ||
| US53168803P | 2003-12-23 | 2003-12-23 | |
| US60/531,688 | 2003-12-23 |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2005055936A2 true WO2005055936A2 (en) | 2005-06-23 |
| WO2005055936A3 WO2005055936A3 (en) | 2005-11-03 |
Family
ID=34681506
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2004/040573 Ceased WO2005055936A2 (en) | 2003-12-04 | 2004-12-06 | Methods of killing tumor cells by targeting internal antigens exposed on apoptotic tumor cells |
Country Status (10)
| Country | Link |
|---|---|
| US (2) | US20050158323A1 (https=) |
| EP (1) | EP1708751B1 (https=) |
| JP (1) | JP5042631B2 (https=) |
| CN (1) | CN1913921B (https=) |
| AT (1) | ATE526037T1 (https=) |
| AU (1) | AU2004296184B2 (https=) |
| CA (1) | CA2548180C (https=) |
| IL (1) | IL176007A (https=) |
| NZ (1) | NZ547591A (https=) |
| WO (1) | WO2005055936A2 (https=) |
Cited By (8)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP2029172A4 (en) * | 2006-06-22 | 2010-07-28 | Vaccinex Inc | Anti-c35 antibodies for treating cancer |
| KR20100095017A (ko) * | 2007-12-26 | 2010-08-27 | 백시넥스 인코포레이티드 | 항-c35 항체 병용 치료 및 방법 |
| US10526414B2 (en) | 2013-06-25 | 2020-01-07 | Vaccinex, Inc. | Use of anti-semaphorin-4D antibodies in combination with an immune modulating therapy to inhibit tumor growth and metastases |
| US10550199B2 (en) | 2016-04-22 | 2020-02-04 | Vaccinex, Inc. | Integral membrane protein display on poxvirus extracellular enveloped virions |
| US10640765B2 (en) | 2016-08-02 | 2020-05-05 | Vaccinex, Inc. | Methods for producing polynucleotide libraries in vaccinia virus/eukaryotic cells |
| US10662422B2 (en) | 2012-04-26 | 2020-05-26 | Vaccinex, Inc. | Method for selecting polynucleotides encoding antigen-specific immunoglobulin subunit |
| US11274149B2 (en) | 2009-05-08 | 2022-03-15 | Vaccinex, Inc. | Anti-CD100 antibodies and methods for using the same |
| US11534488B2 (en) | 2011-10-11 | 2022-12-27 | Vaccinex, Inc. | Use of semaphorin-4D binding molecules for modulation of blood brain barrier permeability |
Families Citing this family (17)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP1272636B8 (en) * | 2000-04-04 | 2008-10-08 | University Of Rochester | A gene differentially expressed in breast and bladder cancer and encoded polypeptides |
| AU2003274463B2 (en) | 2002-06-10 | 2009-10-29 | University Of Rochester | Gene differentially expressed in breast and bladder cancer and encoded polypeptides |
| AU2004296184B2 (en) * | 2003-12-04 | 2010-12-16 | Vaccinex, Inc. | Methods of killing tumor cells by targeting internal antigens exposed on apoptotic tumor cells |
| WO2006068794A2 (en) * | 2004-11-22 | 2006-06-29 | New York University | Genetically engineered clostridial genes, proteins encoded by the engineered genes, and uses thereof |
| KR20080068004A (ko) * | 2005-08-15 | 2008-07-22 | 아라나 테라퓨틱스 리미티드 | 뉴 월드 영장류 구조형성영역을 가진 조작 항체 |
| EP2081585A2 (en) * | 2006-10-13 | 2009-07-29 | The Regents of the University of California | Cancer treatment |
| WO2008073578A2 (en) | 2006-12-08 | 2008-06-19 | Iowa State University Research Foundation, Inc. | Plant genes involved in nitrate uptake and metabolism |
| US9422234B2 (en) * | 2007-11-30 | 2016-08-23 | The Johns Hopkins University | Prostate specific membrane antigen (PSMA) targeted nanoparticles for therapy of prostate cancer |
| AU2010300380B2 (en) * | 2009-10-02 | 2016-06-09 | University Of Iowa Research Foundation | Methods of improving vaccine immunogenicity |
| EP2528941A4 (en) * | 2010-01-25 | 2013-05-29 | Univ New York | FOR TRANSPORT STUDIES AND NEURONAL ADMINISTRATION, MANIPULATED RECOMBINANT DERIVATIVES FROM BOTULINUM NEUROTOXINES |
| US10059746B2 (en) | 2011-04-04 | 2018-08-28 | University Of Iowa Research Foundation | Methods of improving vaccine immunogenicity |
| MX393973B (es) | 2011-05-08 | 2025-03-24 | Legochem Biosciences Inc | Conjugados de proteína-agente activo y método para su preparación. |
| WO2014069682A1 (ko) * | 2012-10-29 | 2014-05-08 | 인제대학교 산학협력단 | 암 표적 항체 및 이를 포함하는 암 예방 또는 치료용 조성물 |
| WO2014069681A1 (ko) * | 2012-10-29 | 2014-05-08 | 인제대학교 산학협력단 | 암 표적 항체 및 이를 포함하는 암 예방 또는 치료용 조성물 |
| US11897921B2 (en) | 2014-12-09 | 2024-02-13 | New York University | Propeptide fusion comprising a mutated clostridium botulinum neurotoxin and a VHH domain |
| CA2998611A1 (en) * | 2015-09-14 | 2017-03-23 | Leukemia Therapeutics, LLC | Identification of novel diagnostics and therapeutics by modulating rhoh |
| US10994033B2 (en) * | 2016-06-01 | 2021-05-04 | Bristol-Myers Squibb Company | Imaging methods using 18F-radiolabeled biologics |
Family Cites Families (74)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4444887A (en) * | 1979-12-10 | 1984-04-24 | Sloan-Kettering Institute | Process for making human antibody producing B-lymphocytes |
| JPS57154232A (en) * | 1981-02-18 | 1982-09-24 | Konishiroku Photo Ind Co Ltd | Photosensitive silver halide emulsion |
| US4474893A (en) * | 1981-07-01 | 1984-10-02 | The University of Texas System Cancer Center | Recombinant monoclonal antibodies |
| US4714681A (en) * | 1981-07-01 | 1987-12-22 | The Board Of Reagents, The University Of Texas System Cancer Center | Quadroma cells and trioma cells and methods for the production of same |
| US4647447A (en) * | 1981-07-24 | 1987-03-03 | Schering Aktiengesellschaft | Diagnostic media |
| US4716111A (en) * | 1982-08-11 | 1987-12-29 | Trustees Of Boston University | Process for producing human antibodies |
| US4741900A (en) * | 1982-11-16 | 1988-05-03 | Cytogen Corporation | Antibody-metal ion complexes |
| US4816567A (en) * | 1983-04-08 | 1989-03-28 | Genentech, Inc. | Recombinant immunoglobin preparations |
| US5807715A (en) * | 1984-08-27 | 1998-09-15 | The Board Of Trustees Of The Leland Stanford Junior University | Methods and transformed mammalian lymphocyte cells for producing functional antigen-binding protein including chimeric immunoglobulin |
| US4687659A (en) * | 1984-11-13 | 1987-08-18 | Salutar, Inc. | Diamide-DTPA-paramagnetic contrast agents for MR imaging |
| US4676980A (en) * | 1985-09-23 | 1987-06-30 | The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services | Target specific cross-linked heteroantibodies |
| US4885363A (en) * | 1987-04-24 | 1989-12-05 | E. R. Squibb & Sons, Inc. | 1-substituted-1,4,7-triscarboxymethyl-1,4,7,10-tetraazacyclododecane and analogs |
| US5057313A (en) * | 1986-02-25 | 1991-10-15 | The Center For Molecular Medicine And Immunology | Diagnostic and therapeutic antibody conjugates |
| US5225539A (en) * | 1986-03-27 | 1993-07-06 | Medical Research Council | Recombinant altered antibodies and methods of making altered antibodies |
| US4946778A (en) * | 1987-09-21 | 1990-08-07 | Genex Corporation | Single polypeptide chain binding molecules |
| US5019368A (en) * | 1989-02-23 | 1991-05-28 | Cancer Biologics, Inc. | Detection of necrotic malignant tissue and associated therapy |
| US5258498A (en) * | 1987-05-21 | 1993-11-02 | Creative Biomolecules, Inc. | Polypeptide linkers for production of biosynthetic proteins |
| US5489425A (en) * | 1987-06-24 | 1996-02-06 | The Dow Chemical Company | Functionalized polyamine chelants |
| US4994560A (en) * | 1987-06-24 | 1991-02-19 | The Dow Chemical Company | Functionalized polyamine chelants and radioactive rhodium complexes thereof for conjugation to antibodies |
| JP3040121B2 (ja) * | 1988-01-12 | 2000-05-08 | ジェネンテク,インコーポレイテッド | 増殖因子レセプターの機能を阻害することにより腫瘍細胞を処置する方法 |
| US5120525A (en) * | 1988-03-29 | 1992-06-09 | Immunomedics, Inc. | Radiolabeled antibody cytotoxic therapy of cancer |
| US5756065A (en) * | 1988-06-24 | 1998-05-26 | The Dow Chemical Company | Macrocyclic tetraazacyclododecane conjugates and their use as diagnostic and therapeutic agents |
| ZA894792B (en) * | 1988-06-24 | 1991-04-24 | Dow Chemical Co | Macrocyclic bifunctional chelants,complexes thereof and their antibody conjugates |
| CA1341373C (en) * | 1988-06-24 | 2002-07-02 | Roberta C. Cheng | Macrocyclic bifunctional chelants, complexes thereof and their antibody conjugates |
| US5274119A (en) * | 1988-07-01 | 1993-12-28 | The Dow Chemical Company | Vicinal diols |
| US4925648A (en) * | 1988-07-29 | 1990-05-15 | Immunomedics, Inc. | Detection and treatment of infectious and inflammatory lesions |
| US5601819A (en) * | 1988-08-11 | 1997-02-11 | The General Hospital Corporation | Bispecific antibodies for selective immune regulation and for selective immune cell binding |
| US5223409A (en) * | 1988-09-02 | 1993-06-29 | Protein Engineering Corp. | Directed evolution of novel binding proteins |
| US5342604A (en) * | 1988-10-31 | 1994-08-30 | The Dow Chemical Company | Complexes possessing ortho ligating functionality |
| US5696239A (en) * | 1988-10-31 | 1997-12-09 | The Dow Chemical Company | Conjugates possessing ortho ligating functionality and complexes thereof |
| US5530101A (en) * | 1988-12-28 | 1996-06-25 | Protein Design Labs, Inc. | Humanized immunoglobulins |
| US5766883A (en) * | 1989-04-29 | 1998-06-16 | Delta Biotechnology Limited | Polypeptides |
| US5808003A (en) * | 1989-05-26 | 1998-09-15 | Perimmune Holdings, Inc. | Polyaminocarboxylate chelators |
| US5413923A (en) * | 1989-07-25 | 1995-05-09 | Cell Genesys, Inc. | Homologous recombination for universal donor cells and chimeric mammalian hosts |
| US5780225A (en) * | 1990-01-12 | 1998-07-14 | Stratagene | Method for generating libaries of antibody genes comprising amplification of diverse antibody DNAs and methods for using these libraries for the production of diverse antigen combining molecules |
| DE69120146T2 (de) * | 1990-01-12 | 1996-12-12 | Cell Genesys Inc | Erzeugung xenogener antikörper |
| US5314995A (en) * | 1990-01-22 | 1994-05-24 | Oncogen | Therapeutic interleukin-2-antibody based fusion proteins |
| US5427908A (en) * | 1990-05-01 | 1995-06-27 | Affymax Technologies N.V. | Recombinant library screening methods |
| GB9015198D0 (en) * | 1990-07-10 | 1990-08-29 | Brien Caroline J O | Binding substance |
| US5545806A (en) * | 1990-08-29 | 1996-08-13 | Genpharm International, Inc. | Ransgenic non-human animals for producing heterologous antibodies |
| US5814318A (en) * | 1990-08-29 | 1998-09-29 | Genpharm International Inc. | Transgenic non-human animals for producing heterologous antibodies |
| ATE158021T1 (de) * | 1990-08-29 | 1997-09-15 | Genpharm Int | Produktion und nützung nicht-menschliche transgentiere zur produktion heterologe antikörper |
| US5661016A (en) * | 1990-08-29 | 1997-08-26 | Genpharm International Inc. | Transgenic non-human animals capable of producing heterologous antibodies of various isotypes |
| US5698426A (en) * | 1990-09-28 | 1997-12-16 | Ixsys, Incorporated | Surface expression libraries of heteromeric receptors |
| US5367080A (en) * | 1990-11-08 | 1994-11-22 | Sterling Winthrop Inc. | Complexing agents and targeting radioactive immunoreagents useful in therapeutic and diagnostic imaging compositions and methods |
| CA2095633C (en) * | 1990-12-03 | 2003-02-04 | Lisa J. Garrard | Enrichment method for variant proteins with altered binding properties |
| ATE414768T1 (de) * | 1991-04-10 | 2008-12-15 | Scripps Research Inst | Bibliotheken heterodimerer rezeptoren mittels phagemiden |
| CA2108451A1 (en) * | 1991-04-26 | 1992-10-27 | Beverley J. Randle | Novel antibodies, and methods for their use |
| US5625425A (en) * | 1991-08-28 | 1997-04-29 | Kranhouse; Jon | Diving mask with lenses and method of fabricating the same |
| US5565332A (en) * | 1991-09-23 | 1996-10-15 | Medical Research Council | Production of chimeric antibodies - a combinatorial approach |
| PT1024191E (pt) * | 1991-12-02 | 2008-12-22 | Medical Res Council | Produção de auto-anticorpos a partir de reportórios de segmentos de anticorpo e exibidos em fagos |
| US5428139A (en) * | 1991-12-10 | 1995-06-27 | The Dow Chemical Company | Bicyclopolyazamacrocyclophosphonic acid complexes for use as radiopharmaceuticals |
| FR2686899B1 (fr) * | 1992-01-31 | 1995-09-01 | Rhone Poulenc Rorer Sa | Nouveaux polypeptides biologiquement actifs, leur preparation et compositions pharmaceutiques les contenant. |
| US5733743A (en) * | 1992-03-24 | 1998-03-31 | Cambridge Antibody Technology Limited | Methods for producing members of specific binding pairs |
| US5505931A (en) * | 1993-03-04 | 1996-04-09 | The Dow Chemical Company | Acid cleavable compounds, their preparation and use as bifunctional acid-labile crosslinking agents |
| CA2141602A1 (en) * | 1992-08-26 | 1994-03-03 | Philip Leder | Use of the cytokine ip-10 as an anti-tumor agent |
| ES2156149T3 (es) * | 1992-12-04 | 2001-06-16 | Medical Res Council | Proteinas de union multivalente y multiespecificas, su fabricacion y su uso. |
| US5441050A (en) * | 1992-12-18 | 1995-08-15 | Neoprobe Corporation | Radiation responsive surgical instrument |
| US5516637A (en) * | 1994-06-10 | 1996-05-14 | Dade International Inc. | Method involving display of protein binding pairs on the surface of bacterial pili and bacteriophage |
| US5516717A (en) * | 1995-04-19 | 1996-05-14 | United Microelectronics Corporation | Method for manufacturing electrostatic discharge devices |
| AUPO591797A0 (en) * | 1997-03-27 | 1997-04-24 | Commonwealth Scientific And Industrial Research Organisation | High avidity polyvalent and polyspecific reagents |
| US5972622A (en) * | 1996-02-08 | 1999-10-26 | Desjardins; Louise | Method of detecting apoptosis using an anti-human GP46 monoclonal anti-body |
| US5935801A (en) * | 1996-03-29 | 1999-08-10 | Dana-Farber Cancer Institute | Monoclonal antibody that detects apoptotic antigen |
| US5994560A (en) * | 1996-08-29 | 1999-11-30 | Hoechst Celanese Corp. | Resolution of racemic mixtures using polymers containing chiral units |
| US5916771A (en) * | 1996-10-11 | 1999-06-29 | Abgenix, Inc. | Production of a multimeric protein by cell fusion method |
| US5958660A (en) * | 1997-12-31 | 1999-09-28 | Eastman Kodak Company | Hydrophilic colloid composition |
| US20020052308A1 (en) * | 1999-03-12 | 2002-05-02 | Rosen Craig A. | Nucleic acids, proteins and antibodies |
| EP1272636B8 (en) * | 2000-04-04 | 2008-10-08 | University Of Rochester | A gene differentially expressed in breast and bladder cancer and encoded polypeptides |
| US20030166277A1 (en) * | 2000-04-12 | 2003-09-04 | University Of Rochester | Targeted vaccine delivery systems |
| US20050196755A1 (en) * | 2000-11-17 | 2005-09-08 | Maurice Zauderer | In vitro methods of producing and identifying immunoglobulin molecules in eukaryotic cells |
| AU2001297872B2 (en) * | 2000-11-17 | 2006-11-09 | University Of Rochester | In vitro methods of producing and identifying immunoglobulin molecules in eukaryotic cells |
| JP2005507659A (ja) * | 2001-10-15 | 2005-03-24 | イミューノメディクス、インコーポレイテッド | 直接ターゲッティング結合タンパク質 |
| AU2003274463B2 (en) * | 2002-06-10 | 2009-10-29 | University Of Rochester | Gene differentially expressed in breast and bladder cancer and encoded polypeptides |
| AU2004296184B2 (en) * | 2003-12-04 | 2010-12-16 | Vaccinex, Inc. | Methods of killing tumor cells by targeting internal antigens exposed on apoptotic tumor cells |
-
2004
- 2004-12-06 AU AU2004296184A patent/AU2004296184B2/en not_active Ceased
- 2004-12-06 US US11/003,819 patent/US20050158323A1/en not_active Abandoned
- 2004-12-06 AT AT04812982T patent/ATE526037T1/de not_active IP Right Cessation
- 2004-12-06 CA CA2548180A patent/CA2548180C/en not_active Expired - Fee Related
- 2004-12-06 JP JP2006542802A patent/JP5042631B2/ja not_active Expired - Fee Related
- 2004-12-06 NZ NZ547591A patent/NZ547591A/en not_active IP Right Cessation
- 2004-12-06 WO PCT/US2004/040573 patent/WO2005055936A2/en not_active Ceased
- 2004-12-06 EP EP04812982A patent/EP1708751B1/en not_active Expired - Lifetime
- 2004-12-06 CN CN2004800413850A patent/CN1913921B/zh not_active Expired - Fee Related
-
2006
- 2006-05-30 IL IL176007A patent/IL176007A/en not_active IP Right Cessation
-
2008
- 2008-05-22 US US12/125,849 patent/US20090081210A1/en not_active Abandoned
Non-Patent Citations (1)
| Title |
|---|
| See references of EP1708751A4 * |
Cited By (13)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP2029172A4 (en) * | 2006-06-22 | 2010-07-28 | Vaccinex Inc | Anti-c35 antibodies for treating cancer |
| KR20100095017A (ko) * | 2007-12-26 | 2010-08-27 | 백시넥스 인코포레이티드 | 항-c35 항체 병용 치료 및 방법 |
| EP2237792A4 (en) * | 2007-12-26 | 2012-07-25 | Vaccinex Inc | ANTI-C35 ANTIBODY COMBINATION THERAPIES AND METHOD |
| US8637026B2 (en) | 2007-12-26 | 2014-01-28 | Vaccinex, Inc. | Anti-C35 antibody combination therapies and methods |
| KR101642846B1 (ko) * | 2007-12-26 | 2016-07-26 | 백시넥스 인코포레이티드 | 항-c35 항체 병용 치료 및 방법 |
| US11274149B2 (en) | 2009-05-08 | 2022-03-15 | Vaccinex, Inc. | Anti-CD100 antibodies and methods for using the same |
| US11534488B2 (en) | 2011-10-11 | 2022-12-27 | Vaccinex, Inc. | Use of semaphorin-4D binding molecules for modulation of blood brain barrier permeability |
| US10662422B2 (en) | 2012-04-26 | 2020-05-26 | Vaccinex, Inc. | Method for selecting polynucleotides encoding antigen-specific immunoglobulin subunit |
| US11078295B2 (en) | 2013-06-25 | 2021-08-03 | Vaccinex, Inc. | Use of semaphorin-4D inhibitory molecules with an immune modulating therapy to inhibit tumor growth and metastases |
| US10526414B2 (en) | 2013-06-25 | 2020-01-07 | Vaccinex, Inc. | Use of anti-semaphorin-4D antibodies in combination with an immune modulating therapy to inhibit tumor growth and metastases |
| US10577427B2 (en) | 2016-04-22 | 2020-03-03 | Vaccinex, Inc. | Integral membrane protein display on poxvirus extracellular enveloped virions |
| US10550199B2 (en) | 2016-04-22 | 2020-02-04 | Vaccinex, Inc. | Integral membrane protein display on poxvirus extracellular enveloped virions |
| US10640765B2 (en) | 2016-08-02 | 2020-05-05 | Vaccinex, Inc. | Methods for producing polynucleotide libraries in vaccinia virus/eukaryotic cells |
Also Published As
| Publication number | Publication date |
|---|---|
| IL176007A (en) | 2012-03-29 |
| AU2004296184B2 (en) | 2010-12-16 |
| AU2004296184A1 (en) | 2005-06-23 |
| EP1708751A2 (en) | 2006-10-11 |
| US20090081210A1 (en) | 2009-03-26 |
| CA2548180C (en) | 2014-02-04 |
| IL176007A0 (en) | 2006-10-05 |
| EP1708751B1 (en) | 2011-09-28 |
| ATE526037T1 (de) | 2011-10-15 |
| CA2548180A1 (en) | 2005-06-23 |
| CN1913921B (zh) | 2012-02-22 |
| NZ547591A (en) | 2009-11-27 |
| EP1708751A4 (en) | 2007-11-07 |
| US20050158323A1 (en) | 2005-07-21 |
| CN1913921A (zh) | 2007-02-14 |
| JP5042631B2 (ja) | 2012-10-03 |
| JP2007515165A (ja) | 2007-06-14 |
| WO2005055936A3 (en) | 2005-11-03 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US20090081210A1 (en) | Methods of Killing Tumor Cells by Targeting Internal Antigens Exposed on Apoptotic Tumor Cells | |
| JP7564274B2 (ja) | 結合剤 | |
| US8637026B2 (en) | Anti-C35 antibody combination therapies and methods | |
| EP2644205A1 (en) | Targeting ABCB5 for cancer therapy | |
| JP2022115854A (ja) | ガングリオシドgd2に対するヒトモノクローナル抗体 | |
| SA111320266B1 (ar) | أجسام مضادة مع ارتباط مولد مضاد يعتمد على الأس الهيدروجيني | |
| HUE033472T2 (en) | Antibodies to ErbB3 and their applications | |
| US11851460B2 (en) | PD1 binding agents | |
| EP2245066A2 (en) | Ron antibodies and uses thereof | |
| WO2019152895A1 (en) | Antibodies to galectin-3 and methods of use thereof | |
| US20080305111A1 (en) | Anti-C35 antibodies for treating cancer |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| AK | Designated states |
Kind code of ref document: A2 Designated state(s): AE AG AL AM AT AU AZ BA BB BG BR BW BY BZ CA CH CN CO CR CU CZ DE DK DM DZ EC EE EG ES FI GB GD GE GH GM HR HU ID IL IN IS JP KE KG KP KR KZ LC LK LR LS LT LU LV MA MD MG MK MN MW MX MZ NA NI NO NZ OM PG PH PL PT RO RU SC SD SE SG SK SL SY TJ TM TN TR TT TZ UA UG US UZ VC VN YU ZA ZM ZW |
|
| AL | Designated countries for regional patents |
Kind code of ref document: A2 Designated state(s): BW GH GM KE LS MW MZ NA SD SL SZ TZ UG ZM ZW AM AZ BY KG KZ MD RU TJ TM AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HU IE IS IT LT LU MC NL PL PT RO SE SI SK TR BF BJ CF CG CI CM GA GN GQ GW ML MR NE SN TD TG |
|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application | ||
| WWE | Wipo information: entry into national phase |
Ref document number: 176007 Country of ref document: IL |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2004296184 Country of ref document: AU Ref document number: 547591 Country of ref document: NZ |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2548180 Country of ref document: CA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2006542802 Country of ref document: JP |
|
| ENP | Entry into the national phase |
Ref document number: 2004296184 Country of ref document: AU Date of ref document: 20041206 Kind code of ref document: A |
|
| WWP | Wipo information: published in national office |
Ref document number: 2004296184 Country of ref document: AU |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2004812982 Country of ref document: EP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 1853/KOLNP/2006 Country of ref document: IN |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 200480041385.0 Country of ref document: CN |
|
| WWP | Wipo information: published in national office |
Ref document number: 2004812982 Country of ref document: EP |