WO2005047484A2 - Biomarkers for alzheimer's disease - Google Patents
Biomarkers for alzheimer's disease Download PDFInfo
- Publication number
- WO2005047484A2 WO2005047484A2 PCT/US2004/037994 US2004037994W WO2005047484A2 WO 2005047484 A2 WO2005047484 A2 WO 2005047484A2 US 2004037994 W US2004037994 W US 2004037994W WO 2005047484 A2 WO2005047484 A2 WO 2005047484A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- peptide
- biomarker
- alzheimer
- fragment
- cystatin
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/68—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
- G01N33/6893—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids related to diseases not provided for elsewhere
- G01N33/6896—Neurological disorders, e.g. Alzheimer's disease
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
- A61P25/28—Drugs for disorders of the nervous system for treating neurodegenerative disorders of the central nervous system, e.g. nootropic agents, cognition enhancers, drugs for treating Alzheimer's disease or other forms of dementia
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/68—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
- G01N33/6803—General methods of protein analysis not limited to specific proteins or families of proteins
- G01N33/6842—Proteomic analysis of subsets of protein mixtures with reduced complexity, e.g. membrane proteins, phosphoproteins, organelle proteins
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/68—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
- G01N33/6803—General methods of protein analysis not limited to specific proteins or families of proteins
- G01N33/6848—Methods of protein analysis involving mass spectrometry
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/68—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
- G01N33/6803—General methods of protein analysis not limited to specific proteins or families of proteins
- G01N33/6848—Methods of protein analysis involving mass spectrometry
- G01N33/6851—Methods of protein analysis involving laser desorption ionisation mass spectrometry
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2800/00—Detection or diagnosis of diseases
- G01N2800/28—Neurological disorders
- G01N2800/2814—Dementia; Cognitive disorders
- G01N2800/2821—Alzheimer
Definitions
- BIOMARKERS FOR ALZHEIMER'S DISEASE CROSS-REFERENCE TO RELATED APPLICATIONS [0001] This application claims the benefit of United States provisional patent application No. 60/518,360, filed November 7, 2003; United States provisional patent application No. 60/526,753, filed December 2, 2003; United States provisional patent application No. 60/546,423, filed February 19, 2004; United States provisional patent application No. 60/547,250, filed February 23, 2004; United States provisional patent application No. 60/558,896, filed April 2, 2004; United States provisional patent application No. 60/572,617, filed May 18, 2004; and United States provisional patent application No. 60/586,503, filed July 8, 2004, the disclosure of each of which is inco ⁇ orated herein by reference in its entirety for all piuposes.
- Alzheimer's Disease is a progressive neurodegenerative disorder that leads to the death of . brain cells that cannot be replaced once lost.
- the two key neuropathological hallmarks of AD are the presence of senile plaques predominantly comprised of aggregated beta-amyloid protein (A ⁇ ) and neurofibrillary tangles (NFTs) formed by the accumulation of hype ⁇ hosphorylated tau protein.
- a ⁇ aggregated beta-amyloid protein
- NFTs neurofibrillary tangles
- AD the clinical diagnosis of AD requires an evaluation of medical history and physical examination including neurological, neuropsychological and psychiatric assessment, as well as various biological, radiological and electrophysiological tests. Despite the battery of tests, a definitive diagnosis can only be achieved by post-mortem brain examination.
- CSF-tau as an ante-mortem marker for AD mainly using enzyme-linked immunoabsorbent assays (ELISA) as the measurement assay.
- ELISA enzyme-linked immunoabsorbent assays
- the protein Ubiquitin is known to complex with hype ⁇ hosphorylated Tau during maturation of NFTs in the brains of AD patients (Iqbal et. al J Neural Transm Suppl. 55:169-80 (1998)). Ubiquitin levels in CSF of AD and neurological control groups have been shown to be significantly higher than those of non- neurological aged controls (Wang et. al. Ada Neuropathol (Berl). 82(1):6-12 (1991); Kudo et. al. Brain Res. 639(1): 1-7 (1994)).
- the acute phase/inflammatory protein alpha(l)-antichymotrypsin (ACT) is ove ⁇ roduced in the AD brain.
- ACT also can promote the formation of, and is associated with, neurotoxic amyloid deposits (Potter et. al. Neurobiol Aging. 22(6) :923-30 (2001)).
- the levels of ACT in both serum and CSF are significantly and specifically higher in patients with Alzheimer-type dementia than in control subjects (Matsubara et. al. Ann Neurol. 28(4) :561-1 (1990)).
- There is a particularly close association of increases in CSF- ACT with late onset AD Harigaya et. al. Intern Med. 34(6) :481-4 (1995)).
- Chromogranin A is the major protein of large dense-core synaptic vesicles and may be of value as a biochemical marker for synaptic function in AD.
- CrA Chromogranin A
- Beta-2-Microglobulin (B2M) is an initiator of inflammatory responses modulated by interferons and certain cytokines (Hoekman et.al Neth. J. Med.
- TTR Transthyretin
- TTR isoform was shown to be increased in AD- CSF using 2D gel analysis of a small number of AD and control patients (Davidsson, supra.). However, this result conflicts with other reports showing a clear decrease of TTR in CSF from AD patients compared with controls (Serot et. al. J Neurol Neurosurg Psychiatry. 63(4):506-8 (1997); Riisoen et. al. Acta Neurol Scand. 78(6):455-9 (1998)). This decrease is also negatively correlated with the senile plaque (SP) abundance (Merched et. al. FEBSLett. 425(2):225-8 (1998)).
- SP senile plaque
- Cystatin C a cysteine protease inhibitor
- CAA cerebral amyloid angiopathy
- Full length Cystatin C was found as a CSF marker for AD in a previous SELDI profiling study (Carrette, supra.).
- BBB blood-brain barrier
- the CSF/serum albumin ratio can be used as a measure of BBB function.
- the present invention provides polypeptide-based biomarkers that are differentially present in subjects having Alzheimer's disease versus subjects free of the disease and/or versus subjects suffering from forms of non- Alzheimer's dementia (e.g., LBD, FTD, etc.). hi addition, the present invention provides methods of using the polypeptide- based biomarkers to qualify Alzheimer's disease in a subject.
- the present invention also provides methods for identifying Alzheimer's disease therapeutics and treating qualified individuals.
- the present invention provides a method for qualifying Alzheimer's disease status in a subject, the method comprising: (a) measuring at least one biomarker in a biological sample from the subject, wherein the at least one biomarker is selected from the group consisting of the biomarkers of Table I, Table II, Table IV-A and Table IV-B, supra; and (b) correlating the measurement with Alzheimer's disease status.
- the sample is cerebrospinal fluid (CSF).
- the sample is serum.
- the at least one biomarker is selected from the group consisting of the biomarkers of Table II, Table IV-A and Table IV-B. hi another preferred embodiment, the at least one biomarker is selected from the group consisting of the biomarkers of Table IV-B. [0015] In a preferred embodiment, the at least one biomarker is selected from the biomarkers of Table II or Table IV-A or Table IV-B.
- the at least one biomarker is selected from the following biomarkers: M60464.7 (Hemopexin), M3513.9 (7B2 CT fragment), M8291.0 (Ubiquitin -3aa from CT), M5044.2, M10379.8 (10.3 kDa), M9984.6 (related to 10.3 kDa), M10265.6 (related to 10.3 kDa), M9802.4 (EA-92 (ChrA peptide)), 9757.0 (related to 10.3 kDa), M16207.4 (Pancreatic ribonuclease), M14092.7 (Transthyretin S-glutathionylated), M13904.7 (Transthyretin S-Cys/S-CysGly), M12545.9 (Cystatin-C -8aa from NT), M8183.6 (Ubiquitin -4aa from CT), M5227.4, M3687.0 (Secretoneurin (ChrC
- the method comprises measuring N-acetylated thymosin beta-4.
- the at least one biomarker is selected from one of the biomarkers in Table II or IV-A or IV-B which is named in Table V.
- the method comprises additionally measuring one or more of the following biomarkers: Ml 1725.7 (Beta-2-Microglobulin), M78936.5 (transferrin), M13349.5 (Cystatin C), M66479.2 (Albumin) and M8585.9 (Ubiquitin), or alternatively, measuring each of these additional biomarkers.
- the method comprising measuring at least each of the biomarkers in the following two sets of biomarkers: M17349.3 (Apolipoprotein A-II dimer), M60464.7
- Hemopexin Hemopexin
- M3513.9 7B2 CT fragment
- Ml 7349.3 Polipoprotein A-LT dimer
- M60464.7 Hemopexin
- M10379.8 (10.3 kDa
- Ml 1725.7 Beta-2-Microglobulin
- the method comprising measuring at least one biomarker from the set consisting of the following biomarkers: 16207.4 (Pancreatic ribonuclease), 8183.6 (Ubiquitin -4aa from CT), M5227.4, M3806.2, M8955.1, M5263.9, M20839.2, M4320.6 (A-beta 1-40), 7258.2 (Chromogranin B peptide), M6608.9, M5838.3, M23477.4 ((Prostaglandin-D synthase), 7653.2 (Osteopontin CT fragment), M16716.9, M7878.7, 7718.8 (Osteopontin CT fragment phosphor), and M4455.4.
- 16207.4 Pancreatic ribonuclease
- 8183.6 Ubiquitin -4aa from CT
- M5227.4, M3806.2, M8955.1, M5263.9, M20839.2, M4320.6 A-be
- the at least one biomarker is measured by capturing the biomarker on an adsorbent of a SELDI probe and detecting the captured biomarkers by laser deso ⁇ tion-ionization mass spectrometry.
- the adsorbent is a cation exchange adsorbent, an anion exchange adsorbent, a metal chelate or a hydrophobic adsorbent.
- the adsorbent is a biospecific adsorbent.
- the at least one biomarker is measured by immunoassay.
- the correlating is performed by a software classification algorithm, hi certain embodiments, the Alzheimer's disease status is selected ⁇ • from Alzheimer's disease, non-dementia, and non- Alzheimer's dementia.
- non- Alzheimer's dementia includes Lewy body dementia (LBD) and frontotemporal dementia (FTD).
- the method further comprises: (c) managing subject treatment based on the status. If the measurement correlates with Alzheimer's disease, then managing subject treatment comprises administering a choline esterase inhibitor to the subject.
- the method further comprises: (d) measuring the at least one biomarker after subject management.
- the present invention provides a method comprising measuring at least one biomarker in a sample from a subject, wherein the at least one biomarker is selected from the group consisting of the biomarkers set forth in Table I, II, IV- A, Table IV-B, or any of the groups of biomarkers discussed above.
- the sample is cerebrospinal fluid (CSF).
- the sample is serum.
- the at least one biomarker is selected from the group consisting of the biomarkers of Table II.
- the at least one biomarker is selected from the group consisting of the biomarkers of Table IV-A or Table IV-B.
- the method comprises measuring N-acetylated thymosin beta- 4.
- the at least one biomarker is selected from one of the biomarkers in Table II, Table IV-A, or Table IV-B which is named in Table V.
- the at least one biomarker is selected from the following biomarkers: M60464.7 (Hemopexin), M3513.9 (7B2 CT fragment), M8291.0 (Ubiquitin -3aa from CT), M5044.2, M10379.8 (10.3 kDa), M9984.6 (related to 10.3 kDa), Ml 0265.6 (related to 10.3 kDa), M9802.4 (EA-92 (ChrA peptide)), 9757.0 (related to 10.3 kDa), M16207.4 (Pancreatic ribonuclease), M14092.7 (Transthyretin S-glutathionylated), M13904.7 (Transthyretin S-Cys/S-CysGly), M12545.9 (Cystatin-C -8aa from NT), M8183.6 (Ubiquitin -4aa from CT), M5227.4, M3687.0 (Secretoneuri
- the at least one biomarker is selected from the following biomarkers: Ml 1728.3 ( ⁇ 2 microglobulin), M60976.2 (Hemopexin), Ml 1127.8 and M9742.3.
- the method further comprises measuring Cystatin C (M13391).
- the method further comprises additionally measuring a modified form of Cystatin C (CysC), for example, CysC ⁇ l-8, a truncated form of CysC missing 8 amino acids from the N-terminus of full- length CysC.
- CysC Cystatin C
- the method further comprises measuring at least one of the following additional biomarkers: Ml 1725.7 (Beta-2-Microglobulin), M78936.5 (transferrin), Ml 3349.5 (Cystatin C), M66419.2 (Albumin) and M8585.9 (Ubiquitin), or alternatively, measuring each of these additional biomarkers.
- the method comprises measuring N-acetylated thymosin beta-4.
- the at least one biomarker is selected from one of the biomarkers in Table II, Table IV-A, or Table IV-B which is named in Table V.
- the at least one biomarker is measured by capturing the biomarker on an adsorbent of a SELDI probe and detecting the captured biomarkers by laser deso ⁇ tion-ionization mass spectrometry.
- the adsorbent is a cation exchange adsorbent, an anion exchange adsorbent, a metal chelate or a hydrophobic adsorbent.
- the adsorbent is a biospecific adsorbent.
- the at least one biomarker is measured by immunoassay.
- the present invention provides a kit comprising: (a) a solid support comprising at least one capture reagent attached thereto, wherein the capture reagent binds at least one biomarker from a first group consisting of the biomarkers set forth in Table I, Table II, Table IV-A and Table IV-B; and (b) instructions for using the solid support to detect the at least one biomarker set forth in Table I, Table II, Table IV-A and Table IV-B.
- the at least one biomarker is selected from the group consisting of the biomarkers of Table II.
- the at least one biomarker is selected from one of the biomarkers in Table II, Table IV-A or Table IV-B which is named in Table V.
- the biomarker is N- acetylated thymosin beta-4.
- the kit provides instructions for using the solid support to detect a biomarker selected from the following biomarkers: M60464.7 (Hemopexin), M3513.9 (7B2 CT fragment), M8291.0 (Ubiquitin -3aa from CT), M5044.2, M10379.8 (10.3 kDa), M9984.6 (related to 10.3 kDa), M10265.6 (related to 10.3 kDa), M9802.4 (EA-92 (ChrA peptide)), 9757.0 (related to 10.3 kDa), Ml 6207.4 (Pancreatic ribonuclease), M14092.7 (Transthyretin S-glutathionylated), M13904.7 (Transthyretin S- Cys/S-CysGly), M12545.9 (Cystatin-C -8aa from NT), M8183.6 (Ubiquitin -4aa from CT), M5227.4, M368
- the kit provides instructions for using the solid support to detect a biomarker selected from the following biomarkers: Ml 1728.3 ( ⁇ 2 microglobulin), M60976.2 (Hemopexin), Ml 1127.8 and M9742.3.
- the kit further comprises instructions for using the solid support to detect Cystatin C (M13391).
- the kit further comprises instructions for using the solid support to detect at least one of the following additional biomarkers: Ml 1725.7 (Beta-2-Microglobulin), M78936.5 (transferrin), M13349.5 (Cystatin C), M66479.2 (Albumin) and M8585.9 (Ubiquitin), or, alternatively, additionally detecting each of these biomarkers.
- the kit further comprises instructions for using the solid support to detect at least one of the biomarkers in Table II or IV which is named in Table V.
- the solid support comprising the capture reagent is a SELDI probe.
- the adsorbent is a cation exchange adsorbent, an anion exchange adsorbent, a metal chelate or a hydrophobic adsorbent.
- the capture reagent is a cation exchange adsorbent.
- the kit additionally comprises (c) an anion exchange chromatography sorbent.
- the kit additionally comprises (c) a container containing at least one of the biomarkers of Table I, Table II, Table IV-A or Table IV-B.
- the present invention provides a kit comprising: (a) a solid support comprising at least one capture reagent attached thereto, wherein the capture reagent binds at least one biomarker from a first group consisting of the biomarkers set forth in Table I, Table II, Table IV-A, or Table IV-B; and (b) a container comprising at least one of the biomarkers set forth in Table I, Table IL Table IV-A, or Table IV-B.
- the at least one biomarker is selected from the group consisting of the biomarkers of Table II, Table IV-A, and Table IV-B.
- the at least one biomarker is N-acetylated thymosin beta-4. In yet another preferred embodiment, the at least one biomarker is selected from one of the biomarkers in Table ⁇ or IV-A or IV-B which is named in Table V.
- the kit provides instructions for using the solid support to detect a biomarker selected from the following biomarkers: M60464.7 (Hemopexin), M3513.9 (7B2 CT fragment), M8291.0 (Ubiquitin -3aa from CT), M5044.2, M10379.8 (10.3 kDa), M9984.6 (related to 10.3 kDa), M10265.6 (related to 10.3 kDa), M9802.4 (EA-92 (ChrA peptide)), 9757.0 (related to 10.3 kDa), Ml 6207.4 (Pancreatic ribonuclease), M14092.7 (Transthyretin S-glutathionylated), M13904.7 (Transthyretin S- Cys/S-CysGly), M12545.9 (Cystatin-C -8aa from NT), M8183.6 (Ubiquitin -4aa from CT), M5227.4, M368
- the kit further comprises instructions for using the solid support to detect Cystatin C (M13391).
- the kit provides instructions for additionally measuring one of the following biomarkers:
- the kit further comprises instructions for using the solid support to detect at least one of the following additional biomarkers: Ml 1725.7 (Beta-2-Microglobulin), M78936.5 (transferrin), M13349.5 (Cystatin C), M66479.2 (Albumin) and M8585.9 (Ubiquitin), or, alternatively, additionally detecting each of these biomarkers.
- the kit further comprises instructions for using the solid support to detect at least one of the biomarkers in Table II or Table IV-A or Table IV-B which is named in Table V.
- the solid support comprising the capture reagent is a SELDI probe.
- the adsorbent is a cation exchange adsorbent, an anion exchange adsorbent, a metal chelate or a hydrophobic adsorbent.
- the adsorbent is a biospecific adsorbent.
- the capture reagent is a cation exchange adsorbent.
- the kit additionally comprises (c) an anion exchange chromatography sorbent.
- the present invention provides a software product, the software product comprising: (a) code that accesses data attributed to a sample, the data comprising measurement of at least one biomarker in the sample, the biomarker selected from the group consisting of the biomarkers of Table I, Table II, Table IV-A, and Table IV-B; and (b) code that executes a classification algorithm that classifies the Alzheimer's disease status of the sample as a function of the measurement, hi a preferred embodiment, the biomarker is selected from the group consisting of the biomarkers of Table IV-A or Table IV-B.
- the classification algorithm classifies Alzheimer's disease status of the sample as a function of the measurement of a biomarker selected from the group consisting of M60464.7 (Hemopexin), M3513.9 (7B2 CT fragment), M8291.0 (Ubiquitin -3aa from CT), M5044.2, Ml 0379.8 (10.3 kDa), M9984.6 (related to 10.3 kDa), , M10265.6 (related to 10.3 kDa), M9802.4 (EA-92 (ChrA peptide)), 9757.0 (related to 10.3 kDa), Ml 6207.4 (Pancreatic ribonuclease), M14092.7 (Transthyretin S-glutathionylated), M13904.7 (Transthyretin S-Cys/S-CysGly), M12545.9 (Cystatin-C -8aa from NT), M8183.6 (Ubiquitin -4
- the classification algorithm classifies Alzheimer's disease status of the sample as a function of the additional measurement of the one of the following biomarkers: Ml 1725.7 (Beta-2- Microglobulin), M78936.5 (transferrin), M13349.5 (Cystatin C), M66479.2 (Albumin) and M8585.9 (Ubiquitin)..
- the classification algorithm classifies Alzheimer's disease status of the sample as a function of the additional measurement of at least one of the biomarkers in Table II, Table IV-A or Table IV-B.
- the classification algorithm classifies Alzheimer's disease status of the sample as a function of the additional measurement of at least one of the biomarkers in Table II, Table IV-A or Table IV-B which is named in Table V.
- the present invention provides purified biomolecules selected from the biomarkers set forth in Table I, Table II, Table IV-A and Table IV-B, and additionally, methods comprising detecting a biomarker set forth in Table I, II, IV-A or Table IV-B by mass spectrometry or immunoassay.
- FIG. 1A-1Q show mass spectra displaying biomarkers identified according to the techniques described in Example 1. The Figure also provides the mass-to- charge ratio for each biomarker.
- FIG. 2A shows a decision tree for classifying a sample as Alzheimer's or non- Alzheimer's using certain biomarkers of this invention.
- FIG. 3 shows the results of statistical tests used to validate the measurement of ⁇ 2 microglobulin in CSF as a means for distinguishing between patients suffering from Alzheimer's disease (“AD”) versus non-Alzheimer's dementia (“non AD”) and versus patients who are not showing symptoms of dementia ("Control").
- AD Alzheimer's disease
- non AD non-Alzheimer's dementia
- the data indicates a statistically significant difference in the average peak intensities of ⁇ 2 microglobulin between Alzheimer's patients and the control group ("A-C”); between Alzheimer's patients and patients with non- Alzheimer's dementia ("A-N”); and between patients with non- Alzheimer's dementia and the control group (“C-N”).
- Measurements of peak intensities were performed as described in the Examples, utilizing the Ciphergen H50 ProteinChip.
- FIG. 4A-K shows the distribution of peak intensities observed for the various groups and the results of Mann- Whitney or Kruskal-Wallis tests used to determine the significance of any differences observed.
- FIG. 4A-K shows the distribution of peak intensities observed for the various groups and the results of Mann- Whitney or Kruskal-Wallis tests used to determine the significance of any differences observed.
- FIG. 5 shows the distribution of peak intensities observed for full- length and truncated ubiquitin biomarkers, and the results of Mann- Whitney or Kruskal- Wallis tests used to determine the significance of any differences observed. Results are also presented for comparisons between disease and control groups using age-matched samples and using samples restricted by specific Tau/AB42 cut-off levels.
- FIG. 6 shows the distribution of peak intensities observed for full- length and truncated Cystatin C biomarkers and the results of Mann- Whitney or Kruskal- Wallis tests used to determine the significance of any differences observed. Results are also presented for comparisons between disease and control groups using age-matched samples and using samples restricted by specific Tau/AB42 cut-off levels. [0040] FIG.
- FIG. 7 shows the distribution of peak intensities observed for the Thymosin beta-4 biomarker and the results of Mann- Whitney or Kruskal-Wallis tests used to determine the significance of any differences observed. Results are also presented for comparisons between disease and control groups using age-matched samples and using samples restricted by specific Tau/AB42 cut-off levels.
- FIG. 8 shows the distribution of peak intensities observed for the neuroendocrine protein 7B2, hemopexin, beta-2-microglobulin and transferrin biomarkers.
- FIG. 8 also shows the results of Mann- Whitney or Kruskal-Wallis tests used to determine the significance of any differences observed.
- FIG. 9 shows mass spectra displaying biomarkers identified according to the techniques described in Example 3, utilizing neat CSF samples. [0043] FIG.
- FIG. 11 shows the results of statistical tests used to validate the measurement of truncated CysC as a means for distinguishing between patients suffering from Alzheimer's dementia versus non- Alzheimer's dementia.
- the Figure shows a statistically significant difference in the average peak intensities of the truncated form of CysC (the 12583.8 Da marker) in Alzheimer's patients versus patients with non-Alzheimer's dementia ("A-N" p-value ⁇ 0.0001).
- a biomarker is an organic biomolecule which is differentially present in a sample taken from a subject of one phenotypic status (e.g., having a disease) as compared with another phenotypic status (e.g., not having the disease).
- a biomarker is differentially present between different phenotypic statuses if the mean or median expression level of the biomarker in the different groups is calculated to be statistically significant. Common tests for statistical significance include, among others, t-test, ANOVA, Kruskal- Wallis, Wilcoxon, Mann- Whitney and odds ratio. Biomarkers, alone or in combination, provide measures of relative risk that a subject belongs to one phenotypic status or another. Therefore, they are useful as markers for disease (diagnostics), therapeutic effectiveness of a drug (theranostics) and drug toxicity.
- This invention provides polypeptide-based biomarkers that are differentially present in subjects having Alzheimer's disease versus subjects free of the disease and or versus subjects suffering from forms of non- Alzheimer's dementia (e.g., LB, FTD, etc.).
- the present invention provides methods of using the polypeptide- based biomarkers to qualify Alzheimer's disease in a subject. They are characterized by mass-to-charge ratio as determined by mass spectrometry, by the shape of their spectral peak in time-of-flight mass spectrometry and by their binding characteristics to adsorbent surfaces.
- biomarkers provide one method to determine whether a particular detected biomolecule is a biomarker of this invention. These characteristics represent inherent characteristics of the biomolecules and not process limitations in the manner in which the biomolecules are discriminated. In one aspect, this invention provides these biomarkers in isolated form. [0047] The biomarkers were discovered using SELDI technology employing ProteinChip arrays from Ciphergen Biosystems, hie. (Fremont, CA) ("Ciphergen"). CSF samples were collected from subjects diagnosed with Alzheimer's disease and subjects diagnosed as normal (non-demented). In some circumstances, CSF samples were fractionated by anion exchange chromatography (e.g., Example 1). Neat CSF samples may also be used (e.g., Example 3).
- biomarkers for qualifying Alzheimer's disease are presented in Tables I, II, IV-A, IV-B and V.
- the "ProteinChip assay” column refers to chromatographic fraction in which the biomarker is found, the type of biochip to which the biomarker binds and the wash conditions, as described m detail in the ⁇ xamples herein.
- the biomarkers of this invention are characterized by their mass-to- charge ratio as determined by mass spectrometry. The mass-to-charge ratio of each biomarker is provided in the Tables herein.
- biomarker M2579.3 has a measured mass-to- charge ratio of 2579.3.
- the mass-to-charge ratios were determined from mass spectra generated on a Ciphergen Biosystems, Inc. PBS II mass spectrometer. This instrument has a mass accuracy of about +/- 0.15 percent (e.g., for a 5,000 Da protein, the error is ⁇ 7.5 Da).
- the biomarkers herein which are referred to by a measured apparent mass are not expected to provide precisely the same apparent weight every time their presence is detected in a given sample.
- the PBS II mass spectrometer has a mass resolution of about 400 to 1000 m/dm, where m is mass and dm is the mass spectral peak width at 0.5 peak height.
- the mass-to-charge ratio of the biomarkers was determined using Biomarker Wizard 1 " 1 software (Ciphergen Biosystems, Inc.). Biomarker Wizard assigns a mass-to- charge ratio to a biomarker by clustering the mass-to-charge ratios of the same peaks from all the spectra analyzed, as determined by the PBSII, taking the maximum and minimum mass- to-charge-ratio in the cluster, and dividing by two. Accordingly, the masses provided reflect these specifications.
- the biomarkers of this invention are further characterized by the shape of their spectral peak in time-of-flight mass spectrometry. Mass spectra showing peaks representing many of the biomarkers are presented in FIGS. 1 and 9. [0051]
- the biomarkers of this invention are further characterized by their binding properties on chromatographic surfaces.
- the biomarkers of the present invention bind to cation exchange adsorbents (preferably a CM- 10 or WCX-2 ProteinChip array
- the presence of the biomarker can be determined by other methods known in the art, for example, by immunoassay, enzymatic activity assay, or by measuring any other detectable property of the biomarker.
- biomarkers of this invention are characterized by mass-to- charge ratio, binding properties and spectral shape, they can be detected by mass spectrometry without knowing their specific identity.
- biomarkers whose identity is not determined can be identified by, for example, determining the amino acid sequence of the polypeptides.
- a biomarker can be peptide-mapped with a number of enzymes, such as trypsin or V8 protease, and the molecular weights of the digestion fragments can be used to search databases for sequences that match the molecular weights of the digestion fragments generated by the various enzymes.
- protein biomarkers can be sequenced using tandem MS technology. In this method, the protein is isolated by, for example, gel electrophoresis. A band containing the biomarker is cut out and the protein is subject to protease digestion. Individual protein fragments are separated by a first mass spectrometer. The fragment is then subjected to collision-induced cooling, which fragments the peptide and produces a polypeptide ladder.
- a polypeptide ladder is then analyzed by the second mass spectrometer of the tandem MS.
- the difference in masses of the members of the polypeptide ladder identifies the amino acids in the sequence.
- An entire protein can be sequenced this way, or a sequence fragment can be subjected to database mining to find identity candidates.
- the preferred biological source for detection of the biomarkers is cerebrospinal fluid ("CSF").
- CSF cerebrospinal fluid
- the biomarkers can be detected in serum.
- Many of the biomarkers of the present invention can be found in both CSF and serum. For instance, it has been discovered that Alzheimer's disease biomarkers Beta-2-microglobulin and Cystatin C (both full-length and variant forms) are found in both CSF and serum.
- the biomarkers of this invention are biomolecules. Accordingly, this invention provides these biomolecules in isolated form.
- the biomarkers can be isolated from biological fluids, such as CSF or serum. They can be isolated by any method known in the art, based on both their mass and their binding characteristics. For example, a sample comprising the biomolecules can be subject to chromatographic fractionation, as described herein, and subject to further separation by, e.g., acrylamide gel electrophoresis. Knowledge of the identity of the biomarker also allows their isolation by immunoaffinity chromatography. B.
- Pre-translational modified forms include allelic variants, slice variants and RNA editing forms.
- Post- translationally modified forms include forms resulting from proteolytic cleavage (e.g., fragments of a parent protein), glycosylation, phosphorylation, lipidation, oxidation, methylation, cystinylation, sulphonation and acetylation.
- proteins including a specific protein and all modified forms of it is referred to herein as a "protein cluster.”
- the collection of all modified forms of a specific protein, excluding the specific protein, itself, is referred to herein as a "modified protein cluster.”
- Modified forms of any biomarker of this invention (including those set forth in Tables I, II, IV-A, IV-B or V) also may be used, themselves, as biomarkers. In certain cases, the modified forms may exhibit better discriminatory power in diagnosis than the unmodified form of the protein. [0057] Modified forms of a biomarker including any of those set forth in
- Tables including those set forth in Tables I, II, IV-A, IV-B or V, can be initially detected by any methodology that can detect and distinguish the modified form from the biomarker.
- a preferred method for initial detection involves first capturing the biomarker and modified forms of it, e.g., with biospecific capture reagents, and then detecting the captured proteins by mass spectrometry. More specifically, the proteins are captured using biospecific capture reagents, such as antibodies, aptamers or Affibodies that recognize the biomarker and modified forms of it. This method will also result in the capture of protein interactors that are bound to the proteins or that are otherwise recognized by antibodies and that, themselves, can be biomarkers.
- the biospecific capture reagents are bound to a solid phase.
- the captured proteins can be detected by SELDI mass spectrometry or by eluting the proteins from the capture reagent and detecting the eluted proteins by traditional MALDI or by SELDI.
- mass spectrometry is especially attractive because it can distinguish and quantify modified forms of a protein based oh mass and without the need for labeling.
- the biospecific capture reagent is bound to a solid phase, such as a bead, a plate, a membrane or a chip. Methods of coupling biomolecules, such as antibodies, to a solid phase are well known in the art.
- Biospecific capture reagents against different target proteins can be mixed in the same place, or they can be attached to solid phases in different physical or addressable locations. For example, one can load multiple columns with derivatized beads, each column able to capture a single protein cluster. Alternatively, one can pack a single column with different beads derivatized with capture reagents against a variety of protein clusters, thereby capturing all the analytes in a single place.
- antibody-derivatized bead-based technologies such as xMAP technology of Luminex (Austin, TX) can be used to detect the protein clusters.
- the biospecific capture reagents must be specifically directed toward the members of a cluster in order to differentiate them.
- the surfaces of biochips can be derivatized with the capture reagents directed against protein clusters either in the same location or in physically different addressable locations.
- One advantage of capturing different clusters in different addressable locations is that the analysis becomes simpler.
- the modified form After identification of modified forms of a protein and correlation with the clinical parameter of interest, the modified form can be used as a biomarker in any of the methods of this invention.
- detection of the modified from can be accomplished by any specific detection methodology including affinity capture followed by mass spectrometry, or traditional immunoassay directed specifically the modified form, hnmunoassay requires biospecific capture reagents, such as antibodies, to capture the analytes. Furthermore, if the assay must be designed to specifically distinguish protein and modified forms of protein. This can be done, for example, by employing a sandwich assay in which one antibody captures more than one form and second, distinctly labeled antibodies, specifically bind, and provide distinct detection of, the various forms. Antibodies can be produced by immunizing animals with the biomolecules. This invention contemplates traditional immunoassays including, for example, sandwich immunoassays including ELISA or fluorescence-based immunoassays, as well as other enzyme immunoassays.
- the biomarkers of this invention can be detected by any suitable method. Detection paradigms that can be employed to this end include optical methods, electrochemical methods (voltametry and amperometry techniques), atomic force microscopy, and radio frequency methods, e.g., multipolar resonance spectroscopy.
- a sample is analyzed by means of a biochip.
- Biochips generally comprise solid substrates and have a generally planar surface, to which a capture reagent (also called an adsorbent or affinity reagent) is attached.
- Protein biochip refers to a biochip adapted for the capture of polypeptides. Many protein biochips are described in the art. These include, for example, protein biochips produced by Ciphergen Biosystems, Inc. (Fremont, CA), Packard
- the biomarkers of this invention are detected by mass spectrometry, a method that employs a mass spectrometer to detect gas phase ions.
- mass spectrometers are time-of-flight, magnetic sector, quadrupole filter, ion trap, ion cyclotron resonance, electrostatic sector analyzer and hybrids of these.
- the mass spectrometer is a laser deso ⁇ tion/ionization mass spectrometer.
- the analytes are placed on the surface of a mass spectrometry probe, a device adapted to engage a probe interface of the mass spectrometer and to present an analyte to ionizing energy for ionization and introduction into a mass spectrometer.
- a laser deso ⁇ tion mass spectrometer employs laser energy, typically from an ultraviolet laser, but also from an infrared laser, to desorb analytes from a surface, to volatilize and ionize them and make them available to the ion optics of the mass spectrometer. 1.
- SELDI [0066] A preferred mass spectrometric technique for use in the invention is
- SELDI Surface Enhanced Laser Deso ⁇ tion and Ionization
- This version involves the use of probes that have a material on the probe surface that captures analytes through a non- covalent affinity interaction (adso ⁇ tion) between the material and the analyte.
- the material is variously called an “adsorbent,” a “capture reagent,” an “affinity reagent” or a “binding moiety.”
- Such probes can be referred to as “affinity capture probes” and as having an “adsorbent surface.”
- the capture reagent can be any material capable of binding an analyte.
- the capture reagent may be attached directly to the substrate of the selective surface, or the substrate may have a reactive surface that carries a reactive moiety that is capable of binding the capture reagent, e.g., through a reaction forming a covalent or coordinate covalent bond.
- Epoxide and carbodiimidizole are useful reactive moieties to covalently bind polypeptide capture reagents such as antibodies or cellular receptors.
- Mtriloacetic acid and iminodiacetic acid are useful reactive moieties that function as chelating agents to bind metal ions that interact non-covalently with histidine containing peptides.
- Adsorbents are generally classified as chromatographic adsorbents and biospecific adsorbents.
- Chromatographic adsorbent refers to an adsorbent material typically used in chromatography.
- Chromatographic adsorbents include, for example, ion exchange materials, metal chelators (e.g., nitriloacetic acid or iminodiacetic acid), immobilized metal chelates, hydrophobic interaction adsorbents, hydrophilic interaction adsorbents, dyes, simple biomolecules (e.g., nucleotides, amino acids, simple sugars and fatty acids) and mixed mode adsorbents (e.g., hydrophobic attraction/electrostatic repulsion adsorbents).
- metal chelators e.g., nitriloacetic acid or iminodiacetic acid
- immobilized metal chelates e.g., immobilized metal chelates
- hydrophobic interaction adsorbents e.g., hydrophilic interaction adsorbents
- dyes e.
- Biospecific adsorbent refers to an adsorbent comprising a biomolecule, e.g., a nucleic acid molecule (e.g., an aptamer), a polypeptide, a polysaccharide, a lipid, a steroid or a conjugate of these (e.g., a glycoprotein, a lipoprotein, a glycolipid, a nucleic acid (e.g., DNA)-protein conjugate), i certain instances, the biospecific adsorbent can be a macromolecular structure such as a multiprotein complex, a biological membrane or a virus. Examples of biospecific adsorbents are antibodies, receptor proteins and nucleic acids.
- Biospecific adsorbents typically have higher specificity for a target analyte than chromatographic adsorbents. Further examples of adsorbents for use in SELDI can be found in U.S. Patent No. 6,225,047.
- a "bioselective adsorbent” refers to an adsorbent that binds to an analyte with an affinity of at least 10 "8 M.
- Ciphergen ProteinChip ® arrays include NP20 (hydrophilic); H4 and H50 (hydrophobic); SAX-2, Q-10 and LSAX-30 (anion exchange); WCX-2, CM- 10 and LWCX- 30 (cation exchange); MAC-3, MAC-30 and MAC, 40 (metal chelate); and PS-10, PS-20 (reactive surface with carboimidizole, expoxide) and PG-20 (protein G coupled through carboimidizole). Hydrophobic ProteinChip arrays have isopropyl or nonylphenoxy- poly(ethylene glycol)methacrylate functionalities. Anion exchange ProteinChip arrays have quaternary ammonium functionalities.
- Cation exchange ProteinChip arrays have carboxylate functionalities.
- Immobilized metal chelate ProteinChip arrays have have nitriloacetic acid functionalities that adsorb transition metal ions, such as copper, nickel, zinc, and gallium, by chelation.
- Preactivated ProteinChip arrays have carboimidizole or epoxide functional groups that can react with groups on proteins for covalent binding. [0071] Such biochips are further described in: U.S. Patent No. 6,579,719 (Hutchens and Yip, "Retentate Chromatography," June 17, 2003); PCT International Publication No.
- washing solutions can be used; preferably, aqueous solutions are employed.
- the extent to which molecules remain bound can be manipulated by adjusting the stringency of the wash.
- the elution characteristics of a wash solution can depend, for example, on pH, ionic strength, hydrophobicity, degree of chaotropism, detergent strength, and temperature.
- an energy absorbing molecule then is applied to the substrate with the bound biomarkers.
- the biomarkers bound to the substrates are detected in a gas phase ion spectrometer such as a time-of-flight mass spectrometer.
- the biomarkers are ionized by an ionization source such as a laser, the generated ions are collected by an ion optic assembly, and then a mass analyzer disperses and analyzes the passing ions. The detector then translates information of the detected ions into mass-to-charge ratios. Detection of a biomarker typically will involve detection of signal intensity. Thus, both the quantity and mass of the biomarker can be determined.
- SEND Surface-Enhanced Neat Deso ⁇ tion
- SEND probe involves the use of probes comprising energy absorbing molecules that are chemically bound to the probe surface
- the phrase "energy absorbing molecules” denotes molecules that are capable of absorbing energy from a laser deso ⁇ tion/ionization source and, thereafter, contribute to deso ⁇ tion and ionization of analyte molecules in contact therewith.
- the EAM category includes molecules used in MALDI, frequently referred to as “matrix,” and is exemplified by cinnamic acid derivatives, sinapinic acid (SPA), cyano-hydroxy-cinnamic acid (CHCA) and dihydroxybenzoic acid, ferulic acid, and hydroxyaceto-phenone derivatives.
- the energy absorbing molecule is inco ⁇ orated into a linear or cross-linked polymer, e.g., a polymethacrylate.
- the composition can be a co-polymer of ⁇ -cyano-4-methacryloyloxycinnamic acid and acrylate.
- the composition is a co-polymer of ⁇ -cyano-4- methacryloyloxycinnamic acid, acrylate and 3-(tri-ethoxy)silyl propyl methacrylate.
- the composition is a co-polymer of ⁇ -cyano-4- methacryloyloxycinnamic acid and octadecylmethacrylate ("C18 SEND"). SEND is further described in U.S. Patent No. 6,124,137 and PCT International Publication No.
- SEAC/SEND is a version of SELDI in which both a capture reagent and an energy absorbing molecule are attached to the sample presenting surface. SEAC/SEND probes therefore allow the capture of analytes through affinity capture and ionization/deso ⁇ tion without the need to apply external matrix.
- the C18 SEND biochip is a version of SEAC/SEND, comprising a C18 moiety which functions as a capture reagent, and a CHCA moiety which functions as an energy absorbing moiety.
- SELDI Surface-Enhanced Photolabile Attachment and Release
- SEPAR Surface-Enhanced Photolabile Attachment and Release
- the biomarkers can be first captured on a chromatographic resin having chromatographic properties that bind the biomarkers.
- this could include a variety of methods. For example, one could, capture the biomarkers on a cation exchange resin, such as CM Ceramic HyperD F resin, wash the resin, elute the biomarkers and detect by MALDI. Alternatively, this method could be preceded by fractionating the sample on an anion exchange resin before application to the cation exchange resin. In another alternative, one could fractionate on an anion exchange resin and detect by MALDI directly. In yet another method, one could capture the biomarkers on an immuno-chromatographic resin that comprises antibodies that bind the biomarkers, wash the resin to remove unbound material, elute the biomarkers from the resin and detect the eluted biomarkers by MALDI or by SELDI. 3.
- a cation exchange resin such as CM Ceramic HyperD F resin
- Time-of-flight mass spectrometry generates a time-of-flight spectrum.
- the time-of-flight spectrum ultimately analyzed typically does not represent the signal from a single pulse of ionizing energy against a sample, but rather the sum of signals from a number of pulses. This reduces noise and increases dynamic range.
- This time-of-flight data is then subject to data processing.
- data processing typically includes TOF-to-M/Z transformation to generate a mass, spectrum, baseline subtraction to eliminate instrument offsets and high frequency noise filtering to reduce high frequency noise.
- Data generated by deso ⁇ tion and detection of biomarkers can be analyzed with the use of a programmable digital computer.
- the computer program analyzes the data to indicate the number of biomarkers detected, and optionally the strength of the signal and the determined molecular mass for each biomarker detected;
- Data analysis can include steps of determining signal strength of a biomarker and removing data deviating from a predetermined statistical distribution.
- the observed peaks can be normalized, by calculating the height of each peak relative to some reference.
- the reference can be background noise generated by the instrument and chemicals such as the energy absorbing molecule which is set at zero in the scale.
- the computer can transform the resulting data into various formats for display.
- the standard spectrum can be displayed, but in one useful format only the peak height and mass information are retained from the spectrum view, yielding a cleaner image and enabling biomarkers with nearly identical molecular weights to be more easily seen.
- two or more spectra are compared, conveniently highlighting unique biomarkers and biomarkers that are up- or down-regulated between samples. Using any of these formats, one can readily determine whether a particular biomarker is present in a sample.
- Analysis generally involves the identification of peaks in the spectrum that represent signal from an analyte. Peak selection can be done visually, but software is available, as part of Ciphergen's ProteinChip® software package, that can automate the detection of peaks.
- this software functions by identifying signals having a signal- to-noise ratio above a selected threshold and labeling the mass of the peak at the centroid of the peak signal, hi one useful application, many spectra are compared to identify identical peaks present in some selected percentage of the mass spectra.
- One version of this software clusters all peaks appearing in the various spectra within a defined mass range, and assigns a mass (M/Z) to all the peaks that are near the mid-point of the mass (M/Z) cluster.
- Software used to analyze the data can include code that applies an algorithm to the analysis of the signal to determine whether the signal represents a peak in a signal that corresponds to a biomarker according to the present invention.
- the software also can subject the data regarding observed biomarker peaks to classification tree or ANN analysis, to determine whether a biomarker peak or combination of biomarker peaks is present that indicates the status of the particular clinical parameter under examination.
- Analysis of the data may be "keyed" to a variety of parameters that are obtained, either directly or indirectly, from the mass spectrometric analysis of the sample. These parameters include, but are not limited to, the presence or absence of one or more peaks, the shape of a peak or group of peaks, the height of one or more peaks, the log of the height of one or more peaks, and other arithmetic manipulations of peak height data. 4.
- a preferred protocol for the detection of the biomarkers of this invention is as follows.
- the sample to be tested is contacted with an affinity capture probe comprising an cation exchange adsorbent (preferably a CM-10 or WCX-2 ProteinChip array (Ciphergen Biosystems, Inc.)), an anion exchange adsorbent (preferably a Q-10 ProteinChip array (Ciphergen Biosystems, hie.)), a hydrophobic exchange adsorbent (preferably a H50 ProteinChip array (Ciphergen Biosystems, Inc.)) and/or an MAC adsorbent (preferably an MAC30.
- an cation exchange adsorbent preferably a CM-10 or WCX-2 ProteinChip array (Ciphergen Biosystems, Inc.)
- an anion exchange adsorbent preferably a Q-10 ProteinChip array (Ciphergen Biosystems, hie.)
- a hydrophobic exchange adsorbent preferably
- the sample e.g., serum
- an anion exchange chromatographic material such as Q HyperD (BioSepra, SA).
- the bound materials are then subject to stepwise pH elution using buffers at pH 9, pH 7, pH 5 and pH 4. (See, Example 1 - Buffer list.) (The fractions in which the biomarkers are eluted may be indicated in, e.g., Table I.) Various fractions containing the biomarker are collected. Thereafter, the fractions containing the biomarkers are subjected to SELDI analysis as described above.
- antibodies that recognize the biomarker are available, for example in the case of /32-microglobulin, cystatin, transferrin, transthyretin, hemopexin, WT ABri/ADan Amyloid Peptide, full length Cystatin C, Cystatin C ⁇ N1-8, N-terminal fragments of Neurosecretory Protein VGF, Complement 3a des-Arg, C-terminal fragment of Neuroendocrine protein 7B2, and Secretoneurin, these can be attached to the surface of a probe, such as a pre-activated PS 10 or PS20 ProteinChip array (Ciphergen Biosystems, Inc.). These antibodies can capture the biomarkers from a sample onto the probe surface.
- a probe such as a pre-activated PS 10 or PS20 ProteinChip array (Ciphergen Biosystems, Inc.).
- the biomarkers of this invention can be detected by, e.g., laser deso ⁇ tion/ionization mass spectrometry.
- the biomarkers of this invention can be measured by immunoassay. hnmunoassay requires biospecific capture reagents, such as antibodies, to capture the biomarkers. Antibodies can be produced by methods well known in the art, e.g., by immunizing animals with the biomarkers. Biomarkers can be isolated from samples based on their binding characteristics. Alternatively, if the amino acid sequence of a polypeptide biomarker is known, the polypeptide can be synthesized and used to generate antibodies by methods well known in the art.
- This invention contemplates traditional immunoassays including, for example, sandwich immunoassays including ELISA or fluorescence-based immunoassays, as well as other enzyme immunoassays.
- sandwich immunoassays including ELISA or fluorescence-based immunoassays, as well as other enzyme immunoassays.
- a biospecific capture reagent for the biomarker is attached to the surface of an MS probe, such as a pre- activated ProteinChip array. The biomarker is then specifically captured on the biochip through this reagent, and the captured biomarker is detected by mass spectrometry.
- the biomarkers of the invention can be used in diagnostic tests to assess Alzheimer's disease status in a subject, e.g., to diagnose Alzheimer's disease.
- the phrase "Alzheimer's disease status" includes distinguishing, inter alia, Alzheimer's disease v. non- Alzheimer's disease and, in particular, Alzheimer's disease v. non- Alzheimer's disease normal or Alzheimer's disease v. non- Alzheimer's disease dementia. Based on this status, further procedures may be indicated, including additional diagnostic tests or therapeutic procedures or regimens.
- the power of a diagnostic test to correctly predict status is commonly measured as the sensitivity of the assay, the specificity of the assay or the area under a receiver operated characteristic ("ROC") curve.
- Sensitivity is the percentage of true positives that are predicted by a test to be positive, while specificity is the percentage of true negatives that are predicted by a test to be negative.
- An ROC curve provides the sensitivity of a test as a function of 1 -specificity. The greater the area under the ROC curve, the more powerful the predictive value of the test.
- Other useful measures of the utility of a test are positive predictive value and negative predictive value. Positive predictive value is the percentage of actual positives who test as positive. Negative predictive value is the percentage of actual negatives that test as negative.
- the biomarkers of this invention show a statistical difference in different Alzheimer's disease statuses of at least p ⁇ 0.05, p ⁇ IO "2 , p 10 "3 , p ⁇ IO "4 or p ⁇ 10 "5 . Diagnostic tests that use these biomarkers alone or in combination show a sensitivity and specificity of at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98% and about 100%. [0091] Each biomarker listed in Tables I, II and IV are differentially present in Alzheimer's disease, and, therefore, each is individually useful in aiding in the determination of Alzheimer's disease status.
- the method involves, first, measuring the selected biomarker in a subject sample using the methods described herein, e.g., capture on a SELDI biochip followed by detection by mass spectrometry and, second, comparing the measurement with a diagnostic amount or cut-off that distinguishes a positive Alzheimer's disease status from a negative Alzheimer's disease status.
- the diagnostic amount represents a measured amount of a biomarker above which or below which a subject is classified as having a particular Alzheimer's disease status. For example, if the biomarker is up-regulated compared to normal during Alzheimer's disease, then a measured amount above the diagnostic cutoff provides a diagnosis of Alzheimer's disease.
- the biomarker is down-regulated during Alzheimer's disease, then a measured amount below the diagnostic cutoff provides a diagnosis of Alzheimer's disease.
- the biomarker is up-regulated compared to normal during non- Alzheimer's dementia, then a measured amount above the diagnostic cutoff provides a diagnosis of non- Alzheimer's dementia.
- a measured amount below the diagnostic cutoff provides a diagnosis of non- Alzheimer's dementia (i.e., a negative diagnosis of Alzheimer's disease).
- the particular diagnostic cut-off used in an assay by adjusting the particular diagnostic cut-off used in an assay, one can increase sensitivity or specificity of the diagnostic assay depending on the preference of the diagnostician.
- the particular diagnostic cut-off can be determined, for example, by measuring the amount of the biomarker in a statistically significant number of samples from subjects with the different Alzheimer's disease statuses, as was done here, and drawing the cut-off to suit the diagnostician's desired levels of specificity and sensitivity.
- B. Combmations of Markers While individual biomarkers are useful diagnostic biomarkers, it has been found that a combination of biomarkers can provide greater predictive value of a particular status than single biomarkers alone.
- the detection of a plurality of biomarkers in a sample can increase the sensitivity and/or specificity of the test.
- the protocols described in the Examples were used to generate mass spectra from patient samples that were diagnosed with Alzheimer's disease and no dementia. The peak masses and heights were abstracted into a discovery data set. This data set was used to train a learning algorithm employing classification and regression tree analysis (CART) (Ciphergen Biomarker Patterns SoftwareTM). In particular, CART chose many subsets of the peaks at random. For each subset, CART generated a best or near best decision tree to classify a sample as Alzheimer's disease or non-Alzheimer's disease.
- CART classification and regression tree analysis
- FIG. 2 An exemplar decision tree is presented in FIG. 2. This decision tree uses Ml 1753.4 (82 microglobulin, therein "B2M”), M60976.2 (Hemopexin, therein “HPX”), Ml 3391 (Cystatin C, therein “CysC”), Ml 1.1K and M9.7K. Accordingly, these biomarkers are recognized as powerful classifiers for Alzheimer's disease when used in combination with each other and, optionally, with other biomarkers.
- M78677.3 Transferrin
- M2432.2 WT ABri/ADan Amyloid Peptide
- M12583.4 Cystatin C ⁇ N1-8
- M3687.7 N-terminal fragment of Neurosecretory Protein VGF
- M3951.6 N-terminal fragment of Neurosecretory Protein VGF
- M8933.2 Complement 3a des-Arg
- M 3514.5 C-terminal fragment of Neuroendocrine protein 7B2
- M3680.7 secretoneurin
- a decision tree in particular the cutoff values used in making branching decisions, depends on the details of the assay used to generate the discovery data set.
- the data acquisition parameters of the assay that produced the data used in the present analysis is provided in Example 3.
- the operator In developing a classification algorithm from, for example, a new sample set or a different assay protocol, the operator uses a protocol that detects these biomarkers and keys the learning algorithm to include them. [0098] h the decision tree set forth in FIG.
- biomarkers Ml 1753.4 ( ⁇ 2 microglobulin, therein “B2M"), M60976.2 (Hemopexin, therein “HPX”), M13391 (Cystatin C, therein “CysC”), Ml 1. IK and M9.7K. are particularly useful in combination to classify Alzheimer's disease v. non- Alzheimer's disease. This combination is particularly useful in a recursive partitioning process as shown in FIG. 2. Again, the measure of each cut-off depends on the particulars of the assay protocol, of course. In this case, the cut-offs are based on the protocol set forth in Example 3. [0099] In this decision tree, B2M is the root decision node of the decision tree.
- Subjects having an amount of this biomarker above the cut-off are sent to node 4 based on CysC.
- Subjects having an amount of M13391 below the cut-off i.e., CysC ⁇ - 2.071
- Subjects having an amount of M13391 above the cutoff are sent to node 5 based on M9.7K.
- Subjects having an amount of M9.7K above the cut-off are classified as Alzheimer's.
- Subjects having an amount of the biomarker B2M below the cut-off are sent to node 2 based on HPX.
- Subjects having an amount of HPX below the cut- off are sent to node three based on Ml 1.1K.
- this invention provides methods for determining the risk of developing Alzheimer's disease in a subject. Biomarker amounts or patterns are characteristic of various risk states, e.g., high, medium or low.
- this invention provides methods for determining the stage of Alzheimer's disease in a subject. Each stage of the disease has a characteristic amount of a biomarker or relative amounts of a set of biomarkers (a pattern). The stage of a disease is determined by measuring the relevant biomarker or biomarkers and then either submitting them to a classification algorithm or comparing them with a reference amount and/or pattern of biomarkers that is associated with the particular stage.
- this invention provides methods for determining the course of Alzheimer's disease in a subject.
- Disease course refers to changes in disease status over time, including disease progression (worsening) and disease regression (improvement).
- the amounts or relative amounts (e.g., the pattern) of the biomarkers changes.
- concentrations of biomarkers M9984.6 and M10265.6 (Table IV-B) are increased in samples from Alzheimer's patients, while the concentration of hemopexin is decreased in samples from Alzheimer's patients. Therefore, the trend of these markers, either increased or decreased over time toward diseased or non-diseased indicates the course of the disease.
- this method involves measuring one or more biomarkers in a subject at least two different time points, e.g., a first time and a second time, and comparing the change in amounts, if any. The course of disease is determined based on these comparisons. Similarly, this method is useful for determining the response to treatment. If a treatment is effective, then the biomarkers will trend toward normal, while if treatment is ineffective, the biomarkers will trend toward disease indications.
- Subject Management [0109] In certain embodiments of the methods of qualifying Alzheimer's disease status, the methods further comprise managing subject treatment based on the status. Such management includes the actions of the physician or clinician subsequent to determining Alzheimer's disease status.
- a physician makes a diagnosis of Alzheimer's disease
- a certain regime of treatment such as prescription or administration of cholinesterase inhibitors, antiglutamatergic therapy or antioxidants
- a diagnosis of non- Alzheimer's disease or non- Alzheimer's disease dementia might be followed with further testing to determine a specific dementia that might the patient might be suffering from.
- further tests may be called for.
- computers will be used to communicate assay results or diagnoses or both to interested parties, e.g., physicians and their patients.
- the assays will be performed or the assay results analyzed in a country or jurisdiction which differs from the country or jurisdiction to which the results or diagnoses are communicated.
- a diagnosis based on the presence or absence in a test subject of any the biomarkers of Tables I, II, IV-A,B or V is communicated to the subject as soon as possible after the diagnosis is obtained.
- the diagnosis may be communicated to the subject by the subject's treating physician. Alternatively, the diagnosis may be sent to a test subject by email or communicated to the subject by phone.
- a computer may be used to communicate the diagnosis by email or phone.
- the message containing results of a diagnostic test maybe generated and delivered automatically to the subject using a combination of computer hardware and software which will be familiar to artisans skilled in telecommunications.
- One example of a healthcare-oriented communications system is described in U.S. Patent Number 6,283,761; however, the present invention is not limited to methods which utilize this particular communications system.
- all or some of the method steps, including the assaying of samples, diagnosing of diseases, and communicating of assay results or diagnoses may be carried out in diverse (e.g., foreign) jurisdictions.
- data derived from the spectra e.g., mass spectra or time-of-flight spectra
- samples such as "known samples”
- a "known sample” is a sample that has been pre- classified.
- the data that are derived from the spectra and are used to form the classification model can be referred to as a "training data set.”
- the classification model can recognize patterns in data derived from spectra generated using unknown samples. The classification model can then be used to classify the unknown samples into classes.
- the training data set that is used to form the classification model may comprise raw data or pre-processed data.
- raw data can be obtained directly from time-of-flight spectra or mass spectra, and then may be optionally "pre- processed” as described above.
- Classification models can be formed using any suitable statistical classification (or "learning") method that attempts to segregate bodies of data into classes based on objective parameters present in the data. Classification methods may be either supervised or unsupervised.
- supervised and unsupervised classification processes are described in Jain, "Statistical Pattern Recognition: A Review", IEEE Transactions on Pattern Analysis and Machine Intelligence, Vol. 22, No. 1 , January 2000, the teachings of which are inco ⁇ orated by reference. [0115]
- supervised classification fraining data containing examples of known categories are presented to a learning mechanism, which learns one or more sets of relationships that define each of the known classes. New data may then be applied to the learning mechanism, which then classifies the new data using the learned relationships.
- supervised classification processes include linear regression processes (e.g., multiple linear regression (MLR), partial least squares (PLS) regression and principal components regression (PCR)), binary decision trees (e.g., recursive partitioning processes such as CART - classification and regression trees), artificial neural networks such as back propagation networks, discriminant analyses (e.g., Bayesian classifier or Fischer analysis), logistic classifiers, and support vector classifiers (support vector machines).
- LLR multiple linear regression
- PLS partial least squares
- PCR principal components regression
- binary decision trees e.g., recursive partitioning processes such as CART - classification and regression trees
- artificial neural networks such as back propagation networks
- discriminant analyses e.g., Bayesian classifier or Fischer analysis
- logistic classifiers logistic classifiers
- support vector classifiers support vector machines
- the classification models that are created can be formed using unsupervised learning methods.
- Unsupervised classification attempts to learn classifications based on similarities in the training data set, without pre-classifying the spectra from which the training data set was derived.
- Unsupervised learning methods include cluster analyses. A cluster analysis attempts to divide the data into "clusters" or groups that ideally should have members that are very similar to each other, and very dissimilar to members of other clusters. Similarity is then measured using some distance metric, which measures the distance between data items, and clusters together data items that are closer to each other.
- Clustering techniques include the MacQueen's K-means algorithm and the Kohonen's Self- Organizing Map algorithm.
- Learning algorithms asserted for use in classifying biological information are described, for example, in PCT International Publication No. WO 01/31580 (Barnhill et al, "Methods and devices for identifying patterns in biological systems and methods of use thereof), U.S. Patent Application No. 2002 0193950 Al (Gavin et al, "Method or analyzing mass spectra"), U.S. Patent Application No. 2003 0004402 Al (Hitt et al, "Process for discriminating between biological states based on hidden patterns from biological data"), and U.S. Patent Application No.
- the classification models can be formed on and used on any suitable digital computer. Suitable digital computers include micro, mini, or large computers using any standard or specialized operating system, such as a Unix, WindowsTM or LinuxTM based operating system. The digital computer that is used may be physically separate from the mass spectrometer that is used to create the spectra of interest, or it may be coupled to the mass spectrometer. [0120]
- the framing data set and the classification models according to embodiments of the invention can be embodied by computer code that is executed or used by a digital computer.
- the computer code can be stored on any suitable computer readable media including optical or magnetic disks, sticks, tapes, etc., and can be written in any suitable computer programming language including C, C++, visual basic, etc.
- the learning algorithms described above are useful both for developing classification algorithms for the biomarkers already discovered, or for finding new biomarkers for Alzheimer's disease.
- the classification algorithms in turn, form the base for diagnostic tests by providing diagnostic values (e.g., cut-off points) for biomarkers used singly or in combination.
- the present invention provides kits for qualifying
- the kit comprises a solid support, such as a chip, a microtiter plate or a bead or resin having a capture reagent attached thereon, wherein the capture reagent binds a biomarker of the invention.
- the kits of the present invention can comprise mass spectrometry probes for SELDI, such as ProteinChip ® arrays.
- the kit can comprise a solid support with a reactive surface, and a container comprising the biospecific capture reagent.
- the kit can also comprise a washing solution or instructions for making a washing solution, in which the combination of the capture reagent and the washing solution allows capture of the biomarker or biomarkers on the solid support for subsequent detection by, e.g., mass spectrometry.
- the kit may include more than type of adsorbent, each present on a different solid support.
- such a kit can comprise instructions for suitable operational parameters in the form of a label or separate insert. For example, the instructions may inform a consumer about how to collect the sample, how to wash the probe or the particular biomarkers to be detected.
- the kit can comprise one or more containers with biomarker samples, to be used as standard(s) for calibration.
- Calibration of an immunoassay is important for ensuring the quality of results generated in the immunoassay.
- Calibration generally involves the use of an immunoassay calibrator that contains the target analyte in a prescribed amount or concentration.
- the signal produced by the calibrator in an immunoassay is correlated to the amount of target analyte in the calibrator.
- This calibration is used to correlate the amount of signal measured in a test sample with an amount of target analyte in the test sample.
- the signal generated by the calibrator may not represent the true amount of analyte in the calibrator if, for example, the target analyte in the calibrator is degraded or otherwise modified so as to corrupt the signal.
- this invention provides a method for determining the quality of a Cystatin immunoassay calibrator.
- the method involves capturing molecules from a immunoassay calibrator used in an immunoassay against Cystatin with an antibody that captures Cystatin, and specifically measuring the amount of Cystatin or one or more modified forms of Cystatin captured by the antibody.
- the immunoassay could be directed to measuring a particular modified form of Cystatin and involve the use of antibodies against this form and a calibrator that included this form.
- an immunoassay capable of accurately measuring levels of modified Cystatin polypeptides, e.g., Cystatin C ⁇ N1-8, may be used to determine the likelihood that a subject diagnosed with dementia is suffering from Alzheimer's disease as opposed to some form of non- Alzheimer's dementia.
- the invention also provides a method for determining the quality of any immunossay calibrator used in an immunassay against any of the biomarkers disclosed herein, comprising the same steps described above with respect to a Cystatin immunoassay calibrator.
- Immunoassays typically involve the use an immunoassay reagent that comprises an antibody directed against the target analyte.
- the accuracy of such assays depends upon the integrity and purity of the antibody in the immunoassay reagent.
- the presence of contaminants in an antibody reagent can interfere with an accurate measurement of the amount of antibody in the antibody reagent.
- the present invention provides methods for determining the quality of an antibody against an AD biomarker, as used in an immunoassay reagent, by specifically detecting modified, e.g., degraded, forms of the antibody in the reagent.
- the performance of the assay will be tested alone and in combination with other markers to diagnose and monitor treatment of patients, e.g., dementia patients. Initially, different types of dementia samples including AD and non-AD dementias along with aged normal samples will be analysed to determine assay sensitivity and specificity. The utility of the assay will be determined both for cerebrospinal fluid and matched serum samples. The ultimate objectives are to produce a test that will improve the early diagnosis of AD patients, help with stratification of patients for enrollment in clinical trials and provide a surrogate marker for drug treatment response.
- the biomarkers can be used to screen for compounds that modulate the expression of the biomarkers in vitro or in vivo, which compounds in turn maybe useful in treating or preventing Alzheimer's disease in patients, hi another example, the biomarkers can be used to monitor the response to treatments for Alzheimer's disease, hi yet another example, the biomarkers can be used in heredity studies to determine if the subject is at risk for developing Alzheimer's disease.
- kits of this invention could include a solid substrate having an cation exchange function, such as a protein biochip (e.g., a Ciphergen WCX2 ProteinChip array, e.g., ProteinChip array) and a sodium acetate buffer for washing the substrate, as well as instructions providing a protocol to measure the biomarkers of this invention on the chip and to use these measurements to diagnose Alzheimer's disease.
- a protein biochip e.g., a Ciphergen WCX2 ProteinChip array, e.g., ProteinChip array
- a sodium acetate buffer for washing the substrate
- Compounds suitable for therapeutic testing may be screened initially by identifying compounds which interact with one or more biomarkers listed in Tables I, II, IV-A, IV-B or V.
- screening might include recombinantly expressing a biomarker listed in Tables I, II, IV-A, IV-B or V, purifying the biomarker, and affixing the biomarker to a substrate.
- Test compounds would then be contacted with the substrate, typically in aqueous conditions, and interactions between the test compound and the biomarker are measured, for example, by measuring elution rates as a function of salt concentration.
- Certain proteins may recognize and cleave one or more biomarkers of Tables I, II, IV-A, IV-B or V, such as Cystatin C, in which case the proteins may be detected by monitoring the digestion of one or more biomarkers in a standard assay, e.g., by gel electrophoresis of the proteins.
- a test compound to inhibit the activity of one or more of the biomarkers of Tables I, II, IV-A, IV-B, or V may be measured.
- One of skill in the art will recognize that the techniques used to measure the activity of a particular biomarker will vary depending on the function and properties of the biomarker.
- an enzymatic activity of a biomarker may be assayed provided that an appropriate substrate is available and provided that the concentration of the substrate or the appearance of the reaction product is readily measurable.
- the ability of potentially therapeutic test compounds to inhibit or enhance the activity of a given biomarker may be determined by measuring the rates of catalysis in the presence or absence of the test compounds.
- the ability of a test compound to interfere with a non-enzymatic (e.g., structural) function or activity of one of the biomarkers of Tables I, II, IV-A, IV-B or V may also be measured.
- the self-assembly of a multi-protein complex which includes one of the biomarkers of Tables I, II, IV-A, IV-B or V may be monitored by spectroscopy in the presence or absence of a test compound.
- the biomarker is a non- enzymatic enhancer of transcription
- test compounds which interfere with the ability of the biomarker to enhance transcription may be identified by measuring the levels of biomarker- dependent transcription in vivo or in vitro in the presence and absence of the test compound.
- Test compounds capable of modulating the activity of any of the biomarkers of Table I may be administered to patients who are suffering from or are at risk of developing Alzheimer's disease or other dementia's.
- the administration of a test compound which increases the activity of a particular biomarker may decrease the risk of Alzheimer's in a patient if the activity of the particular biomarker in vivo prevents the accumulation of proteins for Alzheimer's disease.
- the administration of a test compound which decreases the activity of a particular biomarker may decrease the risk of Alzheimer's disease in a patient if the increased activity of the biomarker is responsible, at least in part, for the onset of Alzheimer's disease.
- the invention provides a method for identifying compounds useful for the treatment of disorders such as Alzheimer's disease which are associated with increased levels of modified forms of any of the biomarkers of Tables I, II, IV-A, IV-B or V, such as cystatin C.
- cell extracts or expression libraries may be screened for compounds which catalyze the cleavage of full- length biomarkers, e.g., cystatin C, to form truncated forms of the biomarkers, e.g., Cystatin C ⁇ N1-8.
- cleavage of cystatin C may be detected by attaching a fluorophore to cystatin C which remains quenched when cystatin C is uncleaved but which fluoresces when the protein is cleaved between positions 8 and 9.
- a version of full-length cystatin C modified so as to render the amide bond between amino acids 8 and 9 uncleavable may be used to selectively bind or "trap" the cellular protease which cleaves full-length cystatin C at that site in vivo.
- the invention provides a method for treating or reducing the progression or likelihood of a disease, e.g., Alzheimer's disease, which is associated with the increased levels of one or more of the biomarkers described herein, for example, Cystatin C ⁇ l-8.
- a disease e.g., Alzheimer's disease
- the biomarkers described herein for example, Cystatin C ⁇ l-8.
- combinatorial libraries may be screened for compounds which inhibit the cleavage activity of the identified proteins. Methods of screening chemical libraries for such compounds are well-known in art. See, e.g., Lopez-Otin et al. (2002).
- inhibitory compounds maybe intelligently designed based on the structure of cystatin C.
- the compounds tested as modulators of the relative levels of full- length versus truncated biomarkers e.g., cystatin C versus truncated Cystatin C ⁇ l-8, can be any small chemical compound, or a biological entity, such as a protein, sugar, nucleic acid or lipid.
- modulators can be proteases or genetically engineered proteases.
- test compounds will be small chemical molecules and peptides.
- any chemical compound can be used as a potential modulator or binding compound in the assays of the invention, although most often compounds can be dissolved in aqueous or organic (especially DMSO-based) solutions are used.
- the assays are designed to screen large chemical libraries by automating the assay steps and providing compounds from any convenient source to assays, which are typically run in parallel (e.g., in microtiter formats on microtiter plates in robotic assays). It will be appreciated that there are many suppliers of chemical compounds, including Sigma (St. Louis, MO), Aldrich (St. Louis, MO), Sigma- Aldrich (St. Louis, MO), Fluka Chemika-Biochemica Analytika (Buchs, Switzerland) and the like. [0140] Where the modification of a particular biomarker is associated with
- the modulating enzyme can be similarly targeted by compounds which inhibit the modulating enzyme's activity, specifically or generally.
- the activity of the appropriate modulating enzyme may be increased by the addition of exogenous compounds which enhance the activity of the modulating enzyme, directly or indirectly, or by the recombinant addition of the appropriate modulating enzyme(s).
- high throughput screening methods involve providing a combinatorial chemical or peptide library containing a large number of potential therapeutic compounds (potential modulator or binding compounds). Such "combinatorial chemical libraries" are then screened in one or more assays, as described herein, to identify those library members (particular chemical species or subclasses) that display a desired characteristic activity.
- a combinatorial chemical library is a collection of diverse chemical compounds generated by either chemical synthesis or biological synthesis, by combining a number of chemical "building blocks” such as reagents.
- a linear combinatorial chemical library such as a polypeptide library is formed by combining a set of chemical building blocks (amino acids) in every possible way for a given compound length (i.e., the number of amino acids in a polypeptide compound). Millions of chemical compounds can be synthesized through such combinatorial mixing of chemical building blocks.
- combinatorial chemical libraries include, but are not limited to, peptide libraries (see, e.g., U.S. Patent No. 5,010,175, Furka, Int. J. Pept. Prot. Res. 37:487-493 (1991) and Houghton et al, Nature 354:84-88 (1991)).
- Other chemistries for generating chemical diversity libraries can also be used. Such chemistries include, but are not limited to: peptoids (e.g., PCT Publication No. WO 91/19735), encoded peptides (e.g., PCT Publication No.
- WO 93/20242 random bio-oligomers (e.g., PCT Publication No. WO 92/00091), benzodiazepines (e.g., U.S. Pat. No. 5,288,514), diversomers such as hydantoins, benzodiazepines and dipeptides (Hobbs et al, Proc. Nat. Acad. Sci. USA 90:6909-6913 (1993)), vinylogous polypeptides (Hagihara et al, J. Amer. Chem. Soc. 114:6568 (1992)), nonpeptidal peptidomimetics with glucose scaffolding (Hirschmann et al, J. Amer. Chem. Soc.
- cystatin C is believed to bind to and inhibit the activity of human lysosomal proteases such as cathepsins B and L. N-terminal truncations of cystatin C are thought to diminish cystatin C's protease inhibitory activity. See, e.g., Abrahamson et al. (Biochem. J. 273:621-626 (1991)).
- the invention provides methods for identifying compounds which increase the affinity of truncated cystatin C for its target proteases, e.g., various cathepsins. For example, compounds may be screened for their ability to impart truncated cystatin C with the protease inhibitory activity of full-length cystatin C.
- test compounds capable of modulating the inhibitory activity of cystatin C or the activity of molecules which interact with cystatin C may then be tested in vivo for their ability to slow or stop the progression of Alzheimer's disease in a subject.
- screening a test compound includes obtaining samples from test subjects before and after the subjects have been exposed to a test compound. The levels in the samples of one or more of the biomarkers listed in Table I may be measured and analyzed to determine whether the levels of the biomarkers change after exposure to a test compound. The samples may be analyzed by mass spectrometry, as described herein, or the samples may be analyzed by any appropriate means known to one of skill in the art.
- the levels of one or more of the biomarkers listed in Table I may be measured directly by Western blot using radio- or fluorescently-labeled antibodies which specifically bind to the biomarkers.
- changes in the levels of mRNA encoding the one or more biomarkers may be measured and correlated with the administration of a given test compound to a subject.
- the changes in the level of expression of one or more of the biomarkers may be measured using in vitro methods and materials.
- human tissue cultured cells which express, or are capable of expressing, one or more of the biomarkers of Tables I, II, IV-A, IV-B or V maybe contacted with test compounds.
- test compounds will be routinely examined for any physiological effects which may result from the treatment.
- the test compounds will be evaluated for their ability to diminish the likelihood of disease in a subject.
- test compounds will be administered to subjects who have previously been diagnosed with Alzheimer's disease, test compounds will be screened for their ability to slow or stop the progression of the disease.
- Non-invasive medical imaging techniques such as Positron Emisson Tomography (PET) or single photon emission computerized tomography (SPECT) imaging are particularly useful for the detection of cancer, coronary artery disease and brain disease.
- PET and SPECT imaging shows the chemical functioning of organs and tissues, while other imaging techniques - such as X-ray, CT and MRI - show structure.
- imaging techniques - such as X-ray, CT and MRI - show structure.
- the use of PET and SPECT imaging has become increasingly useful for qualifying and monitoring the development of brain diseases such as Alzheimer's disease.
- the use of PET or SPECT imaging allows Alzheimer's disease to be detected several years earlier than the onset of symptoms.
- the peptide biomarkers disclosed herein, or fragments thereof, can be used in the context of PET and SPECT imaging applications. After modification with appropriate tracer residues for PET or SPECT applications, peptide biomarkers which interact with amyloid plaque proteins can be used to image the deposition of amyloid plaques in Alzheimer's patients.
- the AD biomarker alpha(l)-antichymotrypsin (ACT) is associated with neurotoxic amyloid deposits.
- the M4357 ACT CT fragment described in Table IV-B, or a sub-fragment thereof, may therefore be used as a probe for PET or SPECT imaging applications.
- EXAMPLE 1 DISCOVERY OF BIOMARKERS FOR ALZHEIMER'S DISEASE
- the protocols described in the Example below were used to generate mass spectra from 65 Swedish patient samples, 30 of whom were diagnosed with Alzheimer's disease and 35 of whom did not exhibit dementia.
- patients were diagnosed as AD patients according to NINCDS-ADRDA criteria, which includes cognitive testing, routine blood and urine tests, MRI or CT imaging when applicable, and measurements of CSF Tau and A-Beta(42). Severity of dementia assessed using Mini Mental State Examination (MMSE).
- MMSE Mini Mental State Examination
- the 30 Alzheimer's samples were taken from patients with an average MMSE of 21 (range from 5 to 30).
- the 35 control patients were age-matched, with a mean MMSE of 29 (range from 25-30).
- Anion Exchange Fractionation Buffer List for anion exchange fractionation UI (1M urea, 0.22% CHAPS, 50mM Tris-HCl pH9) 50mM Tris-HCl with 0.1% OGP pH9 (Wash buffer 1) 50mM Hepes with 0.1% OGP pH7 (Wash buffer 2) lOOmM NaAcetate with 0.1% OGP pH5 (Wash buffer 3) lOOmM NaAcetate with 0.1% OGP pH4 (Wash buffer 4) 33.3% isopropanol/ 16.7% acetonitrile/ 0.1% trifluoracetic acid (Wash buffer 5) Note: do not aliquot wash buffer 5 into the buffer tray until wash buffer 4 is being applied to the resin. This ensures that evaporation of the volatile organic solvents will not be an issue.
- Fraction 1 contains the flow through and the pH 9 eluant.
- Fraction 2 contains the pH 7 eluant.
- Fraction 3 contains the pH 5 eluant
- Fraction 4 contains the pH 4 eluant.
- Bind CSF fractions to chips Add 60 ⁇ L of corresponding buffer into each well
- Chip Washing Buffer list IMAC3 array (Ciphergen Biosystems, Inc.) lOOmM CuSO 4 lOOmM Sodium Phosphate + 0.5M NaCl pH 7
- Energy absorbing molecule 50% SPA Set high mass to 100000 Daltons, optimized from 2000 Daltons to 100000
- biomarkers were determined as follows. Proteins were separated on an acrylamide gel and a band containing the biomarker was cut out of the gel. The protein in the band was destained. The gel was dried using acetonitrile and then subject to digestion in a solution of trypsin. The digest fragments were analyzed on a Ciphergen PBSII mass spectrometer. The determined masses were used to interrogate a protein database, which identified the protein having the same tryptic digest pattern. All of these identifications were further confirmed by tandem MS analysis. Finally, the identity of ⁇ - microglobulin was determined by antibody capture. Antibodies were bound to Ciphergen PS20 ProteinChip arrays, which have reactive epoxide surfaces.
- the amino acid sequence of C4ades-Arg was determined by direct sequencing.
- the amino acid sequence of C4ades-Arg is as follows: NVNFQK-AJNEKLGQYASPTAKRCCQDGVTRLPMMRSCEQRAARVQQ PDCREPFLSCCQFAESLRKKSRDKGQAGLQ (SEQ ID NO:l) (theoretical MW is 8607.88 Da).
- CSF cerebrosprinal fluid
- EXAMPLE 3 DISCOVERY OF ADDITIONAL BIOMARKERS FOR ALZHEIMER'S DISEASE
- 237 CSF samples from Swedish and Finnish patients were used. These samples included: 98 samples from patients with Alzheimer's Disease (including 83 very mild cases with MMSE >24), 31 samples from patients with Frontotemporal Dementia (FTD), 29 samples from patients with dementia with Lewy Body (DLB), and 79 age-matched normal individuals including 9 depression controls. Diagnoses were made according to the NLNCDS-ADRDA criteria discussed in the preceding Examples. The 237 samples were randomly divided into sets for training (2/3) and blind testing (1/3).
- the chips used were Ciphergen's MAC30 (activated with copper or nickel), Q10, CM 10 and H50 ProteinChips.
- the samples were run in triplicate using multiple data collection settings using two different types of Energy Absorbing Molecules (EAM).
- EAM Energy Absorbing Molecules
- a pooled normal reference CSF sample was run in parallel with clinical samples to monitor inter- and intra-assay reproducibility. All samples were processed and analyzed using a ProteinChip
- MAC30 array (Ciphergen Biosystems, Inc.): lOOmM CuSO 4 orNiSO , as appropriate lOOmM Sodium Phosphate + 0.5M NaCl pH 7
- H50 array (Ciphergen Biosystems, Inc.): 10% Acetonitrile + 0.1% TFA
- CM10 array (Ciphergen Biosystems, Inc.): 1 OOmM Sodium Acetate pH 4
- Bind CSF fractions to arrays Add 45 ⁇ l chip washing buffer appropriate to the array to each well
- SPA For SPA a. Add 400 ⁇ L of 50% acetonitrile, 0.5% TFA to SPA tube. b. Mix 5 min at room temperature. c. Add l ⁇ L to each spot. d. Air dry. e. Add l ⁇ L to each spot. f. Air dry.
- CM10 Equilibrate arrays 1. Add 100 ⁇ L 100 mM Sodium acetate pH 4 to each well. 2. Mix 5 min at room temperature. 3. Remove buffer after mixing. 4. Add 100 ⁇ L 100 mM Sodium acetate pH 4 to each well. 5. Mix 5 min at room temperature. 6. Remove buffer after mixing.
- SPA For SPA a. Add 400 ⁇ L of 50% acetonitrile, 0.5% TFA to SPA tube. b. Mix 5 min at room temperature. c. Add 1 ⁇ L to each spot. d. Air dry. e. Add l ⁇ L to each spot. f. Air dry.
- the protocol for the MAC30 ProteinChips is essentially the same as that given for the MAC3 ProteinChip except that, as with the all the chips in this Example, the anion exchange fractionation step as been eliminated.
- the MAC30 ProteinChip is an alternative to the MAC3 arrays with the added feature of a hydrophobic barrier for sample containment. Like the MAC3 arrays, the MAC30 arrays are activated with transition metals (e.g., copper or nickel) prior to use.
- CHCA Set Detector Voltage 2850 Volts Set high mass to 200000 Daltons, optimized from 1000 Daltons to 200000 Daltons. Set starting laser intensity to 170. Set starting detector sensitivity to 7. Focus mass at 4000 Daltons. Set Mass Deflector to 1000 Daltons. Set data acquistion method to Seldi Quantitation Set Seldi acquisition parameters 22. delta to 5. transients per to 5 ending position to 82. Set warming positions with 2 shots at intensity 220 and Don't include warming shots. Process sample. SPA low
- Set warming positions with 2 shots at intensity 220 and Don't include warming shots.
- Set warming positions with 2 shots at intensity 220 and Don't include warming shots.
- IC IMAC chip activated with Cu
- IN - IMAC chip activated wit Ni
- H - H50 chip C - CM10 chip
- Q - Q10 chip ' and "s" refer to the use of the energy absorbing molecules SPA and CHCA, respectively.
- Figure 4A-K shows the distribution of peak intensities observed for the various groups and the results of Mann- Whitney or Kruskal-Wallis tests used to determine the significance of any differences observed.
- Figure 9 shows examples of mass spectra obtained for many of the biomarkers of Table IV-A and IV-B.
- Biomarkers were purified using combinations of chromatography techniques employing a range of Biosepra sorbents typically followed by 1D-SDS-PAGE. The purification schemes were monitored using a ProteinChip system to track biomarkers of interest. For proteins smaller than 30 kDa, intact bands of interest were extracted from gels and reanalyzed using the ProteinChip Reader to confirm the mass matched with the original biomarker. The gel-extracted proteins were in- solution digested with trypsin and proteins larger than 30 kDa were in-gel digested.
- Tryptic digests were analyzed by peptide mapping using the ProteinChip Reader and by tandem MS using a Q-STAR (Applied Biosystems) instrument fitted with a PCI-1000 ProteinChip Interface. Biomarkers smaller than 4 kDa were enriched by combinations of chromatography techniques and identified directly by tandem MS without SDS-P AGE purification and/or trypsin digestion. [0166] For instance, the following peptides/proteins were identified: [0167] Ml 1727: This protein was identified as ⁇ 2 microglobulin (Swiss-Prot accession number P01884, http://us.expasy.org/cgi-bin niceprot.pl7P01884), which finding is consistent with the findings of Example 1 and 2.
- ⁇ 2 microglobulin is a potential initiator of inflammatory responses in that (1) it directs intracellular transport of major histocompatibility complex class I molecules; and (2) it is modulated by interferons and certain cytokines that also play an important role in inflammation. Its role as a CSF biomarker for AD has previously been discussed. However, it has now been identified as a biomarker for AD in blood. [0168] M3680.7: This peptide was identified as a Secretogranin II peptide (also known as secretoneurin), which has the italicized sequence of SEQ LO NO:2.
- Secretogranin II is a large dense-core synaptic vesicle protein.
- the levels of secretogranin II were observed to decrease in the temporal cortex of AD patients vs. age-matched controls.
- One of the main features of AD is a degeneration of synapses.
- the levels of secretoneurin peptide in CSF may therefore reflect synaptic loss. This loss of synapses, reflected by early cognitive impairments, precedes the appearance of extra cellular focal deposits of beta- amyloid peptide in the brain of patients.
- M78677.3 This protein was identified as Transferrin (Swiss-Prot accession number P02787), which is consistent with the findings of Example 1.
- Transferrin is a major transport protein for iron, which is a major factor in free radical generation and oxidative stress in neurodegenerative diseases. Transferrin levels increase in AD frontal cortex, compared with elderly controls. C2 allele associated with AD in ApoE4 negative subjects. ApoE and Transferrin may be part of a complex mechanism in the pathogenesis of Alzheimer's disease.
- M2431.2 This peptide was identified as a truncated ABri/ADan amyloid peptide of Integral Membrane Protein 2B (MMP2B or BRI), which has the underlined sequence of SEQ ID NO:3. The exact physiological role in the brain is yet to be fully understood.
- M13391 peptide was identified to be full-length Cystatin C, which has the italicized sequence of SEQ ID NO:4. Cystatin C is found in most bodily fluids and tissues and is a marker of renal function in urine. Cystatin C inhibits activity of lysosomal cysteine proteases (Cathepsins).
- Cystatin-C/Cathepsin balance is important for many disease processes including inflammation, cancer and AD.
- Cystatin C is associated with AD. For instance, CST3 B/B homozygosity is associated with an increased risk of developing AD; Cystatin C increases in AD brain at neuronal sites most susceptible to cell death in AD independent of cystatin C genotype; and Cystatin C co-localizes with A-beta in AD brain denosits. 10172]
- M12583.4 This peptide was identified as a truncated Cystatin C peptide, which has the underlined sequence of SEQ ID NO:4.
- This truncated Cys-C which lacks the first eight N-terminal residues, has a 20-fold lower affinity for Cathepsin B, but not other cathepsins.
- Cathepsin B plays key role in AD. It is identified in most early endosomes in Alzheimer brains, but detectable in only a minor proportion of endosomes in normal brain. Specific cathepsin B inhibitors abolish neurotoxic effects caused by Abeta42-activated microglial cells. It has been found that this truncated Cys-C is a biomarker for AD in both CSF and blood. This is the first time this 8aa N-terminal truncated version has been described in CSF or blood.
- M3951.6 This peptide was identified to be a N-terminal fragment of the Neurosecretory protein VGF, which has the italicized sequence of SEQ ID NO:5. Similarly, the M3687.7 peptide was identified to be a N-terminal fragment of Neurosecretory protein VGF (-3amino acids), which has the bolded sequence of SEQ ID NO:5.
- the Neurosecretory protein VGF is a nerve growth factor selectively synthesized in neuroendocrine and neuronal cells. VGF mRNA levels are regulated by neuronal activity, including long-term potentiation, seizure, and injury. The sequence is rich in paired basic amino acid residues that are potential sites for proteolytic processing. Such fragments appear to be novel.
- M60976.2 This protein was identified as Hemopexin (Swiss-Prot accession number P02790). Hemopexin is an acute phase reactant protein induced after inflammation by IL-6; a scavenger/transporter of heme to prevent heme-mediated oxidative stress; and also believed to play a role in nerve repair.
- M8933.2 This peptide was identified to be C3a anaphylatoxin desArg, which has the underlined sequence of SEQ ID NO: 6. The full-length sequence for the C3a anaphylatoxin peptide is the italicized sequence of SEQ ID NO: 6.
- Complement activation known to occur in the AD brain (1) contributes to the development of a local inflammatory state; and (2) correlated with cognitive dysfunction.
- Localization and potential mechanism for C3 in AD brain (1) protein expression increases (5-10 fold) in cultured mice microglial cells in response to A-Beta synthetic peptides; and (2) inhibition of C3 in hAPP mice increases plaque deposition and neuronal degeneration - potential role in clearance.
- This peptide is a novel complement protein fragment marker of AD.
- M3514.5 This peptide was identified as a C-terminal fragment of Neuroendocrine protein 7B2, which has the underlined sequence of SEQ ID NO: 7.
- the C- terminal fragment corresponds to amino acids 182-212; the full-length protein has the italicized sequence of SEQ ID NO: 7.
- a marked decrease in the ratio of the PC2 precursor to the total enzymatic pool is observed in the frontal cortex of Alzheimer patients. This decrease coincides with an increase in the binding protein 7B2.
- a somatostatin deficit occurs in the cerebral cortex of Alzheimer's disease patients without a major loss in somatostatin- containing neurons. This deficit could be related to a reduction in the rate of proteolytic processing of peptide precursors. There is a body of evidence to suggest that certain forms of somatostatin in CSF correlate with dementia severity. [0177] M3912.8: This peptide was identified as a fragment of chromogranin A (CMGA_HUMAN (SwissProt # PI 0645)) corresponding to the italicized sequence in SEQ ID NO: 8.
- the underlined sequence in SEQ ID NO: 8 is vasostatin I.
- the protein consisting of the underlined sequence and the italicized sequence is vasostatin II, a fragment of chromogranin A with vasoinhibitory properties.
- Chromogranin A is the major protein of large dense-core synaptic vesicles.
- the ratio of chromogranin A to secretogranin II in the temporal cortex is significantly correlated to the clinical severity of dementia and to the extent of neuropathological changes.
- the levels of the vasostatin II peptide in CSF may reflect synaptic loss.
- M4352.4 This peptide was identified as a C-terminal fragment of alpha-1-antichymotrypsin (SwissProt # P01011; theoretical MW 4354.19 Da; SEQ ID NO: 9). This is an acute phase/inflammatory protein ove ⁇ roduced in the AD brain that can promote the formation of, and is associated with, neurotoxic amyloid deposits. Increase in brain levels is reflected by higher levels in the CSF. The peptide was directly sequenced and the identify was confirmed using an anti-alpha-1-antichymotrypsin antibody. [0179] M21100.1 : This protein was identified as full-length Retinol-binding protein (SwissProt # P02753; theoretical.
- M8575, M8292, M8184 These proteins were identified as ubiquitin and C-terminus fragments thereof.
- Neurofibrillary tangles are composed of a hype ⁇ hosphorylated and ubiquitinated form of tau protein. With maturation, tau-based neurofibrillary tangles are increasingly ubiquitinated. Levels of tau and conjugated ubiquitin are elevated both in AD brain and CSF. CSF-ubiquitin levels are also associated with increasing degree of cortical and central brain atrophy as measured by computerized tomography.
- M4971 This protein was identified as an N-acetylated form of
- Thymosin beta-4 (the N-terminal serine is acetylated). It is thought that Thymosin beta-4 may act as a marker for activated microglia, a central part of the chronic inflammatory processes in AD.
- SEQ LO: 10 The amino acid sequence of this protein is shown as SEQ LO: 10 (SwissProt Accession Number P62328).
- M13960 and M14110 These biomarkers were identified as full-length
- Transthyretin S-Cys (and/or S-CysGly) and Transthyretin S-gluathionylated proteins, respectively.
- Transthyretin has been previously characterized as an A-beta sequestering protein which is present at lower concentrations in the CSF of AD patients versus healthy controls. This decrease is negatively correlated with senile plaque abundance.
- M6502 and 7262 These biomarkers were identified as fragments of
- ChB Chromogranin B peptide found in neuronal large dense-core vesicles. ChB is highly processed by prohormone convertase (PC) enzymes to form smaller peptides from the precursor protein. A disease associated imbalance in PC enzymes could lead to changes in the processing of chromogranin proteins. Chromogranin proteins (ChA, ChB and Secretograninll) show distinct changes in their distribution in the brains of AD patients and are often associated with amyloid plaques. Chromogranin peptides including ChB have a potential as neuronal markers for synaptic degeneration in Alzheimer's disease.
- PC prohormone convertase
- M7658 and M7738 These biomarkers are Osteopontin C-terminal fragments, unphosphorylated and singly phosphorylated species respectively. Osteopontin is a cytokine regulating tissue repair that may play a key role in the pathogenesis of neuroinflammation.
- M17380 This biomarker is a dimer of Apolipoprotein A-II. ApoA-II forms a complex with the protein ApoE which binds strongly to a-beta possibly playing a role in clearance. Levels of ApoA-II have previously been shown to be decreased in the serum of dementia patients.
- M23477 This biomarker is prostaglandin D-synfhase, a glycoprotein also known as beta-trace protein that catalyzes the formation of prostaglandin D2 (PGD2) from PGffi.
- PPD2 prostaglandin D2
- 7653 Da/7718 Da IMAC-Cu SPA: This protein was identified as a C- terminal fragment of Osteopontin (SwissProt# P10451, MW 7658.19 Da; SEQ ID NO: 11). Osteopontin is known to be extensively phosphorylated at serine residues. The 7653 Da is an unphosphorylated form, while the 7718 Da is a phosphorylated peptide.
- 7258 Da (Q10 SPA): This protein is a processed fragment of Chromogranin B (Secretogranin I; SG1_HUMAN (SwissProt# P05060)). The sequence highlighted in bold in SEQ ID NO: 12 corresponds to the 7258 Da biomarker. Three underlined fragments were identified by MSMS with high scores. Y341 is sulfotyrosine, therefore the predicted MW is 7262.42 Da. The biochemistry to generate this peptide is exactly the same as for the 6502 Da peptide.
- the 7262 Da peptide sequence is flanked by cleavage sequences for prohormone convertase 1/3 and prohormone convertase 2: -KK-, - RR-, and -KR- (and carboxypeptidase H trims C-terminal Lys and Arg).
- 23 kDa biomarker This protein is Prostaglandin-H2 D-isomerase (SwissProt# P41222). The predicted MW is 18.7 kDa, but the protein is very heavily glycosylated.
- 17.3 kDa biomarker This protein is a Cys-Cys dimer of Apolipoprotein A-II (SwissProt# P02652).
- the MW of the plain monomer is 8707.91 Da, however the N-terminal Q is known to be modified to pyrrolidone carboxylic acid (-17 Da). Therefore the dimer of two full-length monomers is 17379.82 Da.
- 9.8 kDa (Q10 SPA) The protein was identified as the EA-92 peptide of Chromogranin A (SwissProt# P 10645, MW 9730.18 Da; SEQ ID NO: 13). The sequence highlighted in bold in SEQ LO NO: 13 corresponds to the 9730 Da biomarker. Three fragments underlined were identified by MSMS with high scores.
- the 9730 Da peptide sequence is flanked by cleavage sequences for prohormone convertase 1/3 and prohormone convertase 2. Note that the 9.8 kDa biomarker (Q10) is not the same as the 9750 Da biomarker which appears under other (CM10, H50) assay conditions.
- 4812 Da (Q10) This biomarker was identified as processed fragment of VGF nerve growth factor inducible precursor (NCBI# gil7136078, MW 4808.80 Da; SEQ LD NO: 14). The sequence highlighted in bold in SEQ ID NO: 14 corresponds to the 4808 Da biomarker. Two fragments underlined were identified by MSMS and cover all the sequence of the peptide.
- 4320 (LMAC-Ni): This biomarker was identified as A-beta 1-40 peptide (MW 4329.86 Da). This peak was found in Q fraction 3 using MAC-Ni array, purified by RPC, YM30, and SDS-PAGE, digested with trypsin, and major ions in the digest were identified as fragments of Amyloid beta A4 precursor (SwissProt# P05067; SEQ ID NO: 15). The sequence in SEQ ID NO: 15 highlighted in bold corresponds to the 4330 Da biomarker.
- 16.2 kDa (MAC-Cu): This biomarker is glycosylated Pancreatic Ribonuclease (SwissProt# P07998). All peaks after the 16.2 kDa peak co-purify as an entity and appear to be various glycosylation forms. Ribonuclease is known to be only partially glycosylated. The 14.6 kDa peak, which co-purifieds with the 16.2 kDa biomarker, corresponds to the plain non-glycosylated form of Pancreatic Ribonuclease (MW 14,574.33 Da).
- plaque "related" proteins/peptides BRI membrane protein (fragment); A-Beta (fragments/forms); Cystatin C and truncated Cystatin-C (fragment); secreteoneurin; vasostatin II; ubiquitin and ubiquitin fragments; neuroendocrine protein 7B2; and
- Complement 3a protein fragment
- Transferrin full-length
- Hemopexin full-length
- Sample Protocol 1 Manually apply 2 ⁇ L of a solution containing 0.25 mg/mL of Cystatin C antibody to each spot of an PS-20 array (Ciphergen Biosystems, Inc., Fremont, CA). For a negative control, use the same concentration of IgG on another spot. 2. Incubate for 2 h in a humidity chamber at room temperature to allow the antibodies to covalently bind to the spots. 3. Transfer the bioprocessor to Biomek 2000 liquid handling robot. 4. Block residual active sites by adding 25 ⁇ L 1 M ethanolamine. Incubate for 30 min at room temperature in a humidity chamber. 5. Remove unbound proteins by washing the array with 3 times 100 ⁇ L PBS + 0.5% Triton X-1005 min. each. 6.
- CysC ⁇ l-8 As a marker for Alzheimer's disease, 158 cerebrospinal fluid (CSF) samples were taken from pre-diagnosed subjects in three groups: (1) Alzheimer's disease (AD), Control, and Non- Alzheimer's dementia (Non AD). The distribution of samples in these groups is shown in Table III, above.
- SELDI-MS measurements of CysC ⁇ l-8 in each of the samples were obtained according to standard protocols, using a Ciphergen H50 ProteinChip and 50% SPA as an EAM. The results are shown in the graph at the bottom left in Figure 11. Similar measurements of full-length CysC were also made using the same set of samples ( Figure 11, bottom right). The results show that the levels of CysC ⁇ l-8 in subjects suffering from Alzheimer's disease are significantly higher than the levels in subjects suffering from non- Alzheimer's dementia.
- a combination of biomarkers can provide greater predictive value of a particular status than single biomarkers alone.
- a plurality of biomarkers in a sample can increase the sensitivity and/or specificity of the test.
- a preferred set of biomarkers for qualifying Alzheimer's status in a patient is one in which the biomarkers of the set are regulated in vivo independently of each other.
- a prefened test has greater than 80%o sensitivity and specificity. Even more preferred are tests where both the sensitivity and specificity are greater than 90%.
- One example of a set of biomarkers which is preferred for a combination test includes M17349.3 (Apolipoprotein A-FI dimer), M60464.7 (Hemopexin), and M3513.9 (7B2 CT fragment).
- Another example of a preferred set of biomarkers is the set which includes M17349.3 (Apolipoprotein A-II dimer), M60464.7 (Hemopexin), M10379.8 (10.3 kDa) and Ml 1725.7 (Beta-2-Microglobulin).
Landscapes
- Life Sciences & Earth Sciences (AREA)
- Health & Medical Sciences (AREA)
- Engineering & Computer Science (AREA)
- Molecular Biology (AREA)
- Physics & Mathematics (AREA)
- Biomedical Technology (AREA)
- Chemical & Material Sciences (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Immunology (AREA)
- Urology & Nephrology (AREA)
- Hematology (AREA)
- Bioinformatics & Computational Biology (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Analytical Chemistry (AREA)
- Biochemistry (AREA)
- Cell Biology (AREA)
- Biotechnology (AREA)
- Food Science & Technology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Biophysics (AREA)
- Microbiology (AREA)
- Pathology (AREA)
- General Physics & Mathematics (AREA)
- Spectroscopy & Molecular Physics (AREA)
- Neurology (AREA)
- Neurosurgery (AREA)
- Optics & Photonics (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Public Health (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Organic Chemistry (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Psychiatry (AREA)
- Veterinary Medicine (AREA)
- Hospice & Palliative Care (AREA)
- Investigating Or Analysing Biological Materials (AREA)
- Other Investigation Or Analysis Of Materials By Electrical Means (AREA)
Priority Applications (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP04810948.2A EP1694816B1 (en) | 2003-11-07 | 2004-11-06 | Biomarkers for alzheimer's disease |
| JP2006538558A JP4796967B2 (ja) | 2003-11-07 | 2004-11-06 | アルツハイマー病のためのバイオマーカー |
Applications Claiming Priority (14)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US51836003P | 2003-11-07 | 2003-11-07 | |
| US60/518,360 | 2003-11-07 | ||
| US52675303P | 2003-12-02 | 2003-12-02 | |
| US60/526,753 | 2003-12-02 | ||
| US54642304P | 2004-02-19 | 2004-02-19 | |
| US60/546,423 | 2004-02-19 | ||
| US54725004P | 2004-02-23 | 2004-02-23 | |
| US60/547,250 | 2004-02-23 | ||
| US55889604P | 2004-04-02 | 2004-04-02 | |
| US60/558,896 | 2004-04-02 | ||
| US57261704P | 2004-05-18 | 2004-05-18 | |
| US60/572,617 | 2004-05-18 | ||
| US58650304P | 2004-07-08 | 2004-07-08 | |
| US60/586,503 | 2004-07-08 |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2005047484A2 true WO2005047484A2 (en) | 2005-05-26 |
| WO2005047484A3 WO2005047484A3 (en) | 2007-06-07 |
Family
ID=34596275
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2004/037994 Ceased WO2005047484A2 (en) | 2003-11-07 | 2004-11-06 | Biomarkers for alzheimer's disease |
Country Status (4)
| Country | Link |
|---|---|
| US (2) | US7794948B2 (https=) |
| EP (3) | EP2369347A1 (https=) |
| JP (2) | JP4796967B2 (https=) |
| WO (1) | WO2005047484A2 (https=) |
Cited By (26)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2006138325A2 (en) | 2005-06-16 | 2006-12-28 | Vermillion, Inc. | Fragment of neurosecretory protein vgf as a biomarker for alzheimer's disease |
| WO2007012052A1 (en) * | 2005-07-20 | 2007-01-25 | Medical College Of Georgia Research Institute | Use of protein profiles in disease diagnosis and treatment |
| WO2007098585A1 (en) * | 2006-02-28 | 2007-09-07 | Phenomenome Discoveries Inc. | Methods for the diagnosis of dementia and other neurological disorders |
| WO2007105442A1 (ja) * | 2006-02-22 | 2007-09-20 | Kyowa Hakko Kogyo Co., Ltd. | 摂食障害または摂水障害の治療薬 |
| JP2008546701A (ja) * | 2005-06-14 | 2008-12-25 | イェシバ・ユニバーシティ | Aβ産生へのBRI蛋白の効果 |
| JP2009529694A (ja) * | 2006-03-11 | 2009-08-20 | ザ ボード オブ トラスティーズ オブ ザ レランド スタンフォード ジュニア ユニバーシティー | 末梢性の動脈疾患のためのバイオマーカーとしてのβ−2ミクログロブリン |
| WO2010034072A1 (en) * | 2008-09-26 | 2010-04-01 | The University Of Melbourne | Alzheimer's disease biomarkers |
| EP2373999A4 (en) * | 2008-12-09 | 2012-11-07 | Stephanie Fryar-Williams | NEW BIOMARKERS |
| US8497074B2 (en) | 2008-10-10 | 2013-07-30 | Universitetet I Oslo | Granin proteins as markers of heart disease |
| US20140030274A1 (en) * | 2011-04-05 | 2014-01-30 | Alphabeta Ab | Amyloidosis target useful in methods of treatment and for screening of compounds |
| US8753607B2 (en) | 2008-03-21 | 2014-06-17 | Manuela G. Neuman | Methods and kits for the differential diagnosis of Alzheimer's disease versus frontotemporal dementia and for the diagnosis of frontotemporal dementia, comprising FAS-L and CK 18 as biomarkers |
| US9034923B2 (en) | 2007-02-08 | 2015-05-19 | Phenomenome Discoveries Inc. | Methods for the treatment of senile dementia of the alzheimer's type |
| US9062101B2 (en) | 2010-08-14 | 2015-06-23 | AbbVie Deutschland GmbH & Co. KG | Amyloid-beta binding proteins |
| EP2657706A4 (en) * | 2010-12-22 | 2015-11-04 | Mcbi Inc | BIOMARKER FOR DISEASES RELATED TO COGNITIVE DYSFUNCTION AND METHOD FOR DETECTING DISEASES CONNECTED WITH COGNITIVE DYSFUNCTION THROUGH THIS BIOMARKER |
| US9402883B2 (en) | 2009-01-30 | 2016-08-02 | Alphareta Ab | Compound and method for treatment of Alzheimer's disease |
| US9822171B2 (en) | 2010-04-15 | 2017-11-21 | AbbVie Deutschland GmbH & Co. KG | Amyloid-beta binding proteins |
| US9951125B2 (en) | 2006-11-30 | 2018-04-24 | Abbvie Inc. | Aβ conformer selective anti-Aβ globulomer monoclonal antibodies |
| US10208109B2 (en) | 2005-11-30 | 2019-02-19 | Abbvie Inc. | Monoclonal antibodies against amyloid beta protein and uses thereof |
| US10393759B2 (en) | 2011-04-12 | 2019-08-27 | Quanterix Corporation | Methods of determining a treatment protocol for and/or a prognosis of a patient's recovery from a brain injury |
| US10464976B2 (en) | 2003-01-31 | 2019-11-05 | AbbVie Deutschland GmbH & Co. KG | Amyloid β(1-42) oligomers, derivatives thereof and antibodies thereto, methods of preparation thereof and use thereof |
| US10538581B2 (en) | 2005-11-30 | 2020-01-21 | Abbvie Inc. | Anti-Aβ globulomer 4D10 antibodies |
| US10718785B2 (en) * | 2015-03-17 | 2020-07-21 | Electrophoretics Limited | Materials and methods for diagnosis and treatment of Alzheimer's disease |
| US20210070819A1 (en) * | 2018-03-16 | 2021-03-11 | INSERM (Institut National de la Santé et de la Recherche Médicale) | Antigenic peptides deriving from secretogranin v and uses thereof for the diagnosis and treatment of type 1 diabetes |
| CN115078570A (zh) * | 2022-05-30 | 2022-09-20 | 郑州大学第一附属医院 | Tau蛋白639位硫氰酸氨基酸修饰在快速质谱法检测阿尔茨海默症中的应用 |
| US11657189B2 (en) | 2020-03-30 | 2023-05-23 | Kyndryl, Inc. | Object loss prevention using cognitive computing |
| US20230277501A1 (en) * | 2013-03-15 | 2023-09-07 | The Johns Hopkins University | Methods and compositions for improving cognitive function |
Families Citing this family (43)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US7707134B2 (en) * | 2005-01-14 | 2010-04-27 | Siemens Medical Solutions Usa, Inc. | System and method for molecular diagnosis of depression based on boosting classification |
| FR2882171A1 (fr) * | 2005-02-14 | 2006-08-18 | France Telecom | Procede et dispositif de generation d'un arbre de classification permettant d'unifier les approches supervisees et non supervisees, produit programme d'ordinateur et moyen de stockage correspondants |
| WO2006106115A2 (de) * | 2005-04-06 | 2006-10-12 | Mosaiques Diagnostics And Therapeutics Ag | Polypeptidmarker zur diagnose von alzheimer |
| US9335331B2 (en) * | 2005-04-11 | 2016-05-10 | Cornell Research Foundation, Inc. | Multiplexed biomarkers for monitoring the Alzheimer's disease state of a subject |
| WO2007136614A2 (en) * | 2006-05-19 | 2007-11-29 | Merck & Co., Inc. | Assays and methods for the diagnosis and progression of alzheimer's disease using a multi-analyte marker panel |
| WO2007139777A2 (en) * | 2006-05-26 | 2007-12-06 | Merck & Co., Inc. | Methods for the diagnosis and prognosis of alzheimer's disease using csf protein profiling |
| US7851172B2 (en) * | 2006-07-25 | 2010-12-14 | University Of Kentucky Research Foundation | Biomarkers of mild cognitive impairment and alzheimer's disease |
| EP2076172A4 (en) * | 2006-10-27 | 2012-03-21 | Aretais Inc | USE OF COHERENT RAMAN PROCEDURES FOR MEDICAL DIAGNOSTIC AND THERAPEUTIC PURPOSES AND CALIBRATION METHOD THEREFOR |
| DE102006056337A1 (de) * | 2006-11-29 | 2008-06-05 | B.R.A.H.M.S Ag | In vitro Verfahren zur Diagnose und Frühdiagnose von neurodegenerativen Erkrankungen |
| GB0701626D0 (en) * | 2007-01-22 | 2007-03-07 | Cambridge Entpr Ltd | Methods and biomarkers for diagnosing and monitoring psychotic disorders |
| EP2124952A2 (en) | 2007-02-27 | 2009-12-02 | Abbott GmbH & Co. KG | Method for the treatment of amyloidoses |
| JP2010537200A (ja) | 2007-08-21 | 2010-12-02 | ワシントン ユニバーシティー | 改善されたアルツハイマー診断法 |
| US20140342381A1 (en) * | 2008-08-11 | 2014-11-20 | Banyan Biomarkers, Inc. | Devices and methods for biomarker detection process and assay of neurological condition |
| ES2665245T3 (es) | 2008-08-11 | 2018-04-25 | Banyan Biomarkers, Inc. | Proceso de detección de biomarcador y ensayo de estado neurológico |
| US12601749B2 (en) | 2008-08-11 | 2026-04-14 | Banyan Biomarkers, Inc. | Biomarker detection process and assay of neurological condition |
| WO2011005893A2 (en) * | 2009-07-07 | 2011-01-13 | Abbott Laboratories | Biomarkers and methods for detecting alzheimer's disease |
| US9493834B2 (en) | 2009-07-29 | 2016-11-15 | Pharnext | Method for detecting a panel of biomarkers |
| US20110097747A1 (en) * | 2009-10-26 | 2011-04-28 | Kevin Jones | Monoclonal antibody binds antigen associated with human tumors |
| WO2012037232A2 (en) * | 2010-09-16 | 2012-03-22 | University Of Miami | Compositions, methods and kits for detecting and treating alzheimer's disease |
| WO2013010170A1 (en) * | 2011-07-14 | 2013-01-17 | Lovell Mark A | Process for detection of alzheimer's disease from a serum sample |
| CA2877975C (en) | 2012-04-13 | 2021-09-21 | Oasis Diagnostics Corporation | Specific salivary biomarkers for risk detection, early diagnosis, prognosis and monitoring of alzheimer's and parkinson's diseases |
| US9678086B2 (en) | 2012-09-10 | 2017-06-13 | The Johns Hopkins University | Diagnostic assay for Alzheimer's disease |
| US20140271463A1 (en) * | 2013-03-12 | 2014-09-18 | Stichting Vu-Vumc | Bri2 as a novel biomarker for alzheimer's disease |
| WO2014183023A1 (en) | 2013-05-09 | 2014-11-13 | Trustees Of Boston University | Using plexin-a4 as a biomarker and therapeutic target for alzheimer's disease |
| WO2015020523A1 (en) | 2013-08-07 | 2015-02-12 | Stichting Vu-Vumc | Biomarkers for early diagnosis of alzheimer's disease |
| JP2017505756A (ja) | 2013-12-13 | 2017-02-23 | ザ ジェネラル ホスピタル コーポレイション | 可溶性高分子量(hmw)タウ種およびその用途 |
| WO2015152724A2 (en) | 2014-04-02 | 2015-10-08 | Stichting Vu-Vumc | Biomarkers for the detection of frontotemporal dementia |
| US9753036B2 (en) | 2014-04-29 | 2017-09-05 | Edp Biotech Corporation | Methods and compositions for screening and detecting biomarkers |
| WO2017193115A1 (en) * | 2016-05-06 | 2017-11-09 | Nanosomix, Inc. | Synaptic protein biomarkers and differential diagnosis of alzheimer's disease and other neurodegenerative disorders |
| US10832089B2 (en) * | 2016-05-11 | 2020-11-10 | Institut National De La Sante Et De La Recherche Medicale (Inserm) | Method for determining the temporal progression of a biological phenomenon and associated methods and devices |
| WO2018030252A1 (ja) * | 2016-08-09 | 2018-02-15 | 大塚製薬株式会社 | 尿バイオマーカーを用いたアルツハイマー病の診断補助方法 |
| JP6702836B2 (ja) * | 2016-09-28 | 2020-06-03 | ハルメク・ベンチャーズ株式会社 | 認知症判定得点算出装置及びそのプログラム |
| WO2018081649A1 (en) | 2016-10-28 | 2018-05-03 | Banyan Biomarkers, Inc. | Antibodies to ubiquitin c-terminal hydrolase l1 (uch-l1) and glial fibrillary acidic protein (gfap) and related methods |
| ES2600386B8 (es) * | 2016-11-16 | 2017-08-04 | Grifols Worldwide Operations Limited | Método de diagnóstico in vitro de la enfermedad de alzheimer basado en el nivel redox de la albúmina en el líquido cefalorraquídeo |
| JP6359159B2 (ja) * | 2017-07-25 | 2018-07-18 | 株式会社Mcbi | 認知機能障害疾患のバイオマーカーおよび該バイオマーカーを用いる認知機能障害疾患の検出方法 |
| EP3740761A4 (en) * | 2018-01-18 | 2021-10-20 | University of North Texas Health Science Center at Fort Worth | ACCOMPANYING DIAGNOSTICS FOR NSAIDS AND DONEPEZIL FOR THE TREATMENT OF SPECIFIC SUBPOPULATIONS OF PATIENTS WITH ALZHEIMER'S MORBUS |
| US11231401B2 (en) | 2018-03-16 | 2022-01-25 | Quest Diagnostics Investments Llc | Methods for detecting chromogranin a by mass spectrometry |
| KR20210035825A (ko) * | 2018-07-19 | 2021-04-01 | 제넨테크, 인크. | 마커 분자를 기반으로 아밀로이드-양성 치매를 갖거나 발생 위험성이 있는 개체를 식별하는 방법 및 관련 용도 |
| WO2020069621A1 (en) * | 2018-10-04 | 2020-04-09 | University Of Manitoba | Novel biomarker for alzheimer's disease in human |
| US11621087B2 (en) | 2019-09-24 | 2023-04-04 | International Business Machines Corporation | Machine learning for amyloid and tau pathology prediction |
| JP7109499B2 (ja) * | 2020-05-07 | 2022-07-29 | 一般社団法人脳と心の健康科学研究所 | 認知症判定得点算出装置及びそのプログラム |
| JPWO2022070798A1 (https=) * | 2020-09-29 | 2022-04-07 | ||
| US20240077501A1 (en) * | 2020-12-28 | 2024-03-07 | Mcbi Inc. | Judgment supporting information generating method, judgment supporting information generating system, and information processing device |
Citations (25)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5010175A (en) | 1988-05-02 | 1991-04-23 | The Regents Of The University Of California | General method for producing and selecting peptides with specific properties |
| WO1991019735A1 (en) | 1990-06-14 | 1991-12-26 | Bartlett Paul A | Libraries of modified peptides with protease resistance |
| WO1992000091A1 (en) | 1990-07-02 | 1992-01-09 | Bioligand, Inc. | Random bio-oligomer library, a method of synthesis thereof, and a method of use thereof |
| US5242828A (en) | 1988-11-10 | 1993-09-07 | Pharmacia Biosensor Ab | Sensing surfaces capable of selective biomolecular interactions, to be used in biosensor systems |
| WO1993020242A1 (en) | 1992-03-30 | 1993-10-14 | The Scripps Research Institute | Encoded combinatorial chemical libraries |
| US5288514A (en) | 1992-09-14 | 1994-02-22 | The Regents Of The University Of California | Solid phase and combinatorial synthesis of benzodiazepine compounds on a solid support |
| US5506337A (en) | 1985-03-15 | 1996-04-09 | Antivirals Inc. | Morpholino-subunit combinatorial library and method |
| US5519134A (en) | 1994-01-11 | 1996-05-21 | Isis Pharmaceuticals, Inc. | Pyrrolidine-containing monomers and oligomers |
| US5525735A (en) | 1994-06-22 | 1996-06-11 | Affymax Technologies Nv | Methods for synthesizing diverse collections of pyrrolidine compounds |
| US5539083A (en) | 1994-02-23 | 1996-07-23 | Isis Pharmaceuticals, Inc. | Peptide nucleic acid combinatorial libraries and improved methods of synthesis |
| US5549974A (en) | 1994-06-23 | 1996-08-27 | Affymax Technologies Nv | Methods for the solid phase synthesis of thiazolidinones, metathiazanones, and derivatives thereof |
| US5569588A (en) | 1995-08-09 | 1996-10-29 | The Regents Of The University Of California | Methods for drug screening |
| US5593853A (en) | 1994-02-09 | 1997-01-14 | Martek Corporation | Generation and screening of synthetic drug libraries |
| US5719060A (en) | 1993-05-28 | 1998-02-17 | Baylor College Of Medicine | Method and apparatus for desorption and ionization of analytes |
| WO1999051773A1 (en) | 1998-04-03 | 1999-10-14 | Phylos, Inc. | Addressable protein arrays |
| WO2000056934A1 (en) | 1999-03-24 | 2000-09-28 | Packard Bioscience Company | Continuous porous matrix arrays |
| US6225047B1 (en) | 1997-06-20 | 2001-05-01 | Ciphergen Biosystems, Inc. | Use of retentate chromatography to generate difference maps |
| WO2001031580A2 (en) | 1999-10-27 | 2001-05-03 | Biowulf Technologies, Llc | Methods and devices for identifying patterns in biological systems |
| US6283761B1 (en) | 1992-09-08 | 2001-09-04 | Raymond Anthony Joao | Apparatus and method for processing and/or for providing healthcare information and/or healthcare-related information |
| US6329209B1 (en) | 1998-07-14 | 2001-12-11 | Zyomyx, Incorporated | Arrays of protein-capture agents and methods of use thereof |
| US20020138208A1 (en) | 2000-11-16 | 2002-09-26 | Ciphergen Biosystems, Inc. | Method for analyzing mass spectra |
| US20020193950A1 (en) | 2002-02-25 | 2002-12-19 | Gavin Edward J. | Method for analyzing mass spectra |
| US20030004402A1 (en) | 2000-07-18 | 2003-01-02 | Hitt Ben A. | Process for discriminating between biological states based on hidden patterns from biological data |
| US20030055615A1 (en) | 2001-05-11 | 2003-03-20 | Zhen Zhang | System and methods for processing biological expression data |
| US9610287B2 (en) | 2011-06-20 | 2017-04-04 | H. Lundbeck A/S | Method of administration of 4-((1R,3S)-6-chloro-3-phenyl-indan-1-yl)-1,2,2-trimethyl-piperazine and the salts thereof in the treatment of schizophrenia |
Family Cites Families (13)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2000025138A2 (en) * | 1998-10-23 | 2000-05-04 | Roger Nitsch | Methods of diagnosing or prognosing alzheimer's disease |
| AU774336B2 (en) | 1999-04-27 | 2004-06-24 | Ciphergen Biosystems, Inc. | Probes for a gas phase ion spectrometer |
| EP1181705A2 (en) | 1999-04-29 | 2002-02-27 | Ciphergen Biosystems, Inc. | Sample holder with hydrophobic coating for gas phase mass spectrometers |
| WO2002002824A1 (en) | 2000-07-03 | 2002-01-10 | University Of South Florida | Methods and assays for diagnosing alzheimer's disease |
| CA2446666A1 (en) * | 2001-05-09 | 2002-11-14 | Biovision Ag | Method for detecting progredient chronic dementia, and associated peptides and detection reagents |
| US7541003B2 (en) | 2001-07-17 | 2009-06-02 | Bio-Rad Laboratories, Inc. | Latex based adsorbent chip |
| JPWO2003027151A1 (ja) * | 2001-09-25 | 2005-01-06 | 株式会社 免疫生物研究所 | 組換え抗オステオポンチン抗体およびその用途 |
| US7842498B2 (en) | 2001-11-08 | 2010-11-30 | Bio-Rad Laboratories, Inc. | Hydrophobic surface chip |
| US20030100016A1 (en) | 2001-11-23 | 2003-05-29 | George Jackowski | Complement C3 precursor biopolymer markers predictive of Alzheimers disease |
| WO2003064594A2 (en) | 2002-01-25 | 2003-08-07 | Ciphergen Biosystems, Inc. | Monomers and polymers having energy absorbing moieties of use in desorption/ionization of analytes |
| AU2003253014A1 (en) * | 2002-06-21 | 2004-01-06 | Innogenetics N.V. | Method for the diagnosis and differential diagnosis of neurological diseases |
| PT1535076E (pt) * | 2002-08-23 | 2008-11-03 | Bayer Healthcare Ag | Marcadores biológicos para diagnóstico da doença de alzheimer |
| US7632686B2 (en) * | 2002-10-03 | 2009-12-15 | Anderson Forschung Group | High sensitivity quantitation of peptides by mass spectrometry |
-
2004
- 2004-11-06 JP JP2006538558A patent/JP4796967B2/ja not_active Expired - Fee Related
- 2004-11-06 US US10/982,545 patent/US7794948B2/en not_active Expired - Fee Related
- 2004-11-06 EP EP11156064A patent/EP2369347A1/en not_active Withdrawn
- 2004-11-06 WO PCT/US2004/037994 patent/WO2005047484A2/en not_active Ceased
- 2004-11-06 EP EP11156065A patent/EP2369348A1/en not_active Withdrawn
- 2004-11-06 EP EP04810948.2A patent/EP1694816B1/en not_active Expired - Lifetime
-
2010
- 2010-07-28 US US12/845,025 patent/US20110129920A1/en not_active Abandoned
-
2011
- 2011-01-24 JP JP2011012368A patent/JP5479379B2/ja not_active Expired - Fee Related
Patent Citations (25)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5506337A (en) | 1985-03-15 | 1996-04-09 | Antivirals Inc. | Morpholino-subunit combinatorial library and method |
| US5010175A (en) | 1988-05-02 | 1991-04-23 | The Regents Of The University Of California | General method for producing and selecting peptides with specific properties |
| US5242828A (en) | 1988-11-10 | 1993-09-07 | Pharmacia Biosensor Ab | Sensing surfaces capable of selective biomolecular interactions, to be used in biosensor systems |
| WO1991019735A1 (en) | 1990-06-14 | 1991-12-26 | Bartlett Paul A | Libraries of modified peptides with protease resistance |
| WO1992000091A1 (en) | 1990-07-02 | 1992-01-09 | Bioligand, Inc. | Random bio-oligomer library, a method of synthesis thereof, and a method of use thereof |
| WO1993020242A1 (en) | 1992-03-30 | 1993-10-14 | The Scripps Research Institute | Encoded combinatorial chemical libraries |
| US6283761B1 (en) | 1992-09-08 | 2001-09-04 | Raymond Anthony Joao | Apparatus and method for processing and/or for providing healthcare information and/or healthcare-related information |
| US5288514A (en) | 1992-09-14 | 1994-02-22 | The Regents Of The University Of California | Solid phase and combinatorial synthesis of benzodiazepine compounds on a solid support |
| US5719060A (en) | 1993-05-28 | 1998-02-17 | Baylor College Of Medicine | Method and apparatus for desorption and ionization of analytes |
| US5519134A (en) | 1994-01-11 | 1996-05-21 | Isis Pharmaceuticals, Inc. | Pyrrolidine-containing monomers and oligomers |
| US5593853A (en) | 1994-02-09 | 1997-01-14 | Martek Corporation | Generation and screening of synthetic drug libraries |
| US5539083A (en) | 1994-02-23 | 1996-07-23 | Isis Pharmaceuticals, Inc. | Peptide nucleic acid combinatorial libraries and improved methods of synthesis |
| US5525735A (en) | 1994-06-22 | 1996-06-11 | Affymax Technologies Nv | Methods for synthesizing diverse collections of pyrrolidine compounds |
| US5549974A (en) | 1994-06-23 | 1996-08-27 | Affymax Technologies Nv | Methods for the solid phase synthesis of thiazolidinones, metathiazanones, and derivatives thereof |
| US5569588A (en) | 1995-08-09 | 1996-10-29 | The Regents Of The University Of California | Methods for drug screening |
| US6225047B1 (en) | 1997-06-20 | 2001-05-01 | Ciphergen Biosystems, Inc. | Use of retentate chromatography to generate difference maps |
| WO1999051773A1 (en) | 1998-04-03 | 1999-10-14 | Phylos, Inc. | Addressable protein arrays |
| US6329209B1 (en) | 1998-07-14 | 2001-12-11 | Zyomyx, Incorporated | Arrays of protein-capture agents and methods of use thereof |
| WO2000056934A1 (en) | 1999-03-24 | 2000-09-28 | Packard Bioscience Company | Continuous porous matrix arrays |
| WO2001031580A2 (en) | 1999-10-27 | 2001-05-03 | Biowulf Technologies, Llc | Methods and devices for identifying patterns in biological systems |
| US20030004402A1 (en) | 2000-07-18 | 2003-01-02 | Hitt Ben A. | Process for discriminating between biological states based on hidden patterns from biological data |
| US20020138208A1 (en) | 2000-11-16 | 2002-09-26 | Ciphergen Biosystems, Inc. | Method for analyzing mass spectra |
| US20030055615A1 (en) | 2001-05-11 | 2003-03-20 | Zhen Zhang | System and methods for processing biological expression data |
| US20020193950A1 (en) | 2002-02-25 | 2002-12-19 | Gavin Edward J. | Method for analyzing mass spectra |
| US9610287B2 (en) | 2011-06-20 | 2017-04-04 | H. Lundbeck A/S | Method of administration of 4-((1R,3S)-6-chloro-3-phenyl-indan-1-yl)-1,2,2-trimethyl-piperazine and the salts thereof in the treatment of schizophrenia |
Non-Patent Citations (19)
| Title |
|---|
| "3D Pharmaceuticals", MARTEK BIOSCIENCES |
| "Advanced Chem Tech", 357 MPS, 390 MPS |
| "benzodiazepines", BAUM C&EN, 18 January 1993 (1993-01-18), pages 33 |
| "ComGenex", TRIPOS, INC. |
| "Statistical Pattern Recognition: A Review", IEEE TRANSACTIONS ON PATTERN ANALYSIS AND MACHINE INTELLIGENCE, vol. 22, no. I, January 2000 (2000-01-01) |
| 433 A APPLIED BIOSYSTEMS |
| ABRAHAMSON ET AL., BIOCHEM. J., vol. 273, 1991, pages 621 - 626 |
| CAMPBELL ET AL., J. ORG. CHEM., vol. 59, 1994, pages 658 |
| CHEN ET AL., J. AMER. CHEM. SOC., vol. 116, 1994, pages 2661 |
| CHO ET AL., SCIENCE, vol. 261, 1993, pages 1303 |
| FURKA, INT. J. PEPT. PROT. RES., vol. 37, 1991, pages 487 - 493 |
| HAGIHARA ET AL., J. AMER. CHEM. SOC., vol. 114, 1992, pages 6568 |
| HIRSCHMANN ET AL., J. AMER. CHEM. SOC., vol. 114, 1992, pages 9217 - 9218 |
| HOBBS ET AL., PROC. NAT. ACAD. SCI. USA, vol. 90, 1993, pages 6909 - 6913 |
| HOUGHTON ET AL., NATURE, vol. 354, 1991, pages 84 - 88 |
| LIANG ET AL., SCIENCE, vol. 274, 1996, pages 1520 - 1522 |
| LOPEZ-OTTIN ET AL., NATURE REVIEWS, vol. 3, 2002, pages 509 - 519 |
| See also references of EP1694816A4 |
| VAUGHN ET AL., NATURE BIOTECHNOLOGY, vol. 14, no. 3, 1996, pages 309 - 314 |
Cited By (50)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US10464976B2 (en) | 2003-01-31 | 2019-11-05 | AbbVie Deutschland GmbH & Co. KG | Amyloid β(1-42) oligomers, derivatives thereof and antibodies thereto, methods of preparation thereof and use thereof |
| JP2008546701A (ja) * | 2005-06-14 | 2008-12-25 | イェシバ・ユニバーシティ | Aβ産生へのBRI蛋白の効果 |
| JP2013082721A (ja) * | 2005-06-14 | 2013-05-09 | Yeshiva Univ | Aβ産生へのBRI蛋白の効果 |
| WO2006138325A2 (en) | 2005-06-16 | 2006-12-28 | Vermillion, Inc. | Fragment of neurosecretory protein vgf as a biomarker for alzheimer's disease |
| EP1907838A4 (en) * | 2005-06-16 | 2008-10-01 | Vermillion Inc | FRAGMENT OF THE NEUROSCRETOR PROTEIN VGF AS BIOMARKER FOR MORBUS ALZHEIMER |
| WO2007012052A1 (en) * | 2005-07-20 | 2007-01-25 | Medical College Of Georgia Research Institute | Use of protein profiles in disease diagnosis and treatment |
| US10538581B2 (en) | 2005-11-30 | 2020-01-21 | Abbvie Inc. | Anti-Aβ globulomer 4D10 antibodies |
| US10323084B2 (en) | 2005-11-30 | 2019-06-18 | Abbvie Inc. | Monoclonal antibodies against amyloid beta protein and uses thereof |
| US10208109B2 (en) | 2005-11-30 | 2019-02-19 | Abbvie Inc. | Monoclonal antibodies against amyloid beta protein and uses thereof |
| WO2007105442A1 (ja) * | 2006-02-22 | 2007-09-20 | Kyowa Hakko Kogyo Co., Ltd. | 摂食障害または摂水障害の治療薬 |
| JP2012255793A (ja) * | 2006-02-28 | 2012-12-27 | Phenomenome Discoveries Inc | 認知症及び他の神経障害の診断方法 |
| US8304246B2 (en) | 2006-02-28 | 2012-11-06 | Phenomenome Discoveries, Inc. | Methods for the diagnosis of dementia and other neurological disorders |
| WO2007098585A1 (en) * | 2006-02-28 | 2007-09-07 | Phenomenome Discoveries Inc. | Methods for the diagnosis of dementia and other neurological disorders |
| JP2009528517A (ja) * | 2006-02-28 | 2009-08-06 | フェノメノーム ディスカバリーズ インク | 認知症及び他の神経障害の診断方法 |
| JP2014197018A (ja) * | 2006-02-28 | 2014-10-16 | フェノメノーム ディスカバリーズ インク | 認知症及び他の神経障害の診断方法 |
| US8377646B2 (en) | 2006-03-11 | 2013-02-19 | Vermillion, Inc. | Beta-2 microglobulin as a biomarker for peripheral artery disease |
| JP2009529694A (ja) * | 2006-03-11 | 2009-08-20 | ザ ボード オブ トラスティーズ オブ ザ レランド スタンフォード ジュニア ユニバーシティー | 末梢性の動脈疾患のためのバイオマーカーとしてのβ−2ミクログロブリン |
| US8709735B2 (en) | 2006-03-11 | 2014-04-29 | Vermillion, Inc. | β-2 microglobulin as a biomarker for peripheral artery disease |
| US9951125B2 (en) | 2006-11-30 | 2018-04-24 | Abbvie Inc. | Aβ conformer selective anti-Aβ globulomer monoclonal antibodies |
| US9034923B2 (en) | 2007-02-08 | 2015-05-19 | Phenomenome Discoveries Inc. | Methods for the treatment of senile dementia of the alzheimer's type |
| US9517222B2 (en) | 2007-02-08 | 2016-12-13 | Phenomenome Discoveries Inc. | Method for the treatment of senile dementia of the Alzheimer's type |
| US8753607B2 (en) | 2008-03-21 | 2014-06-17 | Manuela G. Neuman | Methods and kits for the differential diagnosis of Alzheimer's disease versus frontotemporal dementia and for the diagnosis of frontotemporal dementia, comprising FAS-L and CK 18 as biomarkers |
| WO2010034072A1 (en) * | 2008-09-26 | 2010-04-01 | The University Of Melbourne | Alzheimer's disease biomarkers |
| US8497074B2 (en) | 2008-10-10 | 2013-07-30 | Universitetet I Oslo | Granin proteins as markers of heart disease |
| EP2373999A4 (en) * | 2008-12-09 | 2012-11-07 | Stephanie Fryar-Williams | NEW BIOMARKERS |
| US9402883B2 (en) | 2009-01-30 | 2016-08-02 | Alphareta Ab | Compound and method for treatment of Alzheimer's disease |
| US9822171B2 (en) | 2010-04-15 | 2017-11-21 | AbbVie Deutschland GmbH & Co. KG | Amyloid-beta binding proteins |
| US9062101B2 (en) | 2010-08-14 | 2015-06-23 | AbbVie Deutschland GmbH & Co. KG | Amyloid-beta binding proteins |
| US10047121B2 (en) | 2010-08-14 | 2018-08-14 | AbbVie Deutschland GmbH & Co. KG | Amyloid-beta binding proteins |
| EP2657706A4 (en) * | 2010-12-22 | 2015-11-04 | Mcbi Inc | BIOMARKER FOR DISEASES RELATED TO COGNITIVE DYSFUNCTION AND METHOD FOR DETECTING DISEASES CONNECTED WITH COGNITIVE DYSFUNCTION THROUGH THIS BIOMARKER |
| EP3422007A1 (en) * | 2010-12-22 | 2019-01-02 | Mcbi Inc. | Novel biomarkers for cognitive impairment and methods for detecting cognitive impairment using such biomarkers |
| EP3422010A1 (en) * | 2010-12-22 | 2019-01-02 | Mcbi Inc. | Novel biomarkers for cognitive impairment and methods for detecting cognitive impairment using such biomarkers |
| EP3422009A1 (en) * | 2010-12-22 | 2019-01-02 | Mcbi Inc. | Novel biomarkers for cognitive impairment and methods for detecting cognitive impairment using such biomarkers |
| EP3422008A1 (en) * | 2010-12-22 | 2019-01-02 | Mcbi Inc. | Novel biomarkers for cognitive impairment and methods for detecting cognitive impairment using such biomarkers |
| EP3255434A1 (en) * | 2010-12-22 | 2017-12-13 | Mcbi Inc. | Novel biomarkers for cognitive impairment and methods for detecting cognitive impairment using such biomarkers |
| US11307208B2 (en) | 2010-12-22 | 2022-04-19 | Mcbi, Inc. | Biomarkers for cognitive impairment and methods for detecting cognitive impairment using such biomarkers |
| EP3260866A1 (en) * | 2010-12-22 | 2017-12-27 | Mcbi Inc. | Novel biomarkers for cognitive impairment and methods for detecting cognitive impairment using such biomarkers |
| US20140030274A1 (en) * | 2011-04-05 | 2014-01-30 | Alphabeta Ab | Amyloidosis target useful in methods of treatment and for screening of compounds |
| US9522170B2 (en) * | 2011-04-05 | 2016-12-20 | Alphabeta Ab | Methods of screening compounds for the fibril formation of Aβ peptides based on a decreased trimer/monomer ratio of a chaperone protein |
| US10393759B2 (en) | 2011-04-12 | 2019-08-27 | Quanterix Corporation | Methods of determining a treatment protocol for and/or a prognosis of a patient's recovery from a brain injury |
| US11275092B2 (en) | 2011-04-12 | 2022-03-15 | Quanterix Corporation | Methods of determining a treatment protocol for and/or a prognosis of a patient's recovery from a brain injury |
| US12540950B2 (en) | 2011-04-12 | 2026-02-03 | Quanterix Corporation | Methods of assaying phosphorylated tau protein in a sample |
| US12571803B2 (en) | 2011-04-12 | 2026-03-10 | Quanterix Corporation | Methods of producing bodily fluid samples containing an analytically quantified amount of phosphorylated tau protein |
| US20230277501A1 (en) * | 2013-03-15 | 2023-09-07 | The Johns Hopkins University | Methods and compositions for improving cognitive function |
| US10718785B2 (en) * | 2015-03-17 | 2020-07-21 | Electrophoretics Limited | Materials and methods for diagnosis and treatment of Alzheimer's disease |
| US20210070819A1 (en) * | 2018-03-16 | 2021-03-11 | INSERM (Institut National de la Santé et de la Recherche Médicale) | Antigenic peptides deriving from secretogranin v and uses thereof for the diagnosis and treatment of type 1 diabetes |
| US12492230B2 (en) * | 2018-03-16 | 2025-12-09 | INSERM (Institut National de la Santé et de la Recherche Médicale) | Antigenic peptides deriving from secretogranin V and uses thereof for the diagnosis and treatment of type 1 diabetes |
| US11657189B2 (en) | 2020-03-30 | 2023-05-23 | Kyndryl, Inc. | Object loss prevention using cognitive computing |
| CN115078570A (zh) * | 2022-05-30 | 2022-09-20 | 郑州大学第一附属医院 | Tau蛋白639位硫氰酸氨基酸修饰在快速质谱法检测阿尔茨海默症中的应用 |
| CN115078570B (zh) * | 2022-05-30 | 2024-05-28 | 郑州大学第一附属医院 | Tau蛋白639位硫氰酸氨基酸修饰在快速质谱法检测阿尔茨海默症中的应用 |
Also Published As
| Publication number | Publication date |
|---|---|
| EP2369348A1 (en) | 2011-09-28 |
| EP1694816A4 (en) | 2008-08-20 |
| US20050244890A1 (en) | 2005-11-03 |
| JP4796967B2 (ja) | 2011-10-19 |
| JP2007524847A (ja) | 2007-08-30 |
| EP2369347A1 (en) | 2011-09-28 |
| WO2005047484A3 (en) | 2007-06-07 |
| JP2011085601A (ja) | 2011-04-28 |
| US20110129920A1 (en) | 2011-06-02 |
| US7794948B2 (en) | 2010-09-14 |
| JP5479379B2 (ja) | 2014-04-23 |
| EP1694816A2 (en) | 2006-08-30 |
| EP1694816B1 (en) | 2013-08-28 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| EP1694816B1 (en) | Biomarkers for alzheimer's disease | |
| JP2007524847A5 (https=) | ||
| Davidsson et al. | The use of proteomics in biomarker discovery in neurodegenerative diseases | |
| US20110313681A1 (en) | Biomarkers for peripheral artery disease | |
| AU2005278136A1 (en) | Platelet biomarkers for cancer | |
| US20120172356A1 (en) | Serum biomarkers for chagas disease | |
| US7993868B2 (en) | Saposin D and FAM3C are biomarkers for alzheimer's disease | |
| US20130073308A1 (en) | Methods of Detecting a Fragment of Neurosecretory Protein VGF for Diagnosing Alzheimer's Disease | |
| EP1907838B1 (en) | Fragment of neurosecretory protein vgf as a biomarker for alzheimer's disease | |
| HK1110388B (en) | Fragment of neurosecretory protein vgf as a biomarker for alzheimer's disease | |
| Carrette et al. | Proteomic Applications for Molecular Assessment of Alzheimer's Disease |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| AK | Designated states |
Kind code of ref document: A2 Designated state(s): AE AG AL AM AT AU AZ BA BB BG BR BW BY BZ CA CH CN CO CR CU CZ DE DK DM DZ EC EE EG ES FI GB GD GE GH GM HR HU ID IL IN IS JP KE KG KP KR KZ LC LK LR LS LT LU LV MA MD MG MK MN MW MX MZ NA NI NO NZ OM PG PH PL PT RO RU SC SD SE SG SK SL SY TJ TM TN TR TT TZ UA UG US UZ VC VN YU ZA ZM ZW |
|
| AL | Designated countries for regional patents |
Kind code of ref document: A2 Designated state(s): BW GH GM KE LS MW MZ NA SD SL SZ TZ UG ZM ZW AM AZ BY KG KZ MD RU TJ TM AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HU IE IS IT LU MC NL PL PT RO SE SI SK TR BF BJ CF CG CI CM GA GN GQ GW ML MR NE SN TD TG |
|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application | ||
| WWE | Wipo information: entry into national phase |
Ref document number: 2006538558 Country of ref document: JP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2004810948 Country of ref document: EP |
|
| WWP | Wipo information: published in national office |
Ref document number: 2004810948 Country of ref document: EP |