WO2003106615A2 - Post-cleavage sulfur deprotection for convergent protein synthesis by chemical ligation - Google Patents
Post-cleavage sulfur deprotection for convergent protein synthesis by chemical ligation Download PDFInfo
- Publication number
- WO2003106615A2 WO2003106615A2 PCT/IB2003/005087 IB0305087W WO03106615A2 WO 2003106615 A2 WO2003106615 A2 WO 2003106615A2 IB 0305087 W IB0305087 W IB 0305087W WO 03106615 A2 WO03106615 A2 WO 03106615A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- group
- substituted
- groups
- unprotected
- terminus
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K1/00—General methods for the preparation of peptides, i.e. processes for the organic chemical preparation of peptides or proteins of any length
- C07K1/107—General methods for the preparation of peptides, i.e. processes for the organic chemical preparation of peptides or proteins of any length by chemical modification of precursor peptides
- C07K1/1072—General methods for the preparation of peptides, i.e. processes for the organic chemical preparation of peptides or proteins of any length by chemical modification of precursor peptides by covalent attachment of residues or functional groups
- C07K1/1077—General methods for the preparation of peptides, i.e. processes for the organic chemical preparation of peptides or proteins of any length by chemical modification of precursor peptides by covalent attachment of residues or functional groups by covalent attachment of residues other than amino acids or peptide residues, e.g. sugars, polyols, fatty acids
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K1/00—General methods for the preparation of peptides, i.e. processes for the organic chemical preparation of peptides or proteins of any length
- C07K1/02—General methods for the preparation of peptides, i.e. processes for the organic chemical preparation of peptides or proteins of any length in solution
- C07K1/026—General methods for the preparation of peptides, i.e. processes for the organic chemical preparation of peptides or proteins of any length in solution by fragment condensation in solution
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K1/00—General methods for the preparation of peptides, i.e. processes for the organic chemical preparation of peptides or proteins of any length
- C07K1/04—General methods for the preparation of peptides, i.e. processes for the organic chemical preparation of peptides or proteins of any length on carriers
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K7/00—Peptides having 5 to 20 amino acids in a fully defined sequence; Derivatives thereof
- C07K7/04—Linear peptides containing only normal peptide links
- C07K7/06—Linear peptides containing only normal peptide links having 5 to 11 amino acids
Definitions
- an unprotected ohgopeptide intermediate having a C-terminal thioester reacts with an N-terminal cysteine of another ohgopeptide intermediate under mild aqueous conditions to form a thioester linkage which spontaneously rearranges to a natural peptide linkage, Kent et al, U.S. Patent No. 6,184,344.
- the approach has been used to assemble ohgopeptides into active proteins both in solution phase, e.g. Kent et al, U.S. Patent No. 6,184,344, and on a solid phase support, e.g. Canne et al, J.Am.Chem.Soc, 121 : 8720-8727 (1999).
- Fmoc 9-fluorenylmethoxycarbonyl
- Botti et al International patent publication WO 02/18417.
- Botti et al. have suggested the use of a nucleophile-stable thioester precursor that is removable under non-nucleophilic conditions, in combination with a nucleophilic labile Fmoc protecting group as the N-terminal protecting group. While the work of Botti et al.
- the 2-mercapto carboxyesters of Botti et al. are susceptible to nucleophilic cleavage during long reaction times.
- a new method that provides stable N-terminal and C-terminal protecting groups for the preparation of ohgopeptides, polypeptides and proteins would be advantageous. Surprisingly, the present invention provides such methods.
- the present invention provides a method for preparing an ohgopeptide or polypeptide product, comprising: (a) ligating in a first reaction, first and second ohgopeptides each having an N-terminus and a C-terminus, wherein the first ohgopeptide comprises a C-terminus having a thioester group, and an N-terminus that is substantially unreactive with the thioester group, wherein the second ohgopeptide comprises an N- terminus having an unprotected cysteine, an unprotected 1 ,2-amino thiol, or an unprotected 1,3-amino thiol, and a C-terminus having an inactive thioester precursor, and wherein the ligating forms a first ohgopeptide ligation product comprising a C-terminus having an inactive thioester precursor, and an N-terminus that is substantially unreactive with the thioest
- R e groups 3 alkyl substituted with 1-3 R c groups; alternatively, when two R e groups are present, they can be taken together with the atom to which they are attached to form a 5-6 membered non-aromatic heterocylic ring containing 1- 3 heteroatoms each independently selected from the group consisting of N, O and S, substituted with 0-3 R c groups.
- the present invention provides a compound of the formula: Xaaj- ... -Xaa m -(CH-R)-CO-NH-N[(CH 2 ) n - S-R']-Y
- m is an integer from 2 to 200
- n is an integer from 1 to 10
- R is an amino acid side chain
- R' is a sulfur protecting group
- Y is an electron withdrawing group selected from the group consisting of R c , C ⁇ - 3 alkyl substituted with 1-3 R c groups, -C(O)-R d , -S(O) p -C ⁇ - 3 alkyl substituted with 0-3 R c groups, and an aryl substituted with 1-3 R c groups
- each R c group is independently a member selected from the group consisting of halogen, polyhaloalkyl, substituted or unsub
- Figure 2 illustrates the use of ohgopeptides of the present invention in a convergent synthesis scheme for making an ohgopeptide or polypeptide product.
- Figure 3 illustrates native chemical ligation with the use of auxiliary groups ("extended native chemical ligation") using a heterocyclic-protected thioester-modified ohgopeptide intermediate of the present invention.
- Figure 4 illustrates a first scheme for synthesizing heterocyclic-protected thioester- modified ohgopeptides of the present invention.
- Figure 5 illustrates a second scheme for synthesizing heterocyclic-protected thioester-modified ohgopeptides of the present invention.
- Figure 6 illustrates a third scheme for synthesizing heterocyclic-protected thioester- modified ohgopeptides of the present invention.
- Figure 7 illustrates a synthesis scheme for making a 4-substituted-l,3-thiazolidine- protected ohgopeptide thioester.
- Figure 8 illustrates an example of the use of ohgopeptides of the present invention in a convergent synthesis scheme for making an ohgopeptide or polypeptide product.
- Figure 9 shows the separation on a cleavage of crude material of the two diastereomers at the C-l position of the carboxythioester of the present invention.
- Figure 10 illustrates the preparation of the disulfide protected carboxythioester groups of the present invention according to different synthetic strategies ( Figures 10A to
- Figure 11 illustrates the ligation of model Peptide LYRAF-COO-CH(CH 2 -S-S-t-
- Figure 12 illustrates the ligation of model Peptide LYRAG-COO-CH(CH 2 -S-S-t-
- Figure 13 illustrates the HPLC chromatograms following the synthesis of NNY
- Figure 14 illustrates the MS data of synthesized NNY Rantes 1-68.
- Figure 15 illustrates a RP-HPLC analysis of the chemical ligation to form SPT1 1-
- Figure 16 shows the size exclusion chromatography analysis of chemical ligation of
- Figure 17 shows the MS analysis of purified serine 8-phosphorylated SPT1.
- peptide As used herein, the terms "peptide,” “peptide fragment,” “ohgopeptide,” or “fragment” in reference to a peptide are used synonymously and refer to a compound made up of a single unbranched chain of amino acid residues linked by peptide bonds. Amino acid residues are sometimes represented herein by the symbol “Xaa;” where “i”, when present, designates the position of the amino acid within a peptide. Each Xaai is independently selected from the group of natural and non-natural amino acids.
- Amino acids in a peptide or ohgopeptide can be derivatized with lipid moieties, polyethylene glycol, dyes, biotin, haptens, oligonucleotides, or like moieties.
- the number of amino acid residues in such compounds varies widely.
- Peptides or ohgopeptides referred to herein preferably have from 2 to 70 amino acid residue. More preferably, peptides or ohgopeptides referred to herein have from 2 to 50 amino acid residues.
- protein is used synonymously with the term “polypeptide”, or can refer to, in addition, a complex of two or more polypeptides which can be linked by bonds other than peptide bonds, for example, such polypeptides making up the protein can be linked by disulfide bonds.
- the term “protein” can also include a family of polypeptides having identical amino acid sequences but different post-translational modifications, such as phosphorylations, acylations, glycosylations, and the like. In particular, these post-translational modifications can be added when such proteins are expressed in eukaryotic hosts. Polypeptides and proteins referred to herein usually have from a few tens of amino acid residues, e.g.
- Amino acid residues are referred to herein by their standard single-letter or three-letter notations: A, alanine; C, cysteine; D, aspartic acid; E, glutamic acid; F, phenylalanine; G, glycine; H, histidine; I, Isoleucine; K, lysine; L, leucine; M, methionine; N, asparagine; P, proline; Q, glutamine; R, arginine; S, serine; T, threonine; V, valine; W, tryptophan; and Y, tyrosine.
- DKLLM amino acid sequence set forth herein, such as "DKLLM,” orders the amino acids from the N-terminus to the C-terminus in a left-to-right manner, unless otherwise indicated from the context.
- DKLLM amino acid sequence set forth herein, such as "DKLLM”
- electronegative refers to the tendency of a substituent to donate valence electrons to the molecule to which it is attached, i.e. it is electropositive, e.g., Smith and March, March's Advanced Organic Chemistry: Reactions, Mechanisms, Structure, 5 th Edition (Wiley-Interscience, New York, 2001).
- Preferred electron withdrawing substituents are halogen, substituted or unsubstituted amides, substituted or unsubstituted sulfonamides, substituted or unsubstituted benzyl, substituted or unsubstituted hydroxy-amine, polyhaloalkyl, hydrazide, cyano, nitro and quaternary ammonium salts, or alkyl groups having 1 to 3 carbons and substituted with one or more of the above substituents, aryl groups substituted with one or more of the above substituents, substituted or unsubstituted esters, or substituted or unsubstituted thioesters.
- electron withdrawing substituents are halo-substituted methyl.
- Preferred electron donating substituents include alkyl having from 1 to 3 carbon atoms, methoxy, thiol, hydroxyl, and methylthio. More preferably, electron donating substituents are methoxy, thiol, methylthio, or hydroxyl.
- an electron-donating group or an electron- withdrawing group such as electron donating- or electron-withdrawing-substituted phenyl, between 1 and 3 such groups are attached. More preferably, between 1 and 2 such groups are attached.
- the term “chemically ligating” refers to the joining of two ohgopeptides to form a single product, such as another ohgopeptide, a polypeptide, or a protein, for example.
- the term “transforming” refers to the transformation of a first chemical moiety to a second chemical moiety. In a preferred embodiment, the transformation from the first chemical moiety to the second proceeds through at least one intermediate.
- the term “inactive thioester precursor” refers to a chemical moiety that, upon transformation, affords an active thioester moiety.
- the term “ligation products” refers to products formed through the chemical ligation of ohgopeptides.
- Alkyl group is branched or unbranched and contains 1 to 7 carbon atoms, preferably 1-4 carbon atoms.
- Alkyl represents, for example, methyl, ethyl, propyl, butyl, isopropyl or isobutyl.
- Alkyl groups can be substituted by up to 3 substituents selected from alkoxy, aryl, heterocyclyl, hydroxy, halogen, cyano, optionally substituted amino, optionally substituted amino-oxy- or trifluoromethyl.
- Aryl represents a monocyclic, bicyclic or tricyclic aromatic ring system, for example, phenyl or phenyl mono-, di- or tri-substituted by one, two or three radicals independently selected from alkyl, alkoxy, unsubstituted phenyl, hydroxy, halogen, cyano, amino, amino-alkyl, trifluoromethyl, alkylenedioxy and oxy-C 2 -C 3 -alkylene, all of which are optionally further substituted, for instance as hereinbefore defined.
- Aryl can also represent 1- or 2-naphthyl, or 1- or 2-phenanthrenyl.
- aryl is naphthyl, phenyl or phenyl mono- or disubstituted by alkoxy, halogen, alkyl or trifluoromethyl, especially phenyl or phenyl-mono- or disubstituted by alkoxy, halogen or trifluoromethyl, and in particular phenyl.
- substituted phenyl groups are, e.g. 4-chlorophen-l-yl, 3,4-dichlorophen-l-yl, 4-methoxyphen-l-yl, 4-methylphen-l-yl, 4-aminomethylphen-l-yl, 4- methoxyethylaminomethylphen- 1 -yl, 4-hydroxyethylaminomethylphen- 1 -yl, 4-hydroxyethyl- (methyl)-aminomethylphen- 1 -yl, 3-aminomethylphen- 1 -yl, 4-N-acetylaminomethylphen- 1 - yl, 4-aminophen-l-yl, 3-aminophen-l-yl, 2-aminophen-l-yl, 4-phenyl-phen-l-yl and 4-(2- methoxyethylaminomethyl)-phen- 1 -yl.
- Benzyl represents a phenyl-CH 2 - group.
- Substituted benzyl means a benzyl group in which the phenyl ring is substituted with one or more ring system substituents.
- Representative benzyl groups include 4-bromobenzyl, 4-methoxybenzyl, 2,4- dimethoxybenzyl, and the like.
- heteroaryl refers to a monocyclic or bicyclic aromatic ring system having 5-12 carbons and 1-4 ring members as heteroatoms each independently selected from N, O and S.
- Representative examples include pyridyl, indolyl, indazolyl, quinoxalinyl, quinolinyl, isoquinolinyl, benzothienyl, benzofuranyl, benzopyranyl, benzothiopyranyl, furanyl, pyrrolyl, thiazolyl, benzothiazolyl, oxazolyl, isoxazolyl, triazolyl, tetrazolyl, pyrazolyl, imidazolyl, and thienyl, each of which is optionally substituted, preferably mono- or di-substituted, by e.g.
- Pyridyl represents 2-, 3- or 4-pyridyl, advantageously 2- or 3-pyridyl.
- Thienyl represents 2- or 3-thienyl.
- Quinolinyl represents preferably 2-, 3- or 4-quinolinyl.
- Isoquinolinyl represents preferably 1-, 3- or 4- isoquinolinyl.
- Benzopyranyl, benzothiopyranyl represents preferably 3-benzopyranyl or 3- benzothiopyranyl, respectively.
- Thiazolyl represents preferably 2- or 4-thiazolyl, and most preferred, 4-thiazolyl.
- Triazolyl is preferably 1-, 2- or 5-(l,2,4-triazolyl).
- Tetrazolyl is preferably 5 -tetrazolyl.
- heteroaryl is pyridyl, indolyl, quinolinyl, pyrrolyl, thiazolyl, isoxazolyl, triazolyl, tetrazolyl, pyrazolyl, imidazolyl, thienyl, furanyl, benzothiazolyl, benzofuranyl, isoquinolinyl, benzothienyl, oxazolyl, and indazolyl, each of which is optionally substituted, preferably mono- or di-substituted.
- Biaryl may preferably be, e.g., biphenyl, namely 2, 3 or 4-biphenyl, preferably, 4- biphenyl, each optionally substituted by, e.g., alkyl, alkoxy, halogen, trifluoromethyl or cyano, or heterocyclic-carbocyclic biaryl, preferably, e.g., thienylphenyl, pyrrolylphenyl and pyrazolylphenyl.
- Amino can be optionally substituted by, e.g., alkyl.
- Heterocyclyl represents a saturated cyclic hydrocarbon containing one or more, preferably 1 or 2, hetero atoms selected from O, N or S, and from 3 to 10, preferably 5 to 8, ring atoms.
- hetero atoms selected from O, N or S, and from 3 to 10, preferably 5 to 8, ring atoms.
- Halogen preferably represents chloro or fluoro, but may also be bromo or iodo.
- polyhalo defines a compound or radical which has at least two available hydrogens substituted with a halogen. Those compounds or chemical moieties that have all available hydrogens replaced with a halogen are termed "perhalo".
- perfluorophenyl can refer to 1,2,3,4,5-pentafluorophenyl
- perfluoromethane can refer to 1,1,1 -trifluoromethyl
- perfluoromethoxy can refer to 1,1,1 -trifluoromethoxy.
- quaternary ammonium salts refers to chemical moieties of the following formula:
- Rh X- 9-N-R 1 R f wherein R f , R g , R h and R* are generally hydrogen, alkyl, or aryl, or one of R f , R s , R h and R' can be an amino acid, a peptide, or a protein, for example, and X " is an anionic chemical moiety, such as a halogen, sulphate, nitrate, phosphate, or carbonate, that is ionically bound to the positively charged nitrogen atom.
- the present invention stems from the fact that the carboxyester structure shown in Fig. 1 a with the free thiol has a limited applicability, since it is prone to hydrolysis, to generate the free carboxyhc acid and therefore the effectiveness of the depicted structure depends on the size of the peptide fragments in ligation. This is crucial in the preparation of long ohgopeptide and polypeptide chains where, due to the complexity of the system, the ligation is much slower than on small model peptides. Any improvement to the stability of the carboxythioester system can therefore have a very significant impact on the production yields of larger ohgopeptides, polypeptides and proteins, potentially of high biological importance.
- a solution to reduce the amount of free carboxyhc acid is to keep the thiol protected during the cleavage and purification steps.
- Such a protection scheme presents several advantages: when the thiol is protected as, e.g., disulfide bond (S-S-R"), (Fig 1 b), the disulfide protected 2-mercapto carboxyester shows total stability under cleavage conditions, even when Lys and Phe are the adjacent amino acid residues.
- purification of the intermediate is simplified since the protected thiol does not undergo isomerism due to O to S acyl-migration.
- the carboxyester with the protected thiol can be more easily differentiated from the hydrolyzed form due to the additional mass of the protecting group.
- Such a scheme also significantly facilitates the preparation of the S-disulfide protected 2-mercapto carboxyester intermediates.
- the S-disulfide protected cysteine can be coupled to a solid support using standard coupling conditions, and after removal of the amino protecting group, the free amine is then transformed into an OH moiety by reacting with KNO 2 in acidic conditions.
- the resin can be functionalized with the amino acid of choice using a base-catalyzed coupling like HBTU/DIEA with DMAP ( Figure 10).
- a free active thiol can be liberated in situ under ligation conditions by adding: (i) thiols to catalyze the ligation (e.g. thiophenol); and/or (ii) phosphine, (TCEP or Pbut 3 ) or any other reducing agent compatible with ligation, such as sodium dithionite.
- thiols to catalyze the ligation
- phosphine TCEP or Pbut 3
- any other reducing agent compatible with ligation such as sodium dithionite.
- This strategy is especially advantageous when the disulfide pair is made with S-S- tert-butyl (sulfur protected as S-tert-butylthio). Indeed, due to the high steric hindrance of the tert-butylthio moiety, the cleavage of the disulfide is much slower than on a standard disulfide pair under similar conditions. In such a situation, the free active thiol is liberated slowly, allowing a strong excess of the N-terminal cysteine or the 1,2- or 1,3-N-terminal amino thiol fragment to be present, and thus driving the process to completion with higher yield. This positive effect of the S-S-tert-butyl protection scheme (i.e.
- a peptide fragment bearing at the N-terminal a free cysteine and at the C-terminal a S-tert- butylthio carboxyester can selectively undergo native chemical ligation with an incoming thioester fragment using either a mild reducing agent or a mild nucleophile.
- a mild reducing agent such as a phosphine like TCEP or PBut , would be useful as it does not reduce the S-S- tert-butyl moiety very rapidly.
- a mild nucleophile like thiophenol or sodium dithionite, both in stoichiometric amount or in low excess, would be useful as both act without significantly cleaving the S-S-tert-butyl protecting group.
- each ohgopeptide has an N-terminus and a C-terminus.
- Ohgopeptide A has a thioester group at the C-terminus, and an N-terminus that is substantially unreactive to the thioester group at the C-terminus.
- Ohgopeptide B has a cysteine or a 1,2- or 1,3-amino thiol at the N-terminus, and an inactive thioester precursor at the C-terminus.
- ohgopeptide C has a protected cysteine or a protected 1,2- or 1,3-amino thiol at the N-terminus, and a thioester at the C-terminus.
- Ohgopeptide D has an unprotected cysteine or unprotected 1,2- or 1,3-amino thiol at the N-terminus, and a C-terminus that is substantially unreactive with the unprotected cysteine or unprotected 1,2- or 1,3-amino thiol.
- ohgopeptides A and B are chemically ligated to form the first ohgopeptide ligation product (A-B), having an inactive thioester precursor at the C-terminus and an N-terminus that is substantially unreactive to the thioester group.
- ohgopeptides C and D are chemically ligated to form a second ohgopeptide ligation product (C-D), having a protected cysteine or a protected 1,2- or 1,3-amino thiol at the N-terminus, and a C-terminus that is substantially unreactive with the unprotected cysteine or unprotected 1,2- or 1,3-amino thiol.
- C-D second ohgopeptide ligation product
- A-B inactive thioester precursor of the first ligation product
- A-B is then transformed into a thioester to afford a third ohgopeptide ligation product A-B*).
- the protected cysteine or protected 1,2- or 1,3-amino thiol of the second ohgopeptide ligation product (C-D) is deprotected to afford the fourth ohgopeptide ligation product (C*-D).
- the third (A-B*) and fourth (C*-D) ohgopeptide ligation products are then placed into a single reaction vessel and are chemically ligated to form a fifth ohgopeptide ligation product (A-B-C-D).
- the present invention provides methods for the assembly of oligopeptides into an ohgopeptide or polypeptide by the process of native chemical ligation. Related methods are described by Dawson et al, Science, 266: 776-779 (1994); Low et al, Proc. Natl. Acad. Sci., 98: 6554-6559 (2001) and Botti et al, Tetrahedron Letters, 42: 1831-1833 (2001). In particular, the present invention provides a method and compounds for producing ohgopeptide thioester intermediates using Fmoc chemistry which, in turn, enables convergent synthesis strategies for chemical synthesis of polypeptides using such intermediates.
- the present invention provides a method for preparing an ohgopeptide or polypeptide product, comprising: (a) ligating in a first reaction, first and second oligopeptides each having an N-terminus and a C-terminus, wherein the first ohgopeptide comprises a C-terminus having a thioester group, and an N-terminus that is substantially unreactive with the thioester group, wherein the second ohgopeptide comprises an N- terminus having an unprotected cysteine, an unprotected 1,2-amino thiol, or an unprotected 1,3-amino thiol, and a C-terminus having an inactive thioester precursor, and wherein the ligating forms a first ohgopeptide ligation product comprising a C-terminus having an inactive thioester precursor, and an N-terminus that is substantially unreactive with the thioester group;
- the present invention provides a method for preparing an ohgopeptide or polypeptide product further comprising the following step: (f) ligating the fifth ohgopeptide ligation product of step (e) to one or more additional oligopeptides, with the proviso that the fifth ohgopeptide ligation product of step (e) and the one or more additional oligopeptides bear, or are prepared to bear N-terminal and C-terminal groups capable of chemical ligation, wherein the N-terminal group capable of chemical ligation comprises an unprotected cysteine, an unprotected 1,2-amino thiol, or an unprotected 1,3- amino thiol, and wherein the C-terminal group capable of chemical ligation comprises a thioester.
- the present invention provides a method for preparing an ohgopeptide or polypeptide product wherein the N-terminus of the fifth ohgopeptide ligation product of step (e) comprises an unprotected N-terminal amino acid, or a protected N-terminal amino acid.
- the present invention provides a method for preparing an ohgopeptide or polypeptide product wherein the protected N-terminal amino acid is cyclic.
- the present invention provides a method for preparing an ohgopeptide or polypeptide product wherein the protected N-terminal amino acid comprises a protected cysteine, a protected 1,2-amino thiol, or a protected 1,3-amino thiol.
- the present invention provides a method for preparing an ohgopeptide or polypeptide product wherein the C-terminus of the fifth ohgopeptide ligation product of step (e) comprises an unprotected amino acid, or an inactive thioester precursor.
- the present invention provides a method for preparing an ohgopeptide or polypeptide product wherein any of the oligopeptides or ohgopeptide ligation products having an inactive thioester precursor at the C-terminus is defined by the formula:
- the present invention provides a method for preparing an ohgopeptide or polypeptide product wherein R' is a sulfur protecting group. [0064] In yet another preferred embodiment, the present invention provides a method for preparing an ohgopeptide or polypeptide product wherein R' is -SR". In a further embodiment, the present invention provides a method for preparing an ohgopeptide or polypeptide product wherein R" is a member selected from the group consisting of ethyl, t- butyl and substituted phenyl.
- the present invention provides a method for preparing an ohgopeptide or polypeptide product wherein the ohgopeptide or polypeptide product is prepared according to the procedure in Figure 10.
- the present invention provides a method for preparing an ohgopeptide or polypeptide product wherein each step is performed in a solution selected from the group consisting of an organic solvent and an organic and aqueous solvent mixture.
- the present invention provides a method for preparing an ohgopeptide or polypeptide product wherein Y is -C(O)NH 2 .
- All the Y groups of the present invention are sufficiently electron- withdrawing to efficiently activate the carboxyester to allow the O to S acyl shift. Variations on the Y group, however, can have effects during ligation.
- peptide A generates approximately 20% of hydrolyzed carboxyester
- peptide B where the ester moiety has a stronger electron-withdrawing effect than the carboxyamide, produces approximately 30% of hydrolyzed carboxyester. Therefore, while all the Y groups of the present invention enhance the stability of the carboxyester, some Y groups have a greater stabilizing effect on the carboxyester than other Y groups of the present invention.
- the unoxidized sulfhydryl side chain of the N-terminal cysteine is condensed with the C-terminal thioester to produce an intermediate oligopeptide which links the first and second oligopeptides with a ⁇ -aminothioester bond.
- the ⁇ -aminothioester bond of the intermediate oligopeptide then undergoes an intramolecular rearrangement to produce the ohgopeptide product that links the first and second oligopeptides via an amide bond.
- At least one fragment will have both an N-terminal cysteine and a C-terminal thioester, thereby creating the possibility for self-ligation, which under conventional reaction conditions is quite significant because of the close proximity of the reactive intra-molecular moieties.
- the N-terminal cysteine of an internal fragment can be protected from such reactions by a cyclic thiazolidine protecting group, as demonstrated by Gaertner et al, Proceedings of the 17 th American Peptide Symposium, pgs. 107-108 (San Diego, June 9-14, 2001).
- These protecting group strategies were previously unavailable to chemical ligations using auxiliary groups, such as disclosed by Low et al. and Botti et al.
- a new class of heterocychc protecting groups is provided that significantly increases the efficiency of ligations by preventing self-ligations in auxiliary group-assisted ligations.
- the operation of the heterocychc protecting groups is illustrated in Figure 3 for a three component ligation.
- radical R 4 is such that it promotes the opening of the thiazolidine ring
- R 5 is hydrogen or alkyl
- R 3 is hydrogen or an electron-donating group
- R 6 is an alkyl linker to an amide or an amino acid.
- Heterocyclic-protected thioester-modified oligopeptide (102) has thioester group (106) and exemplary heterocychc protecting group (200).
- Thioester (106) reacts with N-terminal cysteine (104) of oligopeptide (100) in a procedure similar to that described by Dawson et al, Kent et al, and others (cited above) to give oligopeptide ligation product (202) consisting of oligopeptide (100) and oligopeptide (102) conjugated by amide bond (204).
- the oligopeptide ligation product at this step is then treated with an O-alkoxyhydroxylamine (206) under acidic conditions to open heterocychc protecting group (200) affording a free terminal sulfhydryl group on auxiliary group (212), which is attached to the secondary amine of the N-terminal amino acid (208), which in this illustration is glycine.
- the next thioester-modified oligopeptide (210) reacts (214) with N-terminal amine (208) in a procedure similar to that by Low et al. and Botti et al. (cited above) to provide the intermediate product (216).
- the auxiliary group (212) is removed (220) by acid treatment to afford the final product (218).
- removal is accomplished by treatment with HF or trifluoroacetic acid (TFA).
- Exemplary removal conditions include: (i) 95% HF and 5% -cresol; (ii) TFA/bromotrimethylsilane; and (iii) 95% TFA, 2.5% triisopropylsilane (TIS), and 2.5% water.
- TFA trifluoroacetic acid
- the heterocychc protecting group (200) can be formed at the N-terminus of an oligopeptide thioester by first synthesizing the oligopeptide thioester with an auxiliary group (212) followed by cyclization of the free sulfhydryl of the auxiliary group with the secondary ⁇ -amine (208) of the terminal amino acid.
- An oligopeptide thioester having an auxiliary group can be synthesized in several ways, including by halogen-mediated amino alkylation or by reductive amination.
- the heterocychc protecting group can be formed by preparation of a fully protected amino acid monomer with the heterocychc protecting group in place for the last addition cycle in the synthesis of a desired oligopeptide thioester.
- synthesis begins with an oligopeptide thioester attached to a resin, as shown in Figures 4-6.
- oligopeptides prepared by the methods described above can also be prepared on a suitable solid support member.
- a suitable solid phase support can be selected on the basis of desired end use and suitability for various synthetic protocols.
- useful solid phase support can be resins such as polystyrene (e.g., PAM- resin obtained from Bachem Inc., Peninsula Laboratories, etc.), POLYHIPETM resin (obtained from Aminotech, Canada), polyamide resin (obtained from Peninsula Laboratories), polystyrene resin grafted with polyethylene glycol (TentaGelTM, Rapp Polymere, Tubingen, Germany), polydimethyl-acrylamide resin (available from Milligen/Biosearch, California), or PEGA beads (obtained from Polymer Laboratories).
- polystyrene e.g., PAM- resin obtained from Bachem Inc., Peninsula Laboratories, etc.
- POLYHIPETM resin obtained from Aminotech, Canada
- polyamide resin obtained from Peninsula Laboratories
- Oligopeptides having a C-terminal thioester can be prepared following procedures similar to those described in the following references: Kent et al, U.S. Patent No. 6,184,344; Tarn et al, Proc. Natl. Acad. Sci., 92: 12485-12489 (1995); Blake, Int. J. Peptide Protein Res., 17: 273 (1981); Canne et al, Tetrahedron Letters, 36: 1217-1220 (1995); hackeng et al, Proc. Natl. Acad. Sci., 94: 7845-7850 (1997); or Hackeng et al, Proc. Natl. Acad.
- Oligopeptides can be synthesized on a solid phase support typically on a 0.25 mmol scale by using the in situ neutralization/HBTU activation procedure for Boc chemistry, following a procedure similar to that disclosed by Schnolzer et al, Int. J. Peptide Protein Res., 40: 180-193 (1992).
- HBTU is 2-(lH-benzotriazol-l-yl)-l,l,3,3-tetramethyluronium hexafluorophosphate and Boc is tert-butoxycarbonyl).
- Each synthetic cycle consists of N"-Boc removal by a 1- to 2-minute treatment with neat TFA, a 1 -minute DMF flow wash, a 10- to 20-minute coupling time with 1.0 mmol of preactivated Boc-amino acid in the presence of DIEA, and a second DMF flow wash.
- TFA trifluoroacetic acid
- DMF is N,N-dimethylformamide
- DIEA is N,N-diisopropylethylamine
- N ⁇ -Boc-amino acids (1.1 mmol) are preactivated for 3 minutes with 1.0 mmol of HBTU (0.5 M in DMF) in the presence of excess DIEA (3 mmol).
- yields are determined by measuring residual free amine with a conventional quantitative ninhydrin assay, e.g. as disclosed in Sarin et al, Anal. Biochem., 117: 147-157 (1981).
- a DCM flow wash is used before and after deprotection by using TFA, to prevent possible high-temperature (TFA/DMF)-catalyzed pyrrohdone formation.
- a haloacetyl group such as bromoacetyl, can be added, in a procedure similar to that disclosed by Zuckerman et al, J. Am. Chem. Soc.
- Oligopeptide thioesters of the present invention can be synthesized using either Fmoc or Boc chemistries. When Fmoc chemistry is employed, a
- 3-carboxypropanesulfonamide "safety catch” linker is used to generate the thioester.
- Thioester oligopeptides described above are preferably synthesized on a trityl-associated mercaptopropionic acid-leucine (TAMPAL) resin, made in a procedure similar to that disclosed by Hackeng et al (1999), or comparable protocol.
- TAMPAL trityl-associated mercaptopropionic acid-leucine
- N ⁇ -Boc-Leu (4 mmol) is activated with 3.6 mmol of HBTU in the presence of 6 mmol of DIEA and coupled for 16 minutes to 2 mmol of -methylbenzhydrylamine (MBHA) resin, or the equivalent.
- MBHA -methylbenzhydrylamine
- TAMPAL resin can be used as a starting resin for polypeptide-chain assembly after removal of the trityl protecting group with two 1-minute treatments with 3.5% triisopropylsilane and 2.5% H 2 O in TFA.
- the thioester bond can be formed with any desired amino acid by using standard in sitM-neutralization peptide coupling protocols for 1 hour, in a procedure similar to that disclosed in Schnolzer et al. (cited above). Treatment of the final oligopeptide with anhydrous HF yields the C-terminal activated mercaptopropionic acid-leucine (MPAL) thioester oligopeptides.
- MPAL C-terminal activated mercaptopropionic acid-leucine
- oligopeptide thioesters are deprotected and cleaved from the resin by treatment with anhydrous HF for 1 hour at 0 °C with 4%/>-cresol as a scavenger.
- the imidazole side-chain 2,4-dinitrophenyl (DNP) protecting groups remain on the His residues because the DNP-removal procedure is incompatible with C-terminal thioester groups. However, DNP is gradually removed by thiols during the ligation reaction.
- oligopeptide thioesters can be precipitated in ice-cold diethylether, dissolved in aqueous acetonitrile, and lyophilized.
- Heterocyclic protected oligopeptide thioesters are synthesized by a variety of schemes, as illustrated in Figures 4-6.
- Scheme 1 shown in Figure 4, a free N-terminal amine of oligopeptide thioester (300) is reacted with protected amino acid (302), having auxiliary group (-D-S-R 7 ), in a standard coupling reaction (304), e.g. Schnolzer et al (cited above), to afford oligopeptide thioester (306) having auxiliary group (308) attached to the ⁇ -amine.
- R 9 is amino acid side chain, other than the side chain for proline.
- R 9 is a non-sterically hindering amino acid side chain, or the side chain of histidine. More preferably, R 9 is hydrogen, methyl, hydroxymethyl, or the side chain of histidine.
- Oligopeptide thioester (312) is formed by selective deprotection (310) of the ⁇ -amine and the sulfhydryl group of the auxiliary group. In a preferred embodiment, selective deprotection (310) is achieved by mild acid treatment, for example, trifluoroacetic acid (TFA) under conventional reaction conditions, e.g.
- TFA trifluoroacetic acid
- R 8 protecting groups are Boc and Fmoc.
- R 7 protecting groups include benzyl, 4-methylbenzyl, 4-methoxybenzyl, trityl, acetamidomethyl, trimethylacetamidomethyl, xanthyl, and the like.
- R 1 and R 2 are selected to promote the opening of the heterocyclic protecting group under acidic conditions in the presence of a nucleophilic agent.
- R 1 and R 2 are separately hydrogen, electron withdrawing-substituted alkyl having from 1 to 3 carbon atoms, alkylcarbonyl having 2 to 3 carbon atoms, or arylcarbonyl having 7 to 10 carbon atoms.
- D is a linking moiety that together with a free sulfhydryl (“HS-D-”) is referred to herein as an auxiliary group.
- D is an alkyl, alkenyl, aryl, aralkyl, cycloalkyl moiety having from 2 to 16 carbon atoms and from 0 to 4 heteroatoms that: (i) maintains the heterocyclic sulfur closely adjacent to the heterocylic nitrogen after deprotection in order to promote the rearrangement reaction of native chemical ligation; and (ii) provides a cleavable bond to the heterocyclic nitrogen so that after deprotection and fragment coupling, the auxiliary group is removed.
- D maintains the sulfhydryl group within an equivalent distance of 2 to 3 carbon-carbon bond lengths to the N ⁇ of the N-terminal amino acid of the oligopeptide thioester reactant, the carbon-carbon bonds being those of a linear alkyl group.
- the auxiliary group is an ethylthiol.
- R 3 taken alone is hydrogen or an electron donating group having from 1 to 12 carbon atoms and from 0 to 4 heteroatoms selected from the group consisting of nitrogen, oxygen, sulfur, and phosphorus.
- R 3 taken alone is hydrogen or electron donating group having from 1 to 8 carbon atoms and from 0 to 2 heteroatoms selected from the group consisting of nitrogen, oxygen, and sulfur. Still more preferred, R 3 taken alone is hydrogen, phenyl, electron donating-substituted phenyl, 2- or 4-picolyl, or electron donating-substituted 2- or 4-picolyl. Still more preferably, R 3 taken alone is hydrogen or methoxy-substituted phenyl. Most preferably, R 3 taken alone is 4-methoxyphenyl or 2,4-dimethoxyphenyl.
- R 6 is alkyl having from 1 to 6 carbon atoms or alkylaryl having from 6 to 8 carbon atoms, -CH 2 -CONH 2 , -CH2CH2CONH2, or -(CH 2 ) k -CO-Xaa, wherein subscript k is an integer equal to 1 or 2 and Xaa is an amino acid.
- R 9 is an amino acid side chain, other than those of proline and cysteine. More preferably, R 9 is an amino acid side chain other than those of proline, cysteine, valine, isoleucine, and threonine. In further preference, R 9 is hydrogen, methyl, hydroxymethyl, or the side chain of histidine. Most preferably, R 9 is hydrogen or methyl. Reaction of bromoacetylated oligopeptides with auxiliary group precursors
- Scheme 2 A second scheme (Scheme 2) for synthesizing heterocyclic protected oligopeptide thioesters is shown in Figure 5.
- This Scheme roughly follows the procedure disclosed by Botti et al. (cited above). Bromoacetylated oligopeptide thioester (400) is reacted with S-protected ethylamine or S-protected aminothiophenyl (402), or like group, to afford oligopeptide thioester (404) with auxiliary group (406), after which the sulfhydryl protecting group (R 7 ) is removed (408) with mild acid.
- R 7 is removed with TFA in the presence of a trityl scavenger, such as TIS.
- a trityl scavenger such as TIS.
- the ⁇ -amine of oligopeptide thioester (410) and the free sulfhydryl of the auxiliary group are reacted (412) with carbonyl (414) to form a heterocyclic protected oligopeptide thioester (416).
- R 1 and R 2 can be biotin, digoxigenin, or like affinity group, connected to a linking moiety, e.g. biotin-(CH 2 ) n -, or R 1 or R 2 can be a hydrophobic or hydrophilic group designed to modify chromatographic retention time to aid in purification.
- Heterocyclic protected oligopeptide thioester (416) is then deprotected and cleaved from the resin (418), e.g. by HF treatment, to give final product (420). Reaction of N-terminal amines with auxiliary group derivatized amino acids
- a third Scheme (Scheme 3) shown in Figure 6 the heterocyclic protecting group is added to the oligopeptide thioester by coupling a derivatized amino acid already having the group in place.
- Oligopeptide thioester (500) having a free N-terminal amine is reacted with a derivatized amino acid (502) in a conventional solid phase peptide synthesis reaction to afford oligopeptide (504), after which it is deprotected and cleaved (506) from the synthesis column to afford the final product (508).
- Derivatized amino acid (502) can be prepared by several routes.
- derivatived amino acid (502) is prepared by first synthesizing an intermediate having an auxiliary group-substituted N ⁇ in the following nucleophilic substitution reaction: X-CH(R 9 )-COOR 10 + R 7 -S-D-NH 2 ⁇ R 7 -S-D-NH-CH(R 9 )-COOH where X is halogen, preferably bromo, and R 10 is a conventional protecting group or a solid phase support.
- the sulfhydryl group of the resulting N ⁇ -substituted amino acid can be afforded by conventional protocols (e.g.
- TFA/TIS for trityl-protected sulfhydryl after which it can be reacted with a substituted formaldehyde, CO(R')(R 2 ), and the N" amine to provide the derivatized amino acid (502).
- the above intermediate can be prepared via nucleophilic substitution or by reductive amination, as shown in the following reaction scheme:
- radical D of the product is chain extended by a single carbon atom. Accordingly, radical D in the starting material of the scheme above is a methyl ene or ethylene unit in some embodiments, and a direct bond in other embodiments.
- heterocyclic-protected oligopeptide thioester intermediates are used in native chemical ligation under conditions similar to those described by Hackeng et al. (1999), or like conditions.
- 0.1 M phosphate buffer (pH 8.5) containing 6 M guanidine, 2% (vol/vol) benzylmercaptan, and 2% (vol/vol) thiophenol is added to dry peptides to be ligated, affording a final peptide concentration of 1-3 mM at about pH 7.
- the ligation reaction can be performed in a heating chamber at 37 °C under continuous stirring and can be periodically vortexed to equilibrate the thiol additives. The reaction can be monitored for degree of completion by MALDI-MS or HPLC and electrospray ionization MS .
- N-terminal amines and removal of auxiliary groups [0089] After a native chemical ligation reaction is completed or stopped, the N-terminal heterocyclic ring of the product can be opened by treatment with a deprotecting agent that is nucleophilic under acidic conditions.
- a deprotecting agent that is nucleophilic under acidic conditions.
- agents include certain O-alkylhydroxylamines, hydrazines, and like reagents.
- the N-terminal heterocyclic ring of the product is opened by treatment with O-methylhydroxylamine (0.5 M) at pH 3.5-4.5 for 2 hours at 37 °C, after which a 10-fold excess of Tris-(2-carboxyethyl)-phosphine (TCEP) is added to the reaction mixture to completely reduce any oxidizing reaction constituents prior to purification of the product.
- TCEP Tris-(2-carboxyethyl)-phosphine
- Preparative HPLC is the preferred method of purification.
- fractions containing the ligation product are identified by electrospray MS, pooled, and lyophilized.
- N-terminal thiazolidines can be ring- opened with a variety of nucleophilic agents under acidic conditions, as discussed above. Ring-opening under acidic conditions is dependent on the C2 substituents (Wohr et al, J. Am. Chem. Soc, 118: 9218 (1994)).
- the following agents can be used as thiazolidine ring- opening agents: O-methylhydroxylamine and other hydroxylamine derivatives.
- TCEP Tris-(2-carboxyethyl)-phosphine
- O-methoxyhydroxylamine is used as the thiazolidine ring- opening agent.
- O-methoxyhydroxylamine reacts with the masked aldehyde function in the thiazolidine ring to form an oxime, as shown below:
- R 3 is as defined above, and R 4 and R 5 can be, for example, hydrogen, alkyl, amide, ester, halogen, cycloalkyl, heterocyclyl, aryl and heteroaryl, all optionally substituted.
- R 4 promotes the deprotection of the thiazolidine ring.
- substituents will be apparent to one of skill in the art.
- One of skill in the art will appreciate that other agents can also be used to deprotect thiazolidine protecting groups of the present invention.
- Auxiliary groups can be removed after each ligation step, or they can be removed all at the same time after the polypeptide final product is completely synthesized.
- D a variety of removal procedures are available.
- D that donates electrons to the N 01 of the adjacent amino acid
- removal of the auxiliary group can be readily effected by acidic conditions, such as used in conventional peptide synthesis for side chain deprotection.
- Exemplary acids for such cleavage include HF, TFA, trifluoromethanesulfonic acid (TFMSA), and the like.
- conventional scavenging agents e.g. 5% p-cresol, or the like, can be used to bind or react with aryl, thiol, or other reactive moieties, and to prevent undesired secondary reactions with amino acid side chains.
- the final polypeptide product can be refolded by conventional techniques similar to those described by Creighton, Meth. Enzymol., 107: 305-329 (1984); White, Meth. Enzymol., 11 : 481-484 (1967); Wetlaufer, Meth. Enzymol., 107: 301-304 (1984); Misawa et al, Biopolymers, 51 : 297-307 (1999); Anfinsen, Science, 181 : 223-230 (1973); and the like.
- a final product is refolded by air oxidation by dissolving the reduced lyophilized product (at about 0.1 mg/mL) in 1 M guanidine hydrochloride (or like chaotropic agent) with 100 rriM Tris, 10 mM methionine, at pH 8.6. After gentle overnight stirring, the re-folded product is isolated by reverse phase HPLC with conventional protocols.
- S-Disulfide-protected 2-mercapto carboxyester of an oligopeptide intermediate can be prepared by a variety of possibilities including the following schemes ( Figure 10 A,B,C,D): A) Formation of 2 S-Disulfide-protected mercapto carboxyester from a S- protected 2-mercapto carboxyester peptide resin whose thiol is protected with a mildly or super acid-labile protecting group followed by deprotection of the thiol prior to cleavage from the synthesis resin and formation of a disulfide prior or concomitantly to the cleavage.
- a protected thiol precursor, PG-S-(CH ) n - CH(OH)COOH is coupled using carbodiimide chemistry (DCC, or DIC preferably) with a mild activated agent like trichlorophenol or N-hydroxysuccinimide to an amino-derivatized synthesis resin.
- the resin can then be functionalized with the first amino acid of the sequence using a base-catalyzed coupling like HBTU/DIEA with DMAP.
- disulfide protected carboxythioesters are formed prior to cleavage of the intermediate from the synthesis resin.
- PG-S-(CH 2 ) n -CH(O-CO-Xaa 1 -Fmoc)-CONH-linker-resin [0095]
- the Fmoc is removed, followed by removal of the protecting group, PG, with mild acid.
- formation of a peptide S-Disulfide-protected 2-mercapto carboxyester can be accomplished according to Figure 10A.
- PG is monomethoxytrityl, and is removed by conventional conditions, e.g. 1-2% trifluoroacetic acid and TIS.
- Disulfide-forming reagents include symmetric disulfides such as symmetric aromatic disulfides, symmetric hindered alkyl disulfides, and the like. More particularly, disulfide-forming reagents include bithiobis(pyridine), dithiobis(5-nitropyridine), dithiobis-t-butyl, R"-SO-S-R", and the like. HS-(CH 2 ) n -CH(O-CO-Xaa ⁇ -Xaa 2 - ...
- PG may be picolyl, ACM, Phenacyl, or other acid stable protecting groups known to one of skill in the art.
- the initial precursor (I) is produced as follows. Chloroalanine is treated with sodium nitrate or potassium nitrate under acidic conditions to convert the ⁇ -amine to a hydroxyl, as shown:
- chloro is then replaced with a protected sulfur or a protected disulfide, e.g. via nucleophilic displacement.
- the chloro is replaced with a mercapto generating labile sulfur protecting group like 4-methoxytrityl mercaptan, after which the product is reacted with an Fmoc-protected activated amino acid like Fmoc-AA-OPFP or Fmoc-AA-OSu to give compound (I).
- a free thioester is generated by treating the ligation product with a reducing agent, preferably a thiol reducing agent, such as benzenethiol.
- a reducing agent preferably a thiol reducing agent, such as benzenethiol.
- the reducing agent frees the thiol group which spontaneously forms a thioester.
- the present invention provides a compound of the formula: Xaa,- ... -Xaa m -(CH-R)-CO-O-C*H[(CH 2 ) n -S-R']-Y
- m is an integer from 2 to 200
- n is an integer from 1 to 10
- C is a chiral carbon in either the R or the S configuration, and substantially free of the other configuration
- R is an amino acid side chain
- R' is a member selected from the group consisting of a sulfur protecting group, -SR" and hydrogen
- R" is a member selected from the group consisting of C 2 - ⁇ 0 alkyl, substituted aryl having from 5 to 12 carbon atoms, substituted benzyl, and substituted heteroaryl having from 5 to 12 carbon atoms and 1 to 4 heteroatoms each independently selected from the group consisting of N, O and S;
- the present invention provides a compound wherein R' is a sulfur protecting group. [0102] In yet another preferred embodiment, the present invention provides a compound wherein R' is -SR". In yet still another preferred embodiment, the present invention provides a compound wherein R' is hydrogen. In a further embodiment, the present invention provides a compound wherein R" is a member selected from the group consisting of ethyl, t- butyl and substituted phenyl. [0103] In another preferred embodiment, the present invention provides a compound wherein Y is -C(O)NH 2 . [0104] In yet another aspect, the present invention provides a compound of the formula:
- m is an integer from 2 to 200
- n is an integer from 1 to 10
- R is an amino acid side chain
- R' is a sulfur protecting group
- Y is an electron withdrawing group selected from the group consisting of R c , C ⁇ - 3 alkyl substituted with 1-3 R c groups, -C(O)-R d , -S(O) p -C ⁇ - 3 alkyl substituted with 0-3 R c groups, and an aryl substituted with 1-3 R c groups
- each R c group is independently a member selected from the group consisting of halogen, polyhaloalkyl, substituted or unsubstituted benzyl, substituted or unsubstituted
- Example 1 Preparation of LYRAF-O-COCH(CH ? -S-S-Pyr : ⁇ NE ( Figure 10A)
- Rink amide resin Novabiochem 0.61 mmol/g, 0.1 mmol
- MmtSCH 2 CH(OH)COOH 0.5 mmol
- N-hydroxysuccinimide 1.2 eq
- Diisopropylcarbodiimide 1.2 eq.
- the first Fmoc amino acid (1 mmol) was activated with HBTU/DIEA in the presence of a catalytic amount of DMAP and it was coupled to the resin for 1 hour. A double coupling was necessary. Then the SPPS was performed manually, using 10 excess of each activated Fmoc amino acid and monitored with the ninhydrin test. [0109] After the final cycle the Fmoc. was cleaved and the peptide-resin was washed successively with DMF, DCM, DCM and MeOH and it was dried.
- Example 3 Preparation of S-Mmt lactic acid (3S-4 , methoxytrityl-2-hvdroxy-propanoic acid) by reaction of chlorolactic acid with Mmt-SH ( Figure 10B, 10O
- the first Fmoc amino acid was activated with DCC and DMAP and coupled to the resin for 2 hours. The coupling was repeated for 1 hour. Then, the SPPS proceeded with the usual activation of the Fmoc amino acids using HBTU/DIEA and it was monitored with the ninhydrin test.
- the Fmoc was cleaved, the peptide-resin was washed respectively with DMF, DCM, DCM/MeOH 50/50 and it was dried. It was then treated with a mixture of TFA TIS/ ⁇ 2 O : 90/5/5 under stirring at room temperature After lh 30 the resin was removed by filtration and washed with TFA. Diethyl ether was added and the solid was collected by filtration, washed with diethyl ether and dried in vacuo.
- Example 8 Ligation of LYRAFCOO-CH(-CH9-S-S-t-Buf)-CONH ; + CYAKYAKL ( Figure 11) and of LYRAG(-S-S-t-Buf) + CYAKYAKL ( Figure 12) [0129] These two additional exemplary ligation reactions are depicted in Figure 11 (for
- Example 9 HPLC crude of cleavage of LYRAF(-S-S-t-Buf) ( Figure 9) [0130] The synthesis of the model peptide LYRAF-COO-CH(CH 2 -S-STbut)-CO-NH 2 allowed the separation of 2 peaks with different relative abundance: peak 1 (diastereomer 1) was 68.5% and peak 2 (diastereomer 2) was 31.5% of the desired material, with identical Ms ( Figure 9).
- Example 11 Evaluation of various electron-withdrawing groups [0133] A number of alternative electron-withdrawing groups have been tested for their ability to increase the yields of the ligation reaction. Typically, the yields were measured as the ratio, in percentage, of the hydrolysis product (PeplCOOH) to the ligated product. In order to minimize side-reactions, the group providing the minimal ratio is selected.
- the hydrolysis product PeplCOOH
- Spermatid nuclear transition protein 1 (SPTl, Swiss Prot accession P22613) is a 54 residue protein present in sheep sperm and reported to be phosphorylated. One of the phosphorylated sites is serine in position eight.
- STSRKLKS(P0 3 H 2 )QGTRRGKNRTPHKGVKRGCSKRKYRKSSLKSRKRCDDANRNFRSHL Fragment 1 was synthesized using standard Fmoc chemistry and protection, at 0.1 mmoles scale, starting from a PEGA resin prepared as for Example 5.
- the intermediate Fragment 1 STSRKLKS(P0 3 H 2 )QGTRRGKNRTPHKGVKRG-C ⁇ OOCH(CH 2 -S-S-t-butyl)-CONH 2 was purified by preparative RP-HPLC. Fragment 2:
- CSKRKYRKSSLKSRKRCDDANRNFRSHL was prepared by standard Boc chemistry, and after HF cleavage, purified by preparative RP- HPLC. Fragment 1 and Fragment 2 were ligated as follows: 0.5 mg of Fragment 1 (MW 3192.71, 0.015 ⁇ moles) and 1.6 mg of Fragment 2 (MW 3192.71, 0.015 ⁇ moles).
Landscapes
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Genetics & Genomics (AREA)
- Medicinal Chemistry (AREA)
- Molecular Biology (AREA)
- Analytical Chemistry (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Toxicology (AREA)
- Zoology (AREA)
- Gastroenterology & Hepatology (AREA)
- Peptides Or Proteins (AREA)
Priority Applications (7)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| AT03760111T ATE458745T1 (de) | 2002-06-10 | 2003-06-09 | Nachspaltige sulfurentschützung zur konvergenten proteinherstellung beim verfahren von chemischer ligation |
| JP2004513428A JP4559219B2 (ja) | 2002-06-10 | 2003-06-09 | 化学連結による収束性タンパク質合成のための開裂後硫黄脱保護 |
| US10/516,118 US7781488B2 (en) | 2002-06-10 | 2003-06-09 | Post-cleavage sulfur deprotection for convergent protein synthesis by chemical ligation |
| CA002487342A CA2487342A1 (en) | 2002-06-10 | 2003-06-09 | Post-cleavage sulfur deprotection for convergent protein synthesis by chemical ligation |
| EP03760111A EP1529056B1 (en) | 2002-06-10 | 2003-06-09 | Post-cleavage sulfur deprotection for convergent protein synthesis by chemical ligation |
| DE60331437T DE60331437D1 (de) | 2002-06-10 | 2003-06-09 | Nachspaltige sulfurentschützung zur konvergenten proteinherstellung beim verfahren von chemischer ligation |
| AU2003276286A AU2003276286A1 (en) | 2002-06-10 | 2003-06-10 | Post-cleavage sulfur deprotection for convergent protein synthesis by chemical ligation |
Applications Claiming Priority (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US38780302P | 2002-06-10 | 2002-06-10 | |
| US60/387,803 | 2002-06-10 | ||
| US40753002P | 2002-08-30 | 2002-08-30 | |
| US60/407,530 | 2002-08-30 |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2003106615A2 true WO2003106615A2 (en) | 2003-12-24 |
| WO2003106615A3 WO2003106615A3 (en) | 2004-09-16 |
Family
ID=29739962
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/IB2003/005087 Ceased WO2003106615A2 (en) | 2002-06-10 | 2003-06-09 | Post-cleavage sulfur deprotection for convergent protein synthesis by chemical ligation |
Country Status (9)
| Country | Link |
|---|---|
| US (1) | US7781488B2 (https=) |
| EP (1) | EP1529056B1 (https=) |
| JP (1) | JP4559219B2 (https=) |
| AT (1) | ATE458745T1 (https=) |
| AU (1) | AU2003276286A1 (https=) |
| CA (1) | CA2487342A1 (https=) |
| DE (1) | DE60331437D1 (https=) |
| ES (1) | ES2340376T3 (https=) |
| WO (1) | WO2003106615A2 (https=) |
Cited By (9)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP1770099A1 (en) * | 2005-09-28 | 2007-04-04 | University of Geneva | Method of producing a modified (poly)peptide |
| JP2008543803A (ja) * | 2005-06-16 | 2008-12-04 | アミリン・ファーマシューティカルズ,インコーポレイテッド | 側鎖伸張型ライゲーション |
| US7674881B2 (en) * | 2005-10-07 | 2010-03-09 | The University Of Chicago | Convergent synthesis of proteins by kinetically controlled ligation |
| EP2197895A4 (en) * | 2007-09-04 | 2012-12-26 | Ipsen Pharma Sas | METHODS AND INTERMEDIATES FOR CHEMICAL SYNTHESIS OF POLYPEPTIDES AND PROTEINS |
| US8404804B2 (en) | 2007-08-28 | 2013-03-26 | Ipsen Pharma S.A.S. | Methods and intermediates for chemical synthesis of polypeptides and proteins |
| EP1814905B1 (fr) * | 2004-11-12 | 2013-04-17 | Commissariat à l'Énergie Atomique et aux Énergies Alternatives | Peptides derives de la maurocalcine utilisables comme vecteurs pour l'adressage intracellulaire de molecules d'interet |
| EP2534168A4 (en) * | 2010-02-09 | 2013-07-24 | Univ Ben Gurion | CHEMICAL PREPARATION OF UBIQUITINTHIOESTERN AND MODIFICATIONS THEREOF |
| US10329518B2 (en) | 2015-07-02 | 2019-06-25 | Board Of Regents Of The University Of Oklahoma | Anionic surfactants |
| US10584306B2 (en) | 2017-08-11 | 2020-03-10 | Board Of Regents Of The University Of Oklahoma | Surfactant microemulsions |
Families Citing this family (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20240076311A1 (en) * | 2020-12-28 | 2024-03-07 | Jiangsu Genscript Biotech Co., Ltd. | Method for synthesizing peptide thioesters and head-to-tail amide cyclic peptide thereof |
Family Cites Families (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| ATE285415T1 (de) * | 1997-06-13 | 2005-01-15 | Gryphon Therapeutics Inc | Festphasige native chemische ligation von ungeschützten oder n-cystein-geschützten peptiden in wässrigen lösungen |
| KR20030046389A (ko) * | 2000-09-01 | 2003-06-12 | 그리폰 테라퓨틱스, 인코포레이티드 | 친핵체에 안정한 티오에스테르 발생 화합물, 제조 및 사용방법 |
| BR0113579A (pt) * | 2000-09-08 | 2003-06-17 | Gryphon Therapeutics Inc | Proteìnas sintéticas modificadas por polìmero |
| EE200300089A (et) * | 2000-09-08 | 2005-02-15 | Gryphon Therapeutics, Inc. | Sünteetilised erütropoeesi stimuleerivad valgud, nende valmistamismeetodid ning kasutamine |
| GB0113657D0 (en) * | 2001-06-05 | 2001-07-25 | Geneprot Inc | Improved native chemical ligation with three or more components |
-
2003
- 2003-06-09 ES ES03760111T patent/ES2340376T3/es not_active Expired - Lifetime
- 2003-06-09 WO PCT/IB2003/005087 patent/WO2003106615A2/en not_active Ceased
- 2003-06-09 JP JP2004513428A patent/JP4559219B2/ja not_active Expired - Fee Related
- 2003-06-09 CA CA002487342A patent/CA2487342A1/en not_active Abandoned
- 2003-06-09 AT AT03760111T patent/ATE458745T1/de not_active IP Right Cessation
- 2003-06-09 DE DE60331437T patent/DE60331437D1/de not_active Expired - Lifetime
- 2003-06-09 EP EP03760111A patent/EP1529056B1/en not_active Expired - Lifetime
- 2003-06-09 US US10/516,118 patent/US7781488B2/en not_active Expired - Fee Related
- 2003-06-10 AU AU2003276286A patent/AU2003276286A1/en not_active Abandoned
Non-Patent Citations (1)
| Title |
|---|
| None |
Cited By (13)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP1814905B1 (fr) * | 2004-11-12 | 2013-04-17 | Commissariat à l'Énergie Atomique et aux Énergies Alternatives | Peptides derives de la maurocalcine utilisables comme vecteurs pour l'adressage intracellulaire de molecules d'interet |
| JP2008543803A (ja) * | 2005-06-16 | 2008-12-04 | アミリン・ファーマシューティカルズ,インコーポレイテッド | 側鎖伸張型ライゲーション |
| US8729228B2 (en) | 2005-09-28 | 2014-05-20 | University Of Geneva | Method of producing a modified (poly) peptide |
| WO2007039231A3 (en) * | 2005-09-28 | 2007-09-07 | Univ Geneve | Method of producing a modified (poly)peptide |
| WO2007039231A2 (en) | 2005-09-28 | 2007-04-12 | University Of Geneva | Method of producing a modified (poly)peptide |
| EP1770099A1 (en) * | 2005-09-28 | 2007-04-04 | University of Geneva | Method of producing a modified (poly)peptide |
| US7674881B2 (en) * | 2005-10-07 | 2010-03-09 | The University Of Chicago | Convergent synthesis of proteins by kinetically controlled ligation |
| US8404804B2 (en) | 2007-08-28 | 2013-03-26 | Ipsen Pharma S.A.S. | Methods and intermediates for chemical synthesis of polypeptides and proteins |
| EP2197895A4 (en) * | 2007-09-04 | 2012-12-26 | Ipsen Pharma Sas | METHODS AND INTERMEDIATES FOR CHEMICAL SYNTHESIS OF POLYPEPTIDES AND PROTEINS |
| EP2534168A4 (en) * | 2010-02-09 | 2013-07-24 | Univ Ben Gurion | CHEMICAL PREPARATION OF UBIQUITINTHIOESTERN AND MODIFICATIONS THEREOF |
| US9175053B2 (en) | 2010-02-09 | 2015-11-03 | Ben-Gurion University Of The Negev Research And Development Authority | Chemical preparation of ubiquitin thioesters and modifications thereof |
| US10329518B2 (en) | 2015-07-02 | 2019-06-25 | Board Of Regents Of The University Of Oklahoma | Anionic surfactants |
| US10584306B2 (en) | 2017-08-11 | 2020-03-10 | Board Of Regents Of The University Of Oklahoma | Surfactant microemulsions |
Also Published As
| Publication number | Publication date |
|---|---|
| AU2003276286A1 (en) | 2003-12-31 |
| EP1529056B1 (en) | 2010-02-24 |
| ES2340376T3 (es) | 2010-06-02 |
| ATE458745T1 (de) | 2010-03-15 |
| EP1529056A2 (en) | 2005-05-11 |
| JP4559219B2 (ja) | 2010-10-06 |
| US7781488B2 (en) | 2010-08-24 |
| DE60331437D1 (de) | 2010-04-08 |
| CA2487342A1 (en) | 2003-12-24 |
| WO2003106615A3 (en) | 2004-09-16 |
| US20070059792A1 (en) | 2007-03-15 |
| JP2005529186A (ja) | 2005-09-29 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| Kang et al. | Peptide and protein thioester synthesis via N→ S acyl transfer | |
| JP4327589B2 (ja) | 3つまたはそれ以上の成分を用いた改良された自然化学的連結 | |
| JP4399627B2 (ja) | 3つまたはそれ以上の成分による化学ペプチド連結 | |
| EP1529056B1 (en) | Post-cleavage sulfur deprotection for convergent protein synthesis by chemical ligation | |
| US20040138412A1 (en) | Extended native chemical ligation | |
| JP2008150393A (ja) | 拡張天然型化学的ライゲーション | |
| KR20030046389A (ko) | 친핵체에 안정한 티오에스테르 발생 화합물, 제조 및 사용방법 | |
| JP4327718B2 (ja) | オリゴペプチドの化学連結における酸性c末端アミノ酸についてのカルボキシ保護ストラテジー | |
| AU2001288937A1 (en) | Extended native chemical ligation | |
| AU2002363612A1 (en) | Extended native chemical ligation of three or more peptide fragments | |
| AU2002319850A1 (en) | Improved native chemical ligation with three or more components |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| AK | Designated states |
Kind code of ref document: A2 Designated state(s): AE AG AL AM AT AU AZ BA BB BG BR BY BZ CA CH CN CO CR CU CZ DE DK DM DZ EC EE ES FI GB GD GE GH GM HR HU ID IL IN IS JP KE KG KP KR KZ LC LK LR LS LT LU LV MA MD MG MK MN MW MX MZ NO NZ OM PH PL PT RO RU SC SD SE SG SK SL TJ TM TN TR TT TZ UA UG US UZ VC VN YU ZA ZM ZW |
|
| AL | Designated countries for regional patents |
Kind code of ref document: A2 Designated state(s): GH GM KE LS MW MZ SD SL SZ TZ UG ZM ZW AM AZ BY KG KZ MD RU TJ TM AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HU IE IT LU MC NL PT RO SE SI SK TR BF BJ CF CG CI CM GA GN GQ GW ML MR NE SN TD TG |
|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application | ||
| WWE | Wipo information: entry into national phase |
Ref document number: 2487342 Country of ref document: CA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2003276286 Country of ref document: AU |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2004513428 Country of ref document: JP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2003760111 Country of ref document: EP |
|
| WWP | Wipo information: published in national office |
Ref document number: 2003760111 Country of ref document: EP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2007059792 Country of ref document: US Ref document number: 10516118 Country of ref document: US |
|
| WWP | Wipo information: published in national office |
Ref document number: 10516118 Country of ref document: US |