WO2003058203A2 - Extended glucagon-like peptide-1 analogs - Google Patents
Extended glucagon-like peptide-1 analogs Download PDFInfo
- Publication number
- WO2003058203A2 WO2003058203A2 PCT/US2003/000001 US0300001W WO03058203A2 WO 2003058203 A2 WO2003058203 A2 WO 2003058203A2 US 0300001 W US0300001 W US 0300001W WO 03058203 A2 WO03058203 A2 WO 03058203A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- xaa
- glp
- ser
- gly
- lys
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/575—Hormones
- C07K14/605—Glucagons
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
- A61P1/18—Drugs for disorders of the alimentary tract or the digestive system for pancreatic disorders, e.g. pancreatic enzymes
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/04—Anorexiants; Antiobesity agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/08—Drugs for disorders of the metabolism for glucose homeostasis
- A61P3/10—Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P5/00—Drugs for disorders of the endocrine system
- A61P5/48—Drugs for disorders of the endocrine system of the pancreatic hormones
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P9/00—Drugs for disorders of the cardiovascular system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P9/00—Drugs for disorders of the cardiovascular system
- A61P9/10—Drugs for disorders of the cardiovascular system for treating ischaemic or atherosclerotic diseases, e.g. antianginal drugs, coronary vasodilators, drugs for myocardial infarction, retinopathy, cerebrovascula insufficiency, renal arteriosclerosis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
Definitions
- GLP-1 glucagon-like pepide-1
- NIDDM non- insulin dependent diabetes mellitus
- GLP-1 induces numerous biological effects such as stimulating insulin secretion, inhibiting glucagon secretion, inhibiting gastric emptying, enhancing glucose utilization, and inducing weight loss.
- GLP-1 may also act to prevent the pancreatic ⁇ cell deterioration that occurs as the disease progresses.
- the most salient characteristic of GLP-1 is its ability to stimulate insulin secretion without the associated risk of hypoglycemia that is seen when using insulin therapy or some types of oral therapies that act by increasing insulin expression.
- NIDDM As NIDDM progresses, it becomes extremely important to achieve near normal glycemic control and thereby minimize the complications associated with prolonged hyperglycemia .
- GLP-1 would appear to be the drug of choice. However, the usefulness of therapy involving GLP-1 peptides has been limited by the fact that GLP-1 (1-37) is poorly active, and the two naturally occurring truncated peptides, GLP-1 (7-
- DPP-IV dipeptidyl- peptidase IV
- the present invention provides a different approach to the development of biologically active GLP-1 peptides that persist in the serum for extended periods.
- the GLP-1 peptides of the present invention are analogs of GLP- 1(7-37) wherein various amino acids are added to the C- terminus of the analog.
- These extended GLP-1 peptides not only have serum half-lives that are much longer than the native molecules but are particularly suited for oral and pulmonary administration due to their resistance to various proteolytic enzymes found in the stomach, intestine, and lungs. Further, many of these extended GLP-1 peptides are more potent than the native molecules. This increased potency coupled with resistance to various proteases facilitates the use of delivery technology associated with limited bioavailability .
- the present invention makes possible non-injectable therapy which involves delivering cost-effective amounts of biologically active GLP-1 peptides such that therapeutic serum levels are achieved.
- One embodiment of the present invention is a GLP-1 peptide comprising the amino acid sequence of formula 1 (SEQ ID NO: 1 (SEQ ID NO: 1)
- Formula 1 (SEQ ID NO: 1) wherein: Xaa 7 is L-histidine, D-histidine, desamino-hi ⁇ tidine, 2 amino-histidine, ⁇ -hydroxy-histidine, homohistidine, ⁇ -fluoromethyl-histidine, or Dimethyl -histidine ;
- Xaa is: Ala, Gly, Val, Leu, lie, Ser, or Thr;
- Xaa 12 is Phe, Trp, or Tyr
- Xaai ⁇ is Val, Trp, lie, Leu, Phe, or Tyr;
- Xaais is Ser, Trp, Tyr, Phe, Lys, lie, Leu, Val;
- Xaa 19 is Tyr, Trp, or Phe;
- Xaa 20 is Leu, Phe, Tyr, or Trp ;
- Xaa 22 is Gly, Glu, Asp, or Lys
- Xaa 2 5 is Ala, Val, lie, or Leu,
- Xaa 2 7 is Glu, lie, or Ala
- Xaa 30 is Ala or Glu
- Xaa 33 is Val or lie
- Xaa 34 is Lys, Asp, Arg, or Glu
- Xaa 36 is Gly, Pro, or Arg
- Xaa 37 is Gly, Pro, or Ser
- Xaa 38 is Ser, Pro, or His
- Xaa 39 is Ser, Arg, Thr, Trp, or Lys ;
- Xaa 40 is Ser or Gly
- Xaa 4 ⁇ is Ala, Asp, Arg, Glu, Lys, or Gly;
- Xaa 42 is: Pro, Ala, NH 2 , or is absent;
- Xaa 43 is: Pro, Ala, NH 2 , or' is absent;
- Xaa 44 is: Pro, Ala, Arg, Lys, His; NH 2 , or is absent;
- Xaa 45 is: Ser, His, Pro, Lys, Arg, Gly, NH 2 or is absent;
- Xaa 6 is: His, Ser, Arg, Lys, Pro, Gly, NH 2 or is absent; and
- Xaa 47 is: His, Ser, Arg, Lys, NH 2 or is absent;
- Xaa 48 is: Gly, His, NH 2 or is absent;
- Xaa 49 is: Pro, His, NH 2 or is absent;
- Xaa 50 is: Ser, His, Ser-NH 2 ,
- Another embodiment of the present invention is a GLP-1 peptide comprising the amino acid sequence of formula 2 (SEQ ID NO: 2)
- Xaa 7 is: L-histidine, D-histidine, desamino-histidine, 2- amino-histidine , ⁇ -hydroxy-histidine , homohistidine, ⁇ -f luoromethyl -histidine, or ⁇ - methyl -histidine ;
- Xaa 8 is: Ala, Gly, Val, Leu, lie, Ser, or Thr;
- Xaa i2 is: Phe, Trp, or Tyr;
- Xaai ⁇ is: Val, Trp, lie, Leu, Phe, or Tyr;
- Xaa 18 is: Ser, Trp, Tyr, Phe, Lys, lie, Leu, or Val;
- Xaa ⁇ 9 is: Tyr, Trp, or Phe;
- Xaa 20 is: Leu, Phe, Tyr, or Trp,
- Xaa 22 is: Gly, Glu, Asp, or Lys,
- Xaa 25 is: Ala, Val, lie, or Leu;
- Xaa 27 is: Glu, lie, or Ala;
- Xaa 30 is: Ala or Glu
- Xaa 33 is: Val or lie
- Xaa 34 is: Lys, Asp, Arg, or Glu;
- Xaa 36 is: Gly, Pro, or Arg;
- Xaa 37 is: Gly, Pro, or Ser
- Xaa 38 is: Ser, Pro, or His
- Xaa 39 is: Ser, Arg, Thr, Trp, or Lys;
- Xaa 40 is: Ser or Gly
- Xaa 41 is: Ala, Asp, Arg, Glu, Lys, or Gly;
- Xaa 42 is: Pro, Ala, NH 2 , or is absent
- Xaa 43 is: Pro, Ala, NH 2 , or is absent
- Xaa 4 is: Pro, Ala, Arg, Lys, His, NH 2 , or is absent;
- Xaa 45 is: Ser, His, Pro, Lys, Arg, NH 2 or is absent;
- Xaa 6 is: His, Ser, Arg, Lys, NH 2 or is absent;
- Xaa 47 is: His, Ser, Arg, Lys, NH 2 or is absent; provided that if Xaa 42 , Xaa 43 , Xaa 44 , Xaa 45 , Xaa 46 , or Xaa 47 is absent each amino acid downstream is absent and further provided that if Xaa 36 is Arg and Xaa 37 is Gly or Ser, the
- GLP-1 peptide does not have the following C-terminal amino acid extension beginning at Xaa 38 : Ser-Ser-Gly-Ala-Pro-Pro- Pro-Ser-NH 2 .
- Another embodiment of the present invention is an extended GLP-1 peptide comprising the amino acid sequence of formula 3 (SEQ ID NO: 3)
- Xaa ⁇ is: Ala, Asp, Arg, Glu, Lys, or Gly;
- Xaa 42 is: Pro or Ala;
- Xaa 43 is: Pro or Ala;
- Xaa 44 is: Pro, Ala, Arg, Lys, His, NH 2 , or is absent;
- Xaa 45 is: Ser, His, Pro, Lys, Arg, NH 2 or is absent;
- Xaa 46 is: His, Ser, Arg, Lys, NH 2 or is absent; and
- Xaa 47 is: His, Ser, Arg, Lys, NH 2 or is absent; provided that if Xaa 4 , Xaa 45 , Xaa 46 , or Xaa 47 is absent each amino acid downstream is absent and further provided that if Xaa 36 is Arg and Xaa 37 is Gly or Ser, the GLP-1 peptide does not have the following C-terminal amino acid extension beginning at Xaa 38 : Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH 2 .
- Another embodiment of the present invention is an extended GLP-1 peptide comprising the amino acid sequence of formula 4 (
- Xaa 7 is: L-histidine, D-histidine, desamino-histidine , 2- amino-histidine, ⁇ -hydroxy-histidine, homohistidine, ⁇ -f luoromethyl-histidine , or ⁇ - methyl -histidine;
- Xaa 8 is: Gly, Val, Leu, lie, Ser, or Thr;
- Xaa 22 is: Gly, Glu, Asp, or Lys;
- Xaa 25 is: Ala, Val, lie, or Leu;
- Xaa 33 is: Val or lie;
- Xaa 38 is: Ser, Pro, or His;
- Xaa 39 is: Ser, Arg, Thr, Trp, or Lys ;
- Xaa 40 is: Ser or Gly;
- Xaa i is: Ala, Asp, Arg, Glu, Lys, or Gly;
- Xaa 2 is: Pro or Ala;
- Xaa 43 is: Pro or Ala;
- Xaa 44 is: Pro, Ala, Arg, Lys, His, NH 2 , or is absent;
- Xaa 45 is: Ser, His, Pro, Lys, Arg, NH 2 or is absent;
- Xaa 6 is: His, Ser, Arg, Lys, NH 2 or is absent; and
- Xaa 47 is: His, Ser, Arg, Lys, His-NH 2 , Ser-NH 2 , Arg-NH 2 , His- NH 2 , NH 2/ or is absent; provided that if Xaa 4 , Xaa 45 , Xaa 46 , or Xaa 47 is absent each amino acid downstream is absent.
- Another embodiment of the present invention is an extended GLP-1 peptide comprising an amino acid sequence of formula 5 (SEQ ID NO: 60)
- Xaa 44 -Xaa 4 5 ⁇ Xa 45 — Xaa 47 -Xaa 8 ⁇ Xaa 9 -Xaa5o Formula 5 (SEQ ID NO: 60) Wherein: Xaa 38 is: Ser, Pro, or His; Xaa 39 is: Ser, Arg, Thr, Trp, or Lys ;
- Xaa 0 is: Ser or Gly
- Xaa 4X is: ' Ala, Asp, Arg, Glu, Lys; or Gly;
- Xaa 2 is: Pro, Ala, NH 2 , or is absent
- Xaa 43 is: Pro, Ala, NH 2 , or is absent
- Xaa 4 is: Pro, Ala, Arg, Lys, His, NH 2 , or is absent;
- Xaa 45 is: Ser, His, Pro, Lys, Arg, Gly, NH 2 or is absent;
- Xaa 46 is: His, Ser, Arg, Lys, Pro, Gly, NH 2 or is absent;
- Xaa 47 is: His, Ser, Arg, Lys, NH 2 or is absent
- Xaa 48 is: Gly, His, NH 2 or is absent
- Xaa 9 is: Pro, His, NH 2 or is absent;
- Xaa 50 is: Ser, His, Ser-NH 2 , His-NH 2 or. is absent; wherein said GLP-1 peptide comprises from one to six further substitutions and provided that if Xaa 2 , Xaa 43 , Xaa 44 , Xaa 45 , Xaa 46 , Xaa 47/ Xaa 48 or Xaa 49 is absent each amino acid downstream is absent
- formula 4 and formula 5 include GLP-1 peptides that have valine or glycine at position 8 and glutamic acid at position 22.
- the present invention also encompasses a method of stimulating the GLP-1 receptor in a subject in need of such stimulation, said method comprising the step of administering to the subject an effective amount of the GLP- 1 peptides described herein.
- Subjects in need of GLP-1 receptor stimulation include those with non- insulin dependent diabetes, stress-induced hyperglycemia, and obesity.
- GLP-1 peptides of the present invention have various amino acid changes relative to the native GLP-1 molecules and have additional amino acids added to the C- terminus beginning at position 37.
- Native GLP-1 (7-37) OH has the amino acid sequence of SEQ ID NO: 5:
- the native molecule is also amidated in vivo such that the glycine residue at position 37 is replaced with an amide group.
- the amino terminus of GLP-1 (7- 37) OH has been assigned residue number 7 and the carboxy- terminus, number 37.
- the other amino acids in the polypeptide are numbered consecutively, as shown in SEQ ID NO: 4. For example, position 12 is phenylalanine and position 22 is glycine. The same numbering system is used for the extended GLP-1 peptides of the present invention.
- the GLP-1 peptides encompassed by the present invention are "extended GLP-1 peptides.”
- Extended GLP-1 peptides have various amino acid substitutions relative to the native GLP- 1(7-37) or GLP-1 (7-36) molecule and have additional amino acids extending from the C-terminus.
- the extended GLP-1 peptides of the present invention have one or more changes selected from the following positions relative to GLP-1 (7-37): 7, 8, 12, 16, 18, 19, 20, 22, 25, 27, 30, 33, 34, 36, and 37.
- these GLP- 1 peptides have at least 4 amino acids added after amino acid residue number 37 (Xaa 38 through Xaa 4i ) .
- at least 6 amino acids are added to the C-terminus.
- the present invention encompasses extended GLP-1 peptides comprising any combination of the amino acids provided in formula 1 (SEQ ID NO:l), formula 2 (SEQ ID NO:2) , formula 3 (SEQ ID NO:3), and formula 4 (SEQ ID NO:4) wherein these extended GLP-1 peptides exhibit "insulinotropic activity.”
- Insulinotropic activity refers to the ability to stimulate insulin secretion in response to elevated glucose levels, thereby 'causing glucose uptake by cells and decreased plasma glucose . levels .
- Insulinotropic activity can be assessed by methods known in the art, including using in vivo experiments and in vi tro assays that measure GLP-1 receptor binding activity or receptor activation, e.g., assays employing pancreatic islet cells or insulinoma cells, as described in EP 619,322 to Gelfand, et al . , and U.S. Patent No. 5,120,712, respectively.
- Insulinotropic activity is routinely measured in humans by measuring insulin levels or C-peptide 'levels.
- Extended GLP-1 peptides encompassed by the present invention have an in vi tro potency that is not less than 1/10 the in vi tro potency of the DPP-IV resistant GLP-1 analog known as Val 8 -GLP-1 (7- 37) OH. More preferably, the extended GLP-1 peptides of the present invention are as potent or more potent than Val 8 - GLP-1 (7-37) OH.
- In vi tro potency is the measure of the ability of ' a peptide to activate the GLP-1 receptor in a cell-based assay. In vi tro potency is expressed as the
- EC 50 which is the effective concentration of compound that results in 50% activity in a single dose-response experiment.
- vi tro potency is determined using a fluorescence assay that employs HEK-293 Aurora CRE-BLAM cells that stably express the human GLP-1 receptor. These HEK-293 cells have stably integrated a DNA vector having a cAMP response element (CRE) driving expression of the ⁇ -lactamase (BLAM) gene.
- CRE cAMP response element
- BLAM ⁇ -lactamase
- the ⁇ - lactamase CCF2/AM substrate that emits fluorescence when it is cleaved by ⁇ -lactamase can then be added to cells that have been exposed to a specific amount of GLP-1 agonist to provide a measure of GLP-1 agonist potency.
- the assay is further described in Zlokarnik et al . (1998) Science 279:84-88 (See also Example 1) .
- the EC 50 values for the compounds listed in example 1 were determined using the BLAM assay described above by generating a dose response curve using dilutions ranging from 0.00003 nanomolar to 30 nanomolar. Relative in vi tro potency values are established by running Val 8 -GLP-1 (7-37) OH as a control and assigning the control a reference value of 1.
- the extended GLP-1 peptides of the present invention have the amino acid sequence of GLP-1 (7-37) modified so that one, two, three, four, five, or six amino acids differ from the amino acid in the corresponding position of GLP-1 (7-37) and in addition have at least 4, preferably 6, even moire preferably between 6 and 10 amino acids added to the C-terminus.
- the GLP-1 peptides of the present invention comprise extended GLP-1 analogs wherein the backbone for such analogs or fragments contains an amino acid other than alanine at position 8 (position 8 analogs) .
- the backbone may also include L-histidine, D-histidine, or modified forms of histidine such as desamino-histidine, 2-amino-histidine, ⁇ -hydroxy-histidine , homohistidine, ⁇ -fluoromethyl- histidine, or ⁇ -methyl-histidine at position 7.
- these position 8 analogs contain one or more additional changes at positions 12, 16, 18, 19, 20, 22, 25, 27, 30, 33, 34, 36, and 37 compared to the corresponding amino acid of native GLP-1 (7-37) . It is more preferable that these position 8 analogs contain one or more additional changes at positions 16, 18, 22, '25 and 33 compared to the corresponding amino acid of native .GLP-1 (7-37) .
- the amino acid at position 12 of an extended GLP-1 peptide is selected from the group consisting of tryptophan or tyrosine.
- the amino acid at position 8 is substituted with glycine, valine, leu ⁇ ine, isoleucine, serine,, threonine, or methionine and more preferably valine or glycine. It is even more preferred that in addition to the substitutions at position 12 and 8, the amino acid at 1 position 22 is substituted with glutamic acid.
- the amino acid at position 16 of an extended GLP-1 peptide is selected from the group consisting of tryptophan, isoleucine, leucine, phenylalanine , or tyrosine. It is preferred that the amino acid at position 16 is tryptophan.
- the amino acid at position 8 is substituted with glycine, valine, leucine, isoleucine, serine, threonine, or methionine and more preferably valine or glycine. It is even more preferred that in addition to the substitutions at position 16 and 8, the amino acid at position 22 is substituted with glutamic acid. It is also preferred that in addition to the substitutions at positions 16 and 8, the amino acid at position 33 is substituted with isoluecine. It is also preferred that in addition to the substitutions at position 8, 16, and 22, the amino acid at position 36 is substituted with glycine and the amino acid at position 37 is substituted with proline
- the amino acid at position 18 of an extended GLP-1 peptide is selected from the group consisting of tryptophan, tyrosine, phenylalanine , lysine, leucine, or isoleucine, preferably tryptophan, tyrosine, and isoleucine. It is more preferred that in addition to the substitution at position 18, the amino acid at position 8 is substituted with glycine, valine, leucine, isoleucine, serine, threonine, or methionine and more preferably valine or glycine. It is even more preferred that in addition to the substitutions at position 18 and 8, the amino acid at position 22 is substituted with glutamic acid.
- the amino acid at position 33 is substituted with isoleucine. It is also preferred that in addition to the substitutions at position 8, 18, and 22, the amino acid at position 36 is substituted with glycine and the amino acid at position 37 is substituted with proline.
- the amino acid at position 19 of an extended GLP-1 peptide is selected from the group consisting of tryptophan or phenylalanine, preferably tryptophan. It is more preferred that in addition to the substitution at position 19, the amino acid at position 8 is substituted with glycine, valine, leucine, isoleucine, serine, threonine, or methionine and more preferably valine or glycine. It is even more preferred that in addition to the substitutions at position 19 and 8, the amino acid at position 22 is substituted with glutamic acid. It is also preferred that in addition to the substitutions at position 8, 19, and 22, the amino acid at position 36 is substituted with glycine and the amino acid at position 37 is substituted with proline.
- the amino acid at position 20 of an extended GLP-1 peptide is selected from the group consisting of phenylalanine, tyrosine, or tryptophan, preferably tryptophan. It is more preferred that in addition to the substitution at position 20, the amino acid at position 8 is substituted with glycine, valine, leucine, isoleucine, serine, threonine, or methionine and more preferably valine or glycine. It is even more preferred that in addition to the substitutions at position 20 and 8, the amino acid at position 22 is substituted with glutamic acid. It is also preferred that in addition to the substitutions at position 8, 20, and 22, the amino acid at position 36 is substituted with glycine and the amino acid at position 37 is, substituted with proline .
- amino acid at position 25 of an extended GLP-1 peptide is selected from the group consisting of valine, isoleucine, and leucine, preferably valine. It is more preferred that in addition to the substitution at position 25, the amino acid at position 8 is substituted with glycine, valine, leucine, isoleucine, serine, threonine, or methionine and more preferably valine or glycine. It is even more preferred that in addition to the substitutions at position 25 and 8, the amino acid at position 22 is substituted with glutamic acid. It is also preferred that in addition to the substitutions at position 8, 22, and 25, the amino acid at position 36 is substituted with glycine and the amino acid at position 37 is substituted with proline.
- the amino acid at position 27 of an extended GLP-1 peptide is selected from the group consisting of isoleucine or alanine. It is more preferred that in addition to the substitution at position 27, the amino acid at position 8 is substituted with glycine, valine, leucine, isoleucine, serine, threonine, or methionine and more preferably valine or glycine. It is even more preferred that in addition to the substitutions at position 27 and 8, the amino acid at position 22 is substituted with glutamic acid. It is also preferred that in addition to the substitutions at 1 position 8, 22, and 27, the amino acid at position 36 is substituted with glycine and the amino acid at position 37 is substituted with proline.
- the amino acid at position 33 of an extended GLP-1 peptide is isoleucine. It is more preferred that in addition to the substitution at position 33, the amino acid at position 8 is substituted with glycine, valine, leucine, isoleucine, serine, threonine, or methionine and more preferably valine or glycine. It is even more preferred that in addition to the substitutions at position 33 and 8, the amino acid at position 22 is substituted with glutamic acid. It is also preferred that in addition to the substitutions at position 8, 22, and 33 the amino acid at position 36 is substituted with glycine and the amino acid at position 37 is substituted with proline.
- the amino acid at position 34 is aspartic acid. It is more preferred that in addition to the substitution at position 34, the amino acid at position 8 is substituted with glycine, valine, leucine, isoleucine, serine, threonine, or methionine and more preferably valine or glycine. It is even more preferred that in addition to the substitutions at position 34 and 8, the amino acid at position 22 is substituted with glutamic acid. It is also preferred that in addition to the substitutions at position 8, 22, and 34 the amino acid at position 36 is substituted with glycine and the amino acid at position 37 is substituted with proline.
- the C-terminal extension portion fused to the GLP-1 analog backbones discussed above is at least 4 amino acids in length, preferably between 6 and 10 amino acids in length.
- the extended GLP-1 peptides of the present invention have a serine, proline, or histidine at position 38; a serine, arginine, threonine, tryptophan, or lysine at position 39; a serine or glycine at position 40; an alanine, aspartic acid, arginine, glutamic acid, lysine or glycine at position 41; a proline or alanine at position 42; and a proline or alanine at position 43.
- Additional amino acids that may be added include a proline, serine, alanine, arginine, lysine, or histidine at position 44; a serine,' histidine, proline, lysine or arginine at position 45; a histidine, serine, arginine, or lysine at position 46; and a histidine, serine, arginine, or lysine at position 47.
- histidine is the C-terminal amino acid at either position 42, 43, 44, 45, 46, or 47.
- 'Additional amino acids that may be added to the C-terminus also include those specified in formula 1 (SEQ ID N0:1) .
- Xaa 34 is aspartic acid
- Xaa 4 ⁇ is arginine or lysine.
- Xaa 39 is serine.
- Xaa 41 is aspartic acid or arginine
- Xaa 42 , Xaa 43 , and Xaa 4 are all proline.
- the C-terminal amino acid may be in the typical acid form or may be amidated.
- a preferred genus of extended GLP-1 peptides comprise the amino acid sequence of formula 4 (SEQ ID NO : 4 )
- Formula 4 (SEQ ID NO : 4 ) wherein: Xaa 7 is: L-histidine, D-histidine, desamino-histidine, 2- a ino-histidine, ⁇ -hydroxy-histidine , homohistidine, ⁇ -fluoromethyl -histidine, or ⁇ - methyl-histidine ; Xaa 8 is: Gly, Val, Leu, lie, Ser, or Thr; Xaa 2 2 is: Gly, Glu, Asp, or Lys; Xaa 25 is: Ala, Val, lie, or Leu; Xaa 33 is: Val or lie; X
- Xaa ⁇ is: Ala, Asp, Arg, Glu, Lys, or Gly;
- Xaa 42 is: Pro or Ala;
- Xaa 3 is: Pro or Ala;
- Xaa 44 is: Pro, Ala, Arg, Lys, His, NH 2 , or is absent;
- Xaa 5 is: Ser, His, Pro, Lys, Arg, NH 2 or is absent;
- Xaa 46 is: His, Ser, Arg, Lys, NH 2 or is absent; and
- Xaa 47 is: His, Ser, Arg, Lys, NH 2 or is absent; provided that if Xaa 44 , Xaa 5 , Xaa 46 , or Xaa 47 is absent each amino acid downstream is absent.
- Preferred extended GLP-1 peptides are peptides of formula 4 (SEQ ID NO:4) wherein Xaa 7 is L-His, Xaa 8 is Gly or Val, Xaa 22 is Glu, Xaa 25 is Val, Xaa 33 is lie, Xaa 38 is Ser, Xaa 39 is Ser, Xaa 40 is Gly, Xaa 4i is Ala, Xaa 2 is Pro, Xaa 43 is Pro, Xaa 4 is Pro, Xaa 45 is Ser and Xaa 46 and Xaa 47 are absent and amidated forms of thereof .
- Preferred extended GLP-1 peptides also include peptides of formula 4 (SEQ ID NO:4) wherein Xaa 7 is L-His, Xaa 8 is Val, Xaa 22 is Glu, Xaa 2 5 is Ala, Xaa 33 is lie, Xaa 38 is Ser, Xaa 39 is Ser, Xaa 40 is Gly, Xaa 41 is Ala, Xaa 2 is Pro, Xaa 43 is Pro, Xaa 4 is Pro, Xaa 5 is Ser and Xaa 46 and Xaa 47 are absent and amidated forms thereof.
- SEQ ID NO:4 peptides of formula 4
- peptides of formula 4 (SEQ ID NO:4) wherein Xaa 7 is L-His, Xaa 8 is Val, Xaa 22 is Gly, Xaa 25 is Ala, Xaa 33 is lie, Xaa 38 is Ser, Xaa 39 is Ser, Xaa 0 is Gly, Xaa 4X is Ala, Xaa 42 is Pro, Xaa 43 is Pro, Xaa 4 is Pro, Xaa 5 is Ser, and Xaa 46 and Xaa 47 are absent and amidated forms thereof.
- SEQ ID NO:4 peptides of formula 4 (SEQ ID NO:4) wherein Xaa 7 is L-His, Xaa 8 is Val, Xaa 22 is Gly, Xaa 25 is Ala, Xaa 33 is lie, Xaa 38 is Ser, Xaa 39 is Ser, Xaa 0 is Gly, Xaa 4X is Ala,
- the present invention encompasses the discovery that specific amino acids added to the C-terminus of a GLP-1 peptide provide specific structural features that protect the peptide from degradation by various proteases yet do not negatively impact the biological 'activity of the peptide. Further, many of the extended peptides disclosed herein are more potent than DPP-IV resistant GLP-1 analogs such as Val 8 -GLP-1 (7-37)OH.
- Example 1 provides in vi tro potency data for a representative number of extended GLP-1 peptides.
- the in vi tro potency of the tested extended GLP-1 peptides ranged from about the same as Val 8 -GLP-1 (7-37) OH to greater than 7- fold more potent than Val 8 -GLP-1 (7-37) OH.
- example 5 illustrates that extended GLP-1 peptides are also more potent in vivo .
- Example 2 provides a measure of protease insensitivity for a representative number of extended GLP-1 analogs.
- the relative proteolytic stability was determined by exposing extended GLP-1 peptides and Val 8 -GLP-1 (7-37) OH to ⁇ - chymotrypsin and then plotting the progress of the enzymatic reaction as described in Example 2.
- the extended GLP-1 peptides tested ranged from as stable as Val 8 -GLP-1 (7-37) OH to 5-fold more stable than Val 8 -GLP-1 (7-37) OH .
- the extended GLP-1 peptides of the present invention also have an increased half-life in vivo as indicated in example 4.
- the in vivo half -life of these extended peptides is generally longer than the half-life of DPP-IV protected GLP-1 analogs such as Val 8 -GLP-1 (7-37) OH .
- the extended GLP-1 peptides of the present invention are suited for oral administration, nasal administration, pulmonary inhalation or parenteral administration.
- Parenteral administration can include, for example, systemic administration, such as by intramuscular, intravenous, subcutaneous, or intraperitoneal injection.
- the GLP-1 compounds can be administered to the subject in conjunction with an acceptable pharmaceutical carrier, diluent or excipient as part of a pharmaceutical composition for treating various diseases and conditions discussed herein.
- the pharmaceutical composition can be a solution or a suspension.
- Suitable pharmaceutical carriers may contain inert ingredients which do not interact with the peptide or peptide derivative. Standard pharmaceutical formulation techniques may be employed such as those described in Remington's Pharmaceutical Sciences, Mack Publishing Company, Easton, PA.
- Suitable pharmaceutical carriers for parenteral administration include, for example, sterile water, physiological saline, bacteriostatic saline (saline containing about 0.9% mg/ml benzyl alcohol), phosphate- buffered saline, Hank's solution, Ringer ' s-lactate and the like.
- suitable excipients include lactose, dextrose, sucrose, trehalose, sorbitol, and mannitol .
- the GLP-1 compounds may be formulated for administration such that blood plasma levels are maintained in the efficacious range for extended time periods.
- depot formulations wherein a bioadsorbable polymer is used to provide sustained release over time are also suitable for use in the present invention.
- the main barrier to effective oral peptide drug delivery is poor bioavailability due to degradation of peptides by acids and enzymes, poor absorption through epithelial membranes, and transition of peptides to an insoluble form after exposure to the acidic pH environment in the digestive tract. This reduced bioavailability necessitates the use of GLP-1 compounds with increased potency, increased stability, or both.
- Oral delivery systems for peptides such as those encompassed by the present invention are known in the art .
- GLP-1 compounds can be encapsulated using microspheres or other carriers and then delivered orally.
- the extended GLP-1 peptides described herein can be used to treat subjects with a wide variety of diseases and conditions.
- the extended GLP-1 peptides encompassed by the present invention exert their biological effects by acting at a receptor referred to as the "GLP-1 receptor" (see Dillon,' J.S. et al . (1993), Endocrinology, 133: 1907-1910).
- Subjects with diseases and/or conditions that respond favorably to GLP-1 receptor stimulation or to the administration of extended GLP-1 peptides can therefore be treated. These subjects are said tc "be in need of treatment with extended GLP-1 peptides" or "in need of GLP-1 receptor stimulation” .
- subjects requiring prophylactic treatment with a GLP-1 peptide e.g., subjects at risk for developing non-insulin dependent diabetes (see WO 00/07617) .
- Additional subjects include those with impaired glucose tolerance or impaired fasting glucose, subjects with a partial pancreatectomy, subjects having one or more parents with non- insulin dependent diabetes, subjects who have had gestational diabetes and subjects who have had acute or chronic pancreatitis and are at risk for developing non-insulin dependent diabetes.
- the extended GLP-1 peptides of the present invention are also useful in treating subjects who are overweight. Particularly suited are those subjects whose body weight is about 25% above normal body weight for the subject's height and body build. Thus, the .extended GLP-1 peptides can also be used to treat obesity (see WO 98/19698 by Efendic) .
- the extended GLP-1 peptides of the present invention can be used to normalize blood glucose levels, prevent pancreatic ⁇ -cell deterioration, induce ⁇ -cell proliferation, stimulate insulin gene transcription, up- regulate IDX-l/PDX-1 or other growth factors, improve ⁇ -cell function, activate dormant ⁇ -cells, differentiate cells into ⁇ -cells, stimulate ⁇ -cell replication, inhibit ⁇ -cell apoptosis, regulate body weight, and induce weight loss.
- an “effective amount” of an extended GLP-1 peptide is the quantity which results in a desired therapeutic and/or prophylactic effect without causing unacceptable side- effects when administered to a subject in need of GLP-1 receptor stimulation.
- a “desired therapeutic effect” includes one or more of the following: 1) an amelioration of the symptom (s) associated with the disease or condition; 2) a delay in the onset of symptoms associated with the disease or condition; 3) increased longevity compared with the absence of the treatment; and 4) greater quality of life compared with the absence of the treatment.
- an "effective amount" of an extended GLP-1 peptide for the treatment of type 2 diabetes is the quantity that would result in greater control of blood glucose concentration than in the absence of treatment, thereby resulting in a delay in the onset of diabetic complications such as retinopathy, neuropathy or kidney disease.
- An "effective amount” of an extended GLP-1 peptide for the prevention of diabetes is the quantity that would delay, compared with the absence of treatment, the onset of elevated blood glucose levels that require treatment with drugs such as sulfonylureas, thiazolidinediones, insulin and/or bisguanidines .
- a typical dose range for the extended GLP-1 peptides of the present invention will range from about 1 ⁇ g to about 100 mg per day. Preferably, the dose range is about 5 ⁇ g to about 1 mg per day. Even more preferably the dose is about 10 ⁇ g to about 100 ⁇ g per day.
- a "subject” is a mammal, preferably a human, but can also be an animal, e.g., companion animals (e.g., dogs, cats, and the like), farm animals (e.g., cows, sheep, pigs, horses, and the like) and laboratory animals (e.g., rats, mice, guinea pigs, and the like).
- companion animals e.g., dogs, cats, and the like
- farm animals e.g., cows, sheep, pigs, horses, and the like
- laboratory animals e.g., rats, mice, guinea pigs, and the like.
- the extended GLP-1 peptides of the present invention can be prepared using recombinant DNA technology or by using standard methods of solid-phase peptide synthesis techniques.
- Peptide synthesizers are commercially available from, for example, Applied Biosystems in Foster City CA. Reagents for solid phase synthesis are commercially available, for example, from Midwest Biotech (Fishers, IN) .
- Solid phase peptide synthesizers can be used according to manufacturers instructions for blocking interfering groups, protecting the amino acid to be reacted, coupling, decoupling, and capping of unreacted amino acids.
- an -N-carbamoyl protected amino acid and the N-terminal amino acid on the growing peptide chain on a resin is coupled at room temperature in an inert solvent such as di ethylformamide, N-methylpyrrolidone or methylene chloride in the presence of coupling agents such as dicyclohexylcarbodiimide and 1-hydroxybenzotriazole and a base such as diisopropylethylamine .
- the ⁇ -N-carbamoyl protecting group is removed from the resulting peptide resin using a reagent such as trifluoroacetic acid or piperidine, and the coupling reaction repeated with the next desired N- protected amino acid to be added to the peptide chain.
- Suitable amine protecting groups are well known in the art and are described, for example, in Green and Wuts, "Protecting Groups in Organic Synthesis” , John Wiley and Sons, 1991, the entire teachings of which are incorporated by reference. Examples include t-butyloxycarbonyl (tBoc) and fluorenylmethoxycarbonyl (Fmoc) .
- peptides are cleaved from , the solid-phase support with simultaneous side-chain deprotection using standard hydrogen fluoride or trifluoroacetic acid cleavage protocols. Crude peptides are then further purified using Reversed-Phase Chromatography on Vydac C18 columns employing linear water-acetonitrile gradients with all solvents containing 0.1% trifluoroacetic acid (TFA) . To remove acetonitrile, peptides are lyophilized from a solution containing 0.1 % TFA, acetonitrile and water. Purity can be verified by analytical reversed phase chromatography. Identity of peptides can be verified by mass spectrometry . Peptides can be solubilized in aqueous buffers at neutral pH.
- HEK-293 Aurora CRE-BLAM cells expressing the human GLP- 1 receptor are seeded at 20,000 to 40,000 cells/well/100 ⁇ l into a 96 well black clear bottom plate. The day after seeding, the medium is replaced with plasma free medium. On the third day after seeding, 20 ⁇ l of plasma free medium containing different concentrations of GLP-1 agonist is added to each well to generate a dose response curve. Generally, fourteen dilutions containing from 3 nanomolar to 30 nanomolar GLP-1 compound were used to generate a dose response curve from which EC 50 values could be determined.
- HVEGTFTSDVSSYLEEQAAKEFIAWLVKGRGSSGDPPPS-NH2 SEQ ID NO: 8
- HVEGTFTSDVSSYLEGQAAKEFIA IKGGPSSGAPPPS SEQ ID NO: 27
- HVEGTFTSDWSSYLEGQAAKEFIAWLIKGGPSSGAPPPSH SEQ ID NO: 29
- HVEGTFTSDWSSY EGQAAKEFIAWLIKGGPHSSGAPPPS SEQ ID NO: 30
- HVEGTFTSDWSSY EEQAAKEFIA LIKGRGSSGAPPPS SEQ ID NO: 36 HVEGTFTSDVSSY EEQAAKEFIAW IKGRGHSSGAPPPS SEQ ID NO: 37 HVEGTFTSDVSSYLEEQAAKEFIAWLVKGRGHSSGAPPPS SEQ ID NO: 38 HVEGTFTSDWSSYLEEQAAKEFIAW IKGGPHSSGAPPPSH SEQ ID NO: 39 HVEGTFTSDWSSYLEEQAAKEFIAW IKGGPSSGAPPPSH SEQ ID NO: 40 HVEGTFTSDVSWYLEGQAVKEFIA LIKGGPHSSGAPPPS SEQ ID NO: 41 HVEGTFTSDVSSYLEEQAVKEFIAWLIKGGPSSGAPPPS SEQ ID NO: 42 HVEGTFTSDVSSYLEEQAVKEFIAW IKGGPSSGAPPPSH SEQ ID NO: 43 HVEGTFTSDWSSYLEEQAVKEFIAWLIKGGPSSGAPPPS SEQ ID NO: 44 HVEGTFTSDWSS
- Extended GLP-1 peptides were analyzed with respect to their potential to aggregate in solution.
- peptides in solution were stirred at elevated temperature in a suitable buffer while recording turbidity at 350 nm as a function of time. Time to the onset of aggregation was measured to quantify the potential of a given GLP molecule to aggregate under these stressed conditions.
- a GLP-1 peptide was first dissolved under alkaline conditions (pH 10.5) for 30 minutes to dissolve any pre- aggregated material. The solution was then adjusted to pH
- the cuvette was cleaned between experiments with a caustic soap solution (e.g., Contrad-70) .
- a caustic soap solution e.g., Contrad-70
- the following extended GLP-1 peptides were tested and were stable in solution for at least 55 hours compared to Val 8 -GLP-1 (7- 37) OH which was stable for about 1 hour:
- HVEGTFTSDVSSYLEEQAAKEFIAWLIKGGPSSGDPPPS-NH2 SEQ ID NO: 10
- HVEGTFTSDVSSYLEEQAAKEFIAWLIDGGPSSGRPPPS-NH2 SEQ ID NO: 7
- HVEGTFTSDVSSYLEEQAAKEFIA VKGRGSSGDPPPS-NH2 SEQ ID NO : 8
- HVEGTFTSDWSSYLEGQAAKEFIA IKGGPSSGAPPPH SEQ ID NO: 26
- HVEGTFTSDVSSY EGQAAKEFIA LIKGGPSSGAPPPS SEQ ID NO: 27
- HVEGTFTSDWSSYLEEQAAKEFIA IKGGPHSSGAPPPSH SEQ ID NO: 39
- HVEGTFTSDVSSY EEQAAKEFIA LVDGGPSSGRG SEQ ID NO: 54
- HVEGTFTSDVSSYLEGQAAKEFIA LVKGRGSSGAPPPS SEQ ID NO: 31
- SEQ ID NO: 36 Parameters were determined following a single intravenous dose of lO ⁇ g/kg in four different rats. Data are listed in Tables 1 and 2
- Table 1 PK parameters for extended GLP-1 peptides following a single intravenous injection of 10 ⁇ g/kg to Sprague Dawley rats .
- GLP-1 peptides were administered at 'a rate of 1 pmol/kg/min. For the final 60 minutes the infusion rate of each GLP-1 compound was increased to 3 pmol/kg/min. Blood samples were taken periodically for the determination of insulin and GLP- 1 peptide concentrations. Insulin change values were calculated as the difference between the value at time t and the average value during the last 20 minutes of the control period (60-80) minutes and are presented in Table 3. Areas under the insulin change curves were calculated using the trapezoidal rule over the last 30 minutes of each infusion period. GLP-1 peptide concentrations are presented in Table 4. Values listed are the means ⁇ standard error of the mean (SEM) .
- Table 4 GLP-1 peptide concentration from dog hyperglycemic (150 mg/dL) clamp studies after 60 minutes of compound infusion.
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Organic Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Public Health (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Veterinary Medicine (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Diabetes (AREA)
- Endocrinology (AREA)
- Heart & Thoracic Surgery (AREA)
- Toxicology (AREA)
- Hematology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Molecular Biology (AREA)
- Cardiology (AREA)
- Obesity (AREA)
- Genetics & Genomics (AREA)
- Biophysics (AREA)
- Biochemistry (AREA)
- Gastroenterology & Hepatology (AREA)
- Zoology (AREA)
- Emergency Medicine (AREA)
- Child & Adolescent Psychology (AREA)
- Neurosurgery (AREA)
- Neurology (AREA)
- Biomedical Technology (AREA)
- Vascular Medicine (AREA)
- Urology & Nephrology (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Peptides Or Proteins (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
Priority Applications (7)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP03700026A EP1585959A4 (en) | 2002-01-08 | 2003-01-03 | PEPTIDE-1 ANALOGUES OF EXTENSION GLUCAGON TYPE |
| US10/499,111 US7482321B2 (en) | 2002-01-08 | 2003-01-03 | Extended glucagon-like peptide-1 analogs |
| BRPI0306706-8A BR0306706A (pt) | 2002-01-08 | 2003-01-03 | peptìdeo glp-1 estendido, métodos de estimulação do receptor de glp-1 em um indivìduo necessitando de normalização de glicose sanguìnea, de tratamento de um indivìduo profilaticamente para diabetes independente de insulina, de redução ou de manutenção do peso corporal, de tratamento da obesidade, e de tratamento de doenças, em um indivìduo necessitando do mesmo, uso de um composto de glp-1, processo de preparação de uma formulação farmacêutica, e, formulação farmacêutica |
| JP2003558463A JP4282485B2 (ja) | 2002-01-08 | 2003-01-03 | 伸長グルカゴン様ペプチド−1アナログ |
| CA002468700A CA2468700A1 (en) | 2002-01-08 | 2003-01-03 | Extended glucagon-like peptide-1 analogs |
| AU2003200839A AU2003200839B2 (en) | 2002-01-08 | 2003-01-03 | Extended glucagon-like peptide-1 analogs |
| MXPA04006679A MXPA04006679A (es) | 2002-01-08 | 2003-01-03 | Analogos extendidos de peptido-1 de tipo glucagon. |
Applications Claiming Priority (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US34647402P | 2002-01-08 | 2002-01-08 | |
| US60/346,474 | 2002-01-08 | ||
| US40509702P | 2002-08-21 | 2002-08-21 | |
| US60/405,097 | 2002-08-21 |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2003058203A2 true WO2003058203A2 (en) | 2003-07-17 |
| WO2003058203A3 WO2003058203A3 (en) | 2007-02-01 |
Family
ID=26994870
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2003/000001 Ceased WO2003058203A2 (en) | 2002-01-08 | 2003-01-03 | Extended glucagon-like peptide-1 analogs |
Country Status (11)
| Country | Link |
|---|---|
| US (1) | US7482321B2 (https=) |
| EP (1) | EP1585959A4 (https=) |
| JP (1) | JP4282485B2 (https=) |
| AR (1) | AR038102A1 (https=) |
| AU (1) | AU2003200839B2 (https=) |
| BR (1) | BR0306706A (https=) |
| CA (1) | CA2468700A1 (https=) |
| MX (1) | MXPA04006679A (https=) |
| PE (1) | PE20030820A1 (https=) |
| TW (1) | TW200306202A (https=) |
| WO (1) | WO2003058203A2 (https=) |
Cited By (43)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2005120492A1 (en) * | 2004-06-11 | 2005-12-22 | Novo Nordisk A/S | Counteracting drug-induced obesity using glp-1 agonists |
| WO2006023356A3 (en) * | 2004-08-18 | 2006-05-18 | Lilly Co Eli | Selective vpac2 receptor peptide agonists |
| WO2007021498A1 (en) * | 2005-08-11 | 2007-02-22 | Eli Lilly And Company | Selective vpac2 receptor peptide agonists |
| EP1767545A1 (en) | 2005-09-22 | 2007-03-28 | Biocompatibles UK Limited | GLP-1 (Glucagon-like peptide-1) fusion polypeptides with increased peptidase resistance |
| WO2007017892A3 (en) * | 2005-05-05 | 2007-09-20 | Cadila Healthcare Ltd | Novel compounds as glp-i agonists |
| WO2007113205A1 (en) * | 2006-04-03 | 2007-10-11 | Novo Nordisk A/S | Glp-1 peptide agonists |
| WO2007101146A3 (en) * | 2006-02-28 | 2007-12-21 | Lilly Co Eli | Selective vpac2 receptor peptide agonists |
| EP1975176A1 (en) * | 2007-03-27 | 2008-10-01 | Biocompatibles UK Limited | Novel glp-1 fusion peptides, their production and use |
| JP2008540565A (ja) * | 2005-05-13 | 2008-11-20 | イーライ リリー アンド カンパニー | Glp−1peg化化合物 |
| US7557183B2 (en) | 2003-03-19 | 2009-07-07 | Eli Lilly And Company | Polyethylene glycol linked GLP-1 compounds |
| US7582608B2 (en) | 2005-10-26 | 2009-09-01 | Eli Lilly And Company | Selective VPAC2 receptor peptide agonists |
| EP2364735A2 (en) | 2005-12-16 | 2011-09-14 | Nektar Therapeutics | Branched PEG conjugates of GLP-1 |
| WO2012054822A1 (en) | 2010-10-22 | 2012-04-26 | Nektar Therapeutics | Pharmacologically active polymer-glp-1 conjugates |
| WO2012054861A1 (en) | 2010-10-22 | 2012-04-26 | Nektar Therapeutics | Glp-1 polymer conjugates having a releasable linkage |
| WO2012074883A1 (en) | 2010-11-24 | 2012-06-07 | Durect Corporation | Biodegradable drug delivery composition |
| EP2505207A2 (en) | 2005-01-14 | 2012-10-03 | Wuxi Grandchamp Pharmaceutical Technology Co., Ltd. | Modified exendins and uses thereof |
| US8288339B2 (en) | 2006-04-20 | 2012-10-16 | Amgen Inc. | GLP-1 compounds |
| US8338369B2 (en) | 2006-09-13 | 2012-12-25 | Glaxosmithkline Llc | Methods for administering long-lasting hypoglycemic agents |
| US8450270B2 (en) * | 2008-06-17 | 2013-05-28 | Indiana University Research And Technology Corporation | Glucagon analogs exhibiting enhanced solubility and stability in physiological pH buffers |
| WO2013078396A2 (en) | 2011-11-23 | 2013-05-30 | Durect Corporation | Radiation-sterilized biodegradable drug delivery compositions |
| US8536122B2 (en) | 2005-03-18 | 2013-09-17 | Novo Nordisk A/S | Acylated GLP-1 compounds |
| US8557769B2 (en) | 2007-08-03 | 2013-10-15 | Eli Lilly And Company | Co-administration of FGF-21 and GLP-1 to treat diabetes and lower blood glucose |
| US8603972B2 (en) | 2005-03-18 | 2013-12-10 | Novo Nordisk A/S | Extended GLP-1 compounds |
| US8691763B2 (en) | 2010-05-04 | 2014-04-08 | Glaxosmithkline Llc | Methods for treating or preventing cardiovascular disorders and providing cardiovascular protection |
| US8748377B2 (en) | 2008-12-10 | 2014-06-10 | Glaxosmithkline Llc | Pharmaceutical compositions |
| US8778872B2 (en) | 2010-06-24 | 2014-07-15 | Indiana University Research And Technology Corporation | Amide based glucagon superfamily peptide prodrugs |
| US8790705B2 (en) | 2006-05-10 | 2014-07-29 | Biocompatibles Uk Ltd. | Spherical microcapsules comprising GLP-1 peptides, their production and use |
| US8859491B2 (en) | 2011-11-17 | 2014-10-14 | Indiana University Research And Technology Corporation | Glucagon superfamily peptides exhibiting glucocorticoid receptor activity |
| US8900593B2 (en) | 2007-02-15 | 2014-12-02 | Indiana University Research And Technology Corporation | Glucagon/GLP-1 receptor co-agonists |
| US8980830B2 (en) | 2007-10-30 | 2015-03-17 | Indiana University Research And Technology Corporation | Peptide compounds exhibiting glucagon antagonist and GLP-1 agonist activity |
| US9018164B2 (en) | 2005-11-07 | 2015-04-28 | Indiana University Research And Technology Corporation | Glucagon analogs exhibiting physiological solubility and stability |
| WO2015081891A1 (en) | 2013-12-06 | 2015-06-11 | Baikang (Suzhou) Co., Ltd | Bioreversable promoieties for nitrogen-containing and hydroxyl-containing drugs |
| US9062124B2 (en) | 2008-06-17 | 2015-06-23 | Indiana University Research And Technology Corporation | GIP-based mixed agonists for treatment of metabolic disorders and obesity |
| US9127088B2 (en) | 2010-05-13 | 2015-09-08 | Indiana University Research And Technology Corporation | Glucagon superfamily peptides exhibiting nuclear hormone receptor activity |
| US9145451B2 (en) | 2010-05-13 | 2015-09-29 | Indiana University Research And Technology Corporation | Glucagon superfamily peptides exhbiting G protein coupled receptor activity |
| US9150632B2 (en) | 2009-06-16 | 2015-10-06 | Indiana University Research And Technology Corporation | GIP receptor-active glucagon compounds |
| US9249206B2 (en) | 2010-12-22 | 2016-02-02 | Indiana University Research And Technology Corporation | Glucagon analogs exhibiting GIP receptor activity |
| US9309301B2 (en) | 2011-06-22 | 2016-04-12 | Indiana University Research And Technology Corporation | Glucagon/GLP-1 receptor co-agonists |
| US9340600B2 (en) | 2012-06-21 | 2016-05-17 | Indiana University Research And Technology Corporation | Glucagon analogs exhibiting GIP receptor activity |
| US9487571B2 (en) | 2010-01-27 | 2016-11-08 | Indiana University Research And Technology Corporation | Glucagon antagonist-GIP agonist conjugates and compositions for the treatment of metabolic disorders and obesity |
| US9486504B2 (en) | 2003-12-09 | 2016-11-08 | Novo Nordisk A/S | Regulation of food preference using GLP-1 agonists |
| US9758562B2 (en) | 2011-06-22 | 2017-09-12 | Indiana University and Technology Corporation | Glucagon/GLP-1 receptor co-agonists |
| US10758623B2 (en) | 2013-12-09 | 2020-09-01 | Durect Corporation | Pharmaceutically active agent complexes, polymer complexes, and compositions and methods involving the same |
Families Citing this family (12)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| AU2005203925A1 (en) | 2004-01-08 | 2005-07-21 | Theratechnologies Inc. | Glucagon-Like Peptide-1 analogs with long duration of action |
| US8202837B2 (en) * | 2005-11-04 | 2012-06-19 | Glaxosmithkline Llc | Methods for administering hypoglycemic agents |
| EP1972349A1 (en) * | 2007-03-21 | 2008-09-24 | Biocompatibles UK Limited | GLP-1 fusion peptides conjugated to polymer(s), their production and use |
| US8889618B2 (en) | 2008-11-07 | 2014-11-18 | The General Hospital Corporation | C-terminal fragments of glucagon-like peptide-1 (GLP-1) |
| PE20120332A1 (es) | 2008-12-19 | 2012-04-14 | Univ Indiana Res & Tech Corp | Profarmacos de peptido de la superfamilia de glucagon basado en amida |
| WO2012061466A2 (en) | 2010-11-02 | 2012-05-10 | The General Hospital Corporation | Methods for treating steatotic disease |
| WO2013006692A2 (en) * | 2011-07-06 | 2013-01-10 | The General Hospital Corporation | Methods of treatment using a pentapeptide derived from the c-terminus of glucagon-like peptide 1 (glp-1) |
| CN102363633B (zh) * | 2011-11-16 | 2013-11-20 | 天津拓飞生物科技有限公司 | 胰高血糖素样肽-1突变体多肽及其制备方法、药物组合物和其应用 |
| JP6475233B2 (ja) * | 2013-06-20 | 2019-02-27 | ノヴォ ノルディスク アー/エス | Glp−1誘導体及びその使用 |
| JP6730278B2 (ja) | 2014-11-27 | 2020-07-29 | ノヴォ ノルディスク アー/エス | Glp−1誘導体及びその使用 |
| WO2016097108A1 (en) | 2014-12-17 | 2016-06-23 | Novo Nordisk A/S | Glp-1 derivatives and uses thereof |
| MX2020010505A (es) | 2018-04-05 | 2021-01-15 | Sun Pharmaceutical Ind Ltd | Analogos novedosos de glp-1. |
Family Cites Families (8)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| IL128332A0 (en) * | 1996-08-30 | 2000-01-31 | Novo Nordisk As | GLP-1 derivatives |
| WO1999043706A1 (en) * | 1998-02-27 | 1999-09-02 | Novo Nordisk A/S | Derivatives of glp-1 analogs |
| JP2002506792A (ja) | 1998-02-27 | 2002-03-05 | ノボ ノルディスク アクティーゼルスカブ | N末端修飾glp−1誘導体 |
| ATE251465T1 (de) | 1998-07-31 | 2003-10-15 | Novo Nordisk As | In-vitro stimulation von beta zellen vermehrung |
| IL155812A0 (en) * | 2000-12-07 | 2003-12-23 | Lilly Co Eli | Glp-1 fusion proteins |
| ATE408414T1 (de) | 2001-07-31 | 2008-10-15 | Us Gov Health & Human Serv | Glp 1 exendin 4 peptidanaloga und deren verwendungen |
| EP1432430A4 (en) * | 2001-08-28 | 2006-05-10 | Lilly Co Eli | PREMIXTURES OF GLP-1 AND BASALINSULIN |
| MXPA04003569A (es) * | 2001-10-19 | 2004-07-23 | Lilly Co Eli | Mezclas bifasicas de glp-1 e insulina. |
-
2003
- 2003-01-03 AU AU2003200839A patent/AU2003200839B2/en not_active Ceased
- 2003-01-03 JP JP2003558463A patent/JP4282485B2/ja not_active Expired - Fee Related
- 2003-01-03 WO PCT/US2003/000001 patent/WO2003058203A2/en not_active Ceased
- 2003-01-03 TW TW092100093A patent/TW200306202A/zh unknown
- 2003-01-03 CA CA002468700A patent/CA2468700A1/en not_active Abandoned
- 2003-01-03 MX MXPA04006679A patent/MXPA04006679A/es unknown
- 2003-01-03 BR BRPI0306706-8A patent/BR0306706A/pt not_active IP Right Cessation
- 2003-01-03 EP EP03700026A patent/EP1585959A4/en not_active Withdrawn
- 2003-01-03 AR ARP030100014A patent/AR038102A1/es unknown
- 2003-01-03 US US10/499,111 patent/US7482321B2/en not_active Expired - Fee Related
- 2003-01-06 PE PE2003000021A patent/PE20030820A1/es not_active Application Discontinuation
Non-Patent Citations (2)
| Title |
|---|
| KIEFER ET AL.: 'The Glucagon-Like Peptides' ENDOCRINE REVIEWS vol. 20, no. 6, 1999, pages 876 - 913, XP008010226 * |
| See also references of EP1585959A2 * |
Cited By (65)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US7557183B2 (en) | 2003-03-19 | 2009-07-07 | Eli Lilly And Company | Polyethylene glycol linked GLP-1 compounds |
| US9486504B2 (en) | 2003-12-09 | 2016-11-08 | Novo Nordisk A/S | Regulation of food preference using GLP-1 agonists |
| US8853157B2 (en) | 2004-06-11 | 2014-10-07 | Novo Nordisk A/S | Methods of treating steroid-induced obesity using GLP-1 agonists |
| EP2316446A1 (en) * | 2004-06-11 | 2011-05-04 | Novo Nordisk A/S | Counteracting drug-induced obesity using GLP-1 agonists |
| WO2005120492A1 (en) * | 2004-06-11 | 2005-12-22 | Novo Nordisk A/S | Counteracting drug-induced obesity using glp-1 agonists |
| US8410047B2 (en) | 2004-06-11 | 2013-04-02 | Novo Nordisk A/S | Counteracting drug-induced obesity using GLP-1 agonists |
| WO2006023356A3 (en) * | 2004-08-18 | 2006-05-18 | Lilly Co Eli | Selective vpac2 receptor peptide agonists |
| WO2006023359A3 (en) * | 2004-08-18 | 2006-09-14 | Lilly Co Eli | Selective vpac2 receptor peptide agonists |
| EP2505207A2 (en) | 2005-01-14 | 2012-10-03 | Wuxi Grandchamp Pharmaceutical Technology Co., Ltd. | Modified exendins and uses thereof |
| US8603972B2 (en) | 2005-03-18 | 2013-12-10 | Novo Nordisk A/S | Extended GLP-1 compounds |
| US8536122B2 (en) | 2005-03-18 | 2013-09-17 | Novo Nordisk A/S | Acylated GLP-1 compounds |
| WO2007017892A3 (en) * | 2005-05-05 | 2007-09-20 | Cadila Healthcare Ltd | Novel compounds as glp-i agonists |
| JP2008540565A (ja) * | 2005-05-13 | 2008-11-20 | イーライ リリー アンド カンパニー | Glp−1peg化化合物 |
| WO2007021498A1 (en) * | 2005-08-11 | 2007-02-22 | Eli Lilly And Company | Selective vpac2 receptor peptide agonists |
| US8431533B2 (en) | 2005-09-22 | 2013-04-30 | Biocompatibles Uk Ltd. | GLP-1 fusion peptides, their production and use |
| EA013796B1 (ru) * | 2005-09-22 | 2010-06-30 | Байокомпатиблз Юк Лтд. | Слитые полипептиды, содержащие glp-1 (глюкагон-подобный пептид-1), с повышенной устойчивостью к пептидазам |
| EP2174952A3 (en) * | 2005-09-22 | 2010-11-17 | Biocompatibles Uk Ltd. | glp-1 (glucagon-like peptide-1) fusion polypeptides with increased peptidase resistance |
| EP2261245A1 (en) * | 2005-09-22 | 2010-12-15 | Biocompatibles Uk Ltd. | GLP-1 (glucagon-like peptide-1) fusion polypeptides with increased peptidase resistance |
| US8853159B2 (en) | 2005-09-22 | 2014-10-07 | Biocompatibles Uk Ltd | GLP-1 Fusion Peptides |
| AU2006299134B2 (en) * | 2005-09-22 | 2012-02-23 | Biocompatibles Uk Ltd. | GLP-1 ( glucagon-like peptide-1 ) fusion polypeptides with increased peptidase resistance |
| EP2045265A1 (en) * | 2005-09-22 | 2009-04-08 | Biocompatibles Uk Ltd. | GLP-1 fusion peptides, their production and use |
| EP1767545A1 (en) | 2005-09-22 | 2007-03-28 | Biocompatibles UK Limited | GLP-1 (Glucagon-like peptide-1) fusion polypeptides with increased peptidase resistance |
| WO2007039140A1 (en) | 2005-09-22 | 2007-04-12 | Biocompatibles Uk Ltd. | Glp-1 ( glucagon-like peptide-1 ) fusion polypeptides with increased peptidase resistance |
| US7897573B2 (en) | 2005-10-26 | 2011-03-01 | Eli Lilly And Company | Selective VPAC2 receptor peptide agonists |
| US7582608B2 (en) | 2005-10-26 | 2009-09-01 | Eli Lilly And Company | Selective VPAC2 receptor peptide agonists |
| US9018164B2 (en) | 2005-11-07 | 2015-04-28 | Indiana University Research And Technology Corporation | Glucagon analogs exhibiting physiological solubility and stability |
| US8293869B2 (en) | 2005-12-16 | 2012-10-23 | Nektar Therapeutics | Polymer conjugates of GLP-1 |
| EP2364735A2 (en) | 2005-12-16 | 2011-09-14 | Nektar Therapeutics | Branched PEG conjugates of GLP-1 |
| US8580919B2 (en) | 2005-12-16 | 2013-11-12 | Nektar Therapeutics | Polymer conjugates of GLP-1 |
| WO2007101146A3 (en) * | 2006-02-28 | 2007-12-21 | Lilly Co Eli | Selective vpac2 receptor peptide agonists |
| WO2007113205A1 (en) * | 2006-04-03 | 2007-10-11 | Novo Nordisk A/S | Glp-1 peptide agonists |
| US8288339B2 (en) | 2006-04-20 | 2012-10-16 | Amgen Inc. | GLP-1 compounds |
| US8790705B2 (en) | 2006-05-10 | 2014-07-29 | Biocompatibles Uk Ltd. | Spherical microcapsules comprising GLP-1 peptides, their production and use |
| US8338369B2 (en) | 2006-09-13 | 2012-12-25 | Glaxosmithkline Llc | Methods for administering long-lasting hypoglycemic agents |
| US8900593B2 (en) | 2007-02-15 | 2014-12-02 | Indiana University Research And Technology Corporation | Glucagon/GLP-1 receptor co-agonists |
| US9447162B2 (en) | 2007-02-15 | 2016-09-20 | Indiana University Research And Technology Corporation | Glucagon/GLP-1 receptor co-agonists |
| EP1975176A1 (en) * | 2007-03-27 | 2008-10-01 | Biocompatibles UK Limited | Novel glp-1 fusion peptides, their production and use |
| WO2008116648A3 (en) * | 2007-03-27 | 2008-12-31 | Biocompatibles Uk Ltd | Novel glp-1 fusion peptides, their production and use |
| US8557769B2 (en) | 2007-08-03 | 2013-10-15 | Eli Lilly And Company | Co-administration of FGF-21 and GLP-1 to treat diabetes and lower blood glucose |
| US8980830B2 (en) | 2007-10-30 | 2015-03-17 | Indiana University Research And Technology Corporation | Peptide compounds exhibiting glucagon antagonist and GLP-1 agonist activity |
| US8450270B2 (en) * | 2008-06-17 | 2013-05-28 | Indiana University Research And Technology Corporation | Glucagon analogs exhibiting enhanced solubility and stability in physiological pH buffers |
| US9062124B2 (en) | 2008-06-17 | 2015-06-23 | Indiana University Research And Technology Corporation | GIP-based mixed agonists for treatment of metabolic disorders and obesity |
| US8748377B2 (en) | 2008-12-10 | 2014-06-10 | Glaxosmithkline Llc | Pharmaceutical compositions |
| US9790263B2 (en) | 2009-06-16 | 2017-10-17 | Indiana University Research And Technology Corporation | GIP receptor-active glucagon compounds |
| US9150632B2 (en) | 2009-06-16 | 2015-10-06 | Indiana University Research And Technology Corporation | GIP receptor-active glucagon compounds |
| US9487571B2 (en) | 2010-01-27 | 2016-11-08 | Indiana University Research And Technology Corporation | Glucagon antagonist-GIP agonist conjugates and compositions for the treatment of metabolic disorders and obesity |
| US8691763B2 (en) | 2010-05-04 | 2014-04-08 | Glaxosmithkline Llc | Methods for treating or preventing cardiovascular disorders and providing cardiovascular protection |
| US9145451B2 (en) | 2010-05-13 | 2015-09-29 | Indiana University Research And Technology Corporation | Glucagon superfamily peptides exhbiting G protein coupled receptor activity |
| US9127088B2 (en) | 2010-05-13 | 2015-09-08 | Indiana University Research And Technology Corporation | Glucagon superfamily peptides exhibiting nuclear hormone receptor activity |
| US9783592B2 (en) | 2010-05-13 | 2017-10-10 | Indiana University Research And Technology Corporation | Glucagon superfamily peptides exhibiting nuclear hormone receptor activity |
| US8778872B2 (en) | 2010-06-24 | 2014-07-15 | Indiana University Research And Technology Corporation | Amide based glucagon superfamily peptide prodrugs |
| WO2012054822A1 (en) | 2010-10-22 | 2012-04-26 | Nektar Therapeutics | Pharmacologically active polymer-glp-1 conjugates |
| WO2012054861A1 (en) | 2010-10-22 | 2012-04-26 | Nektar Therapeutics | Glp-1 polymer conjugates having a releasable linkage |
| WO2012074883A1 (en) | 2010-11-24 | 2012-06-07 | Durect Corporation | Biodegradable drug delivery composition |
| US9249206B2 (en) | 2010-12-22 | 2016-02-02 | Indiana University Research And Technology Corporation | Glucagon analogs exhibiting GIP receptor activity |
| US9309301B2 (en) | 2011-06-22 | 2016-04-12 | Indiana University Research And Technology Corporation | Glucagon/GLP-1 receptor co-agonists |
| US9758562B2 (en) | 2011-06-22 | 2017-09-12 | Indiana University and Technology Corporation | Glucagon/GLP-1 receptor co-agonists |
| US10174093B2 (en) | 2011-06-22 | 2019-01-08 | Indiana University Research And Technology Corporation | Glucagon/GLP-1 receptor co-agonists |
| US10730923B2 (en) | 2011-06-22 | 2020-08-04 | Indiana University Research And Technology Corporation | Glucagon/GLP-1 receptor co-agonists |
| US8859491B2 (en) | 2011-11-17 | 2014-10-14 | Indiana University Research And Technology Corporation | Glucagon superfamily peptides exhibiting glucocorticoid receptor activity |
| WO2013078396A2 (en) | 2011-11-23 | 2013-05-30 | Durect Corporation | Radiation-sterilized biodegradable drug delivery compositions |
| US9340600B2 (en) | 2012-06-21 | 2016-05-17 | Indiana University Research And Technology Corporation | Glucagon analogs exhibiting GIP receptor activity |
| WO2015081891A1 (en) | 2013-12-06 | 2015-06-11 | Baikang (Suzhou) Co., Ltd | Bioreversable promoieties for nitrogen-containing and hydroxyl-containing drugs |
| US10758623B2 (en) | 2013-12-09 | 2020-09-01 | Durect Corporation | Pharmaceutically active agent complexes, polymer complexes, and compositions and methods involving the same |
| US11529420B2 (en) | 2013-12-09 | 2022-12-20 | Durect Corporation | Pharmaceutically active agent complexes, polymer complexes, and compositions and methods involving the same |
Also Published As
| Publication number | Publication date |
|---|---|
| PE20030820A1 (es) | 2003-10-04 |
| AU2003200839A1 (en) | 2003-07-24 |
| AU2003200839B2 (en) | 2008-12-11 |
| AR038102A1 (es) | 2004-12-29 |
| JP4282485B2 (ja) | 2009-06-24 |
| US7482321B2 (en) | 2009-01-27 |
| BR0306706A (pt) | 2007-03-27 |
| TW200306202A (en) | 2003-11-16 |
| MXPA04006679A (es) | 2004-11-10 |
| CA2468700A1 (en) | 2003-07-17 |
| US20060014241A1 (en) | 2006-01-19 |
| EP1585959A2 (en) | 2005-10-19 |
| EP1585959A4 (en) | 2007-11-14 |
| JP2005528337A (ja) | 2005-09-22 |
| WO2003058203A3 (en) | 2007-02-01 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US7482321B2 (en) | Extended glucagon-like peptide-1 analogs | |
| AU2003200839A2 (en) | Extended glucagon-like peptide-1 analogs | |
| KR100593348B1 (ko) | 글루카곤-유사 펩티드-1 유사체 | |
| EP1294757B1 (en) | Glucagon-like peptide-1 analogs | |
| CN108026153B (zh) | 作为选择性肽双重glp-1/胰高血糖素受体激动剂的新毒蜥外泌肽-4衍生物 | |
| US8900593B2 (en) | Glucagon/GLP-1 receptor co-agonists | |
| CN106715466B (zh) | 作为选择性胰高血糖素受体激动剂的毒蜥外泌肽-4衍生物 | |
| US20060252916A1 (en) | Modified glucagon-like peptide-1 analogs | |
| AU2001264791A1 (en) | Glucagon-like peptide-1 analogs | |
| US20060079456A1 (en) | Vasoactive intestinal polypeptide pharmaceuticals | |
| US7608587B2 (en) | Exendin 4 polypeptide fragment | |
| KR20120116942A (ko) | 폴리펩티드 접합체 | |
| US20060252693A1 (en) | Glucagon-like peptide-1 analogs | |
| HK1055121B (en) | Glucagon-like peptide-1 analogs |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| AK | Designated states |
Kind code of ref document: A2 Designated state(s): AE AG AL AM AT AU AZ BA BB BG BR BY BZ CA CH CN CO CR CU CZ DE DK DM DZ EC EE ES FI GB GD GE GH GM HR HU ID IL IN IS JP KE KG KP KR KZ LC LK LR LS LT LU LV MA MD MG MK MN MW MX MZ NO NZ OM PH PL PT RO RU SC SD SE SG SK SL TJ TM TN TR TT TZ UA UG US UZ VC VN YU ZA ZM ZW |
|
| AL | Designated countries for regional patents |
Kind code of ref document: A2 Designated state(s): GH GM KE LS MW MZ SD SL SZ TZ UG ZM ZW AM AZ BY KG KZ MD RU TJ TM AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HU IE IT LU MC NL PT SE SI SK TR BF BJ CF CG CI CM GA GN GQ GW ML MR NE SN TD TG |
|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application | ||
| WWE | Wipo information: entry into national phase |
Ref document number: 2003200839 Country of ref document: AU |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2468700 Country of ref document: CA |
|
| ENP | Entry into the national phase |
Ref document number: 2006014241 Country of ref document: US Kind code of ref document: A1 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 10499111 Country of ref document: US |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 00929/KOLNP/2004 Country of ref document: IN Ref document number: 929/KOLNP/2004 Country of ref document: IN |
|
| WWE | Wipo information: entry into national phase |
Ref document number: PA/a/2004/006679 Country of ref document: MX Ref document number: 2003558463 Country of ref document: JP Ref document number: 20038020386 Country of ref document: CN |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2003700026 Country of ref document: EP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 164867 Country of ref document: IL |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 165332 Country of ref document: IL |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 1020057010281 Country of ref document: KR |
|
| DFPE | Request for preliminary examination filed prior to expiration of 19th month from priority date (pct application filed before 20040101) | ||
| WWP | Wipo information: published in national office |
Ref document number: 2003700026 Country of ref document: EP |
|
| WWP | Wipo information: published in national office |
Ref document number: 10499111 Country of ref document: US |
|
| ENP | Entry into the national phase |
Ref document number: PI0306706 Country of ref document: BR |