WO2002088170A2 - Cripto blocking antibodies and uses thereof - Google Patents
Cripto blocking antibodies and uses thereof Download PDFInfo
- Publication number
- WO2002088170A2 WO2002088170A2 PCT/US2002/011950 US0211950W WO02088170A2 WO 2002088170 A2 WO2002088170 A2 WO 2002088170A2 US 0211950 W US0211950 W US 0211950W WO 02088170 A2 WO02088170 A2 WO 02088170A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- cripto
- antibody
- antibodies
- tumor
- epitope
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/30—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/34—Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/30—Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto
Definitions
- Cripto is a cell surface protein of 188 amino acid residues serendipitously isolated in a cDNA screen of a human embryonic carcinoma library (Ciccodicola et al., 1989, EMBO J., vol. 8, no. 7, pp. 1987-1991).
- the Cripto protein has at least two notable domains: a cysteine-rich domain, and a domain first characterized as similar to the domain found in the epidermal growth factor (EGF) family.
- EGF epidermal growth factor
- the Cripto signaling pathway has remained elusive despite continued investigation, with the literature supporting activation of several different pathways, including a MAP kinase pathway (DeSantis et al., 1997, Cell Growth Differ., 8:1257- 1266; Kannan et al., 1997, J. Biol. Chem., 272:3330-3335), the TGF- ⁇ pathway (Gritsman et al., 1999, Development, 127:921-932; Schier et al., 2000, Nature, 403:385-389), possible interactions with the Wnt pathway (Salomon et al., Endocr Relat Cancer. 2000 Dec;7(4): 199-226; and cross talk with the EGF pathway (Bianco et al., 1999, J. Biol. Chem., 274:8624-8629).
- Cripto protein overexpression is associated with many tumor types (including but not limited to breast, testicular, colon, lung, ovary, bladder, uterine, cervical, pancreatic, and stomach), as demonstrated by immunostaining of human tissue with rabbit polyclonal antibodies raised against small cripto peptides. Panico et al ., 1996, Int. J. Cancer, 65: 51-56; Byrne et al., 1998, J Pathology, 185:108-111; De Angelis et al., 1999, Int J Oncology, 14:437-440. The art is therefore in need of means of controlling, restricting, and or preventing such overexpression, modulating Cripto signaling, and modulating the consequences of Cripto expression (i.e., promotion and/or maintenance of cell transformation).
- the antibody of the present invention specifically binds to an epitope in the ligand/receptor binding domain of Cripto.
- Cripto can be selected from CR-1 (SEQ ID NO:l) or CR-3 (SEQ ID NO:2).
- antibodies that specifically binds to the epitope in the ligand/receptor binding domain include for example A6C12.11, A6F8.6 (ATCC ACCESSION NO. PTA-3318), A8G3.5 (ATCC ACCESSION NO. PTA-3317), A19A10.30, A8H3.1 (ATCC ACCESSION NO. PTA-3315), A27F6.1 (ATCC ACCESSION NO.
- the epitope to which the antibodies of the present invention bind is in an EGF-like domain.
- Antibodies that specifically bind to the epitope in the EGF-like domain include but are not limited to A40G12.8 (ATCC ACCESSION NO. PTA-3316), A8H3.1 (ATCC ACCESSION NO. PTA-3315), A27F6.1 (ATCC ACCESSION NO. PTA-3310), B6G7.10 (ATCC ACCESSION NO. PTA-3313), A17G12.1 (ATCC ACCESSION NO. PTA-3314) and A18B3.11 (ATCC ACCESSION NO. PTA-3312).
- the epitope to which the antibodies of the present invention bind is in a cys-rich domain.
- Antibodies that specifically bind to the epitope in the cys-rich domain include but are not limited to A19A10.30, A8G3.5 (ATCC ACCESSION NO. PTA-3317), A6F8.6 (ATCC ACCESSION NO. PTA-3318) and A6C12.11.
- the epitope to which the antibodies of the present invention bind is in the domain spanning amino acid residues 46-62 of Cripto.
- Antibodies that specifically bind to the epitope in the domain spanning amino acid residues 46-62 of Cripto include but are not limited to A10B2.18 (ATCC ACCESSION NO. PTA-3311), B3F6.17 (ATCC ACCESSION NO. PTA-3319) and A17A2.16.
- the present inventions also comtemplate antibodies which binds specifically to
- Antibodies that bind specifically to Cripto and are capable of modulating Cripto signaling include but are not limited to, A40G12.8 (ATCC ACCESSION NO. PTA-3316), A8H3.1 (ATCC ACCESSION NO. PTA-3315), A27F6.1 (ATCC ACCESSION NO. PTA-3310), and A6C12.11.
- the antibodies of the present invention which binds specifically to Cripto and are capable of modulating Cripto signaling bind to an epitope in an EGF-like domain or a cys-rich domain of Cripto.
- the present inventions also comtemplate antibodies which binds specifically to Cripto and blocks the interaction between Cripto and ALK4.
- Antibodies that bind specifically to Cripto and are capable of blocking the interaction between Cripto and AL 4 include but are not limited to, A8G3.5 (ATCC ACCESSION NO. PTA-3317), A6F8.6 (ATCC ACCESSION NO. PTA-3318) and A6C12.11.
- the antibodies of the present invention which binds specifically to Cripto and are capable of blocking the interaction between Cripto and ALK4 bind to an epitope in an EGF-like domain or a cys-rich domain of Cripto.
- the present invention comtemplates antibodies which bind specifically to Cripto and are capable of modulating tumor growth.
- Antibodies that specifically bind to Cripto and are capable of modulating tumor growth include but are not limited to, A27F6.1 (ATCC ACCESSION NO. PTA-3310), B6G7.10 (ATCC ACCESSION NO. PTA-3313) and A8G3.5 (ATCC ACCESSION NO. PTA-3317).
- the antibodies of the present invention which bind specifically to Cripto and are capable of modulating tumor growth bind to an epitope in an EGF-like domain or a cys-rich domain of Cripto.
- the antibodies of the present invention which bind specifically to Cripto, which are capable of modulating Cripto signaling, and which are capable of modulating tumor growth bind to an epitope in an EGF-like domain or a cys-rich domain of Cripto.
- the present invention comtemplates antibodies which bind specifically to Cripto, which are capable of blocking the interaction between Cripto and ALK4, and which are capable of modulating tumor growth.
- Antibodies that specifically bind to Cripto, which are capable of blocking the interaction between Cripto and AL 4, and which are capable of modulating tumor growth include but are not limited to A8G3.5 (ATCC ACCESSION NO. PTA-3317).
- the antibodies of the present invention include but are not limited to monoclonal, polyclonal, humanized, chimeric and human antibodies.
- the present invention also provides for a composition for administration to a subject having a tumor that expresses Cripto comprising at least one of the antibodies described above.
- the subject is human.
- the composition may include a pharmaceutically acceptable excipient.
- the antibodies described above can be conjugated to a chemotherapeutic agent or be provided in combination with a nonconjugated chemotherapeutic.
- Contemplated in another aspect of the invention are methods of modulating growth of tumor cells in vitro in a sample comprising the step of adding to the sample the compositions described above.
- the methods of the present invention are particularly useful in modulating growth of tumor cells and/or treating a subject (i.e. a human) having a tumor where the tumor cell is selected from breast, testicular, colon, lung, ovary, bladder, uterine, cervical, pancreatic, and stomach tumor cells.
- the present invention contemplates methods of determining whether a tissue expresses Cripto, comprising the step of analyzing tissue from the subject in an immunoassay using any of the antibodies described above. Also contemplated are methods of determining whether a cell line overexpresses Cripto, comprising the step of analyzing the cell line in an immunoassay using any of the antibodies described above.
- antibodies that specifically bind to Cripto include, for example, antibodies that specifically bind to an epitope in the ligand/receptor binding domain of either a native Cripto protein or a denatured form of Cripto; antibodies that bind an EGF-like domain, a cys-rich domain, or a peptide (e.g., from about 3 to about 20 amino acids) from the region comprising amino acid residues 46 to 150; antibodies that bind Cripto and modulate Cripto signalling; antibodies that bind Cripto and modulate tumor cell growth; and antibodies that bind to Cripto, modulate Cripto signaling, and modulate tumor cell growth. These antibodies are selected using conventional in vitro assays for selecting antibodies which bind the ligand/receptor binding domain, modulate Cripto signaling, or modulate tumor cell growth.
- chimeric antibodies may be constructed, in which the antigen binding domain from an animal antibody is linked to a human constant domain (an antibody derived initially from a nonhuman mammal in which recombinant DNA technology has been used to replace all or part of the hinge and constant regions of the heavy chain and/or the constant region of the light chain, with corresponding regions from a human immunoglobulin light chain or heavy chain) (see, e.g., Cabilly et al., United States patent 4,816,567; Morrison et al., Proc. Natl. Acad. Sci. 81: 6851-55, 1984). Chimeric antibodies reduce the immunogenic responses elicited by animal antibodies when used in human clinical treatments.
- Humanized antibodies minimize the use of heterologous (inter-species) sequences in antibodies for use in human therapies, and are less likely to elicit unwanted immune responses. Primatized antibodies can be produced similarly.
- the term “compound” means any identifiable chemical or molecule, including, but not limited to, ion, atom, small molecule, peptide, protein, sugar, nucleotide, or nucleic acid, and such compound can be natural or synthetic.
- the terms “modulates” or “modifies” means an increase or decreas'e in the amount, quality, or effect of a particular activity or protein.
- blocking the interaction between Cripto and ALK 4" means an increase or decrease in the interaction, i.e. binding, between Cripto and ALK4, by about 5%, preferably 10%, more preferably 20%, more preferably 30%, more preferably 40%, more preferably 50%, more preferably 60%, more preferably 70%, more preferably 80%, more preferably 90%, and most preferably 100%,.
- Activity may be measured by assays known in the art, such as the binding assay shown in Example 8.
- treating refers to having a therapeutic effect and at least partially alleviating or abrogating an abnormal condition in the organism. Treating includes maintenance of inhibited tumor growth, and induction of remission.
- therapeutic effect refers to the inhibition of an abnormal condition.
- administering relates to a method of incorporating a compound into cells or tissues of an organism.
- the abnormal condition can be prevented or treated when the cells or tissues of the organism exist within the organism or outside of the organism.
- Cells existing outside the organism can be maintained or grown in cell culture dishes, or in another organism.
- many techniques exist in the art to administer compounds including (but not limited to) oral, parenteral, dermal, injection, and aerosol applications.
- multiple techniques exist in the art to administer the compounds including (but not limited to) cell microinjection techniques, transformation techniques and carrier techniques.
- Administration may be accomplished by the many modes known in the art, e.g., oral, intravenous, intraperitoneal, intramuscular, and the like.
- an "effective amount" is an amount sufficient to effect beneficial or desired clinical results (i.e., amounts that eliminate or reduce the patient's tumor burden).
- An effective amount can be administered in one or more administrations.
- an effective amount of the antibodies of the present invention is an amount of the antibodies that is sufficient to ameliorate, stabilize, or delay the development of the Cripto-associated disease state, particularly Cripto-associated tumors. Detection and measurement of these indicators of efficacy are discussed below.
- An example of a typical treatment regime includes administering by intravenous infusion to the subject antibodies of the invention on a weekly schedule, at a dose of about 2-5 mg/kg.
- the antibodies are administered in an outpatient chemoinfusion unit, unless the patient requires hospitalization.
- Other administration regimes known in the art are also contemplated.
- “Cripto overexpression” is intended to mean the expression of Cripto by a tissue which expression is greater than the Cripto expression of adjacent normal tissue in a statistically significant amount.
- “Chemotherapeutics” refers to any agents identified in the art as having therapeutic effect on the inhibition of tumor growth, maintenace of inhibited tumor growth, and/or induction of remission, such as natural compounds, synthetic compounds, proteins, modified proteins, and radioactive compounds. Chemotherapeutic agents contemplated herewith include agents that can be conjugated to the antibodies of the present invention or alternatively agents that can be used in combination with the antibodies of the present invention without being conjugated to the antibody.
- chemotherapeutics that can be conjugated to the antibodies of the present invention include, but are not limited to radioconjugates (90 Y, 1311, 99mTc, lllln, 186Rh, et al.), tumor-activated prodrugs (maytansinoids, CC-1065 analogs, clicheamicin derivatives, anthracyclines, vinca alkaloids, et al.), ricin, diptheria toxin, pseudomonas exotoxin.
- radioconjugates 90 Y, 1311, 99mTc, lllln, 186Rh, et al.
- tumor-activated prodrugs maytansinoids, CC-1065 analogs, clicheamicin derivatives, anthracyclines, vinca alkaloids, et al.
- ricin diptheria toxin
- pseudomonas exotoxin pseudomonas exotoxin.
- a “subject” refers to vertebrates, particularly members of a mammalian species, and includes but is not limited to domestic animals, sports animals, and primates, including humans.
- Antibodies of the Invention The antibodies of the invention specifically bind to Cripto: As used herein,
- Cripto includes the CR-1 Cripto protein, the CR-3 Cripto protein, and fragments thereof. Such fragments may be entire domains, such as the extracellular or intracellular domains, the EGF-like domain, the cys-rich domain, the receptor binding domain, and the like. Such fragments may also include contiguous and noncontiguous epitopes in any domain of the Cripto protein.
- the 188 amino acid sequence for CR-1 is as follows [SEQ ID NO: 1]: DCRK ARFSYSVI IMAISKVFELGLVAGLGHQEFARPSRGYLAFRDDS IWPQEEPAIRPRSSQ VPPMGIQHSKELNRTCCLNGGTCM GSFCACPPS FYGRNCEHDVRK ⁇ NCGSVPHDT LPKKCSLCKC HGQLRCFPQAF PGCD GLVMDEHLVASRTPELPPSARTTTFMLVGICLSIQSYYY
- the 188 amino acid sequence for CR-3 is as follows [SEQ ID NO: 2]:
- the antibodies of the invention bind to an epitope in the EGF-like domain of Cripto.
- the EGF-like domain spans from about amino acid residue 75 to about amino acid residue 112 of the mature Cripto protein.
- Epitopes in the EGF-like domain may comprise linear or nonlinear spans of amino acid residues.
- Example of linear epitopes contemplated include but are not limited to about residues 75-85, 80-90, 85-95, 90-100, 95-105, 100-110, or 105-112.
- the epitope in the EGF domain is an epitope formed in the conformational native Cripto protein versus a denatured Cripto protein.
- the antibodies of the invention bind to an epitope in the cys-rich domain of Cripto.
- the cys-rich domain spans from about amino acid residue 114 to about amino acid residue 150 of the mature Cripto protein.
- Epitopes in the cys- rich domain may comprise linear or nonlinear spans of amino acid residues.
- Example of linear epitopes contemplated include but are not limited to about residues 114-125, 120-130, 125-135, 130-140, 135-145, or 140-150.
- the epitope in the cys-rich domain is an epitope formed in the conformational native Cripto protein versus a denatured Cripto protein
- the present invention provides antibodies (e.g., monoclonal and polyclonal antibodies, single chain antibodies, chimeric antibodies, bifunctional/bispecific antibodies, humanized antibodies, human antibodies, and complementary determining region (CDR)-grafted antibodies, including compounds which include CDR sequences which specifically recognize a polypeptide of the invention) specific for Cripto or fragments thereof.
- Antibody fragments including Fab, Fab', F(ab') 2 , and F v , are also provided by the invention.
- the terms "specific " and "selective,” when used to describe binding of the antibodies of the invention, indicates that the variable regions of the antibodies of the invention recognize and bind Cripto polypeptides.
- Hybridomas that produce such antibodies are also intended as aspects of the invention.
- the invention provides an anti-idiotypic antibody specific for an antibody that is specific for Cripto.
- anti-idiotypic antibodies see, e.g., U.S. Patents 6,063,379 and 5,780,029.
- antibodies contain relatively small antigen binding domains that can be isolated chemically or by recombinant techniques. Such domains are useful Cripto binding molecules themselves, and also may be reintroduced into human antibodies, or fused to a chemotherapeutic or polypeptide.
- the invention provides a polypeptide comprising a fragment of a Cripto- specific antibody, wherein the fragment and associated molecule, if any, bind to the Cripto.
- the invention provides polypeptides that are single chain antibodies and CDR-grafted antibodies. For a more detailed discussion of CDR-grafted antibodies, see, e.g., U.S. Patent5,859,205.
- non-human antibodies may be humanized by any of the methods known in the art. Humanized antibodies are useful for in vivo therapeutic applications.
- recombinant "humanized" antibodies may be synthesized. Humanized antibodies are antibodies initially derived from a nonhuman mammal in which recombinant DNA technology has been used to substitute some or all of the amino acids not required for antigen binding with amino acids from corresponding regions of a human immunoglobulin light or heavy chain. That is, they are chimeras comprising mostly human immunoglobulin sequences into which the regions responsible for specific antigen-binding have been inserted (see, e.g., PCT patent application WO 94/04679).
- Another embodiment of the invention includes the use of human antibodies, which can be produced in nonhuman animals, such as transgenic animals harboring one or more human immunoglobulin transgenes. Such animals may be used as a source for splenocytes for producing hybridomas, as is described in United States patent 5,569,825, WO00076310, WO00058499 and WO00037504 and incorporated by reference herein.
- Signal Modulation is described in United States patent 5,569,825, WO00076310, WO00058499 and WO00037504 and incorporated by reference herein.
- Also contemplated are methods of treating a subject suffering from a disorder associated with abnormal levels (i.e. elevated or depleted) of Cripto wherein the method comprises administering to the subject an effective amount of an antibody which specifically forms a complex with Cripto and is directed to the epitope to which an antibody selected from the group consisting of A6C12.11, A6F8.6 (ATCC ACCESSION NO. PTA-3318), A7H1.19, A8F1.30, A8G3.5 (ATCC ACCESSION NO. PTA-3317), A8H3.1 (ATCC ACCESSION NO. PTA-3315), A8H3.2, A19A10.30, A10B2.18 (ATCC ACCESSION NO.
- the vector pEAGl 100 is a derivative of GEBCO-BRL Life Technologies plasmid pCMV-Sport- betagal, the use of which in CHO transient transfections was described by Schifferli et al., 1999, Focus 21: 16. It was made by removing the reporter gene beta-galactosidase Notl fragment from the plasmid pCMV-Sport-Betagal (catalog number 10586-014) as follows: The plasmid was digested with Notl and EcoRV, the 4.38 kb Notl vector backbone fragment was gel-purified and ligated. Ligated DNA was transformed into competent E. coli DH5alpha.
- the eluted CR(del C)-Fc protein is injected into mice, and standard hybridoma techniques known to those of skill in the art are used to generate monoclonal antibodies.
- the mouse was boosted intravenously with 50 ⁇ g CR del C-Fc the day before fusion.
- the mouse spleen cells were fused with FL653 myeloma cell at a 1 spleen :6 myeloma ratio and were plated at 100,000, 33,000and 11,000 cells per well into 96 well tissue culture plates in selection media. Wells positive for growth were screened by FACS and ELIS A a week later. Two fusions were performed.
- B. Screening of Antibodies Supernatants resulting from the first or second fusion were screened first on
- Cripto positive cell lines may be used to assay the monoclonal antibodies for binding to Cripto using cell surface staining and flow cytometry as follows: Release cells from T162 flasks with 2 ml PBS " with 5 mM EDTA, 10 min., 37°C. Bring up to 20 ml with media with serum, pipetting up and down several times to unclump cells. Spin at 1200 rpm for 5 minutes. Wash cells with 5-10 ml 4° C PBS with 0.1% BSA (wash buffer). Spin at 1200 rpm for 5 minutes. Resuspend at 4xl0 6 - 10 7 /ml in wash buffer. Keep on ice.
- Purified antibodies are diluted to 1-10 ⁇ g/ml in wash buffer. Add 50 ⁇ l of cells to a 96-well Linbro V bottomed plate (ICN 7632105). Plate one well of cells for each control for each cell line to be analyzed, including cells for no antibody, 2° antibody only, hybridoma media, positive control antibody supernatant, if available, or purified, and an IgG subclass control (if using purified antibodies).
- the following describes an F9 Cripto null cell signaling assay used to assess inhibition of Cripto signaling.
- Sample 1 0.5 ⁇ g (N 2 ) 7 luciferase FAST reporter cDNA plus 1.5 ⁇ g empty vector cDNA.
- Sample 2 0.5 ⁇ g (N ) 7 luciferase, 0.5 ⁇ g FAST, and 1 ⁇ g empty vector cDNAs.
- Sample 3 0.5 ⁇ g (N 2 ) 7 luciferase, 0.5 ⁇ g Cripto ADD 0.5 FAST, and -0.5 ⁇ g empty vector cDNAs.
- Sample 4 0.5 ⁇ g (N 2 ) 7 luciferase, 0.5 ⁇ g Cripto, 0.5 FAST, and 0.5 ⁇ g empty vector cDNAs
- Sample 5 0.5 ⁇ g (N 2 ) luciferase, 0.5 ⁇ g Cripto, 0.5 FAST, and 0.5 ⁇ g empty vector cDNAs.
- Sample 6 0.5 ⁇ g (N 2 ) 7 luciferase, 0.5 ⁇ g Cripto, 0.5 FAST, and 0.5 ⁇ g empty vector cDNAs.
- Sample 7 0.5 ⁇ g (N 2 ) 7 luciferase, 0.5 ⁇ g Cripto, 0.5 FAST, and 0.5 ⁇ g empty vector cDNAs.
- Sample 8 0.5 ⁇ g (N 2 ) 7 luciferase, 0.5 ⁇ g Cripto, 0.5 FAST, and 0.5 ⁇ g empty vector cDNAs.
- Sample 9 0.5 ⁇ g (N 2 ) 7 luciferase, 0.5 ⁇ g Cripto, 0.5 FAST, and 0.5 ⁇ g empty vector cDNAs.
- Solution B comprises 30 ⁇ l of Lipofectamine plus 270 ⁇ l of OptiMeml.
- Sample 6 wells A40G12.8; lO ⁇ g/ml, Sample 7 wells: A40G12.8 2 ⁇ g/ml; Sample 8 wells: A10B2.18, lO ⁇ g/ml; Sample 9 wells: A10B2.18, 2 ⁇ g/ml.
- Day 2 Remove media, wash cells with PBS, 2ml/well. Add DMEM+0.5% FCS, 2mM Gin, P/S with the same amounts of Cripto antibodies as the previous day, to the same wells.
- Day 0 Implant tumor, record initial body weight of animals.
- a human testicular carcinoma cell line was implanted subcutaneously with an antibody which binds to a cys-rich domain of Cripto.
- Day -1 Randomized mice into control and treatments groups. Recorded initial body weight of animals. Administered first treatments to antibody groups. Dosing solutions were made. Treatments were blinded to the technicians until the assay was terminated.
Landscapes
- Chemical & Material Sciences (AREA)
- Health & Medical Sciences (AREA)
- Organic Chemistry (AREA)
- Immunology (AREA)
- Life Sciences & Earth Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Genetics & Genomics (AREA)
- Molecular Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Biophysics (AREA)
- Biochemistry (AREA)
- Cell Biology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- General Chemical & Material Sciences (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Peptides Or Proteins (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
Priority Applications (37)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| IL15857302A IL158573A0 (en) | 2000-03-20 | 2002-04-17 | Cripto blocking antibodies and uses thereof |
| CA2443840A CA2443840C (en) | 2001-04-26 | 2002-04-17 | Cripto blocking antibodies and uses thereof |
| EP02731384A EP1390389B1 (en) | 2001-04-26 | 2002-04-17 | Cripto blocking antibodies and uses thereof |
| SK1443-2003A SK14432003A3 (sk) | 2001-04-26 | 2002-04-17 | Protilátka špecifická pre Cripto, kompozícia obsahujúca takúto protilátku a jej použitie |
| EA200301158A EA007469B1 (ru) | 2001-04-26 | 2002-04-17 | Антитела, блокирующие cripto, и их применения |
| HK04101788.0A HK1058935B (en) | 2001-04-26 | 2002-04-17 | Cripto blocking antibodies and uses thereof |
| YU84903A RS51635B (sr) | 2001-04-26 | 2002-04-17 | Antitela koja blokiraju cripto i njihova upotreba |
| BRPI0209254-9A BR0209254A (pt) | 2001-04-26 | 2002-04-17 | anticorpos de bloqueio cripto e usos dos mesmos |
| SI200230804T SI1390389T1 (sl) | 2001-04-26 | 2002-04-17 | Protitelesa, ki blokirajo cripto in uporabe le-teh |
| EEP200300528A EE200300528A (et) | 2001-04-26 | 2002-04-17 | Cripto valku blokeerivad antikehad ja nende kasutamine |
| MXPA03009797A MXPA03009797A (es) | 2001-04-26 | 2002-04-17 | ANTICUERPOS PARA BLOQUEO DE PROTEiNA CRIPTO Y USO DE LOS MISMOS. |
| HU0501113A HUP0501113A3 (en) | 2001-04-26 | 2002-04-17 | Cripto blocking antibodies and uses thereof |
| DK02731384T DK1390389T3 (da) | 2001-04-26 | 2002-04-17 | Cripto-blokerende antistoffer og anvendelser deraf |
| DE60230868T DE60230868D1 (de) | 2001-04-26 | 2002-04-17 | Criptoblockierende antikörper und deren verwendung |
| KR1020037014078A KR100592357B1 (ko) | 2001-04-26 | 2002-04-17 | 크립토 차단 항체 및 그 용도 |
| JP2002585468A JP4307845B2 (ja) | 2001-04-26 | 2002-04-17 | Criptoをブロックする抗体およびその使用 |
| HK05105887.0A HK1072381B (en) | 2002-03-22 | 2002-10-01 | Cripto-specific antibodies |
| PT02807155T PT1494693E (pt) | 2002-03-22 | 2002-10-01 | Cripto ¿ anticorpos especificos |
| DE60238559T DE60238559D1 (de) | 2002-03-22 | 2002-10-01 | Criptospezifische antikörper |
| EP02807155A EP1494693B1 (en) | 2002-03-22 | 2002-10-01 | Cripto-specific antibodies |
| JP2003580477A JP2005520566A (ja) | 2002-03-22 | 2002-10-01 | Cripto特異的抗体 |
| AU2002334799A AU2002334799B2 (en) | 2001-04-26 | 2002-10-01 | Cripto-specific antibodies |
| AT02807155T ATE490981T1 (de) | 2002-03-22 | 2002-10-01 | Criptospezifische antikörper |
| PCT/US2002/031462 WO2003083041A2 (en) | 2002-03-22 | 2002-10-01 | Cripto-specific antibodies |
| CA2480119A CA2480119C (en) | 2002-03-22 | 2002-10-01 | Cripto-specific antibodies |
| DK02807155.3T DK1494693T3 (da) | 2002-03-22 | 2002-10-01 | Cripto-specifikke antistoffer |
| US10/693,538 US7531174B2 (en) | 2001-04-26 | 2003-10-23 | Cripto blocking antibodies and uses thereof |
| IS6999A IS2662B (is) | 2001-04-26 | 2003-10-24 | Mótefni sem blokka prótínið Cripto og notkun þeirra |
| NO20034805A NO20034805L (no) | 2001-04-26 | 2003-10-27 | CRIPTO-blokkerende antistoff samt anvendelse derav |
| BG108363A BG108363A (bg) | 2001-04-26 | 2003-11-14 | Крипто блокиращи антитела и тяхното използване |
| US10/945,853 US7582299B2 (en) | 2001-04-26 | 2004-09-20 | Cripto-specific antibodies |
| US11/799,361 US7674462B2 (en) | 2001-04-26 | 2007-04-30 | Cripto blocking antibodies and uses thereof |
| US12/317,476 US8003763B2 (en) | 2001-04-26 | 2008-12-22 | Cripto blocking antibodies and uses thereof |
| US12/353,913 US20090285818A1 (en) | 2001-04-26 | 2009-01-14 | Cripto Blocking Antibodies and Uses Thereof |
| JP2009020949A JP2009161539A (ja) | 2002-03-22 | 2009-01-30 | Cripto特異的抗体 |
| US12/415,659 US7888052B2 (en) | 2001-04-26 | 2009-03-31 | Cripto blocking antibodies and uses thereof |
| US13/213,499 US8673303B2 (en) | 2001-04-26 | 2011-08-19 | Cripto blocking antibodies and uses thereof |
Applications Claiming Priority (8)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US28678201P | 2001-04-26 | 2001-04-26 | |
| US60/286,782 | 2001-04-26 | ||
| US29302001P | 2001-05-17 | 2001-05-17 | |
| US60/293,020 | 2001-05-17 | ||
| US30109101P | 2001-06-26 | 2001-06-26 | |
| US60/301,091 | 2001-06-26 | ||
| US36700202P | 2002-03-22 | 2002-03-22 | |
| US60/367,002 | 2002-03-22 |
Related Child Applications (3)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2002/031462 Continuation WO2003083041A2 (en) | 2001-04-26 | 2002-10-01 | Cripto-specific antibodies |
| US10/693,538 Continuation US7531174B2 (en) | 2001-04-26 | 2003-10-23 | Cripto blocking antibodies and uses thereof |
| US10/945,853 Continuation US7582299B2 (en) | 2001-04-26 | 2004-09-20 | Cripto-specific antibodies |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2002088170A2 true WO2002088170A2 (en) | 2002-11-07 |
| WO2002088170A3 WO2002088170A3 (en) | 2003-12-24 |
Family
ID=27501437
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2002/011950 Ceased WO2002088170A2 (en) | 2000-03-20 | 2002-04-17 | Cripto blocking antibodies and uses thereof |
Country Status (33)
Cited By (97)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2005000899A2 (en) | 2003-06-27 | 2005-01-06 | Biogen Idec Ma Inc. | Modified binding molecules comprising connecting peptides |
| EP1494693A4 (en) * | 2002-03-22 | 2006-08-02 | Biogen Idec Inc | SPECIFIC ANTIBODIES TO CRIPTO |
| WO2006074397A3 (en) * | 2005-01-05 | 2006-12-28 | Biogen Idec Inc | Cripto binding molecules |
| US7318924B2 (en) | 2001-03-26 | 2008-01-15 | The Austin Research Institute | Antibodies against cancer |
| EP1670511A4 (en) * | 2003-09-15 | 2008-03-26 | Res Dev Foundation | CRIPTO ANTAGONISM OF ACTIVIN AND TGF-B SIGNALING |
| WO2008150530A3 (en) * | 2007-06-01 | 2009-02-19 | Biogen Idec Inc | Cripto binding molecules |
| US7531174B2 (en) | 2001-04-26 | 2009-05-12 | Biogen Idec Ma Inc. | Cripto blocking antibodies and uses thereof |
| US7582299B2 (en) | 2001-04-26 | 2009-09-01 | Biogen Idec Ma Inc. | Cripto-specific antibodies |
| EP2260858A2 (en) | 2003-11-06 | 2010-12-15 | Seattle Genetics, Inc. | Monomethylvaline compounds capable of conjugation to ligands |
| EP2286844A2 (en) | 2004-06-01 | 2011-02-23 | Genentech, Inc. | Antibody-drug conjugates and methods |
| WO2011031870A1 (en) | 2009-09-09 | 2011-03-17 | Centrose, Llc | Extracellular targeted drug conjugates |
| WO2011056983A1 (en) | 2009-11-05 | 2011-05-12 | Genentech, Inc. | Zirconium-radiolabeled, cysteine engineered antibody conjugates |
| WO2011130598A1 (en) | 2010-04-15 | 2011-10-20 | Spirogen Limited | Pyrrolobenzodiazepines and conjugates thereof |
| EP2385069A2 (en) | 2003-11-12 | 2011-11-09 | Biogen Idec MA Inc. | Neonatal Fc rReceptor (FcRn)- binding polypeptide variants, dimeric Fc binding proteins and methods related thereto |
| WO2011156328A1 (en) | 2010-06-08 | 2011-12-15 | Genentech, Inc. | Cysteine engineered antibodies and conjugates |
| US8084026B2 (en) | 2005-01-05 | 2011-12-27 | Biogen Idec Ma Inc. | Multispecific binding molecules comprising connecting peptides |
| WO2012074757A1 (en) | 2010-11-17 | 2012-06-07 | Genentech, Inc. | Alaninyl maytansinol antibody conjugates |
| WO2012143499A2 (de) | 2011-04-21 | 2012-10-26 | Bayer Intellectual Property Gmbh | Neue binder-wirkstoff konjugate (adcs) und ihre verwendung |
| WO2012155019A1 (en) | 2011-05-12 | 2012-11-15 | Genentech, Inc. | Multiple reaction monitoring lc-ms/ms method to detect therapeutic antibodies in animal samples using framework signature pepides |
| WO2013012733A1 (en) | 2011-07-15 | 2013-01-24 | Biogen Idec Ma Inc. | Heterodimeric fc regions, binding molecules comprising same, and methods relating thereto |
| WO2013130093A1 (en) | 2012-03-02 | 2013-09-06 | Genentech, Inc. | Biomarkers for treatment with anti-tubulin chemotherapeutic compounds |
| WO2014057074A1 (en) | 2012-10-12 | 2014-04-17 | Spirogen Sàrl | Pyrrolobenzodiazepines and conjugates thereof |
| WO2014140862A2 (en) | 2013-03-13 | 2014-09-18 | Spirogen Sarl | Pyrrolobenzodiazepines and conjugates thereof |
| WO2014140174A1 (en) | 2013-03-13 | 2014-09-18 | Spirogen Sàrl | Pyrrolobenzodiazepines and conjugates thereof |
| WO2014159981A2 (en) | 2013-03-13 | 2014-10-02 | Spirogen Sarl | Pyrrolobenzodiazepines and conjugates thereof |
| WO2015023355A1 (en) | 2013-08-12 | 2015-02-19 | Genentech, Inc. | 1-(chloromethyl)-2,3-dihydro-1h-benzo[e]indole dimer antibody-drug conjugate compounds, and methods of use and treatment |
| US8975037B2 (en) | 2006-07-28 | 2015-03-10 | Ann & Robert H. Lurie Children's Hospital of Chicago | Methods of inhibiting tumor cell aggressiveness using the microenvironment of human embryonic stem cells |
| WO2015095223A2 (en) | 2013-12-16 | 2015-06-25 | Genentech, Inc. | Peptidomimetic compounds and antibody-drug conjugates thereof |
| WO2015095227A2 (en) | 2013-12-16 | 2015-06-25 | Genentech, Inc. | Peptidomimetic compounds and antibody-drug conjugates thereof |
| WO2015095212A1 (en) | 2013-12-16 | 2015-06-25 | Genentech, Inc. | 1-(chloromethyl)-2,3-dihydro-1h-benzo[e]indole dimer antibody-drug conjugate compounds, and methods of use and treatment |
| WO2016037644A1 (en) | 2014-09-10 | 2016-03-17 | Medimmune Limited | Pyrrolobenzodiazepines and conjugates thereof |
| WO2016040825A1 (en) | 2014-09-12 | 2016-03-17 | Genentech, Inc. | Anthracycline disulfide intermediates, antibody-drug conjugates and methods |
| WO2016040856A2 (en) | 2014-09-12 | 2016-03-17 | Genentech, Inc. | Cysteine engineered antibodies and conjugates |
| WO2016090050A1 (en) | 2014-12-03 | 2016-06-09 | Genentech, Inc. | Quaternary amine compounds and antibody-drug conjugates thereof |
| WO2016161477A1 (en) * | 2015-04-07 | 2016-10-13 | Prince Henry's Institute Of Medical Research (Acn 132 025 024) | A method of treating neoplasias |
| EP3088004A1 (en) | 2004-09-23 | 2016-11-02 | Genentech, Inc. | Cysteine engineered antibodies and conjugates |
| WO2016207089A1 (de) | 2015-06-22 | 2016-12-29 | Bayer Pharma Aktiengesellschaft | Binder-wirkstoff-konjugate (adcs) und binder-prodrug-konjugate (apdcs) mit enzymatisch spaltbaren gruppen |
| WO2017059289A1 (en) | 2015-10-02 | 2017-04-06 | Genentech, Inc. | Pyrrolobenzodiazepine antibody drug conjugates and methods of use |
| WO2017060322A2 (en) | 2015-10-10 | 2017-04-13 | Bayer Pharma Aktiengesellschaft | Ptefb-inhibitor-adc |
| WO2017064675A1 (en) | 2015-10-16 | 2017-04-20 | Genentech, Inc. | Hindered disulfide drug conjugates |
| WO2017068511A1 (en) | 2015-10-20 | 2017-04-27 | Genentech, Inc. | Calicheamicin-antibody-drug conjugates and methods of use |
| WO2017165734A1 (en) | 2016-03-25 | 2017-09-28 | Genentech, Inc. | Multiplexed total antibody and antibody-conjugated drug quantification assay |
| WO2017162663A1 (de) | 2016-03-24 | 2017-09-28 | Bayer Pharma Aktiengesellschaft | Prodrugs von cytotoxischen wirkstoffen mit enzymatisch spaltbaren gruppen |
| EP3235820A1 (en) | 2014-09-17 | 2017-10-25 | Genentech, Inc. | Pyrrolobenzodiazepines and antibody disulfide conjugates thereof |
| WO2017201449A1 (en) | 2016-05-20 | 2017-11-23 | Genentech, Inc. | Protac antibody conjugates and methods of use |
| WO2017205741A1 (en) | 2016-05-27 | 2017-11-30 | Genentech, Inc. | Bioanalytical method for the characterization of site-specific antibody-drug conjugates |
| WO2017214024A1 (en) | 2016-06-06 | 2017-12-14 | Genentech, Inc. | Silvestrol antibody-drug conjugates and methods of use |
| WO2018031662A1 (en) | 2016-08-11 | 2018-02-15 | Genentech, Inc. | Pyrrolobenzodiazepine prodrugs and antibody conjugates thereof |
| US9919056B2 (en) | 2012-10-12 | 2018-03-20 | Adc Therapeutics S.A. | Pyrrolobenzodiazepine-anti-CD22 antibody conjugates |
| US9931415B2 (en) | 2012-10-12 | 2018-04-03 | Medimmune Limited | Pyrrolobenzodiazepine-antibody conjugates |
| US9931414B2 (en) | 2012-10-12 | 2018-04-03 | Medimmune Limited | Pyrrolobenzodiazepine-antibody conjugates |
| WO2018065501A1 (en) | 2016-10-05 | 2018-04-12 | F. Hoffmann-La Roche Ag | Methods for preparing antibody drug conjugates |
| US9950078B2 (en) | 2013-10-11 | 2018-04-24 | Medimmune Limited | Pyrrolobenzodiazepine-antibody conjugates |
| US9956299B2 (en) | 2013-10-11 | 2018-05-01 | Medimmune Limited | Pyrrolobenzodiazepine—antibody conjugates |
| WO2018114578A1 (de) | 2016-12-21 | 2018-06-28 | Bayer Pharma Aktiengesellschaft | Binder-wirkstoff-konjugate (adcs) mit enzymatisch spaltbaren gruppen |
| WO2018114798A1 (de) | 2016-12-21 | 2018-06-28 | Bayer Aktiengesellschaft | Prodrugs von cytotoxischen wirkstoffen mit enzymatisch spaltbaren gruppen |
| US10010624B2 (en) | 2013-10-11 | 2018-07-03 | Medimmune Limited | Pyrrolobenzodiazepine-antibody conjugates |
| US10022453B2 (en) | 2013-12-23 | 2018-07-17 | Bayer Pharma Aktiengesellschaft | Antibody drug conjugates (ADCs) with kinesin spindel protein (KSP) |
| US10029018B2 (en) | 2013-10-11 | 2018-07-24 | Medimmune Limited | Pyrrolobenzodiazepines and conjugates thereof |
| WO2019060398A1 (en) | 2017-09-20 | 2019-03-28 | Ph Pharma Co., Ltd. | ANALOGUES OF THAILANSTATINE |
| US10392393B2 (en) | 2016-01-26 | 2019-08-27 | Medimmune Limited | Pyrrolobenzodiazepines |
| US10420777B2 (en) | 2014-09-12 | 2019-09-24 | Medimmune Limited | Pyrrolobenzodiazepines and conjugates thereof |
| WO2019232449A1 (en) | 2018-06-01 | 2019-12-05 | Eisai R&D Management Co., Ltd. | Splicing modulator antibody-drug conjugates and methods of use |
| US10544223B2 (en) | 2017-04-20 | 2020-01-28 | Adc Therapeutics Sa | Combination therapy with an anti-axl antibody-drug conjugate |
| US10543279B2 (en) | 2016-04-29 | 2020-01-28 | Medimmune Limited | Pyrrolobenzodiazepine conjugates and their use for the treatment of cancer |
| WO2020049286A1 (en) | 2018-09-03 | 2020-03-12 | Femtogenix Limited | Polycyclic amides as cytotoxic agents |
| WO2020086858A1 (en) | 2018-10-24 | 2020-04-30 | Genentech, Inc. | Conjugated chemical inducers of degradation and methods of use |
| WO2020123275A1 (en) | 2018-12-10 | 2020-06-18 | Genentech, Inc. | Photocrosslinking peptides for site specific conjugation to fc-containing proteins |
| WO2020123836A2 (en) | 2018-12-13 | 2020-06-18 | Eisai R&D Management Co., Ltd. | Herboxidiene splicing modulator antibody-drug conjugates and methods of use |
| US10695433B2 (en) | 2012-10-12 | 2020-06-30 | Medimmune Limited | Pyrrolobenzodiazepine-antibody conjugates |
| US10695439B2 (en) | 2016-02-10 | 2020-06-30 | Medimmune Limited | Pyrrolobenzodiazepine conjugates |
| WO2020157491A1 (en) | 2019-01-29 | 2020-08-06 | Femtogenix Limited | G-a crosslinking cytotoxic agents |
| US10736903B2 (en) | 2012-10-12 | 2020-08-11 | Medimmune Limited | Pyrrolobenzodiazepine-anti-PSMA antibody conjugates |
| US10751346B2 (en) | 2012-10-12 | 2020-08-25 | Medimmune Limited | Pyrrolobenzodiazepine—anti-PSMA antibody conjugates |
| US10780096B2 (en) | 2014-11-25 | 2020-09-22 | Adc Therapeutics Sa | Pyrrolobenzodiazepine-antibody conjugates |
| US10799595B2 (en) | 2016-10-14 | 2020-10-13 | Medimmune Limited | Pyrrolobenzodiazepine conjugates |
| US11001636B2 (en) | 2016-06-15 | 2021-05-11 | Bayer Pharma Aktiengesellschaft | Specific antibody-drug-conjugates (ADCs) with KSP inhibitors and anti-CD123-antibodies |
| US11059893B2 (en) | 2015-04-15 | 2021-07-13 | Bergenbio Asa | Humanized anti-AXL antibodies |
| US11135303B2 (en) | 2011-10-14 | 2021-10-05 | Medimmune Limited | Pyrrolobenzodiazepines and conjugates thereof |
| US11160872B2 (en) | 2017-02-08 | 2021-11-02 | Adc Therapeutics Sa | Pyrrolobenzodiazepine-antibody conjugates |
| WO2022023735A1 (en) | 2020-07-28 | 2022-02-03 | Femtogenix Limited | Cytotoxic agents |
| US11318211B2 (en) | 2017-06-14 | 2022-05-03 | Adc Therapeutics Sa | Dosage regimes for the administration of an anti-CD19 ADC |
| US11352324B2 (en) | 2018-03-01 | 2022-06-07 | Medimmune Limited | Methods |
| US11370801B2 (en) | 2017-04-18 | 2022-06-28 | Medimmune Limited | Pyrrolobenzodiazepine conjugates |
| US11433140B2 (en) | 2016-12-21 | 2022-09-06 | Bayer Pharma Aktiengesellschaft | Specific antibody drug conjugates (ADCs) having KSP inhibitors |
| US11517626B2 (en) | 2016-02-10 | 2022-12-06 | Medimmune Limited | Pyrrolobenzodiazepine antibody conjugates |
| US11524969B2 (en) | 2018-04-12 | 2022-12-13 | Medimmune Limited | Pyrrolobenzodiazepines and conjugates thereof as antitumour agents |
| US11612665B2 (en) | 2017-02-08 | 2023-03-28 | Medimmune Limited | Pyrrolobenzodiazepine-antibody conjugates |
| WO2023078273A1 (en) | 2021-11-03 | 2023-05-11 | Hangzhou Dac Biotech Co., Ltd. | Specific conjugation for an antibody-drug conjugate |
| US11649250B2 (en) | 2017-08-18 | 2023-05-16 | Medimmune Limited | Pyrrolobenzodiazepine conjugates |
| US11702473B2 (en) | 2015-04-15 | 2023-07-18 | Medimmune Limited | Site-specific antibody-drug conjugates |
| WO2024138128A2 (en) | 2022-12-23 | 2024-06-27 | Genentech, Inc. | Cereblon degrader conjugates, and uses thereof |
| WO2024220546A2 (en) | 2023-04-17 | 2024-10-24 | Peak Bio, Inc. | Antibodies and antibody-drug conjugates and methods of use and synthetic processes and intermediates |
| US12209099B2 (en) | 2019-03-15 | 2025-01-28 | Medimmune Limited | Azetidobenzodiazepine dimers and conjugates comprising them for use in the treatment of cancer |
| US12269859B2 (en) | 2016-12-02 | 2025-04-08 | Angeles Therapeutics, Inc. | Synthetic immune receptors and methods of use thereof |
| WO2025132978A1 (en) * | 2023-12-19 | 2025-06-26 | BioNTech SE | Cfc1 binding molecule |
| WO2025132976A1 (en) * | 2023-12-19 | 2025-06-26 | BioNTech SE | Cfc1 binding molecule |
Families Citing this family (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20090123470A1 (en) * | 2001-03-26 | 2009-05-14 | The Macfarlane Burnet Istitute For Medical Research And Public Health Ltd. | Antibodies Against Cancer |
| JP2011522224A (ja) * | 2008-04-21 | 2011-07-28 | メルク・シャープ・エンド・ドーム・コーポレイション | 膵ベータ細胞質量生物マーカー |
| CN102272157B (zh) * | 2008-11-07 | 2015-11-25 | 研究发展基金会 | 用于抑制cripto/grp78复合物形成和信号的组合物和方法 |
| CA2830349C (en) | 2011-03-17 | 2019-07-16 | The University Of Birmingham | Re-directed immunotherapy |
| AU2013366493B2 (en) | 2012-12-21 | 2017-08-24 | Medimmune Limited | Pyrrolobenzodiazepines and conjugates thereof |
| US9567340B2 (en) | 2012-12-21 | 2017-02-14 | Medimmune Limited | Unsymmetrical pyrrolobenzodiazepines-dimers for use in the treatment of proliferative and autoimmune diseases |
| AU2019402097A1 (en) | 2018-12-17 | 2021-06-10 | Revitope Limited | Twin immune cell engager |
Family Cites Families (39)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| NZ207394A (en) * | 1983-03-08 | 1987-03-06 | Commw Serum Lab Commission | Detecting or determining sequence of amino acids |
| US4816567A (en) | 1983-04-08 | 1989-03-28 | Genentech, Inc. | Recombinant immunoglobin preparations |
| JP3040121B2 (ja) | 1988-01-12 | 2000-05-08 | ジェネンテク,インコーポレイテッド | 増殖因子レセプターの機能を阻害することにより腫瘍細胞を処置する方法 |
| US5530101A (en) * | 1988-12-28 | 1996-06-25 | Protein Design Labs, Inc. | Humanized immunoglobulins |
| US5208020A (en) | 1989-10-25 | 1993-05-04 | Immunogen Inc. | Cytotoxic agents comprising maytansinoids and their therapeutic use |
| US5780029A (en) | 1989-11-14 | 1998-07-14 | New York Medical College | Antidiotypic monoclonal antibodies for treatment of melanoma |
| US5859205A (en) | 1989-12-21 | 1999-01-12 | Celltech Limited | Humanised antibodies |
| US5256643A (en) | 1990-05-29 | 1993-10-26 | The Government Of The United States | Human cripto protein |
| KR100272077B1 (ko) | 1990-08-29 | 2000-11-15 | 젠팜인터내셔날,인코포레이티드 | 이종 항체를 생산할 수 있는 전이유전자를 가진 인간이외의 동물 |
| WO1994004679A1 (en) | 1991-06-14 | 1994-03-03 | Genentech, Inc. | Method for making humanized antibodies |
| US5264557A (en) | 1991-08-23 | 1993-11-23 | The United States Of America As Represented By The Department Of Health And Human Services | Polypeptide of a human cripto-related gene, CR-3 |
| US6063379A (en) | 1993-12-09 | 2000-05-16 | Centro De Inmunologia Molecular | Anti-idiotypic monoclonal antibodies and compositions including the anti-idiotypic monoclonal antibodies |
| US5981215A (en) * | 1995-06-06 | 1999-11-09 | Human Genome Sciences, Inc. | Human criptin growth factor |
| DE69738868D1 (de) * | 1996-05-22 | 2008-09-11 | Viventia Biotech Inc | Odieren, und deren verwendung zur vorbeugung und zum nachweis von krebs |
| IL125608A0 (en) | 1998-07-30 | 1999-03-12 | Yeda Res & Dev | Tumor associated antigen peptides and use of same as anti-tumor vaccines |
| WO2000037504A2 (en) | 1998-12-23 | 2000-06-29 | Pfizer Inc. | Human monoclonal antibodies to ctla-4 |
| US6335170B1 (en) * | 1999-02-22 | 2002-01-01 | Torben F. Orntoft | Gene expression in bladder tumors |
| WO2000058499A1 (fr) | 1999-03-30 | 2000-10-05 | Japan Tobacco Inc. | Procede pour la production d'anticorps monoclonal |
| WO2000063693A1 (en) * | 1999-04-20 | 2000-10-26 | Kokolus William J | Improved method of identifying and locating immunobiologically-active linear peptides |
| US6833268B1 (en) | 1999-06-10 | 2004-12-21 | Abgenix, Inc. | Transgenic animals for producing specific isotypes of human antibodies via non-cognate switch regions |
| JP2001046066A (ja) | 1999-08-03 | 2001-02-20 | Kyowa Hakko Kogyo Co Ltd | 新規な相補性決定領域を有するヒトvegf受容体kdrに対する抗体 |
| DK1226177T3 (da) | 1999-10-29 | 2008-10-06 | Genentech Inc | Antistofsammensætninger mod anti-prostata stamcelle-antigen (PSCA) og anvendelser deraf |
| US6663613B1 (en) | 2000-01-25 | 2003-12-16 | Bacchus Vascular, Inc. | System and methods for clot dissolution |
| DK1270595T3 (da) | 2000-03-03 | 2008-11-10 | Kyowa Hakko Kogyo Kk | Anti-CCR4-antistof og dets fragment |
| US6333410B1 (en) * | 2000-08-18 | 2001-12-25 | Immunogen, Inc. | Process for the preparation and purification of thiol-containing maytansinoids |
| GB0020953D0 (en) | 2000-08-24 | 2000-10-11 | Smithkline Beecham Biolog | Vaccine |
| AU9272401A (en) * | 2000-09-18 | 2002-03-26 | Biogen Inc | Cripto mutant and uses thereof |
| CA2434694C (en) | 2001-01-26 | 2012-09-18 | Caterina Bianco | Detection and quantification of cripto-1 |
| WO2002096948A2 (en) | 2001-01-29 | 2002-12-05 | Idec Pharmaceuticals Corporation | Engineered tetravalent antibodies and methods of use |
| NZ545176A (en) | 2001-01-29 | 2008-05-30 | Biogen Idec Inc | Modified antibodies reactive with CD20 and methods of use |
| AUPR395801A0 (en) | 2001-03-26 | 2001-04-26 | Austin Research Institute, The | Antibodies against cancer |
| US7582299B2 (en) * | 2001-04-26 | 2009-09-01 | Biogen Idec Ma Inc. | Cripto-specific antibodies |
| SK14432003A3 (sk) * | 2001-04-26 | 2004-07-07 | Biogen, Inc. | Protilátka špecifická pre Cripto, kompozícia obsahujúca takúto protilátku a jej použitie |
| KR101008758B1 (ko) * | 2001-09-18 | 2011-01-14 | 제넨테크, 인크. | 종양의 진단 및 치료를 위한 방법 및 이를 위한 조성물 |
| US20040014690A1 (en) * | 2002-02-13 | 2004-01-22 | Zhenkun Ma | Macrolides with activity against methicillin-resistant staphylococcus aureus |
| JP2005520566A (ja) * | 2002-03-22 | 2005-07-14 | バイオジェン・アイデック・エムエイ・インコーポレイテッド | Cripto特異的抗体 |
| CA2539116C (en) * | 2003-09-15 | 2014-11-18 | Research Development Foundation | Cripto antagonism of activin and tgf-b signaling |
| EP2311880A3 (en) * | 2005-01-05 | 2011-07-27 | Biogen Idec MA Inc. | Cripto binding molecules |
| US20100041032A1 (en) * | 2006-04-28 | 2010-02-18 | Biogen Idec Ma Inc. | Composition and methods for the detection of cripto-3 |
-
2002
- 2002-04-17 SK SK1443-2003A patent/SK14432003A3/sk not_active Application Discontinuation
- 2002-04-17 GE GE5415A patent/GEP20074091B/en unknown
- 2002-04-17 MX MXPA03009797A patent/MXPA03009797A/es active IP Right Grant
- 2002-04-17 AT AT02731384T patent/ATE420659T1/de active
- 2002-04-17 AT AT08158456T patent/ATE533508T1/de active
- 2002-04-17 CN CNB028128877A patent/CN100352501C/zh not_active Expired - Fee Related
- 2002-04-17 KR KR1020037014078A patent/KR100592357B1/ko not_active Expired - Fee Related
- 2002-04-17 SI SI200230804T patent/SI1390389T1/sl unknown
- 2002-04-17 EP EP10186149A patent/EP2316486A3/en not_active Withdrawn
- 2002-04-17 WO PCT/US2002/011950 patent/WO2002088170A2/en not_active Ceased
- 2002-04-17 DK DK02731384T patent/DK1390389T3/da active
- 2002-04-17 ES ES02731384T patent/ES2321065T3/es not_active Expired - Lifetime
- 2002-04-17 EP EP08158456A patent/EP1974749B1/en not_active Expired - Lifetime
- 2002-04-17 PL PL373513A patent/PL207087B1/pl unknown
- 2002-04-17 DE DE60230868T patent/DE60230868D1/de not_active Expired - Lifetime
- 2002-04-17 SG SG200600551-6A patent/SG157951A1/en unknown
- 2002-04-17 TR TR2003/01846T patent/TR200301846T2/xx unknown
- 2002-04-17 PT PT02731384T patent/PT1390389E/pt unknown
- 2002-04-17 RS RS20110024A patent/RS20110024A/sr unknown
- 2002-04-17 HU HU0501113A patent/HUP0501113A3/hu unknown
- 2002-04-17 EA EA200301158A patent/EA007469B1/ru not_active IP Right Cessation
- 2002-04-17 CZ CZ20033208A patent/CZ20033208A3/cs unknown
- 2002-04-17 RS YU84903A patent/RS51635B/sr unknown
- 2002-04-17 CA CA2443840A patent/CA2443840C/en not_active Expired - Fee Related
- 2002-04-17 EP EP02731384A patent/EP1390389B1/en not_active Expired - Lifetime
- 2002-04-17 CA CA2715570A patent/CA2715570A1/en not_active Abandoned
- 2002-04-17 JP JP2002585468A patent/JP4307845B2/ja not_active Expired - Fee Related
- 2002-04-17 NZ NZ566268A patent/NZ566268A/en not_active IP Right Cessation
- 2002-04-17 BR BRPI0209254-9A patent/BR0209254A/pt not_active IP Right Cessation
- 2002-04-17 EE EEP200300528A patent/EE200300528A/xx unknown
- 2002-04-23 MY MYPI2010003173A patent/MY150237A/en unknown
- 2002-04-23 MY MYPI20021484A patent/MY157382A/en unknown
- 2002-04-24 AR ARP020101492A patent/AR037223A1/es active IP Right Grant
-
2003
- 2003-10-23 US US10/693,538 patent/US7531174B2/en not_active Expired - Lifetime
- 2003-10-24 IS IS6999A patent/IS2662B/is unknown
- 2003-10-27 NO NO20034805A patent/NO20034805L/no not_active Application Discontinuation
- 2003-11-14 BG BG108363A patent/BG108363A/bg unknown
-
2005
- 2005-07-11 JP JP2005202361A patent/JP2005314436A/ja active Pending
-
2007
- 2007-04-30 US US11/799,361 patent/US7674462B2/en not_active Expired - Lifetime
-
2008
- 2008-12-22 US US12/317,476 patent/US8003763B2/en not_active Expired - Lifetime
-
2009
- 2009-01-14 US US12/353,913 patent/US20090285818A1/en not_active Abandoned
- 2009-02-05 JP JP2009025420A patent/JP4575983B2/ja not_active Expired - Fee Related
- 2009-03-31 US US12/415,659 patent/US7888052B2/en not_active Expired - Lifetime
- 2009-04-08 CY CY20091100413T patent/CY1108960T1/el unknown
- 2009-07-08 AR ARP090102597A patent/AR072554A2/es not_active Application Discontinuation
- 2009-12-22 CL CL2009002199A patent/CL2009002199A1/es unknown
-
2010
- 2010-02-15 JP JP2010030683A patent/JP2010163438A/ja not_active Withdrawn
- 2010-07-16 AR ARP100102604A patent/AR077759A2/es not_active Application Discontinuation
-
2011
- 2011-08-19 US US13/213,499 patent/US8673303B2/en not_active Expired - Lifetime
Non-Patent Citations (6)
| Title |
|---|
| BALDASSARRE ET AL., INT. J. CANCER, vol. 66, 1996, pages 538 - 543 |
| CIARDIELLO ET AL., ONCOGENE, vol. 9, 1994, pages 291 - 298 |
| MINCHIOTTI, MECH. DEV., vol. 90, 2000, pages 133 - 142 |
| SAIJOH ET AL., MOL. CELL, vol. 5, 2000, pages 35 - 47 |
| SALOMON ET AL., BIOESSAYS, vol. 21, 1999, pages 61 - 70 |
| SCHIFFERLI ET AL., FOCUS, vol. 21, 1999, pages 16 |
Cited By (143)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US7318924B2 (en) | 2001-03-26 | 2008-01-15 | The Austin Research Institute | Antibodies against cancer |
| US8673303B2 (en) | 2001-04-26 | 2014-03-18 | Biogen Idec Ma Inc. | Cripto blocking antibodies and uses thereof |
| US7888052B2 (en) | 2001-04-26 | 2011-02-15 | Biogen Idec Ma Inc. | Cripto blocking antibodies and uses thereof |
| US8003763B2 (en) | 2001-04-26 | 2011-08-23 | Biogen Idec Ma Inc. | Cripto blocking antibodies and uses thereof |
| US7674462B2 (en) | 2001-04-26 | 2010-03-09 | Biogen Idec Ma Inc. | Cripto blocking antibodies and uses thereof |
| US7531174B2 (en) | 2001-04-26 | 2009-05-12 | Biogen Idec Ma Inc. | Cripto blocking antibodies and uses thereof |
| US7582299B2 (en) | 2001-04-26 | 2009-09-01 | Biogen Idec Ma Inc. | Cripto-specific antibodies |
| EP1494693A4 (en) * | 2002-03-22 | 2006-08-02 | Biogen Idec Inc | SPECIFIC ANTIBODIES TO CRIPTO |
| US7700097B2 (en) | 2003-06-27 | 2010-04-20 | Biogen Idec Ma Inc. | Purification and preferential synthesis of binding molecules |
| WO2005000899A2 (en) | 2003-06-27 | 2005-01-06 | Biogen Idec Ma Inc. | Modified binding molecules comprising connecting peptides |
| US8603473B2 (en) | 2003-06-27 | 2013-12-10 | Biogen Idec Ma Inc. | Modified binding molecules comprising connecting peptides |
| US7820620B2 (en) | 2003-09-15 | 2010-10-26 | Research Development Foundation | Cripto antagonism of activin and TGF-b signaling |
| US9546210B2 (en) | 2003-09-15 | 2017-01-17 | Research Development Foundation | Cripto antagonism of activin and TGF-b signaling |
| AU2004274433B2 (en) * | 2003-09-15 | 2010-08-12 | Research Development Foundation | Cripto antagonism of activin and TGF-beta signaling |
| EP1670511A4 (en) * | 2003-09-15 | 2008-03-26 | Res Dev Foundation | CRIPTO ANTAGONISM OF ACTIVIN AND TGF-B SIGNALING |
| EP2260858A2 (en) | 2003-11-06 | 2010-12-15 | Seattle Genetics, Inc. | Monomethylvaline compounds capable of conjugation to ligands |
| EP3434275A1 (en) | 2003-11-06 | 2019-01-30 | Seattle Genetics, Inc. | Assay for cancer cells based on the use of auristatin conjugates with antibodies |
| EP3858387A1 (en) | 2003-11-06 | 2021-08-04 | Seagen Inc. | Monomethylvaline compounds capable of conjugation to ligands |
| EP2489364A1 (en) | 2003-11-06 | 2012-08-22 | Seattle Genetics, Inc. | Monomethylvaline compounds onjugated to antibodies |
| EP2486933A1 (en) | 2003-11-06 | 2012-08-15 | Seattle Genetics, Inc. | Monomethylvaline compounds conjugated with antibodies |
| EP2478912A1 (en) | 2003-11-06 | 2012-07-25 | Seattle Genetics, Inc. | Auristatin conjugates with anti-HER2 or anti-CD22 antibodies and their use in therapy |
| EP2385069A2 (en) | 2003-11-12 | 2011-11-09 | Biogen Idec MA Inc. | Neonatal Fc rReceptor (FcRn)- binding polypeptide variants, dimeric Fc binding proteins and methods related thereto |
| EP2286844A2 (en) | 2004-06-01 | 2011-02-23 | Genentech, Inc. | Antibody-drug conjugates and methods |
| EP3088004A1 (en) | 2004-09-23 | 2016-11-02 | Genentech, Inc. | Cysteine engineered antibodies and conjugates |
| US8021661B2 (en) | 2005-01-05 | 2011-09-20 | Biogen Idec Ma Inc. | Cripto binding molecules |
| EP2311880A2 (en) | 2005-01-05 | 2011-04-20 | Biogen Idec MA Inc. | Cripto binding molecules |
| US8084026B2 (en) | 2005-01-05 | 2011-12-27 | Biogen Idec Ma Inc. | Multispecific binding molecules comprising connecting peptides |
| WO2006074397A3 (en) * | 2005-01-05 | 2006-12-28 | Biogen Idec Inc | Cripto binding molecules |
| EP2311881A2 (en) | 2005-01-05 | 2011-04-20 | Biogen Idec MA Inc. | Cripto binding molecules |
| EP2311880A3 (en) * | 2005-01-05 | 2011-07-27 | Biogen Idec MA Inc. | Cripto binding molecules |
| EP2311881A3 (en) * | 2005-01-05 | 2011-07-27 | Biogen Idec MA Inc. | Cripto binding molecules |
| CN101137673B (zh) * | 2005-01-05 | 2013-12-04 | 比奥根艾迪克Ma公司 | Cripto结合分子 |
| US8975037B2 (en) | 2006-07-28 | 2015-03-10 | Ann & Robert H. Lurie Children's Hospital of Chicago | Methods of inhibiting tumor cell aggressiveness using the microenvironment of human embryonic stem cells |
| WO2008150530A3 (en) * | 2007-06-01 | 2009-02-19 | Biogen Idec Inc | Cripto binding molecules |
| WO2011031870A1 (en) | 2009-09-09 | 2011-03-17 | Centrose, Llc | Extracellular targeted drug conjugates |
| WO2011056983A1 (en) | 2009-11-05 | 2011-05-12 | Genentech, Inc. | Zirconium-radiolabeled, cysteine engineered antibody conjugates |
| WO2011130598A1 (en) | 2010-04-15 | 2011-10-20 | Spirogen Limited | Pyrrolobenzodiazepines and conjugates thereof |
| WO2011156328A1 (en) | 2010-06-08 | 2011-12-15 | Genentech, Inc. | Cysteine engineered antibodies and conjugates |
| WO2012074757A1 (en) | 2010-11-17 | 2012-06-07 | Genentech, Inc. | Alaninyl maytansinol antibody conjugates |
| WO2012143499A2 (de) | 2011-04-21 | 2012-10-26 | Bayer Intellectual Property Gmbh | Neue binder-wirkstoff konjugate (adcs) und ihre verwendung |
| WO2012143496A2 (de) | 2011-04-21 | 2012-10-26 | Bayer Intellectual Property Gmbh | Neue binder-wirkstoff konjugate (adcs) und ihre verwendung |
| WO2012155019A1 (en) | 2011-05-12 | 2012-11-15 | Genentech, Inc. | Multiple reaction monitoring lc-ms/ms method to detect therapeutic antibodies in animal samples using framework signature pepides |
| WO2013012733A1 (en) | 2011-07-15 | 2013-01-24 | Biogen Idec Ma Inc. | Heterodimeric fc regions, binding molecules comprising same, and methods relating thereto |
| US11135303B2 (en) | 2011-10-14 | 2021-10-05 | Medimmune Limited | Pyrrolobenzodiazepines and conjugates thereof |
| WO2013130093A1 (en) | 2012-03-02 | 2013-09-06 | Genentech, Inc. | Biomarkers for treatment with anti-tubulin chemotherapeutic compounds |
| US9931415B2 (en) | 2012-10-12 | 2018-04-03 | Medimmune Limited | Pyrrolobenzodiazepine-antibody conjugates |
| US11779650B2 (en) | 2012-10-12 | 2023-10-10 | Medimmune Limited | Pyrrolobenzodiazepine-antibody conjugates |
| US10722594B2 (en) | 2012-10-12 | 2020-07-28 | Adc Therapeutics S.A. | Pyrrolobenzodiazepine-anti-CD22 antibody conjugates |
| US10695433B2 (en) | 2012-10-12 | 2020-06-30 | Medimmune Limited | Pyrrolobenzodiazepine-antibody conjugates |
| US10751346B2 (en) | 2012-10-12 | 2020-08-25 | Medimmune Limited | Pyrrolobenzodiazepine—anti-PSMA antibody conjugates |
| US10646584B2 (en) | 2012-10-12 | 2020-05-12 | Medimmune Limited | Pyrrolobenzodiazepines and conjugates thereof |
| US10780181B2 (en) | 2012-10-12 | 2020-09-22 | Medimmune Limited | Pyrrolobenzodiazepine-antibody conjugates |
| US10799596B2 (en) | 2012-10-12 | 2020-10-13 | Adc Therapeutics S.A. | Pyrrolobenzodiazepine-antibody conjugates |
| US10994023B2 (en) | 2012-10-12 | 2021-05-04 | Medimmune Limited | Pyrrolobenzodiazepines and conjugates thereof |
| EP2839860A1 (en) | 2012-10-12 | 2015-02-25 | Spirogen Sàrl | Pyrrolobenzodiazepines and conjugates thereof |
| US10335497B2 (en) | 2012-10-12 | 2019-07-02 | Medimmune Limited | Pyrrolobenzodiazepines and conjugates thereof |
| US10736903B2 (en) | 2012-10-12 | 2020-08-11 | Medimmune Limited | Pyrrolobenzodiazepine-anti-PSMA antibody conjugates |
| WO2014057074A1 (en) | 2012-10-12 | 2014-04-17 | Spirogen Sàrl | Pyrrolobenzodiazepines and conjugates thereof |
| US11690918B2 (en) | 2012-10-12 | 2023-07-04 | Medimmune Limited | Pyrrolobenzodiazepine-anti-CD22 antibody conjugates |
| US9931414B2 (en) | 2012-10-12 | 2018-04-03 | Medimmune Limited | Pyrrolobenzodiazepine-antibody conjugates |
| US9919056B2 (en) | 2012-10-12 | 2018-03-20 | Adc Therapeutics S.A. | Pyrrolobenzodiazepine-anti-CD22 antibody conjugates |
| US11701430B2 (en) | 2012-10-12 | 2023-07-18 | Medimmune Limited | Pyrrolobenzodiazepines and conjugates thereof |
| US12121590B2 (en) | 2012-10-12 | 2024-10-22 | Medimmune Limited | Pyrrolobenzodiazepines and conjugates thereof |
| US9889207B2 (en) | 2012-10-12 | 2018-02-13 | Medimmune Limited | Pyrrolobenzodiazepines and conjugates thereof |
| US11771775B2 (en) | 2012-10-12 | 2023-10-03 | Medimmune Limited | Pyrrolobenzodiazepine-antibody conjugates |
| WO2014140174A1 (en) | 2013-03-13 | 2014-09-18 | Spirogen Sàrl | Pyrrolobenzodiazepines and conjugates thereof |
| WO2014159981A2 (en) | 2013-03-13 | 2014-10-02 | Spirogen Sarl | Pyrrolobenzodiazepines and conjugates thereof |
| WO2014140862A2 (en) | 2013-03-13 | 2014-09-18 | Spirogen Sarl | Pyrrolobenzodiazepines and conjugates thereof |
| WO2015023355A1 (en) | 2013-08-12 | 2015-02-19 | Genentech, Inc. | 1-(chloromethyl)-2,3-dihydro-1h-benzo[e]indole dimer antibody-drug conjugate compounds, and methods of use and treatment |
| US10010624B2 (en) | 2013-10-11 | 2018-07-03 | Medimmune Limited | Pyrrolobenzodiazepine-antibody conjugates |
| US9950078B2 (en) | 2013-10-11 | 2018-04-24 | Medimmune Limited | Pyrrolobenzodiazepine-antibody conjugates |
| US9956299B2 (en) | 2013-10-11 | 2018-05-01 | Medimmune Limited | Pyrrolobenzodiazepine—antibody conjugates |
| US10029018B2 (en) | 2013-10-11 | 2018-07-24 | Medimmune Limited | Pyrrolobenzodiazepines and conjugates thereof |
| WO2015095227A2 (en) | 2013-12-16 | 2015-06-25 | Genentech, Inc. | Peptidomimetic compounds and antibody-drug conjugates thereof |
| WO2015095223A2 (en) | 2013-12-16 | 2015-06-25 | Genentech, Inc. | Peptidomimetic compounds and antibody-drug conjugates thereof |
| WO2015095212A1 (en) | 2013-12-16 | 2015-06-25 | Genentech, Inc. | 1-(chloromethyl)-2,3-dihydro-1h-benzo[e]indole dimer antibody-drug conjugate compounds, and methods of use and treatment |
| US10022453B2 (en) | 2013-12-23 | 2018-07-17 | Bayer Pharma Aktiengesellschaft | Antibody drug conjugates (ADCs) with kinesin spindel protein (KSP) |
| US10188746B2 (en) | 2014-09-10 | 2019-01-29 | Medimmune Limited | Pyrrolobenzodiazepines and conjugates thereof |
| WO2016037644A1 (en) | 2014-09-10 | 2016-03-17 | Medimmune Limited | Pyrrolobenzodiazepines and conjugates thereof |
| WO2016040825A1 (en) | 2014-09-12 | 2016-03-17 | Genentech, Inc. | Anthracycline disulfide intermediates, antibody-drug conjugates and methods |
| WO2016040856A2 (en) | 2014-09-12 | 2016-03-17 | Genentech, Inc. | Cysteine engineered antibodies and conjugates |
| US10420777B2 (en) | 2014-09-12 | 2019-09-24 | Medimmune Limited | Pyrrolobenzodiazepines and conjugates thereof |
| EP3235820A1 (en) | 2014-09-17 | 2017-10-25 | Genentech, Inc. | Pyrrolobenzodiazepines and antibody disulfide conjugates thereof |
| US10780096B2 (en) | 2014-11-25 | 2020-09-22 | Adc Therapeutics Sa | Pyrrolobenzodiazepine-antibody conjugates |
| WO2016090050A1 (en) | 2014-12-03 | 2016-06-09 | Genentech, Inc. | Quaternary amine compounds and antibody-drug conjugates thereof |
| WO2016161477A1 (en) * | 2015-04-07 | 2016-10-13 | Prince Henry's Institute Of Medical Research (Acn 132 025 024) | A method of treating neoplasias |
| US11702473B2 (en) | 2015-04-15 | 2023-07-18 | Medimmune Limited | Site-specific antibody-drug conjugates |
| US11059893B2 (en) | 2015-04-15 | 2021-07-13 | Bergenbio Asa | Humanized anti-AXL antibodies |
| US11123439B2 (en) | 2015-06-22 | 2021-09-21 | Bayer Pharma Aktiengesellschaft | Antibody drug conjugates (ADCS) and antibody prodrug conjugates (APDCS) with enzymatically cleavable groups |
| WO2016207089A1 (de) | 2015-06-22 | 2016-12-29 | Bayer Pharma Aktiengesellschaft | Binder-wirkstoff-konjugate (adcs) und binder-prodrug-konjugate (apdcs) mit enzymatisch spaltbaren gruppen |
| EP4406606A2 (de) | 2015-06-22 | 2024-07-31 | Bayer Pharma Aktiengesellschaft | Binder-wirkstoff-konjugate (adcs) und binder-prodrug-konjugate (apdcs) mit enzymatisch spaltbaren g |
| US12144865B2 (en) | 2015-06-22 | 2024-11-19 | Bayer Pharma Aktiengesellschaft | Antibody drug conjugates with enzymatically cleavable groups |
| WO2017059289A1 (en) | 2015-10-02 | 2017-04-06 | Genentech, Inc. | Pyrrolobenzodiazepine antibody drug conjugates and methods of use |
| WO2017060322A2 (en) | 2015-10-10 | 2017-04-13 | Bayer Pharma Aktiengesellschaft | Ptefb-inhibitor-adc |
| WO2017064675A1 (en) | 2015-10-16 | 2017-04-20 | Genentech, Inc. | Hindered disulfide drug conjugates |
| WO2017068511A1 (en) | 2015-10-20 | 2017-04-27 | Genentech, Inc. | Calicheamicin-antibody-drug conjugates and methods of use |
| US10392393B2 (en) | 2016-01-26 | 2019-08-27 | Medimmune Limited | Pyrrolobenzodiazepines |
| US10695439B2 (en) | 2016-02-10 | 2020-06-30 | Medimmune Limited | Pyrrolobenzodiazepine conjugates |
| US11517626B2 (en) | 2016-02-10 | 2022-12-06 | Medimmune Limited | Pyrrolobenzodiazepine antibody conjugates |
| US11685714B2 (en) | 2016-03-24 | 2023-06-27 | Bayer Pharma Aktiengesellschaft | Prodrugs of cytotoxic active agents having enzymatically cleavable groups |
| WO2017162663A1 (de) | 2016-03-24 | 2017-09-28 | Bayer Pharma Aktiengesellschaft | Prodrugs von cytotoxischen wirkstoffen mit enzymatisch spaltbaren gruppen |
| WO2017165734A1 (en) | 2016-03-25 | 2017-09-28 | Genentech, Inc. | Multiplexed total antibody and antibody-conjugated drug quantification assay |
| EP4273551A2 (en) | 2016-03-25 | 2023-11-08 | F. Hoffmann-La Roche AG | Multiplexed total antibody and antibody-conjugated drug quantification assay |
| US10543279B2 (en) | 2016-04-29 | 2020-01-28 | Medimmune Limited | Pyrrolobenzodiazepine conjugates and their use for the treatment of cancer |
| WO2017201449A1 (en) | 2016-05-20 | 2017-11-23 | Genentech, Inc. | Protac antibody conjugates and methods of use |
| WO2017205741A1 (en) | 2016-05-27 | 2017-11-30 | Genentech, Inc. | Bioanalytical method for the characterization of site-specific antibody-drug conjugates |
| WO2017214024A1 (en) | 2016-06-06 | 2017-12-14 | Genentech, Inc. | Silvestrol antibody-drug conjugates and methods of use |
| US11001636B2 (en) | 2016-06-15 | 2021-05-11 | Bayer Pharma Aktiengesellschaft | Specific antibody-drug-conjugates (ADCs) with KSP inhibitors and anti-CD123-antibodies |
| US11643469B2 (en) | 2016-06-15 | 2023-05-09 | Bayer Pharma Aktiengesellschaft | Specific antibody-drug-conjugates (ADCs) with KSP inhibitors and anti-CD123-antibodies |
| WO2018031662A1 (en) | 2016-08-11 | 2018-02-15 | Genentech, Inc. | Pyrrolobenzodiazepine prodrugs and antibody conjugates thereof |
| WO2018065501A1 (en) | 2016-10-05 | 2018-04-12 | F. Hoffmann-La Roche Ag | Methods for preparing antibody drug conjugates |
| US10799595B2 (en) | 2016-10-14 | 2020-10-13 | Medimmune Limited | Pyrrolobenzodiazepine conjugates |
| US12269859B2 (en) | 2016-12-02 | 2025-04-08 | Angeles Therapeutics, Inc. | Synthetic immune receptors and methods of use thereof |
| WO2018114798A1 (de) | 2016-12-21 | 2018-06-28 | Bayer Aktiengesellschaft | Prodrugs von cytotoxischen wirkstoffen mit enzymatisch spaltbaren gruppen |
| US11660351B2 (en) | 2016-12-21 | 2023-05-30 | Bayer Aktiengesellschaft | Antibody drug conjugates (ADCs) having enzymatically cleavable groups |
| US11433140B2 (en) | 2016-12-21 | 2022-09-06 | Bayer Pharma Aktiengesellschaft | Specific antibody drug conjugates (ADCs) having KSP inhibitors |
| US11478554B2 (en) | 2016-12-21 | 2022-10-25 | Bayer Pharma Aktiengesellschaft | Antibody drug conjugates (ADCS) having enzymatically cleavable groups |
| US12059472B2 (en) | 2016-12-21 | 2024-08-13 | Bayer Aktiengesellschaft | Prodrugs of cytotoxic active agents having enzymatically cleavable groups |
| WO2018114578A1 (de) | 2016-12-21 | 2018-06-28 | Bayer Pharma Aktiengesellschaft | Binder-wirkstoff-konjugate (adcs) mit enzymatisch spaltbaren gruppen |
| US11612665B2 (en) | 2017-02-08 | 2023-03-28 | Medimmune Limited | Pyrrolobenzodiazepine-antibody conjugates |
| US11813335B2 (en) | 2017-02-08 | 2023-11-14 | Medimmune Limited | Pyrrolobenzodiazepine-antibody conjugates |
| US11160872B2 (en) | 2017-02-08 | 2021-11-02 | Adc Therapeutics Sa | Pyrrolobenzodiazepine-antibody conjugates |
| US11370801B2 (en) | 2017-04-18 | 2022-06-28 | Medimmune Limited | Pyrrolobenzodiazepine conjugates |
| US10544223B2 (en) | 2017-04-20 | 2020-01-28 | Adc Therapeutics Sa | Combination therapy with an anti-axl antibody-drug conjugate |
| US11318211B2 (en) | 2017-06-14 | 2022-05-03 | Adc Therapeutics Sa | Dosage regimes for the administration of an anti-CD19 ADC |
| US11938192B2 (en) | 2017-06-14 | 2024-03-26 | Medimmune Limited | Dosage regimes for the administration of an anti-CD19 ADC |
| US11649250B2 (en) | 2017-08-18 | 2023-05-16 | Medimmune Limited | Pyrrolobenzodiazepine conjugates |
| WO2019060398A1 (en) | 2017-09-20 | 2019-03-28 | Ph Pharma Co., Ltd. | ANALOGUES OF THAILANSTATINE |
| US11352324B2 (en) | 2018-03-01 | 2022-06-07 | Medimmune Limited | Methods |
| US11524969B2 (en) | 2018-04-12 | 2022-12-13 | Medimmune Limited | Pyrrolobenzodiazepines and conjugates thereof as antitumour agents |
| WO2019232449A1 (en) | 2018-06-01 | 2019-12-05 | Eisai R&D Management Co., Ltd. | Splicing modulator antibody-drug conjugates and methods of use |
| WO2020049286A1 (en) | 2018-09-03 | 2020-03-12 | Femtogenix Limited | Polycyclic amides as cytotoxic agents |
| WO2020086858A1 (en) | 2018-10-24 | 2020-04-30 | Genentech, Inc. | Conjugated chemical inducers of degradation and methods of use |
| WO2020123275A1 (en) | 2018-12-10 | 2020-06-18 | Genentech, Inc. | Photocrosslinking peptides for site specific conjugation to fc-containing proteins |
| WO2020123836A2 (en) | 2018-12-13 | 2020-06-18 | Eisai R&D Management Co., Ltd. | Herboxidiene splicing modulator antibody-drug conjugates and methods of use |
| WO2020157491A1 (en) | 2019-01-29 | 2020-08-06 | Femtogenix Limited | G-a crosslinking cytotoxic agents |
| US12209099B2 (en) | 2019-03-15 | 2025-01-28 | Medimmune Limited | Azetidobenzodiazepine dimers and conjugates comprising them for use in the treatment of cancer |
| WO2022023735A1 (en) | 2020-07-28 | 2022-02-03 | Femtogenix Limited | Cytotoxic agents |
| WO2023078273A1 (en) | 2021-11-03 | 2023-05-11 | Hangzhou Dac Biotech Co., Ltd. | Specific conjugation for an antibody-drug conjugate |
| WO2024138128A2 (en) | 2022-12-23 | 2024-06-27 | Genentech, Inc. | Cereblon degrader conjugates, and uses thereof |
| WO2024220546A2 (en) | 2023-04-17 | 2024-10-24 | Peak Bio, Inc. | Antibodies and antibody-drug conjugates and methods of use and synthetic processes and intermediates |
| WO2025132978A1 (en) * | 2023-12-19 | 2025-06-26 | BioNTech SE | Cfc1 binding molecule |
| WO2025132976A1 (en) * | 2023-12-19 | 2025-06-26 | BioNTech SE | Cfc1 binding molecule |
Also Published As
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US7888052B2 (en) | Cripto blocking antibodies and uses thereof | |
| EP1494693B1 (en) | Cripto-specific antibodies | |
| US7582299B2 (en) | Cripto-specific antibodies | |
| AU2007200809B2 (en) | Cripto Blocking Antibodies and Uses Thereof | |
| AU2002303364A1 (en) | Cripto blocking antibodies and uses thereof | |
| CA2480119C (en) | Cripto-specific antibodies | |
| HK1058935B (en) | Cripto blocking antibodies and uses thereof | |
| HK1122509A (en) | Cripto blocking antibodies and uses thereof | |
| AU2010202840A1 (en) | Cripto Blocking Antibodies and Uses Thereof | |
| NZ578287A (en) | Cripto blocking antibodies and uses thereof | |
| HK1155081A (en) | Cripto blocking antibodies and uses thereof | |
| ZA200606338B (en) | Cripto blocking antibodies and uses thereof | |
| HK1072381B (en) | Cripto-specific antibodies |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| WWE | Wipo information: entry into national phase |
Ref document number: P-849/03 Country of ref document: YU |
|
| AK | Designated states |
Kind code of ref document: A2 Designated state(s): AE AG AL AM AT AU AZ BA BB BG BR BY BZ CA CH CN CO CR CU CZ DE DK DM DZ EC EE ES FI GB GD GE GH GM HR HU ID IL IN IS JP KE KG KP KR KZ LC LK LR LS LT LU LV MA MD MG MK MN MW MX MZ NO NZ OM PH PL PT RO RU SD SE SG SI SK SL TJ TM TN TR TT TZ UA UG US UZ VN YU ZA ZM ZW |
|
| AL | Designated countries for regional patents |
Kind code of ref document: A2 Designated state(s): GH GM KE LS MW MZ SD SL SZ TZ UG ZM ZW AM AZ BY KG KZ MD RU TJ TM AT BE CH CY DE DK ES FI FR GB GR IE IT LU MC NL PT SE TR BF BJ CF CG CI CM GA GN GQ GW ML MR NE SN TD TG |
|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application | ||
| WWE | Wipo information: entry into national phase |
Ref document number: 10693538 Country of ref document: US Ref document number: 2443840 Country of ref document: CA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: PA/a/2003/009797 Country of ref document: MX Ref document number: 373513 Country of ref document: PL Ref document number: 1-2003-501076 Country of ref document: PH |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2002585468 Country of ref document: JP Ref document number: 2003/01846 Country of ref document: TR Ref document number: 1020037014078 Country of ref document: KR |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 01888/DELNP/2003 Country of ref document: IN |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 200308862 Country of ref document: ZA |
|
| ENP | Entry into the national phase |
Ref document number: 10836302 Country of ref document: BG Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 14432003 Country of ref document: SK |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 529710 Country of ref document: NZ Ref document number: 2002731384 Country of ref document: EP Ref document number: PV2003-3208 Country of ref document: CZ |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2002303364 Country of ref document: AU Ref document number: 200301158 Country of ref document: EA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 7196 Country of ref document: GE Ref document number: 5415 Country of ref document: GE |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 028128877 Country of ref document: CN |
|
| WWP | Wipo information: published in national office |
Ref document number: 2002731384 Country of ref document: EP |
|
| REG | Reference to national code |
Ref country code: DE Ref legal event code: 8642 |
|
| WWP | Wipo information: published in national office |
Ref document number: PV2003-3208 Country of ref document: CZ |
|
| DFPE | Request for preliminary examination filed prior to expiration of 19th month from priority date (pct application filed before 20040101) | ||
| ENP | Entry into the national phase |
Ref document number: PI0209254 Country of ref document: BR |