WO1996027610A1 - Nucleotide and protein sequences of vertebrate serrate genes and methods based thereon - Google Patents

Nucleotide and protein sequences of vertebrate serrate genes and methods based thereon Download PDF

Info

Publication number
WO1996027610A1
WO1996027610A1 PCT/US1996/003172 US9603172W WO9627610A1 WO 1996027610 A1 WO1996027610 A1 WO 1996027610A1 US 9603172 W US9603172 W US 9603172W WO 9627610 A1 WO9627610 A1 WO 9627610A1
Authority
WO
WIPO (PCT)
Prior art keywords
serrate
protein
gly
cys
ser
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US1996/003172
Other languages
English (en)
French (fr)
Inventor
David Ish-Horowicz
Domingos M. P. Henrique
Julian H. Lewis
Anna M. Myat
Spyridon Artavanis-Tsakonas
Robert S. Mann
Grace E. Gray
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Cancer Research Horizons Ltd
Yale University
Original Assignee
Imperial Cancer Research Technology Ltd
Yale University
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Imperial Cancer Research Technology Ltd, Yale University filed Critical Imperial Cancer Research Technology Ltd
Priority to AT96911262T priority Critical patent/ATE442381T1/de
Priority to EP96911262A priority patent/EP0813545B1/en
Priority to DK96911262T priority patent/DK0813545T3/da
Priority to DE69638022T priority patent/DE69638022D1/de
Priority to AU54202/96A priority patent/AU718955B2/en
Priority to CA2214830A priority patent/CA2214830C/en
Priority to JP8527061A priority patent/JPH11507203A/ja
Publication of WO1996027610A1 publication Critical patent/WO1996027610A1/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/46Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • C07K14/465Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from birds
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00Drugs for disorders of the alimentary tract or the digestive system
    • A61P1/16Drugs for disorders of the alimentary tract or the digestive system for liver or gallbladder disorders, e.g. hepatoprotective agents, cholagogues, litholytics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P17/00Drugs for dermatological disorders
    • A61P17/02Drugs for dermatological disorders for treating wounds, ulcers, burns, scars, keloids, or the like
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P17/00Drugs for dermatological disorders
    • A61P17/06Antipsoriatics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P17/00Drugs for dermatological disorders
    • A61P17/14Drugs for dermatological disorders for baldness or alopecia
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P21/00Drugs for disorders of the muscular or neuromuscular system
    • A61P21/02Muscle relaxants, e.g. for tetanus or cramps
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • A61P25/14Drugs for disorders of the nervous system for treating abnormal movements, e.g. chorea, dyskinesia
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • A61P25/14Drugs for disorders of the nervous system for treating abnormal movements, e.g. chorea, dyskinesia
    • A61P25/16Anti-Parkinson drugs
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • A61P25/28Drugs for disorders of the nervous system for treating neurodegenerative disorders of the central nervous system, e.g. nootropic agents, cognition enhancers, drugs for treating Alzheimer's disease or other forms of dementia
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • A61P25/30Drugs for disorders of the nervous system for treating abuse or dependence
    • A61P25/32Alcohol-abuse
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • A61P25/30Drugs for disorders of the nervous system for treating abuse or dependence
    • A61P25/34Tobacco-abuse
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P27/00Drugs for disorders of the senses
    • A61P27/16Otologicals
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • A61P3/08Drugs for disorders of the metabolism for glucose homeostasis
    • A61P3/10Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12Antivirals
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • A61P35/02Antineoplastic agents specific for leukemia
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P9/00Drugs for disorders of the cardiovascular system
    • A61P9/10Drugs for disorders of the cardiovascular system for treating ischaemic or atherosclerotic diseases, e.g. antianginal drugs, coronary vasodilators, drugs for myocardial infarction, retinopathy, cerebrovascula insufficiency, renal arteriosclerosis
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/43504Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from invertebrates
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/43504Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from invertebrates
    • C07K14/43563Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from invertebrates from insects
    • C07K14/43577Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from invertebrates from insects from flies
    • C07K14/43581Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from invertebrates from insects from flies from Drosophila
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/46Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/46Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • C07K14/463Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from amphibians
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides

Definitions

  • the present invention relates to vertebrate Serrate genes and their encoded protein products, as well as derivatives and analogs thereof. Production of vertebrate Serrate proteins, derivatives, and antibodies is also provided. The invention further relates to therapeutic compositions and methods of diagnosis and therapy.
  • the Notch gene encodes a -300 kd protein (we use "Notch” to denote this protein) with a large N-terminal extracellular domain that includes 36 epidermal growth factor (EGF)-like tandem repeats followed by three other cysteine-rich repeats, designated Notch/lin-12 repeats (Wharton, et al., 1985, Cell 43:567-581; Kidd and Young, 1986, Mol. Cell. Biol. 3:194- 3108; Yochem, et al., 1988, Nature 335:547-550) .
  • EGF epidermal growth factor
  • Delta encodes a -100 kd protein (we use "Delta” to denote DLZM, the protein product of the predominant zygotic and maternal transcripts; Kopczynski, et al., 1988, Genes Dev. 2:1723- 1735) that has nine EGF-like repeats within its extracellular domain (Vassin, et al., 1987, EMBO J. 6:3431-3440; Kopczynski, et al., 1988, Genes Dev. 2:1723-1735) .
  • Notch and Delta constitute biochemically interacting elements of a cell communication mechanism involved in early developmental decisions (Fehon et al., 1990, Cell 61:523-534) .
  • the EGF-like motif has been found in a variety of proteins, including those involved in the blood clotting cascade (Furie and Furie, 1988, Cell 53: 505-518). In particular, this motif has been found in extracellular proteins such as the blood clotting factors IX and X (Rees et al., 1988, EMBO J. 7:2053-2061; Furie and Furie, 1988, Cell 53: 505-518) , in other Drosophila genes (Knust et al., 1987 EMBO J.
  • the present invention relates to nucleotide sequences of vertebrate Serrate genes (human Serrate and related genes of other species) , and amino acid sequences of their encoded proteins, as well as derivatives (e . g . , fragments) and analogs thereof. Nucleic acids hybridizable to or complementary to the foregoing nucleotide sequences are also provided.
  • the Serrate protein is a human protein.
  • the invention relates to vertebrate Serrate derivatives and analogs of the invention which are functionally active, i.e., they are capable of displaying one or more known functional activities associated with a full- length (wild-type) Serrate protein.
  • Such functional activities include but are not limited to antigenicity [ability to bind (or compete with Serrate for binding) to an anti-Serrate antibody] , immunogenicity (ability to generate antibody which binds to Serrate) , ability to bind (or compete with Serrate for binding) to Notch or other toporythmic proteins or fragments thereof ("adhesiveness") , ability to bind (or compete with Serrate for binding) to a receptor for Serrate.
  • Topicalthmic proteins refers to the protein products of Notch , Del ta , Serrate , Enhancer of split , and Deltex, as well as other members of this interacting gene family which may be identified, e . g . , by virtue of the ability of their gene sequences to hybridize, or their homology to Delta, Serrate, or Notch, or the ability of their genes to display phenotypic interactions.
  • the invention further relates to fragments (and derivatives and analogs thereof) of vertebrate Serrate which comprise one or more domains of the Serrate protein, including but not limited to the intracellular domain, extracellular domain, transmembrane domain, membrane- associated region, or one or more EGF-like (homologous) repeats of a Serrate protein, or any combination of the foregoing.
  • Antibodies to vertebrate Serrate is additionally provided.
  • the present invention also relates to therapeutic and diagnostic methods and compositions based on vertebrate Serrate proteins and nucleic acids.
  • the invention provides for treatment of disorders of cell fate or differentiation by administration of a therapeutic compound of the invention.
  • therapeutic compounds include: vertebrate Serrate proteins and analogs and derivatives (including fragments) thereof; antibodies thereto; nucleic acids encoding the vertebrate Serrate proteins, analogs, or derivatives; and vertebrate Serrate antisense nucleic acids.
  • a Therapeutic of the invention is administered to treat a cancerous condition, or to prevent progression from a pre- neoplastic or non-malignant state into a neoplastic or a malignant state.
  • a Therapeutic of the invention is administered to treat a nervous system disorder or to promote tissue regeneration and repair.
  • Therapeutics which antagonize, or inhibit, Notch and/or Serrate function are administered for therapeutic effect.
  • Therapeutics which promote Notch and/or Serrate function are administered for therapeutic effect.
  • disorders of cell fate in particular hyperproliferative (e . g. , cancer) or hypoproliferative disorders, involving aberrant or undesirable levels of expression or activity or localization of Notch and/or Serrate protein can be diagnosed by detecting such levels, as described more fully infra .
  • a Therapeutic of the invention is a protein consisting of at least a fragment (termed herein "adhesive fragment") of a vertebrate Serrate which mediates binding to a Notch protein or a fragment thereof.
  • underscoring or italicizing the name of a gene shall indicate the gene, in contrast to its encoded protein product which is indicated by the name of the gene in the absence of any underscoring.
  • Serrate shall mean the Serrate gene
  • Serrate shall indicate the protein product of the Serrate gene.
  • FIGURES Figure 1 Nucleotide sequence (SEQ ID NO:l) and protein sequence (SEQ ID NO:2) of Human Serrate-1 (also known as Human Jagged-1 (HJ1 ) ) .
  • Figure 2 “Complete” nucleotide sequence (SEQ ID NO:3) and amino acid sequence (SEQ ID NO:4) of Human Serrate-2 (also known as Human Jagged-2 (HJ2) ) generated on the computer by combining the sequence of clones pBS15 and pBS3-2 isolated from human fetal brain cDNA libraries. There is a deletion of approximately 120 nucleotides in the region of this sequence which encodes the portion of Human Serrate-2 between the signal sequence and the beginning of the DSL domain.
  • Figure 3 Nucleotide sequence (SEQ ID NO:5) of chick Serrate (C-Serrate) cDNA.
  • FIG. 4 Amino acid sequence (SEQ ID NO:6) of C-Serrate (lacking the amino-terminus of the signal sequence) .
  • the putative cleavage site following the signal sequence is marked with an arrowhead; the DSL domain is indicated by asterisks; the EGF-like repeats (ELRs) are underlined with dashed lines; the cysteine rich region between the ELRs and the transmembrane domain is marked between arrows, and the single transmembrane domain (between amino acids 1042 and 1066) is shown in bold.
  • Figure 5 Amino acid sequence (SEQ ID NO:6) of C-Serrate (lacking the amino-terminus of the signal sequence) .
  • the putative cleavage site following the signal sequence is marked with an arrowhead; the DSL domain is indicated by asterisks; the EGF-like repeats (ELRs) are underlined with dashed lines; the cysteine rich region between the ELRs and the transmembrane domain
  • Figure 6 Diagram showing the domain structures of Drosophila Delta and Drosophila Serrate compared with C-Serrate.
  • Hydrophobic regions are shown in black; DSL domains are checkered and EGF-like repeats are hatched.
  • the present invention relates to nucleotide sequences of vertebrate Serrate genes, and amino acid sequences of their encoded proteins.
  • the invention further relates to fragments and other derivatives, and analogs, of vertebrate Serrate proteins. Nucleic acids encoding such fragments or derivatives are also within the scope of the invention.
  • the invention provides vertebrate Serrate genes and their encoded proteins of many different species.
  • the Serrate genes of the invention include human Serrate and related genes (homologs) in vertebrate species.
  • the Serrate genes and proteins are from mammals.
  • the Serrate protein is a human protein.
  • the Serrate protein is Human Serrate-1 or Human Serrate-2. Production of the foregoing proteins and derivatives, e . g . , by recombinant methods, is provided.
  • the invention relates to vertebrate Serrate derivatives and analogs of the invention which are functionally active, i.e., they are capable of displaying one or more known functional activities associated with a full- length (wild-type) Serrate protein.
  • Such functional activities include but are not limited to antigenicity [ability to bind (or compete with Serrate for binding) to an anti-Serrate antibody] , immunogenicity (ability to generate antibody which binds to Serrate) , ability to bind (or compete with Serrate for binding) to Notch or other toporythmic proteins or fragments thereof ("adhesiveness") , ability to bind (or compete with Serrate for binding) to a receptor for Serrate.
  • Topicalthmic proteins refers to the protein products of Notch , Delta , Serrate , Enhancer of split , and Deltex, as well as other members of this interacting gene family which may be identified, e . g . , by virtue of the ability of their gene sequences to hybridize, or their homology to Delta, Serrate, or Notch, or the ability of their genes to display phenotypic interactions.
  • the invention further relates to fragments (and derivatives and analogs thereof) of a vertebrate Serrate which comprise one or more domains of the Serrate protein, including but not limited to the intracellular domain, extracellular domain, transmembrane domain, membrane- associated region, or one or more EGF-like (homologous) repeats of a Serrate protein, or any combination of the foregoing.
  • Serrate plays a critical role in development and other physiological processes, in particular, as a ligand to Notch, which is involved in cell fate (differentiation) determination.
  • Serrate is believed to play a major role in determining cell fates in the central nervous system.
  • the nucleic acid and amino acid sequences and antibodies thereto of the invention can be used for the detection and quantitation of Serrate mRNA and protein of human and other species, to study expression thereof, to produce Serrate and fragments and other derivatives and analogs thereof, in the study and manipulation of differentiation and other physiological processes.
  • the present invention also relates to therapeutic and diagnostic methods and compositions based on Serrate proteins and nucleic acids.
  • the invention provides for treatment of disorders of cell fate or differentiation by administration of a therapeutic compound of the invention.
  • therapeutic compounds include: vertebrate Serrate proteins and analogs and derivatives (including fragments) thereof; antibodies thereto; nucleic acids encoding the vertebrate Serrate proteins, analogs, or derivatives; and vertebrate Serrate antisense nucleic acids.
  • a Therapeutic of the invention is administered to treat a cancerous condition, or to prevent progression from a pre- neoplastic or non-malignant state into a neoplastic or a malignant state.
  • a Therapeutic of the invention is administered to treat a nervous system disorder or to promote tissue regeneration and repair.
  • Therapeutics which antagonize, or inhibit, Notch and/or Serrate function are administered for therapeutic effect.
  • Therapeutics which promote Notch and/or Serrate function hereinafter “Agonist Therapeutics”.
  • Therapeutics are administered for therapeutic effect.
  • disorders of cell fate in particular hyperproliferative (e.g., cancer) or hypoproliterative disorders, involving aberrant or undesirable levels of expression or activity or localization of Notch and/or
  • Serrate protein can be diagnosed by detecting such levels, as described more fully infra .
  • a Therapeutic of the invention is a protein consisting of at least a fragment (termed herein "adhesive fragment") of a vertebrate Serrate which mediates binding to a Notch protein or a fragment thereof.
  • the invention is illustrated by way of examples infra which disclose, inter alia , the cloning of a mouse Serrate homolog (Section 6) , the cloning of a Xenopus (frog) Serrate homolog (Section 7) , the cloning of a chick Serrate homolog (Section 8) , and the cloning of the human Serrate homologs Human Serrate-1 (HJ1 ) and Human Serrate-2 (HJ2 ) (Section 9) .
  • vertebrate Serrate nucleic acids comprise the cDNA sequences shown in Figure 1 (SEQ ID NO:l), Figure 2 (SEQ ID NO:3), Figure 3 (SEQ ID NO:6) or the coding regions thereof, or nucleic acids encoding a vertebrate Serrate protein (e.g., having the sequence of SEQ ID NO:2, 4, or 6).
  • the invention provides nucleic acids consisting of at least 8 nucleotides (i.e., a hybridizable portion) of a vertebrate Serrate sequence; in other embodiments, the nucleic acids consist of at least 10 (continuous) nucleotides, 25 nucleotides, 50 nucleotides, 100 nucleotides, 150 nucleotides, or 200 nucleotides of a vertebrate Serrate sequence, or a full-length vertebrate Serrate coding sequence.
  • the invention also relates to nucleic acids hybridizable to or complementary to the foregoing sequences.
  • nucleic acids are provided which comprise a sequence complementary to at least 10, 25, 50, 100, or 200 nucleotides or the entire coding region of a Serrate gene.
  • a nucleic acid which is hybridizable to a vertebrate Serrate nucleic acid e.g., having sequence SEQ ID N0:1
  • a nucleic acid encoding a vertebrate Serrate derivative under conditions of low stringency.
  • procedures using such conditions of low stringency are as follows (see also Shilo and Weinberg, 1981, Proc. Natl. Acad. Sci.
  • Filters are incubated in hybridization mixture for 18-20 h at 40°C, and then washed for 1.5 h at 55°C in a solution containing 2X SSC, 25 mM Tris-HCl (pH 7.4), 5 mM EDTA, and 0.1% SDS. The wash solution is replaced with fresh solution and incubated an additional 1.5 h at 60°C. Filters are blotted dry and exposed for autoradiography. If necessary, filters are washed for a third time at 65-68°C and reexposed to film. Other conditions of low stringency which may be used are well known in the art (e.g., as employed for cross- species hybridizations) .
  • a nucleic acid which is hybridizable to a vertebrate Serrate nucleic acid under conditions of high stringency is provided.
  • procedures using such conditions of high stringency are as follows: Prehybridization of filters containing DNA is carried out for 8 h to overnight at 65°C in buffer composed of 6X SSC, 50 mM Tris-HCl (pH 7.5), 1 mM EDTA, 0.02% PVP, 0.02% Ficoll, 0.02% BSA, and 500 ⁇ g/ml denatured salmon sperm DNA.
  • Filters are hybridized for 48 h at 65°C in prehybridization mixture containing 100 ⁇ g/ml denatured salmon sperm DNA and 5-20 X 10 6 cpm of 3 P-labeled probe. Washing of filters is done at 37°C for 1 h in a solution containing 2X SSC, 0.01% PVP, 0.01% Ficoll, and 0.01% BSA. This is followed by a wash in 0.1X SSC at 50°C for 45 min before autoradiography. Other conditions of high stringency which may be used are well known in the art.
  • nucleic acids encoding fragments and derivatives of vertebrate Serrate proteins are additionally provided.
  • a "nucleic acid encoding a fragment or portion of a Serrate protein” shall be construed as referring to a nucleic acid encoding only the recited fragment or portion of the Serrate protein and not the other contiguous portions of the Serrate protein as a continuous sequence. Fragments of vertebrate Serrate nucleic acids comprising regions of homology to other toporythmic proteins are also provided.
  • DSL regions regions of homology with Drosophila Delta and Serrate
  • DSL proteins of other species are also provided.
  • Nucleic acids encoding conserved regions between Delta and Serrate, such as those represented by Serrate amino acids 63-73, 124-134, 149-158, 195-206, 214- 219, and 250-259 of SEQ ID NO:8, or by the DSL domains are also provided.
  • an expression library is constructed by methods known in the art. For example, mRNA (e.g., human) is isolated, cDNA is made and ligated into an expression vector (e.g., a bacteriophage derivative) such that it is capable of being expressed by the host cell into which it is then introduced. Various screening assays can then be used to select for the expressed Serrate product. In one embodiment, anti-Serrate antibodies can be used for selection.
  • an expression vector e.g., a bacteriophage derivative
  • PCR is used to amplify the desired sequence in a genomic or cDNA library, prior to selection.
  • Oligonucleotide primers representing known Serrate sequences can be used as primers in PCR.
  • the oligonucleotide primers encode at least part of the Serrate conserved segments of strong homology between Serrate and Delta .
  • the synthetic oligonucleotides may be utilized as primers to amplify by PCR sequences from a source (RNA or DNA) , preferably a cDNA library, of potential interest.
  • PCR can be carried out, e . g . , by use of a Perkin- Elmer Cetus thermal cycler and Taq polymerase (Gene Amp”) .
  • the DNA being amplified can include mRNA or cDNA or genomic DNA from any eukaryotic species.
  • Any vertebrate cell potentially can serve as the nucleic acid source for the molecular cloning of the Serrate gene.
  • the nucleic acid sequences encoding Serrate can be isolated from human, porcine, bovine, feline, avian, equine, canine, as well as additional primate sources, etc. For example, we have amplified fragments of the appropriate size in mouse, Xenopus , and human, by PCR using cDNA libraries with Drosophila Serrate primers.
  • the DNA may be obtained by standard procedures known in the art from cloned DNA (e . g .
  • a DNA "library” by chemical synthesis, by cDNA cloning, or by the cloning of genomic DNA, or fragments thereof, purified from the desired cell.
  • a DNA "library” by chemical synthesis, by cDNA cloning, or by the cloning of genomic DNA, or fragments thereof, purified from the desired cell.
  • Clones derived from genomic DNA may contain regulatory and intron DNA regions in addition to coding regions; clones derived from cDNA will contain only exon sequences.
  • the gene should be olecularly cloned into a suitable vector for propagation of the gene.
  • DNA fragments are generated, some of which will encode the desired gene.
  • the DNA may be cleaved at specific sites using various restriction enzymes.
  • DNAse in the presence of manganese to fragment the DNA, or the DNA can be physically sheared, as for example, by sonication.
  • the linear DNA fragments can then be separated according to size by standard techniques, including but not limited to, agarose and polyacrylamide gel electrophoresis and column chromatography.
  • identification of the specific DNA fragment containing the desired gene may be accomplished in a number of ways. For example, if a Serrate (of any species) gene or its specific RNA, or a fragment thereof, e .g. , an extracellular domain (see Section 5.6), is available and can be purified and labeled, the generated DNA fragments may be screened by nucleic acid hybridization to the labeled probe (Benton, W. and Davis, R. , 1977, Science 196:180; Grunstein, M. And Hogness, D. , 1975, Proc. Natl. Acad. Sci. U.S.A. 72:3961). Those DNA fragments with substantial homology to the probe will hybridize.
  • cDNA clones, or DNA clones which hybrid-select the proper mRNAs can be selected which produce a protein that, e . g. , has similar or identical electrophoretic migration, isolectric focusing behavior, proteolytic digestion maps, receptor binding activity, in vitro aggregation activity ("adhesiveness") or antigenic properties as known for
  • the Serrate protein may be identified by binding of labeled antibody to the putatively Serrate synthesizing clones, in an ELISA (enzyme-linked immunosorbent assay)-type procedure.
  • the Serrate gene can also be identified by mRNA selection by nucleic acid hybridization followed by in vitro translation. In this procedure, fragments are used to isolate complementary RNAs by hybridization. Such DNA fragments may represent available, purified Serrate DNA of another species (e.g., human, chick). Immunoprecipitation analysis or functional assays (e . g .
  • mRNAs may be selected by adsorption of polysomes isolated from cells to immobilized antibodies specifically directed against Serrate protein.
  • a radiolabeled Serrate cDNA can be synthesized using the selected mRNA (from the adsorbed polysomes) as a template. The radiolabeled mRNA or cDNA may then be used as a probe to identify the Serrate DNA fragments from among other genomic DNA fragments.
  • RNA for cDNA cloning of the Serrate gene can be isolated from cells which express Serrate . Other methods are possible and within the scope of the invention.
  • the identified and isolated gene can then be inserted into an appropriate cloning vector.
  • vector-host systems known in the art may be used. Possible vectors include, but are not limited to, plasmids or modified viruses, but the vector system must be compatible with the host cell used. Such vectors include, but are not limited to, bacteriophages such as lambda derivatives, or plasmids such as PBR322 or pUC plasmid derivatives.
  • the insertion into a cloning vector can, for example, be accomplished by ligating the DNA fragment into a cloning vector which has complementary cohesive termini.
  • the ends of the DNA molecules may be enzymatically modified.
  • any site desired may be produced by ligating nucleotide sequences (linkers) onto the DNA termini; these ligated linkers may comprise specific chemically synthesized oligonucleotides encoding restriction endonuclease recognition sequences.
  • the cleaved vector and Serrate gene may be modified by homopolymeric tailing. Recombinant molecules can be introduced into host cells via transformation, transfection, infection, electroporation, etc. , so that many copies of the gene sequence are generated.
  • the desired gene may be identified and isolated after insertion into a suitable cloning vector in a "shot gun" approach. Enrichment for the desired gene, for example, by size fractionization, can be done before insertion into the cloning vector.
  • transformation of host cells with recombinant DNA molecules that incorporate the isolated Serrate gene, cDNA, or synthesized DNA sequence enables generation of multiple copies of the gene.
  • the gene may be obtained in large quantities by growing transformants, isolating the recombinant DNA molecules from the transformants and, when necessary, retrieving the inserted gene from the isolated recombinant DNA.
  • the Serrate sequences provided by the instant invention include those nucleotide sequences encoding substantially the same amino acid sequences as found in native Serrate proteins, and those encoded amino acid sequences with functionally equivalent amino acids, all as described in Section 5.6 infra for Serrate derivatives.
  • the nucleotide sequence coding for a vertebrate Serrate protein or a functionally active fragment or other derivative thereof can be inserted into an appropriate expression vector, i.e., a vector which contains the necessary elements for the transcription and translation of the inserted protein-coding sequence.
  • the necessary transcriptional and translational signals can also be supplied by the native vertebrate Serrate gene and/or its flanking regions.
  • host-vector systems may be utilized to express the protein-coding sequence. These include but are not limited to mammalian cell systems infected with virus (e . g . , vaccinia virus, adenovirus, etc.); insect cell systems infected with virus (e . g .
  • baculovirus a virus containing yeast vectors, or bacteria transformed with bacteriophage, DNA, plasmid DNA, or cos id DNA.
  • the expression elements of vectors vary in their strengths and specificities. Depending on the host- vector system utilized, any one of a number of suitable transcription and translation elements may be used.
  • the adhesive portion of the Serrate gene is expressed.
  • a Human Serrate gene or a sequence encoding a functionally active portion of a human Serrate gene such as Human Serrate-1 (HJ2 ) or Human Serrate-2 (HJ2 ) , is expressed.
  • a fragment of Serrate comprising the extracellular domain, or other derivative, or analog of Serrate is expressed.
  • Any of the methods previously described for the insertion of DNA fragments into a vector may be used to construct expression vectors containing a chimeric gene consisting of appropriate transcriptional/translational control signals and the protein coding sequences. These methods may include in vitro recombinant DNA and synthetic techniques and in vivo recombinants (genetic recombination) . Expression of nucleic acid sequence encoding a Serrate protein or peptide fragment may be regulated by a second nucleic acid sequence so that the Serrate protein or peptide is expressed in a host transformed with the recombinant DNA molecule.
  • expression of a Serrate protein may be controlled by any promoter/enhancer element known in the art.
  • Promoters which may be used to control toporythmic gene expression include, but are not limited to, the SV40 early promoter region (Bernoist and Chambon, 1981, Nature 290:304- 310), the promoter contained in the 3' long terminal repeat of Rous sarcoma virus (Yama oto, et al., 1980, Cell 22:787- 797), the herpes thymidine kinase promoter (Wagner et al., 1981, Proc. Natl. Acad. Sci. U.S.A.
  • prokaryotic expression vectors such as the ⁇ -lactamase promoter (Villa-Kamaroff, et al., 1978, Proc. Natl. Acad. Sci. U.S.A. 75:3727-3731), or the tae promoter (DeBoer, et al., 1983, Proc. Natl. Acad. Sci. U.S.A.
  • promoter elements from yeast or other fungi such as the Gal 4 promoter, the ADC (alcohol dehydrogenase) promoter, PGK (phosphoglycerol kinase) promoter, alkaline phosphatase promoter, and the following animal transcriptional control regions, which exhibit tissue specificity and have been utilized in transgenic animals: elastase I gene control region which is active in pancreatic acinar cells (Swift et al., 1984, Cell 38:639-646; Ornitz et al., 1986, Cold Spring Harbor Symp. Quant. Biol. 50:399-409; MacDonald, 1987,
  • Alexander et al., 1987, Mol. Cell. Biol. 7:1436-1444) mouse mammary tumor virus control region which is active in testicular, breast, lymphoid and mast cells (Leder et al., 1986, Cell 45:485-495), albumin gene control region which is active in liver (Pinkert et al., 1987, Genes and Devel. 1:268-276) , alpha-fetoprotein gene control region which is active in liver (Kru lauf et al., 1985, Mol. Cell. Biol.
  • Expression vectors containing Serrate gene inserts can be identified by three general approaches: (a) nucleic acid hybridization, (b) presence or absence of "marker" gene functions, and (c) expression of inserted sequences.
  • first approach the presence of a foreign gene inserted in an expression vector can be detected by nucleic acid hybridization using probes comprising sequences that are homologous to an inserted toporythmic gene.
  • second approach the recombinant vector/host system can be identified and selected based upon the presence or absence of certain "marker" gene functions (e . g .
  • recombinants containing the Serrate insert can be identified by the absence of the marker gene function.
  • recombinant expression vectors can be identified by assaying the foreign gene product expressed by the recombinant. Such assays can be based, for example, on the physical or functional properties of the Serrate gene product in vitro assay systems, e .g . , aggregation (binding) with Notch, binding to a receptor, binding with antibody.
  • the expression vectors which can be used include, but are not limited to, the following vectors or their derivatives: human or animal viruses such as vaccinia virus or adenoviru ⁇ ; insect viruses such as baculovirus; yeast vectors; bacteriophage vectors (e .g . , lambda) , and plasmid and cosmid DNA vectors, to name but a few.
  • a host cell strain may be chosen which modulates the expression of the inserted sequences, or modifies and processes the gene product in the specific fashion desired. Expression from certain promoters can be elevated in the presence of certain inducers; thus, expression of the genetically engineered Serrate protein may be controlled.
  • different host cells have characteristic and specific mechanisms for the translational and post-translational processing and modification (e.g., glycosylation, cleavage [e.g., of signal sequence]) of proteins. Appropriate cell lines or host systems can be chosen to ensure the desired modification and processing of the foreign protein expressed. For example, expression in a bacterial system can be used to produce an unglycosylated core protein product. Expression in yeast will produce a glycosylated product.
  • Expression in mammalian cells can be used to ensure "native" glycosylation of a heterologous mammalian toporythmic protein.
  • different vector/host expression systems may effect processing reactions such as proteolytic cleavages to different extents.
  • the Serrate protein, fragment, analog, or derivative may be expressed as a fusion, or chimeric protein product (comprising the protein, fragment, analog, or derivative joined via a peptide bond to a heterologous protein sequence (of a different protein) ) .
  • Such a chimeric product can be made by ligating the appropriate nucleic acid sequences encoding the desired amino acid sequences to each other by methods known in the art, in the proper coding frame, and expressing the chimeric product by methods commonly known in the art.
  • a chimeric product may be made by protein synthetic techniques, e . g . , by use of a peptide synthesizer.
  • cDNA and genomic sequences can be cloned and expressed.
  • the invention provides amino acid sequences of a vertebrate Serrate, preferably a human
  • Serrate homolog, and fragments and derivatives thereof which comprise an antigenic determinant (i . e . , can be recognized by an antibody) or which are otherwise functionally active, as well as nucleic acid sequences encoding the foregoing.
  • Fully active material refers to that material displaying one or more known functional activities associated with a full-length (wild-type) Serrate protein, e.g., binding to Notch or a portion thereof, binding to any other Serrate ligand, antigenicity (binding to an anti- Serrate antibody) , etc.
  • the invention provides fragments of a vertebrate Serrate protein consisting of at least 6 amino acids, 10 amino acids, 25 amino acids, 50 amino acids, or of at least 75 amino acids.
  • the proteins comprise or consist essentially of an extracellular domain, DSL domain, epidermal growth factor- like repeat (ELR) domain, one or any combination of ELRs, cysteine-rich region, transmembrane domain, or intracellular (cytoplasmic) domain, or a portion which binds to Notch, or any combination of the foregoing, of a Serrate protein.
  • ELR epidermal growth factor- like repeat
  • the gene product can be analyzed. This is achieved by assays based on the physical or functional properties of the product, including radioactive labelling of the product followed by analysis by gel electrophoresis, immunoassay, etc.
  • the Serrate protein may be isolated and purified by standard methods including chromatography (e . g . , ion exchange, affinity, and sizing column chromatography) , centrifugation, differential solubility, or by any other standard technique for the purification of proteins.
  • the functional properties may be evaluated using any suitable assay (see Section 5.7) .
  • the amino acid sequence of the protein can be deduced from the nucleotide sequence of the chimeric gene contained in the recombinant.
  • the protein can be synthesized by standard chemical methods known in the art (e.g., see Hunkapiller, M. , et al., 1984, Nature 310:105-111) .
  • Serrate proteins whether produced by recombinant DNA techniques or by chemical synthetic methods, include but are not limited to those containing, as a primary amino acid sequence, all or part of the amino acid sequence substantially as depicted in Figures 1, 2, or 3 (SEQ ID NO:2, 4, or 6, respectively), as well as fragments and other derivatives, and analogs thereof.
  • Serrate genes and proteins can be analyzed by various methods known in the art.
  • the cloned DNA or cDNA corresponding to the vertebrate Serrate gene can be analyzed by methods including but not limited to Southern hybridization (Southern, E.M. , 1975, J. Mol. Biol. 98:503-517), Northern hybridization (see e . g . , Freeman et al., 1983, Proc. Natl. Acad. Sci. U.S.A. 80:4094-4098), restriction endonuclease mapping (Maniatis, T. , 1982, Molecular Cloning, A Laboratory, Cold Spring Harbor, New York), and DNA sequence analysis. Polymerase chain reaction (PCR; U.S. Patent Nos.
  • Southern hybridization can be used to determine the genetic linkage of Serrate .
  • Northern hybridization analysis can be used to determine the expression of the Serrate gene.
  • Various cell types, at various states of development or activity can be tested for Serrate expression. Examples of such techniques and their results are described in Section 6, infra .
  • the stringency of the hybridization conditions for both Southern and Northern hybridization can be manipulated to ensure detection of nucleic acids with the desired degree of relatedness to the specific Serrate probe used.
  • Restriction endonuclease mapping can be used to roughly determine the genetic structure of the Serrate gene.
  • cleavage with restriction enzymes can be used to derive the restriction map shown in Figure 2, infra .
  • Restriction maps derived by restriction endonuclease cleavage can be confirmed by DNA sequence analysis. DNA sequence analysis can be performed by any techniques known in the art, including but not limited to the method of Maxam and Gilbert (1980, Meth. Enzymol. 65:499- 560) , the Sanger dideoxy method (Sanger, F., et al., 1977, Proc. Natl. Acad. Sci. U.S.A.
  • the cDNA sequence of a representative Serrate gene comprises the sequence substantially as depicted in Figures 1 and 2, and is described in Section 9, infra .
  • the amino acid sequence of the Serrate proteins can be derived by deduction from the DNA sequence, or alternatively, by direct sequencing of the protein, e . g . , with an automated amino acid sequencer.
  • the amino acid sequence of a representative Serrate protein comprises the sequence substantially as depicted in Figure 1, and detailed in Section 9, infra , with the representative mature protein that shown by amino acid numbers 30-1219.
  • the Serrate protein sequence can be further characterized by a hydrophilicity analysis (Hopp, T. and Woods, K. , 1981, Proc. Natl. Acad. Sci. U.S.A. 78:3824).
  • a hydrophilicity profile can be used to identify the hydrophobic and hydrophilic regions of the Serrate protein and the corresponding regions of the gene sequence which encode such regions.
  • Secondary, structural analysis (Chou, P. and Fasman, G., 1974, Biochemistry 13:222) can also be done, to identify regions of Serrate that assume specific secondary structures. 5 Manipulation, translation, and secondary structure prediction, as well as open reading frame prediction and plotting, can also be accomplished using computer software programs available in the art.
  • antibodies may be used as an immunogen to generate antibodies which recognize such an immunogen.
  • antibodies include but are not limited to polyclonal, monoclonal, chimeric, single chain, Fab fragments, and an Fab expression library.
  • antibodies to human Serrate are produced.
  • antibodies to the extracellular domain of Serrate are produced.
  • antibodies to the intracellular domain of Serrate are produced.
  • polyclonal antibodies to a Serrate protein or derivative or analog may be obtained.
  • various host animals can be immunized by injection with the native Serrate protein, or a synthetic version, or derivative (e.g., fragment) thereof, including but not limited to rabbits, mice, rats, etc.
  • adjuvants may be used to increase the immunological response, depending on the host species, and including but not limited to Freund's (complete and incomplete) , mineral gels such as aluminum hydroxide, surface active substances such as lysolecithin, pluronic polyols, polyanions, peptides, oil emulsions, keyhole limpet hemocyanins, dinitrophenol, and potentially useful human adjuvants such as BCG (bacille Calmette-Guerin) and corynebacterium parvum.
  • BCG Bacille Calmette-Guerin
  • any technique which provides for the production of antibody molecules by continuous cell lines in culture may be used.
  • the hybridoma technique originally developed by Kohler and Milstein (1975, Nature 256:495-497), as well as the trioma technique, the human B-cell hybridoma technique (Kozbor et al., 1983, Immunology Today 4:72) , and the EBV-hybridoma technique to produce human monoclonal antibodies Colde et al., 1985, in Monoclonal Antibodies and Cancer Therapy, Alan R. Liss, Inc., pp. 77-96) .
  • monoclonal antibodies can be produced in germ-free animals utilizing recent technology (PCT/US90/02545) .
  • human antibodies may be used and can be obtained by using human hybridomas (Cote et al., 1983, Proc. Natl. Acad. Sci. U.S.A. 80:2026-2030) or by transforming human B cells with EBV virus in vitro (Cole et al., 1985, in Monoclonal Antibodies and Cancer Therapy. Alan R. Liss, pp. 77-96) .
  • techniques developed for the production of "chimeric antibodies” (Morrison et al., 1984, Proc. Natl. Acad. Sci.
  • Antibody fragments which contain the idiotype of the molecule can be generated by known techniques.
  • such fragments include but are not limited to: the F(ab') 2 fragment which can be produced by pepsin digestion of the antibody molecule; the Fab 1 fragments which can be generated by reducing the disulfide bridges of the F(ab') 2 fragment, and the Fab fragments which can be generated by treating the antibody molecule with papain and a reducing agent.
  • screening for the desired antibody can be accomplished by techniques known in the art, e.g. ELISA (enzyme-linked immunosorbent assay) .
  • ELISA enzyme-linked immunosorbent assay
  • one may assay generated hybridomas for a product which binds to a Serrate fragment containing such domain.
  • an antibody specific to vertebrate (e.g., human) Serrate one can select on the basis of positive binding to vertebrate Serrate and a lack of binding to Drosophila Serrate. In another embodiment, one can select for binding to human Serrate and not to Serrate of other species.
  • the foregoing antibodies can be used in methods known in the art relating to the localization and activity of the protein sequences of the invention (e.g., see Section 5.7, infra) , e . g. , for imaging these proteins, measuring levels thereof in appropriate physiological samples, in diagnostic methods, etc.
  • Antibodies specific to a domain of a Serrate protein are also provided.
  • antibodies which bind to a Notch-binding fragment of Serrate are provided.
  • anti-Serrate antibodies and fragments thereof containing the binding domain are Therapeutics.
  • the invention further relates to vertebrate Serrate proteins, and derivatives (including but not limited to fragments) and analogs of Serrate proteins.
  • Nucleic acids encoding vertebrate Serrate protein derivatives and protein analogs are also provided.
  • the Serrate proteins are encoded by the vertebrate Serrate nucleic acids described in Section 5.1 supra .
  • the proteins, derivatives, or analogs are of frog, mouse, rat, pig, cow, dog, monkey, or human Serrate proteins.
  • the derivative or analog is functionally active, i.e., capable of exhibiting one or more functional activities associated with a full- length, wild-type Serrate protein.
  • such derivatives or analogs which have the desired immunogenicity or antigenicity can be used, for example, in immunoassays, for immunization, for inhibition of Serrate activity, etc.
  • Such molecules which retain, or alternatively inhibit, a desired Serrate property e.g., binding to Notch or other toporythmic proteins, binding to a cell-surface receptor, can be used as inducers, or inhibitors, respectively, of such property and its physiological correlates.
  • a specific embodiment relates to a Serrate fragment that can be bound by an anti-Serrate antibody but cannot bind to a Notch protein or other toporythmic protein.
  • Derivatives or analogs of Serrate can be tested for the desired activity by procedures known in the art, including but not limited to the assays described in Section 5.7.
  • Serrate derivatives can be made by altering Serrate sequences by substitutions, additions or deletions that provide for functionally equivalent molecules. Due to the degeneracy of nucleotide coding sequences, other DNA sequences which encode substantially the same amino acid sequence as a Serrate gene may be used in the practice of the present invention. These include but are not limited to nucleotide sequences comprising all or portions of Serrate genes which are altered by the substitution of different codons that encode a functionally equivalent amino acid residue within the sequence, thus producing a silent change.
  • the Serrate derivatives of the invention include, but are not limited to, those containing, as a primary amino acid sequence, all or part of the amino acid sequence of a Serrate protein including altered sequences in which functionally equivalent amino acid residues are substituted for residues within the sequence resulting in a silent change.
  • one or more amino acid residues within the sequence can be substituted by another amino acid of a similar polarity which acts as a functional equivalent, resulting in a silent alteration.
  • Substitutes for an amino acid within the sequence may be selected from other members of the class to which the amino acid belongs.
  • the nonpolar (hydrophobic) amino acids include alanine, leucine, isoleucine, valine, proline, phenylalanine, tryptophan and methionine.
  • the polar neutral amino acids include glycine, serine, threonine, cysteine, tyrosine, asparagine, and glutamine.
  • the positively charged (basic) amino acids include arginine, lysine and histidine.
  • the negatively charged (acidic) amino acids include aspartic acid and glutamic acid.
  • proteins consisting of or comprising a fragment of a vertebrate Serrate protein consisting of at least 10 (continuous) amino acids of the Serrate protein is provided.
  • the fragment consists of at least 20 or 50 amino acids of the Serrate protein. In specific embodiments, such fragments are not larger than 35, 100 or 200 amino acids.
  • Derivatives or analogs of vertebrate Serrate include but are not limited to those peptides which are substantially homologous to a vertebrate Serrate or a fragment thereof (e.g., at least 30% identity over an amino acid sequence of identical size) or whose encoding nucleic acid is capable of hybridizing to a coding vertebrate Serrate sequence.
  • the Serrate derivatives and analogs of the invention can be produced by various methods known in the art. The manipulations which result in their production can occur at the gene or protein level.
  • the cloned Serrate gene sequence can be modified by any of numerous strategies known in the art (Maniatis, T. , 1990, Molecular Cloning, A Laboratory Manual, 2d ed. , Cold Spring Harbor Laboratory, Cold Spring Harbor, New York) .
  • the sequence can be cleaved at appropriate sites with restriction endonuclease(s) , followed by further enzymatic modification if desired, isolated, and ligated in vitro .
  • the Serrate-encoding nucleic acid sequence can be mutated in vitro or in vivo , to create and/or destroy translation, initiation, and/or termination sequences, or to create variations in coding regions and/or form new restriction endonuclease sites or destroy preexisting ones, to facilitate further in vitro modification.
  • Any technique for mutagenesis known in the art can be used, including but not limited to, in vitro site- directed mutagenesis (Hutchinson, C. , et al., 1978, J. Biol. Chem 253:6551), use of TAB® linkers (Pharmacia) , etc.
  • Manipulations of the Serrate sequence may also be made at the protein level.
  • Serrate protein fragments or other derivatives or analogs which are differentially modified during or after translation, e.g., by glycosylation, acetylation, phosphorylation, amidation, derivatization by known protecting/blocking groups, proteolytic cleavage, linkage to an antibody molecule or other cellular ligand, etc. Any of numerous chemical modifications may be carried out by known techniques, including but not limited to specific chemical cleavage by cyanogen bromide, trypsin, chymotrypsin, papain, V8 protease, NaBH 4 ; acetylation, formylation, oxidation, reduction; metabolic synthesis in the presence of tunicamycin; etc.
  • analogs and derivatives of Serrate can be chemically synthesized.
  • a peptide corresponding to a portion of a Serrate protein which comprises the desired domain (see Section 5.6.1), or which mediates the desired aggregation activity in vitro , or binding to a receptor can be synthesized by use of a peptide synthesizer.
  • nonclassical amino acids or chemical amino acid analogs can be introduced as a substitution or addition into the Serrate sequence.
  • Non- classical amino acids include but are not limited to the D- isomers of the common amino acids, ⁇ -amino isobutyric acid, 4-aminobutyric acid, hydroxyproline, sarcosine, citrulline, cysteic acid, t-butylglycine, t-butylalanine, phenylglycine, cyclohexylalanine, 3-alanine, designer amino acids such as ⁇ - methyl amino acids, C ⁇ -methyl amino acids, and N ⁇ -methyl amino acids.
  • the Serrate derivative is a chimeric, or fusion, protein comprising a vertebrate Serrate protein or fragment thereof (preferably consisting of at least a domain or motif of the Serrate protein, or at least 10 amino acids of the Serrate protein) joined at its amino- or carboxy-terminus via a peptide bond to an amino acid sequence of a different protein.
  • a chimeric protein is produced by recombinant expression of a nucleic acid encoding the protein (comprising a Serrate- coding sequence joined in-frame to a coding sequence for a different protein) .
  • Such a chimeric product can be made by ligating the appropriate nucleic acid sequences encoding the desired amino acid sequences to each other by methods known in the art, in the proper coding frame, and expressing the chimeric product by methods commonly known in the art.
  • a chimeric product may be made by protein synthetic techniques, e.g., by use of a peptide synthesizer.
  • a chimeric nucleic acid encoding a mature vertebrate Serrate protein with a heterologous signal sequence is expressed such that the chimeric protein is expressed and processed by the cell to the mature Serrate protein.
  • a recombinant molecule can be constructed according to the invention, comprising coding portions of both Serrate and another toporythmic gene, e.g., Delta.
  • the encoded protein of such a recombinant molecule could exhibit properties associated with both Serrate and Delta and portray a novel profile of biological activities, including agonists as well as antagonists.
  • the primary sequence of Serrate and Delta may also be used to predict tertiary structure of the molecules using computer simulation (Hopp and Woods, 1981, Proc. Natl. Acad. Sci. U.S.A.
  • Serrate/Delta chimeric recombinant genes could be designed in light of correlations between tertiary structure and biological function.
  • chimeric genes comprising portions of a vertebrate Serrate fused to any heterologous protein-encoding sequences may be constructed.
  • a specific embodiment relates to a chimeric protein comprising a fragment of a vertebrate Serrate of at least ten amino acids.
  • the Serrate derivative is a fragment of Serrate comprising a region of homology with another toporythmic protein.
  • a region of a first protein shall be considered "homologous" to a second protein when the amino acid sequence of the region is at least 30% identical or at least 75% either identical or involving conservative changes, when compared to any sequence in the second protein of an equal number of amino acids as the number contained in the region. For example, such a
  • Serrate fragment can comprise one or more regions homologous to Delta, or DSL domains or portions thereof.
  • the invention relates to vertebrate Serrate derivatives and analogs, in particular
  • __ domain membrane-associated region, and one or more of the EGF-like repeats (ELR) of the Serrate protein, or any combination of the foregoing.
  • EGF-like repeats EGF-like repeats
  • the molecules comprising specific fragments of vertebrate Serrate are those comprising fragments in the respective Serrate protein most homologous to specific fragments of the Drosophila Serrate and/or Delta
  • such a molecule comprises or consists of the amino acid sequences homologous to SEQ ID NO:10, 12, or 18.
  • a fragment comprising a domain of a Serrate homolog can be identified by protein analysis methods as described in Section 5.3.2.
  • the invention also provides for vertebrate Serrate fragments, and analogs or derivatives of such fragments, which mediate binding to toporythmic proteins (and thus are termed herein "adhesive”) , and nucleic acid sequences encoding the foregoing.
  • the adhesive fragment of Serrate is that comprising the portion of Serrate most homologous to about amino acid numbers 85-283 or 79-282 of the Drosophila Serrate sequence (see PCT Publication WO 93/12141 dated June 24, 1993) .
  • the adhesive fragment of a Serrate protein comprises the DSL domain, or a portion thereof.
  • Subfragments within the DSL domain that mediate binding to Notch can be identified by analysis of constructs expressing deletion mutants.
  • toporythmic protein preferably Notch
  • a toporythmic protein preferably Notch
  • in vitro aggregation assays with cells expressing such a toporythmic protein as well as cells expressing Serrate or a Serrate derivative (See Section 5.7). That is, the ability of a Serrate fragment to bind to a Notch protein can be demonstrated by detecting the ability of the Serrate fragment, when expressed on the surface of a first cell, to bind to a Notch protein expressed on the surface of a second cell.
  • toporythmic proteins or adhesive domains thereof for use in such assays, can be isolated from human, porcine, bovine, feline, avian, equine, canine, or insect, as well as primate sources and any other species in which homologs of known toporythmic genes can be identified. 5.7. ASSAYS OF SERRATE PROTEINS, DERIVATIVES AND ANALOGS
  • various immunoassays known in the art can be used, including but not limited to competitive and non-competitive assay systems using techniques such as radioimmunoassays, ELISA (enzyme linked immunosorbent assay) , "sandwich” immunoassays, immunoradiometric assays, gel diffusion precipitin reactions, immunodiffusion assays, in situ immunoassays (using colloidal gold, enzyme or radioisotope labels, for example) , western blots, precipitation reactions, agglutination assays (e.g., gel agglutination assays, hemagglutination assays) , complement fixation assays, immunofluorescence assays, protein A assays, and immunoelectrophoresis assays, etc.
  • antibody binding is detected by detecting a label on the primary antibody.
  • the primary antibody is detected by detecting binding of a secondary antibody or reagent to the primary antibody.
  • the secondary antibody is labeled. Many means are known in the art for detecting binding in an immunoassay and are within the scope of the present invention.
  • one can carry out an in vitro aggregation assay such as described in PCT Publication WO 93/12141 dated June 24, 1993 (see also Fehon et al., 1990, Cell 61:523-534; Rebay et al., 1991, Cell 67:687-699).
  • receptor binding can be assayed, e.g., by means well-known in the art.
  • physiological correlates of Serrate binding to cells expressing a Serrate receptor can be assayed.
  • genetic studies can be done to study the phenotypic effect of a Serrate mutant that is a derivative or analog of wild-type vertebrate Serrate .
  • the invention provides for treatment of disorders of cell fate or differentiation by administration of a therapeutic compound of the invention.
  • therapeutic compounds include: vertebrate Serrate proteins and analogs and derivatives (including fragments) thereof (e.g., as described hereinabove) ; antibodies thereto (as described hereinabove) ; nucleic acids encoding the vertebrate Serrate proteins, analogs, or derivatives (e.g., as described hereinabove); and Serrate antisense nucleic acids.
  • the Antagonist Therapeutics of the invention are those Therapeutics which antagonize, or inhibit, a vertebrate Serrate function and/or Notch function (since Serrate is a Notch ligand) .
  • Antagonist Therapeutics are most preferably identified by use of known convenient in vitro assays, e.g., based on their ability to inhibit binding of Serrate to another protein (e.g., a Notch protein) , or inhibit any known Notch or Serrate function as preferably assayed in vitro or in cell culture, although genetic assays (e.g., in Drosophila) may also be employed.
  • the Antagonist Therapeutic is a protein or derivative thereof comprising a functionally active fragment such as a fragment of Serrate which mediates binding to Notch, or an antibody thereto.
  • such an Antagonist Therapeutic is a nucleic acid capable of expressing a molecule comprising a fragment of Serrate which binds to Notch, or a Serrate antisense nucleic acid (see Section 5.11 herein) .
  • suitable in vitro or in vivo assays, as described infra should be utilized to determine the effect of a specific Therapeutic and whether its administration is indicated for treatment of the affected tissue, since the developmental history of the tissue may determine whether an Antagonist or Agonist Therapeutic is desired.
  • the mode of administration e.g., whether administered in soluble form or administered via its encoding nucleic acid for intracellular recombinant expression, of the Serrate protein or derivative can affect whether it acts as an agonist or antagonist.
  • a nucleic acid containing a portion of a vertebrate Serrate gene is used, as an Antagonist Therapeutic, to promote Serrate inactivation by homologous recombination (Koller and Smithies, 1989, Proc. Natl. Acad. Sci. USA 86:8932-8935; Zijlstra et al., 1989, Nature 342:435-438).
  • Agonist Therapeutics of the invention promote Serrate function.
  • Such Agonist Therapeutics include but are not limited to proteins and derivatives comprising the portions of Notch that mediate binding to Serrate, and nucleic acids encoding the foregoing (which can be administered to express their encoded products in vivo) .
  • Molecules which retain, or alternatively inhibit, a desired Serrate property e.g., binding to Notch, binding to an intracellular ligand
  • a desired Serrate property e.g., binding to Notch, binding to an intracellular ligand
  • a peptide e.g., in the range of 10-50 or 15-25 amino acids; and particularly of about 10, 15, 20 or 25 amino acids
  • a peptide containing the sequence of a portion of a vertebrate Serrate which binds to Notch is used to antagonize Notch function.
  • such an Antagonist Therapeutic is used to treat or prevent human or other malignancies associated with increased Notch expression (e.g., cervical cancer, colon cancer, breast cancer, squamous adenocarcimas (see infra ) ) .
  • Derivatives or analogs of Serrate can be tested for the desired activity by procedures known in the art, including but not limited to the assays described in the examples infra .
  • molecules comprising vertebrate Serrate fragments which bind to Notch EGF-repeats (ELR) 11 and 12 and which are smaller than a DSL domain can be obtained and selected by expressing deletion mutants and assaying for binding of the expressed product to Notch by any of the several methods (e .
  • peptide libraries can be screened to select a peptide with the desired activity; such screening can be carried out by assaying, e.g., for binding to Notch or a molecule containing the Notch ELR 11 and 12 repeats.
  • the Agonist and Antagonist Therapeutics of the invention have therapeutic utility for disorders of cell fate.
  • the Agonist Therapeutics are administered therapeutically (including prophylactically) : (1) in diseases or disorders involving an absence or decreased (relative to normal, or desired) levels of Notch or Serrate function, for example, in patients where Notch or Serrate protein is lacking, genetically defective, biologically inactive or underactive, or underexpressed; and (2) in diseases or disorders wherein in vitro (or in vivo) assays (see infra) indicate the utility of Serrate agonist administration.
  • Notch or Serrate function can be readily detected, e.g., by obtaining a patient tissue sample (e.g., from biopsy tissue) and assaying it in vitro for protein levels, structure and/or activity of the expressed Notch or Serrate protein.
  • tissue sample e.g., from biopsy tissue
  • a sample of cells from such malignancy is plated out or grown in culture, and the cells are then exposed to a Therapeutic.
  • a Therapeutic which inhibits survival or growth of the malignant cells is selected for therapeutic use in vivo .
  • cell proliferation can be assayed by measuring 3 H-thymidine incorporation, by direct cell count, by detecting changes in transcriptional activity of known genes such as proto- oncogenes (e.g., fo ⁇ , myc) or cell cycle markers; cell viability can be assessed by trypan blue staining, differentiation can be assessed visually based on changes in morphology, etc.
  • known genes such as proto- oncogenes (e.g., fo ⁇ , myc) or cell cycle markers
  • cell viability can be assessed by trypan blue staining, differentiation can be assessed visually based on changes in morphology, etc.
  • the malignant cell cultures are separately exposed to (1) an Agonist Therapeutic, and (2) an Antagonist Therapeutic; the result of the assay can indicate which type of Therapeutic has therapeutic efficacy.
  • a Therapeutic is indicated for use which exhibits the desired effect, inhibition or promotion of cell growth, upon a patient cell sample from tissue having or suspected of having a hyper- or hypoproliferative disorder, respectively.
  • hyper- or hypoproliferative disorders include but are not limited to those described in Sections 5.8.1 through 5.8.3 infra .
  • a Therapeutic is indicated for use in treating nerve injury or a nervous system degenerative disorder (see Section 5.8.2) which exhibits in vitro promotion of nerve regeneration/neurite extension from nerve cells of the affected patient type.
  • administering is also indicated in diseases or disorders determined or known to involve a Notch or Serrate dominant activated phenotype ("gain of function" mutations.)
  • Administration of an Agonist Therapeutic is indicated in diseases or disorders determined or known to involve a Notch or Serrate dominant negative phenotype ("loss of function" mutations) .
  • the functions of various structural domains of the Notch protein have been investigated in vivo , by ectopically expressing a series of Drosophila Notch deletion mutants under the hsp70 heat-shock promoter, as well as eye- specific promoters (see Rebay et al., 1993, Cell 74:319-329) .
  • cells of a patient tissue sample suspected of being pre-neoplastic are similarly plated out or grown in vitro , and exposed to a Therapeutic.
  • the Therapeutic which results in a cell phenotype that is more normal (i.e., less representative of a pre-neoplastic state, neoplastic state, malignant state, or transformed phenotype) is selected for therapeutic use.
  • Many assays standard in the art can be used to assess whether a pre-neoplastic state, neoplastic state, or a transformed or malignant phenotype, is present.
  • characteristics associated with a transformed phenotype include a more rounded cell morphology, looser substratum attachment, loss of contact inhibition, loss of anchorage dependence, release of proteases such as plasminogen activator, increased sugar transport, decreased serum requirement, expression of fetal antigens, disappearance of the 250,000 dalton surface protein, etc. (see Luria et al., 1978, General Virology, 3d Ed., John Wiley & Sons, New York pp. 436-446) .
  • the in vitro assays described supra can be carried out using a cell line, rather than a cell sample derived from the specific patient to be treated, in which the cell line is derived from or displays characteristic(s) associated with the malignant, neoplastic or pre-neoplastic disorder desired to be treated or prevented, or is derived from the neural or other cell type upon which an effect is desired, according to the present invention.
  • the Antagonist Therapeutics are administered therapeutically (including prophylactically) : (1) in diseases or disorders involving increased (relative to normal, or desired) levels of Notch or Serrate function, for example, where the Notch or Serrate protein is overexpressed or overactive; and (2) in diseases or disorders wherein in vitro (or in vivo) assays indicate the utility of Serrate antagonist administration.
  • the increased levels of Notch or Serrate function can be readily detected by methods such as those described above, by quantifying protein and/or RNA.
  • In vitro assays with cells of patient tissue sample or the appropriate cell line or cell type, to determine therapeutic utility can be carried out as described above. 5.8.1.
  • MALIGNANCIES Malignant and pre-neoplastic conditions which can be tested as described supra for efficacy of intervention with Antagonist or Agonist Therapeutics, and which can be treated upon thus observing an indication of therapeutic utility, include but are not limited to those described below in Sections 5.8.1 and 5.9.1.
  • Malignancies and related disorders, cells of which type can be tested in vitro (and/or in vivo) , and upon observing the appropriate assay result, treated according to the present invention include but are not limited to those listed in Table 1 (for a review of such disorders, see Fishman et al., 1985, Medicine , 2d Ed., J.B. Lippincott Co., Philadelphia) :
  • malignancy or dysproliferative changes are treated or prevented in epithelial tissues such as those in the cervix, esophagus, and lung. Malignancies of the colon and cervix exhibit increased expression of human Notch relative to such non- malignant tissue (see PCT Publication no. WO 94/07474 published April 14, 1994, incorporated by reference herein in its entirety) .
  • malignancies or premalignant changes of the colon or cervix are treated or prevented by administering an effective amount of an Antagonist Therapeutic, e.g., a Serrate derivative, that antagonizes Notch function.
  • an Antagonist Therapeutic e.g., a Serrate derivative
  • cancers e.g., breast cancer, squamous adenocarcinoma, seminoma, melanoma, and lung cancer, and premalignant changes therein, as well as other hyperproliferative disorders, can be treated or prevented by administration of an Antagonist Therapeutic that antagonizes Notch function.
  • NERVOUS SYSTEM DISORDERS Nervous system disorders, involving cell types which can be tested as described supra for efficacy of intervention with Antagonist or Agonist Therapeutics, and which can be treated upon thus observing an indication of therapeutic utility, include but are not limited to nervous system injuries, and diseases or disorders which result in either a disconnection of axons, a diminution or degeneration of neurons, or demyelination.
  • Nervous system lesions which may be treated in a patient (including human and non-human mammalian patients) according to the invention include but are not limited to the following lesions of either the central (including spinal cord, brain) or peripheral nervous systems: (i) traumatic lesions, including lesions caused by physical injury or associated with surgery, for example, lesions which sever a portion of the nervous system, or compression injuries; (ii) ischemic lesions, in which a lack of oxygen in a portion of the nervous system results in neuronal injury or death, including cerebral infarction or ischemia, or spinal cord infarction or ischemia; (i ⁇ ) malignant lesions, in which a portion of the nervous system is destroyed or injured by malignant tissue which is either a nervous system associated malignancy or a malignancy derived from non-nervous system tissue; (iv) infectious lesions, in which a portion of the nervous system is destroyed or injured as a result of infection, for example, by an abscess or associated with infection by human immunodeficiency virus
  • Marchiafava-Bignami disease primary degeneration of the corpus callosum
  • alcoholic cerebellar degeneration a demyelinated lesions in which a portion of the nervous system is destroyed or injured by a demyelinating disease including but not limited to multiple sclerosis, human immunodeficiency virus-associated myelopathy, transverse myelopathy or various etiologies, progressive multifocal leukoencephalopathy, and central pontine myelinolysis.
  • Therapeutics which are useful according to the invention for treatment of a nervous system disorder may be selected by testing for biological activity in promoting the survival or differentiation of neurons (see also Section 5.8).
  • Therapeutics which elicit any of the following effects may be useful according to the invention: (i) increased survival time of neurons in culture;
  • Neurosci. 4:17-42 increased production of neuron- associated molecules may be measured by bioassay, enzymatic assay, antibody binding, Northern blot assay, etc., depending on the molecule to be measured; and motor neuron dysfunction may be measured by assessing the physical manifestation of motor neuron disorder, e.g., weakness, motor neuron conduction velocity, or functional disability.
  • motor neuron disorders that may be treated according to the invention include but are not limited to disorders such as infarction, infection, exposure to toxin, trauma, surgical damage, degenerative disease or malignancy that may affect motor neurons as well as other components of the nervous system, as well as disorders that selectively affect neurons such as amyotrophic lateral sclerosis, and including but not limited to progressive spinal muscular atrophy, progressive bulbar palsy, primary lateral sclerosis, infantile and juvenile muscular atrophy, progressive bulbar paralysis of childhood (Fazio-Londe syndrome) , poliomyelitis and the post polio syndrome, and Hereditary Motorsensory Neuropathy (Charcot- Marie-Tooth Disease) .
  • disorders such as infarction, infection, exposure to toxin, trauma, surgical damage, degenerative disease or malignancy that may affect motor neurons as well as other components of the nervous system, as well as disorders that selectively affect neurons such as amyotrophic lateral sclerosis, and including but not limited to progressive spinal muscular atrophy, progressive bulbar pals
  • a Therapeutic of the invention is used for promotion of tissue regeneration and repair, including but not limited to treatment of benign dysproliferative disorders. Specific embodiments are directed to treatment of cirrhosis of the liver (a condition in which scarring has overtaken normal liver regeneration processes) , treatment of keloid (hypertrophic scar) formation (disfiguring of the skin in which the scarring process interferes with normal renewal) , psoriasis (a common skin condition characterized by excessive proliferation of the skin and delay in proper cell fate determination) , and baldness (a condition in which terminally differentiated hair follicles (a tissue rich in Notch) fail to function properly) .
  • a Therapeutic of the invention is used to treat degenerative or traumatic disorders of the sensory epithelium of the inner ear.
  • the Therapeutics of the invention can be administered to prevent progression to a neoplastic or malignant state, including but not limited to those disorders listed in Table 1. Such administration is indicated where the Therapeutic is shown in assays, as described supra , to have utility for treatment or prevention of such disorder. Such prophylactic use is indicated in conditions known or suspected of preceding progression to neoplasia or cancer, in particular, where non-neoplastic cell growth consisting of hyperplasia, metaplasia, or most particularly, dysplasia has occurred (for review of such abnormal growth conditions, see Robbins and Angell, 1976, Basic Pathology, 2d Ed., W.B. Saunders Co., Philadelphia, pp.
  • Hyperplasia is a form of controlled cell proliferation involving an increase in cell number in a tissue or organ, without significant alteration in structure or function.
  • endometrial hyperplasia often precedes endometrial cancer.
  • Metaplasia is a form of controlled cell growth in which one type of adult or fully differentiated cell substitutes for another type of adult cell. Metaplasia can occur in epithelial or connective tissue cells.
  • Atypical metaplasia involves a somewhat disorderly metaplastic epithelium.
  • Dysplasia is frequently a forerunner of cancer, and is found mainly in the epithelia; it is the most disorderly form of non-neoplastic cell growth, involving a loss in individual cell uniformity and in the architectural orientation of cells.
  • Dysplastic cells often have abnormally large, deeply stained nuclei, and exhibit pleomorphism. Dysplasia characteristically occurs where there exists chronic irritation or inflammation, and is often found in the cervix, respiratory passages, oral cavity, and gall bladder.
  • the presence of one or more characteristics of a transformed phenotype, or of a malignant phenotype, displayed in vivo or displayed in vitro by a cell sample from a patient can indicate the desirability of prophylactic/therapeutic administration of a Therapeutic of the invention.
  • characteristics of a transformed phenotype include morphology changes, looser substratum attachment, loss of contact inhibition, loss of anchorage dependence, protease release, increased sugar transport, decreased serum requirement, expression of fetal antigens, disappearance of the 250,000 dalton cell surface protein, etc. (see also id . , at pp. 84-90 for characteristics associated with a transformed or malignant phenotype) .
  • leukoplakia a benign- appearing hyperplastic or dysplastic lesion of the epithelium, or Bowen's disease, a carcinoma in situ , are pre- neoplastic lesions indicative of the desirability of prophylactic intervention.
  • fibrocystic disease cystic hyperplasia, mammary dysplasia, particularly adenosis (benign epithelial hyperplasia)
  • adenosis benign epithelial hyperplasia
  • a patient which exhibits one or more of the following predisposing factors for malignancy is treated by administration of an effective amount of a Therapeutic: a chromosomal translocation associated with a malignancy (e.g., the Philadelphia chromosome for chronic myelogenous leukemia, t(14;18) for follicular lymphoma, etc.), familial polyposis or Gardner's syndrome (possible forerunners of colon cancer) , benign monoclonal gammopathy (a possible forerunner of multiple myeloma) , and a first degree kinship with persons having a cancer or precancerous disease showing a Mendelian (genetic) inheritance pattern (e.g., familial polyposis of the colon, Gardner's syndrome, hereditary exostosis, polyendocrine adenomatosis, medullary thyroid carcinoma with amyloid production and pheochromocytoma, Peutz-Jeghers syndrome, neurofibromat
  • a Therapeutic of the invention can be administered to prevent a nervous system disorder described in Section 5.8.2, or other disorder (e.g., liver cirrhosis, psoriasis, keloids, baldness) described in Section 5.8.3.
  • a nervous system disorder described in Section 5.8.2 or other disorder (e.g., liver cirrhosis, psoriasis, keloids, baldness) described in Section 5.8.3.
  • the Therapeutics of the invention can be tested in vivo for the desired therapeutic or prophylactic activity.
  • such compounds can be tested in suitable animal model systems prior to testing in humans, including but not limited to rats, mice, chicken, cows, monkeys, rabbits, etc.
  • suitable animal model systems prior to testing in humans, including but not limited to rats, mice, chicken, cows, monkeys, rabbits, etc.
  • any animal model system known in the art may be used.
  • the present invention provides the therapeutic or prophylactic use of nucleic acids of at least six or of at least ten nucleotides that are antisense to a gene or cDNA encoding a vertebrate Serrate or a portion thereof.
  • Antisense refers to a nucleic acid capable of hybridizing to a portion of a vertebrate Serrate RNA (preferably mRNA) by virtue of some sequence complementarity.
  • Such antisense nucleic acids have utility as Antagonist Therapeutics of the invention, and can be used in the treatment or prevention of disorders as described supra in Section 5.8 and its subsections.
  • the antisense nucleic acids of the invention can be oligonucleotides that are double-stranded or single-stranded, RNA or DNA or a modification or derivative thereof, which can be directly administered to a cell, or which can be produced intracellularly by transcription of exogenous, introduced sequences.
  • the Serrate antisense nucleic acids provided by the instant invention can be used for the treatment of tumors or other disorders, the cells of which tumor type or disorder can be demonstrated (in vitro or in vivo) to express a Serrate gene or a Notch gene. Such demonstration can be by detection of RNA or of protein.
  • the invention further provides pharmaceutical compositions comprising an effective amount of the Serrate antisense nucleic acids of the invention in a pharmaceutically acceptable carrier, as described infra in Section 5.12. Methods for treatment and prevention of disorders (such as those described in Sections 5.8 and 5.9) comprising administering the pharmaceutical compositions of the invention are also provided.
  • the invention is directed to methods for inhibiting the expression of a Serrate nucleic acid sequence in a prokaryotic or eukaryotic cell comprising providing the cell with an effective amount of a composition comprising an antisense vertebrate Serrate nucleic acid of the invention.
  • the vertebrate Serrate antisense nucleic acids are of at least six nucleotides and are preferably oligonucleotides (ranging preferably from 10 to about 50 oligonucleotides) .
  • the oligonucleotide contains at least 10 nucleotides, at least 15 nucleotides, at least 100 nucleotides, or at least 200 nucleotides antisense to a Serrate gene.
  • the oligonucleotides can be DNA or RNA or chimeric mixtures or derivatives or modified versions thereof, single-stranded or double-stranded.
  • the oligonucleotide can be modified at the base moiety, sugar moiety, or phosphate backbone.
  • the oligonucleotide may include other appending groups such as peptides, or agents facilitating transport across the cell membrane (see, e.g., Letsinger et al., 1989, Proc. Natl. Acad. Sci. U.S.A.
  • a vertebrate Serrate antisense oligonucleotide is provided, preferably of single-stranded DNA.
  • such an oligonucleotide comprises a sequence antisense to the sequence encoding an SH3 binding domain or a Notch-binding domain of Serrate, most preferably, of a human Serrate homolog.
  • the oligonucleotide may be modified at any position on its structure with substituents generally known in the art.
  • the Serrate antisense oligonucleotide may comprise at least one modified base moiety which is selected from the group including but not limited to 5-fluorouracil, 5-bromouracil, 5-chlorouracil, 5-iodouracil, hypoxanthine, xantine, 4-acetylcytosine, 5-(carboxyhydroxylmethyl) uracil, 5-carboxymethylaminomethyl-2-thiouridine, 5-carboxymethylaminomethyluracil, dihydrouracil, beta-D- galactosylqueosine, inosine, N6-isopentenyladenine, 1-methylguanine, 1-methylinosine, 2,2-dimethylguanine, 2-methyladenine, 2-methylguanine, 3-methylcytosine, 5-methylcytosine, N6-adenine, 7-methylguanine,
  • modified base moiety which is selected from the group including but not limited to 5-fluorouracil, 5-bromouracil, 5-chlor
  • 5-methylaminomethyluracil 5-methoxyaminomethyl-2-thiouracil, beta-D-mannosylqueosine, 5'-methoxycarboxymethyluracil, 5-methoxyuracil, 2-methylthio-N6-isopentenyladenine, uracil-5-oxyacetic acid (v) , wybutoxosine, pseudouracil, queosine, 2-thiocytosine, 5-methyl-2-thiouracil,
  • the oligonucleotide comprises at least one modified sugar moiety selected from the group including but not limited to arabinose, 2-fluoroarabinose, xylulose, and hexose.
  • the oligonucleotide comprises at least one modified phosphate backbone selected from the group consisting of a phosphorothioate, a phosphorodithioate, a phosphoramidothioate, a phosphoramidate, a phosphordiamidate, a methylphosphonate, an alkyl phosphotriester, and a formacetal or analog thereof.
  • the oligonucleotide is an ⁇ -anomeric oligonucleotide.
  • ⁇ -anomeric oligonucleotide forms specific double-stranded hybrids with complementary RNA in which, contrary to the usual 0-units, the strands run parallel to each other (Gautier et al., 1987, Nucl. Acids Res. 15:6625-6641).
  • the oligonucleotide may be conjugated to another molecule, e.g., a peptide, hybridization triggered cross- linking agent, transport agent, hybridization-triggered cleavage agent, etc.
  • Oligonucleotides of the invention may be synthesized by standard methods known in the art, e.g. by use of an automated DNA synthesizer (such as are commercially available from Biosearch, Applied Biosystems, etc.).
  • phosphorothioate oligonucleotides may be synthesized by the method of Stein et al. (1988, Nucl. Acids Res.
  • methylphosphonate oligonucleotides can be prepared by use of controlled pore glass polymer supports (Sarin et al., 1988, Proc. Natl. Acad. Sci. U.S.A. 85:7448- 7451) , etc.
  • the Serrate antisense oligonucleotide comprises catalytic RNA, or a ribozyme (see, e.g., PCT International Publication WO 90/11364, published October 4, 1990; Sarver et al., 1990, Science 247:1222-1225).
  • the oligonucleotide is a 2'-0- methylribonucleotide (Inoue et al., 1987, Nucl. Acids Res. 15:6131-6148), or a chimeric RNA-DNA analogue (Inoue et al., 1987, FEBS Lett. 215:327-330) .
  • the Serrate antisense nucleic acid of the invention is produced intracellularly by transcription from an exogenous sequence.
  • a vector can be introduced in vivo such that it is taken up by a cell, within which cell the vector or a portion thereof is transcribed, producing an antisense nucleic acid (RNA) of the invention.
  • RNA antisense nucleic acid
  • Such a vector would contain a sequence encoding the Serrate antisense nucleic acid.
  • Such a vector can remain episomal or become chromosomally integrated, as long as it can be transcribed to produce the desired antisense RNA.
  • Vectors can be constructed by recombinant DNA technology methods standard in the art.
  • Vectors can be plasmid, viral, or others known in the art, used for replication and expression in mammalian cells.
  • Expression of the sequence encoding the Serrate antisense RNA can be by any promoter known in the art to act in mammalian, preferably human, cells. Such promoters can be inducible or constitutive.
  • Such promoters include but are not limited to: the SV40 early promoter region (Bernoist and Chambon, 1981, Nature 290:304- 310), the promoter contained in the 3' long terminal repeat of Rous sarcoma virus (Yamamoto et al., 1980, Cell 22:787- 797), the herpes thymidine kinase promoter (Wagner et al., 1981, Proc. Natl. Acad. Sci. U.S.A. 78:1441-1445), the regulatory sequences of the metallothionein gene (Brinster et al., 1982, Nature 296:39-42), etc.
  • the antisense nucleic acids of the invention comprise a sequence complementary to at least a portion of an RNA transcript specific to a vertebrate Serrate gene, preferably a human Serrate gene.
  • a sequence complementary to at least a portion of an RNA means a sequence having sufficient complementarity to be able to hybridize with the RNA, forming a stable duplex; in the case of double-stranded Serrate antisense nucleic acids, a single strand of the duplex DNA may thus be tested, or triplex formation may be assayed.
  • the ability to hybridize will depend on both the degree of complementarity and the length of the antisense nucleic acid.
  • the longer the hybridizing nucleic acid the more base mismatches with a Serrate RNA it may contain and still form a stable duplex (or triplex, as the case may be) .
  • One skilled in the art can ascertain a tolerable degree of mismatch by use of standard procedures to determine the melting point of the hybridized complex.
  • the vertebrate Serrate antisense nucleic acids can be used to treat (or prevent) malignancies or other disorders, of a cell type which has been shown to express Serrate or Notch .
  • the malignancy is cervical, breast, or colon cancer, or squamous adenocarcinoma.
  • Malignant, neoplastic, and pre-neoplastic cells which can be tested for such expression include but are not limited to those described supra in Sections 5.8.1 and 5.9.1.
  • a single-stranded DNA antisense Serrate oligonucleotide is used.
  • Malignant (particularly, tumor) cell types which express Serrate or Notch RNA can be identified by various methods known in the art. Such methods include but are not limited to hybridization with a Serrate or Notch-specific nucleic acid (e.g. by Northern hybridization, dot blot hybridization, in situ hybridization) , observing the ability of RNA from the cell type to be translated in vitro into Notch or Serrate, immunoassay, etc.
  • primary tumor tissue from a patient can be assayed for Notch or Serrate expression prior to treatment, e.g., by immunocytochemistry or in situ hybridization.
  • Pharmaceutical compositions of the invention see
  • Section 5.12) comprising an effective amount of a vertebrate Serrate antisense nucleic acid in a pharmaceutically acceptable carrier, can be administered to a patient having a malignancy which is of a type that expresses Notch or Serrate RNA or protein.
  • Serrate antisense nucleic acid which will be effective in the treatment of a particular disorder or condition will depend on the nature of the disorder or condition, and can be determined by standard clinical techniques. Where possible, it is desirable to determine the antisense cytotoxicity of the tumor type to be treated in vitro, and then in useful animal model systems prior to testing and use in humans.
  • compositions comprising vertebrate Serrate antisense nucleic acids are administered via liposomes, microparticles, or microcapsules.
  • it may be desirable to utilize liposomes targeted via antibodies to specific identifiable tumor antigens Leonetti et al., 1990, Proc. Natl. Acad. Sci. U.S.A. 87:2448-2451; Renneisen et al., 1990, J. Biol. Chem. 265:16337-16342) . 5.12. THERAPEUTIC/PROPHYLACTIC
  • the invention provides methods of treatment (and prophylaxis) by administration to a subject of an effective
  • the Therapeutic is substantially purified.
  • the subject is preferably an animal, including but not limited to animals such as cows, pigs, chickens, etc., and is preferably a mammal, and most preferably human.
  • a Therapeutic of the invention e.g., encapsulation in liposomes, microparticles, microcapsules, expression by recombinant cells, receptor-mediated endocytosis (see, e.g., Wu and Wu, 1987, J. Biol. Chem. 262:4429-4432), construction of a Therapeutic nucleic acid as part of a retroviral or other vector, etc.
  • Methods of introduction include but are not limited to intradermal, intramuscular, intraperitoneal, intravenous, subcutaneous, intranasal, epidural, and oral routes.
  • the compounds may be
  • __ administered by any convenient route for example by infusion or bolus injection, by absorption through epithelial or mucocutaneous linings (e.g., oral ucosa, rectal and intestinal mucosa, etc.) and may be administered together with other biologically active agents.
  • Administration can be any convenient route, for example by infusion or bolus injection, by absorption through epithelial or mucocutaneous linings (e.g., oral ucosa, rectal and intestinal mucosa, etc.) and may be administered together with other biologically active agents. Administration can be any convenient route, for example by infusion or bolus injection, by absorption through epithelial or mucocutaneous linings (e.g., oral ucosa, rectal and intestinal mucosa, etc.) and may be administered together with other biologically active agents. Administration can be any convenient route, for example by infusion or bolus injection, by absorption through epithelial or mucocutaneous linings (e.g., oral
  • compositions of the invention may be desirable to introduce the pharmaceutical compositions of the invention into the central nervous system by any suitable route, including intraventricular and intrathecal injection; intraventricular injection may be facilitated by an
  • intraventricular catheter for example, attached to a reservoir, such as an Ommaya reservoir.
  • Pulmonary administration can also be employed, e.g., by use of an inhaler or nebulizer, and formulation with an aerosolizing agent.
  • compositions of the invention may be desirable to administer the pharmaceutical compositions of the invention locally to the area in need of treatment; this may be achieved by, for example, and not by way of limitation, local infusion during surgery, topical application, e.g., in conjunction with a wound dressing after surgery, by injection, by means of a catheter, by means of a suppository, or by means of an implant, said implant being of a porous, non-porous, or gelatinous material, including membranes, such as sialastic membranes, or fibers.
  • administration can be by direct injection at the site (or former site) of a malignant tumor or neoplastic or pre- neoplastic tissue.
  • the Therapeutic can be delivered in a vesicle, in particular a liposo e (see Langer, Science 249:1527-1533 (1990); Treat et al., in Liposomes in the Therapy of Infectious Disease and Cancer, Lopez-Berestein and Fidler (eds.) , Liss, New York, pp. 353-365 (1989) ; Lopez-Berestein, ibid . , pp. 317-327; see generally ibid . )
  • the Therapeutic can be delivered in a controlled release system.
  • a pump may be used (see Langer, supra ; Sefton, CRC Crit. Ref. Biomed. Eng. 14:201 (1987); Buchwald et al., Surgery 88:507 (1980); Saudek et al., N. Engl. J. Med. 321:574 (1989)) .
  • polymeric materials can be used (see Medical Applications of Controlled Release, Langer and Wise (eds.), CRC Pres., Boca Raton, Florida (1974); Controlled Drug Bioavailability, Drug Product Design and Performance, Smolen and Ball (eds.) , Wiley, New York (1984) ; Ranger and Peppas, J. Macro ol. Sci. Rev. Macro ol. Chem. 23:61 (1983); see also Levy et al., Science 228:190 (1985) ; During et al., Ann. Neurol. 25:351 (1989); Howard et al., J. Neurosurg. 71:105 (1989)) .
  • a controlled release system can be placed in proximity of the therapeutic target, i . e . , the brain, thus requiring only a fraction of the systemic dose (see , e . g . , Goodson, in Medical Applications of Controlled Release, supra , vol. 2, pp. 115-138 (1984) ) .
  • the nucleic acid can be administered in vivo to promote expression of its encoded protein, by constructing it as part of an appropriate nucleic acid expression vector and administering it so that it becomes intracellular, e.g., by use of a retroviral vector (see U.S. Patent No.
  • a nucleic acid Therapeutic can be introduced intracellularly and incorporated within host cell DNA for expression, by homologous recombination.
  • Parkinson's disease Targeted intravenous; intrathecal
  • compositions comprise a therapeutically effective amount of a Therapeutic, and a pharmaceutically acceptable carrier.
  • pharmaceutically acceptable means approved by a regulatory agency of the Federal or a state government or listed in the U.S. Pharmacopeia or other generally recognized pharmacopeia for use in animals, and more particularly in humans.
  • carrier refers to a diluent, adjuvant, excipient, or vehicle with which the therapeutic is administered.
  • Such pharmaceutical carriers can be sterile liquids, such as water and oils, including those of petroleum, animal, vegetable or synthetic origin, such as peanut oil, soybean oil, mineral oil, sesame oil and the like. Water is a preferred carrier when the pharmaceutical composition is administered intravenously. Saline solutions and aqueous dextrose and glycerol solutions can also be employed as liquid carriers, particularly for injectable solutions. Suitable pharmaceutical excipients include starch, glucose, lactose, sucrose, gelatin, malt, rice, flour, chalk, silica gel, sodium stearate, glycerol monostearate, talc, sodium chloride, dried skim milk, glycerol, propylene, glycol, water, ethanol and the like.
  • compositions can also contain minor amounts of wetting or emulsifying agents, or pH buffering agents.
  • These compositions can take the form of solutions, suspensions, emulsion, tablets, pills, capsules, powders, sustained-release formulations and the like.
  • the composition can be formulated as a suppository, with traditional binders and carriers such as triglycerides.
  • Oral formulation can include standard carriers such as pharmaceutical grades of mannitol, lactose, starch, magnesium stearate, sodium saccharine, cellulose, magnesium carbonate, etc. Examples of suitable pharmaceutical carriers are described in "Remington's Pharmaceutical Sciences" by E.W. Martin.
  • compositions will contain a therapeutically effective amount of the Therapeutic, preferably in purified form, together with a suitable amount of carrier so as to provide the form for proper administration to the patient.
  • the formulation should suit the mode of administration.
  • the composition is formulated in accordance with routine procedures as a pharmaceutical composition adapted for intravenous administration to human beings.
  • compositions for intravenous administration are solutions in sterile isotonic aqueous buffer.
  • the composition may also include a solubilizing agent and a local anesthetic such as lignocaine to ease pain at the site of the injection.
  • the ingredients are supplied either separately or mixed together in unit dosage form, for example, as a dry lyophilized powder or water free concentrate in a hermetically sealed container such as an ampoule or sachette indicating the quantity of active agent.
  • a hermetically sealed container such as an ampoule or sachette indicating the quantity of active agent.
  • the composition is to be administered by infusion, it can be dispensed with an infusion bottle containing sterile pharmaceutical grade water or saline.
  • an ampoule of sterile water for injection or saline can be provided so that the ingredients may be mixed prior to administration.
  • the Therapeutics of the invention can be formulated as neutral or salt forms.
  • Pharmaceutically acceptable salts include those formed with free amino groups such as those derived from hydrochloric, phosphoric, acetic, oxalic, tartaric acids, etc., and those formed with free carboxyl groups such as those derived from sodium, potassium, ammonium, calcium, ferric hydroxides, isopropylamine, triethylamine, 2-ethylamino ethanol, histidine, procaine, etc.
  • the amount of the Therapeutic of the invention which will be effective in the treatment of a particular disorder or condition will depend on the nature of the disorder or condition, and can be determined by standard clinical techniques.
  • in vitro assays may optionally be employed to help identify optimal dosage ranges.
  • the precise dose to be employed in the formulation will also depend on the route of administration, and the seriousness of the disease or disorder, and should be decided according to the judgment of the practitioner and each patient's circumstances.
  • suitable dosage ranges for intravenous administration are generally about 20-500 micrograms of active compound per kilogram body weight.
  • Suitable dosage ranges for intranasal administration are generally about 0.01 pg/kg body weight to 1 g/kg body weight.
  • Effective doses may be extrapolated from dose- response curves derived from in vitro or animal model test systems.
  • Suppositories generally contain active ingredient in the range of 0.5% to 10% by weight; oral formulations preferably contain 10% to 95% active ingredient.
  • the invention also provides a pharmaceutical pack or kit comprising one or more containers filled with one or more of the ingredients of the pharmaceutical compositions of the invention.
  • Optionally associated with such container(s) can be a notice in the form prescribed by a governmental agency regulating the manufacture, use or sale of pharmaceuticals or biological products, which notice reflects approval by the agency of manufacture, use or sale for human administration.
  • Vertebrate Serrate proteins, analogues, derivatives, and subsequences thereof, vertebrate Serrate nucleic acids (and sequences complementary thereto) , anti- vertebrate Serrate antibodies have uses in diagnostics.
  • Such molecules can be used in assays, such as immunoassays, to detect, prognose, diagnose, or monitor various conditions, diseases, and disorders affecting Serrate expression, or monitor the treatment thereof.
  • immunoassay is carried out by a method comprising contacting a sample derived from a patient with an anti-Serrate antibody under conditions such that immunospecific binding can occur, and detecting or measuring the amount of any immunospecific binding by the antibody.
  • such binding of antibody, in tissue sections, preferably in conjunction with binding of anti-Notch antibody can be used to detect aberrant Notch and/or Serrate localization or aberrant levels of Notch-Serrate colocalization in a disease state.
  • antibody to Serrate can be used to assay in a patient tissue or serum sample for the presence of Serrate where an aberrant level of Serrate is an indication of a diseased condition.
  • Aberrant levels of Serrate binding ability in an endogenous Notch protein, or aberrant levels of binding ability to Notch (or other Serrate ligand) in an endogenous Serrate protein may be indicative of a disorder of cell fate (e.g., cancer, etc.)
  • aberrant levels is meant increased or decreased levels relative to that present, or a standard level representing that present, in an analogous sample from a portion of the body or from a subject not having the disorder.
  • the immunoassays which can be used include but are not limited to competitive and non-competitive assay systems using techniques such as western blots, radioimmunoassays, ELISA (enzyme linked immunosorbent assay) , "sandwich” immunoassays, immunoprecipitation assays, precipitin reactions, gel diffusion precipitin reactions, immunodiffusion assays, agglutination assays, complement- fixation assays, immunoradiometric assays, fluorescent immunoassays, protein A immunoassays, to name but a few.
  • competitive and non-competitive assay systems using techniques such as western blots, radioimmunoassays, ELISA (enzyme linked immunosorbent assay) , "sandwich” immunoassays, immunoprecipitation assays, precipitin reactions, gel diffusion precipitin reactions, immunodiffusion assays, agglutination assays, complement- fixation assays,
  • Vertebrate Serrate genes and related nucleic acid sequences and subsequences, including complementary sequences, and other toporythmic gene sequences can also be used in hybridization assays.
  • Vertebrate Serrate nucleic acid sequences, or subsequences thereof comprising about at least 8 nucleotides can be used as hybridization probes.
  • Hybridization assays can be used to detect, prognose, diagnose, or monitor conditions, disorders, or disease states associated with aberrant changes in Serrate expression and/or activity as described supra .
  • such a hybridization assay is carried out by a method comprising contacting a sample containing nucleic acid with a nucleic acid probe capable of hybridizing to Serrate DNA or RNA, under conditions such that hybridization can occur, and detecting or measuring any resulting hybridization.
  • Serrate binds to Notch
  • vertebrate Serrate or a binding portion thereof can be used to assay for the presence and/or amounts of Notch in a sample, e.g., in screening for malignancies which exhibit increased Notch expression such as colon and cervical cancers.
  • M-Serrate-1 A mouse Serrate homolog, termed M-Serrate-1, was isolated as follows:
  • Tissue origin 10.5-day mouse embryonic RNA
  • Isolation method a) random primed cDNA against above RNA b) PCR of above cDNA using
  • PCR primer 1 CGI (C/T)TTTGC(C/T)TIAA(A/G) (G/C)AITA(C/T)CA
  • PCR primer 2 TCIATGCAIGTICCICC(A/G)TT (SEQ ID NO: 11)
  • Amplification conditions 50 ng cDNA, 1 ⁇ g each primer,
  • SRVTAGGPCSFGSGSTPVIGGNTFNLKASRGNDRNRIVLPFSFTWPRSYTLLVE (SEQ ID NO: 14) (corresponds to amino-terminal sequence upstream of the DSL domain) 5
  • Serrate (see Section 11 infra) , including expression in the developing central nervous system, peripheral nervous system, limb, kidney, lens, and vascular system.
  • Xenopus Serrate-1 A Xenopus Serrate homolog, termed Xenopus Serrate-1 was isolated as follows:
  • Isolation method a) random primed cDNA against above RNA b) PCR using:
  • Primer 1 CGI (C/T)TTTGC(C/T)TIAA(A/G) (G/C)AITA(C/T)CA 3Q (SEQ ID NO:9) ⁇ encoding RLCCK(H/E)YQ (SEQ ID NO: 10) ⁇ :
  • PCR primer 2 TCIATGCAIGTICCICC(A/G)TT (SEQ ID NO: 11)
  • Amplification conditions 50 ng cDNA, 1 ⁇ g each primer,
  • Each otic explant consisted of the two otic cups, a short section of intervening hindbrain and pharynx and the associated head ectoderm and esenchyme.
  • RNA was extracted using a modification of standard protocols (Sambrook et al.,
  • PCR and degenerate primers were used to amplify a fragment of a chicken gene homologous to the Drosophila gene Serrate from the otic explant cDNA.
  • the primers were designed to recognize peptide motifs found in both the fly
  • primer 1 5-CGI(T/C)TITGC(T/C)TIAA(G/A) (G/C)AITA(C/T)CA- 3' (SEQ ID N0:17), corresponds to the motif RLCLK(E/H)YQ (SEQ ID NO:18) located at the amino-terminus of the fly Delta and Serrate proteins.
  • primer 2 5'-TCIATGCAIGTICCICC(A/G)TT-3 ' (SEQ ID N0:11), corresponds to the motif NGGTCID (SEQ ID NO:12) found in several of the EGF-like repeats.
  • the PCR conditions were as follows: 35 cycles of 94°C for 1 minute, 45°C for 1.5 minutes and 72°C for 2 minutes; followed by a final extension step of
  • Patterns of gene transcription were determined by in situ hybridization using DIG-labeled RNA probes and: 1) a high-stringency wholemount in situ hybridization protocol, and
  • chick Serrate in the vertebrate embryo, we examined its expression in relation to that of chick Notch, since functional coupling of Notch and Serrate occurs in Drosophila . Two chick Notch homologs were obtained as described below.
  • C-Notch-1 and C-Notch-2 are apparent counterparts of the rodent Notch-l and Notch-2 genes, respectively
  • Notch homologs in the chick by PCR, using cDNA prepared from two-day chick embryos and degenerate primers based on conserved regions common to the known rodent Notch homologs. in this way, we obtained fragments, each approximately 1000 nucleotides long, of two distinct genes, which we have called C-Notch-1 and C-Notch-2.
  • the fragments extend from the third Notch/linl2 repeat up to and including the last five or so EGF-like repeats. EGF-like repeats are present in a large number of proteins, most of which are otherwise unrelated to Notch.
  • the three Notch/linl2 repeats are peculiar to the Notch family of genes and are found in all its known members.
  • C-Notch-1 shows the highest degree of amino-acid identity with rodent Notchl (Weinmaster et al., 1991, Development 113:199-205), and is expressed in broadly similar domains to rodent Notchl (see below) .
  • C-Not ⁇ h-2 appears most similar to Notch2 (Weinmaster et al., 1992, Development 116:931-941).
  • C-Notch-1 was expressed in the 1- to 2-day chick embryo in many well- defined domains, including the neural tube, the presomitic mesoderm, the nephrogenic mesoderm (the prospective mesonephros) , the nasal placode, the otic placode/vesicle, the lens placode, the epibranchial placodes, the endothelial lining of the vascular system, in the heart, and the apical ectodermal ridges (AER) of the limb buds. These sites match the reported sites of Notchl expression in rodents at equivalent stages (Table II) . Taking the sequence data together with the expression data, we conclude that C-Notch-1 is either the chick ortholog of rodent Notchl , or a very close relative of it.
  • Body Region R-Notchl' C-Notchl primitive streak + + Hensen's node neural tube retina + + lens + + otic placode/vesicle + + epibranchial placodes + + nasal placode + + dorsal root ganglia + + preso itic mesoderm + + somites + + notochord ? + mesonephric kidney + + metanephric kidney + + blood vessels + + heart + + whisker follicles + N/A thymus + ? toothbuds + N/A salivary gland + ? limb bud (AER) ?
  • C-Serrate is a homolog of Drosophila Serrate, and codes for a candidate ligand for a receptor belonging to the Notch family
  • Drosophila two ligands for Notch are known, encoded by the two related genes Del ta and Serrate .
  • the amino-acid sequences corresponding to these genes are homologous at their 5' ends, including a region, the DSL motif, which is necessary and sufficient for in vitro binding to Notch.
  • To isolate a fragment of a chicken homolog of Serrate we used PCR and degenerate primers designed to recognize sequences on either side of the DSL motif (see Materials and methods) .
  • a 900 base pair PCR fragment was recovered and used to screen a library, allowing us to isolate overlapping cDNA clones.
  • the DNA sequence of the cDNA clones revealed an almost complete single open reading frame of 3582 nucleotides, lacking only a few 5' bases. Comparison with the amino acid sequences of Drosophila Delta and Serrate suggests that we are missing only the portion of the coding sequence that encodes part of the signal sequence of the chick Serrate protein.
  • Drosophila Serrate contains 14 EGF-like repeats with large insertions in repeats 4, 6 and 10
  • the chicken homolog has an extra two EGF-like repeats and only one small insertion of 16 amino acids in the 10th repeat.
  • Both proteins have a second cysteine-rich region between the EGF-like repeats and the transmembrane domain; the spacing of the cysteines in this region is almost identical in the two proteins (compare
  • C-Serrate is expressed in the central nervous system, cranial placodes, nephric mesoderm, vascular system, and limb bud mesenchyme
  • In situ hybridization was performed to examine the expression of C-Serrate in whole-mount preparations during early embryogenesis, from stage 4 to stage 21, at intervals of roughly 12 hours. Later stages were studied by in situ hybridization on cryosections.
  • C-Serrate The main sites of early expression of C-Serrate , as seen in whole mounts, can be grouped under five headings: central nervous system, cranial placodes, nephric mesoderm, vascular system, and limb bud mesenchyme.
  • the first detectable expression of C-Serrate was seen in the central nervous system at stage 6 (O somites/24 hrs) , within the posterior portion of the neural plate. By stage 10 (9-11 somites/35.5 hrs), a strong stripe of expression was seen in the prospective diencephalon. Additional faint staining was seen in the hindbrain and in the prospective spinal cord.
  • stage 17 expression in the diencephalon and midbrain was unchanged.
  • the anterior limits of these stripes coincided with the anterior border of rhombomere 2.
  • All four longitudinal stripes in the hindbrain continued into the spinal cord of the embryo; decreasing towards its posterior end.
  • These stripes of expression were maintained at least up to and including stage 31 (E7) .
  • stage 21 (84 hrs) , additional expression was seen in the cerebral hemispheres and strong expression in a salt and pepper distribution of cells in the optic tectum.
  • C-Serrate is expressed in all the cranial placodes - the lens placode, the nasal placode, the otic placode/vesicle and the epibranchial placodes, as well as a patch of cranial ectoderm anterior to the otic placode that may correspond to the trigeminal placode (which is not well-defined morphologically) .
  • the epibranchial expression was seen at stage 13/14 as strong staining in the ectoderm around the dorsal margins of the first and second branchial clefts. It was accompanied by expression of the gene in the deep part of the lining of the clefts and in the endodermal lining of the branchial pouches, where the two epithelia abut one another.
  • Nephric mesoderm Expression was detectable in the cells of the intermediate mesoderm from stage 10 and in older embryos (stage 17 to 21) in the developing mesonephric tubules.
  • Limb buds C-Serrate mRNA was localized to a patch of mesenchyme at the distal end of the developing limb bud. This may suggest a role in limb growth.
  • C-Notch-1 was expressed throughout the luminal region as described previously; within this region, there were two small patches in which Serrate was strongly expressed.
  • Notch-dependent signalling is, however, as important in non- neural as in neural tissues.
  • Serrate Although Serrate is expressed in many sites in the fly, it is apparently required only in the humeral, wing and halteres disks. When Serrate function is lost by mutation, these structures fail to grow. Studies on the wing disc have indicated that it is specifically the wing margin that depends on Serrate; when Serrate is lacking, this critical signaling region and growth centre fails to form, and when Serrate is expressed ectopically under a GAL4-UAS promoter in the ventral part of the wing disc, ectopic wing margin tissue is induced, leading to ectopic outgrowths.
  • Notch appears to be the receptor for Serrate at the wing margin, since some mutant alleles of Notch cause similar disturbances of wing margin development and allele-specific interactions are seen in the effects of the two genes.
  • Identification and full length sequence of a homolog of the Drosophila gene Serrate and identification and partial sequence of chick homologs of rat/mouse Notchl and Notch2 .
  • chick Serrate cDNA Within the chick Serrate cDNA there is a single open reading frame predicted to encode a large transmembrane protein with 16 EGF repeats in its extracellular domain. It has a well conserved DSL motif suggesting that it would interact directly with Notch.
  • the intracellular domain of chick Serrate exhibits no homology to anything in the current databases including the intracellular domains of Drosophila Delta and Serrate. It should he pointed out however that the intracellular domains of chick and human Serrate (see Section 12) are almost identical.
  • C-Notch-1 and C-Serrate exhibit dynamic and complex patterns of expression including several regions in which they are coexpressed (CNS, ear, branchial region, lens, heart, nasal placodes and mesonephros) .
  • CNS central nervous system
  • the Notch receptor In Drosophila , the Notch receptor is quite widely distributed and its ligands are found in overlapping but more restricted domains. In the chick a similar situation is observed.
  • C-Serrate has a significant function can be inferred from the conservation of its sequence, in particular, of its Notch-binding domain.
  • the expression patterns reported for C-Serrate in this paper provide the following information. First, since the Serrate gene is expressed in or next to sites where C-Notch-1 is expressed (possibly in conjunction with other Notch homologs) , it is highly probable that C-Serrate exerts its action by binding to C-Notch-1 (or to another chick Notch homolog with a similar expression pattern) . Second, the expression in the developing kidney, the vascular system and the limb buds might reflect an involvement in inductive signalling between mesoderm and ectoderm, which plays an important part in the development of all these organs.
  • C-Serrate is expressed in the distal mesoderm
  • C-Notch-1 is expressed in the overlying apical ectodermal ridge, whose maintenance is known to depend on a signal from the mesoderm below.
  • C-Serrate may equally be involved in communications between cells within the placodal epithelium, for example, in regulating the specialized modes of differentiation of the placodal calls.
  • One possibility is that it is involved in regulating the production of oligodendrocytes, which have likewise been reported to originate from narrow bands of tissue extending along the cranio-caudal axis of the neural tube.
  • PCR polymerase chain reaction
  • Degenerate oligonucleotide primers used in this reaction were designed based on amino-terminal regions of high homology between Drosophila Serrate and Drosophila Delta (see Fig. 5) ; this high homology region includes the 5' "DSL" domain, that is believed to code for the Notch-binding portion of Delta and Serrate.
  • Two PCR products were isolated and used, one a 350 bp fragment, and one a 1.2 kb fragment.
  • PCR fragments were labeled with 32 P and used to screen a commercial human fetal brain cDNA library made from a 17-18 week old fetus (previously available from Stratagene) , in which the cDNAs were inserted into the _?coRI site of a ⁇ -Zap vector.
  • the 1.2 kb fragment hybridized to a single clone out of the 10 6 clones screened. We rescued this fragment from the ⁇ DNA by converting the isolated phage ⁇ clone to a plasmid via the manufacturer's instructions, yielding the Serrate-homologous cDNA as an insert in the J5.coRI site of the vector Bluescript KS- (Stratagene) .
  • This plasmid was named "pBS39" and the gene corresponding to this cDNA clone was called Human Serrate-1 (also known as Human Jagged-1
  • the isolated cDNA was 6464 nucleotides long and contained a complete open reading frame as well as 5' and 3' untranslated regions (Fig. 1) . Sequencing was carried out using the Sequenase® sequencing system (U.S. Biochemical Corp.) on 5 and 6% Sequagel acrylamide sequencing gels.
  • the nucleotide sequence of the pBS14 insert was identical to a 1.1 kb stretch of sequence contained internally within the pBS15 cDNA insert and therefore, this clone was not characterized further.
  • the methionine located at the amino terminal residue of this predicted open reading was homologous to the start methionine encoded by the Human Serrate-1 (HJ1 ) cDNA clone in pBS39.
  • the gene encoding the cDNA insert of pBS15 was named Human Serrate-2 and is also known as Human Jagged-2 ( "HJ2" ) .
  • the pBS15 (HJ2 ) 3.1 kb insert was then labeled with 32 P and used to screen another human fetal brain library (from Clontech) , in which cDNA generated from a 25-26 week-old fetus was cloned into the EcoRl site of ⁇ gtll. This screen identified three potential positive clones.
  • ⁇ gtll DNA was prepared from a liquid lysate and purified over a DEAE column. The purified DNA was then cut with J ⁇ coRI and the cDNA inserts were isolated and subcloned into the _5 ⁇ oRI site of Bluescript KS-.
  • the bluescript constructs containing these cDNAs were named pBS3-15, pBS3-2, and pBS3-20.
  • pBS3-2 had a 3.2 kb insert extending from nucleotide 1210 of the pBS15 cDNA insert to just after the polyadenylation signal.
  • the 2.6 kb insert of pBS3-20 was restriction mapped and partially sequenced to determine its 3' and 5' ends.
  • the insert of pBS3-15 was determined to be a Bluescript vector fragment contaminant.
  • PCR, RACE, and Takara extended PCR techniques were unsuccessful.
  • three human genomic clones potentially containing the 5' end of HJ " 2 were obtained from the screening of a human genomic cosmid library in which 30 kb fragments were cloned into a unique Xhol site introduced into the BatnHI site of a pWE15 vector (the unmodified vector is available from Stratagene) .
  • This cosmid library was screened with a PCR fragment that had been amplified from the 5' end of pBS15 (HJ2 ) and three positive cosmid clones were isolated.
  • Two different sets of primers were used to amplify DNA corresponding to the 5' end of pBS15 using the cosmid clones as a template, and both sets generated single bands that were subcloned, but which were determined to contain PCR artifacts. Portions of the cosmid clones are being subcloned directly without PCR, in order to obtain a portion of the cosmid clones that contains the 120 nucleotide stretch of DNA that is missing from pBS15.
  • the pBS39 cDNA insert encoding the Human Serrate-1 homolog (HJ1 ) , has been sequenced and contains the complete coding sequence for the gene product.
  • the nucleotide (SEQ ID NO:l) and protein (SEQ ID NO:2) sequences are shown in Figure 1.
  • the coding region consists of nucleotide numbers 371-4024 of SEQ ID N0:1.
  • the Protean protein analysis software program from DNAStar was used to predict signal peptide and transmembrane regions (based on hydrophobicity) .
  • the signal peptide was predicted to consist of amino acids 14-29 of SEQ ID NO:2 (encoded by nucleotide numbers 410-457 of SEQ ID N0:1) , whereby the amino terminus of the mature protein was predicted to start with Gly at amino acid number 30.
  • the transmembrane domain was predicted to be amino acid numbers 1068-1089 of SEQ ID NO:2, encoded by nucleotide numbers 3572-3637 of SEQ ID NO:l.
  • the consensus (DSL) domain the region of homology with Drosophila Delta and Serrate, predicted to mediate binding with Notch (in particular, Notch ELR 11 and 12) , spans amino acids 185-229 of SEQ ID NO:2, encoded by nucleotide numbers 923-1057 of SEQ ID NO:l.
  • ELR Epidermal growth factor-like repeats in the amino acid sequence were identified by eye; 15 (full- length) ELRs were identified and 3 partial ELRs as follows: ELR 1: amino acid numbers 234 - 264 ELR 2: amino acid numbers 265 - 299 ELR 3: amino acid numbers 300 - 339
  • ELR 6 amino acid numbers 416 - 453
  • ELR 7 amino acid numbers 454 - 490
  • ELR 14 amino acid numbers 786 - 823
  • ELR 15 amino acid numbers 824 - 862
  • Partial ELR amino acid numbers 863 - 879 Partial ELR: amino acid numbers 880 - 896
  • the total ELR domain is thus amino acid numbers 234 - 896 (encoded by nucleotide numbers 1070 - 3058 of SEQ ID NO:l) .
  • the extracellular domain is thus predicted to be amino acid numbers 1 - 1067 of SEQ ID NO:2, encoded by nucleotide numbers 371 - 3571 of SEQ ID NO:l (amino acid numbers 30 - 1067 in the mature protein; encoded by nucleotides number 458 - 3571 of SEQ ID NO:l).
  • the intracellular (cytoplasmic) domain is thus predicted to be amino acid numbers 1090 - 1218 of SEQ ID NO:2, encoded by nucleotide numbers 3638 - 4024 of SEQ ID NO:l.
  • HJ1 human tissue assayed, which included, heart, brain, placenta, lung, skeletal muscle, pancreas, liver and kidney.
  • the observation that HJ1 was expressed in adult skeletal and heart muscle was particularly interesting, because adult muscle fibers are completely surrounded by a lamina of extracellular matrix, and it is unlikely, therefore, that the role of HJ1 in these cells is in direct cell-cell communication.
  • the transmembrane domain was predicted to be amino acid numbers 912-933 of SEQ ID NO:4, encoded by nucleotides numbers 3065-3130 of SEQ ID NO:3.
  • the consensus (DSL) domain the region of homology with Drosophila Delta and Serrate, predicted to mediate binding with Notch (in particular, Notch ELR 11 and 12), spans amino acids 26-70 of SEQ ID NO:4, encoded by nucleotide numbers 407 - 541 of SEQ ID NO: 3.
  • ELR Epidermal growth factor-like repeats in the amino acid sequence were identified by eye; 15 (full-length) ELRs were identified and 3 partial ELRs as follows:
  • ELR 2 amino acid numbers 106 - 140
  • ELR 3 amino acid numbers 141 - 180
  • ELR 7 amino acid numbers 295 - 331
  • ELR 8 amino acid numbers 332 - 369
  • ELR 10 amino acid numbers 470 - 507
  • ELR 11 amino acid numbers 508 - 545
  • ELR 13 amino acid numbers 585 - 622
  • ELR 14 amino acid numbers 623 - 660
  • ELR 15 amino acid numbers 664 - 701
  • Partial ELR amino acid numbers 702 - 718
  • Partial ELR amino acid numbers 719 - 735
  • the total ELR domain is thus amino acid numbers 75 - 735 (encoded by nucleotides number 554 - 2536 of SEQ ID NO:3).
  • the extracellular domain is thus predicted to be amino acid numbers 1 - 912 of SEQ ID NO:4, encoded by nucleotides number 332 - 3064 of SEQ ID NO:3.
  • the intracellular (cytoplasmic) domain is thus predicted to be amino acid numbers 934 - 1257 of SEQ ID NO:4, encoded by nucleotide numbers 3131 - 4102 of SEQ ID NO:3.
  • HJ1 Like Human Serrate-1 (HJ1 ) , the "complete" (with an internal deletion) Human Serrate-2 (HJ2 ) cDNA (SEQ ID NO:3) generated on the computer encodes a protein containing 16 complete and 2 interrupted EGF repeats as well as the diagnostic cryptic EGF repeat known as the DSL domain, which has been found only in putative Notch ligands.
  • the open reading frame of the computer generated "complete" Human Serrate-2 (HJ2) is about 1400 amino acids long, approximately 182 amino acids longer than the carboxy terminus of HJ1 and the rat Serrate homologue Jagged.
  • HJ2 Human Serrate-2 cDNA sequence
  • SEQ ID NO:3 Human Serrate-2 (HJ2 ) cDNA sequence can be constructed by taking advantage of the unique restriction sites for Accl, Drain, or BamHI present in the sequence overlap of pBS15 and pBS3-2, and which enzymes cleave the pBS15 insert at nucleotides 1431, 2648, and 2802, respectively.
  • HJ2 The expression of HJ2 in certain human tissues was established by probing a Clontech Human Multiple Tissue Northern blot with radio-labeled clone pBS15. This probe hybridized to a single band of about 5.2 kb and was expressed in heart, brain, placenta, lung, skeletal muscle, and pancreas, but was absent or nearly undetectable in liver and kidney.
  • HJ1 expression discussed supra, the observation that the pBSl5 insert component of HJ2 was expressed in adult skeletal and heart muscle was particularly interesting, because adult muscle fibers are completely surrounded by a lamina of extracellular matrix, and it is unlikely, therefore, that the role of HJ2 in these cells is in direct cell-cell communication.
  • Expression constructs are made using the isolated clone(s) .
  • the clone is excised from its vector as an _ScoRI restriction fragment(s) and subcloned into the EcoRI restriction site of an expression vector. This allows for the expression of the Human Serrate protein product from the subclone in the correct reading frame.
  • expression constructs in which the HJ " ! cDNA insert of pBS39 was cloned into an expression vector for expression under the control of a cytomegalovirus promoter have been generated and HJ1 has been expressed in both 3T3 and HAKAT human keratinocyte cell lines.
  • Plasmid pBS15 containing a 3.1 kb EcoRI fragment encoding the amino terminus of Human Serrate-2 (HJ2) , cloned into the EcoRI site of Bluescript KS-, was deposited on March 5, 1996 with the American Type Culture Collection, 1201 Parklawn Drive, Rockville, Maryland 20852, under the provisions of the Budapest Treaty on the International Recognition of the Deposit of Microorganisms for the Purposes of Patent Procedures, and assigned Accession No. .
  • ATC GAT TAT TGT GAG CCT AAT CCC TGC CAG AAC GGT GCC CAG TGC TAC 1993 lie Asp Tyr Cys Glu Pro Asn Pro Cys Gin Asn Gly Ala Gin Cys Tyr
  • ATC TGT AGT GAC GGC TGG GAG GGG GCC TAC TGT GAA ACC AAT ATT AAT 2377 lie Cys Ser Asp Gly Trp Glu Gly Ala Tyr Cys Glu Thr Asn lie Asn
  • GGGTAGAGCT CAGGGGCTTT CTTATTGAAA TGGTCACATG ATAAAAACGG GCTGAAAAAG 5557

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Organic Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Veterinary Medicine (AREA)
  • Engineering & Computer Science (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Animal Behavior & Ethology (AREA)
  • General Chemical & Material Sciences (AREA)
  • Public Health (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Zoology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Genetics & Genomics (AREA)
  • Biophysics (AREA)
  • Biochemistry (AREA)
  • Molecular Biology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Toxicology (AREA)
  • Neurology (AREA)
  • Biomedical Technology (AREA)
  • Neurosurgery (AREA)
  • Insects & Arthropods (AREA)
  • Addiction (AREA)
  • Tropical Medicine & Parasitology (AREA)
  • Diabetes (AREA)
  • Dermatology (AREA)
  • Psychiatry (AREA)
  • Psychology (AREA)
  • Hematology (AREA)
  • Immunology (AREA)
  • Cell Biology (AREA)
  • Oncology (AREA)
  • Virology (AREA)
  • Vascular Medicine (AREA)
  • Orthopedic Medicine & Surgery (AREA)
PCT/US1996/003172 1995-03-07 1996-03-07 Nucleotide and protein sequences of vertebrate serrate genes and methods based thereon Ceased WO1996027610A1 (en)

Priority Applications (7)

Application Number Priority Date Filing Date Title
AT96911262T ATE442381T1 (de) 1995-03-07 1996-03-07 Nukleotid- und proteinsequenzen eines serrate- gens aus wirbeltieren und darauf basierende verfahren
EP96911262A EP0813545B1 (en) 1995-03-07 1996-03-07 Nucleotide and protein sequences of vertebrate serrate genes and methods based thereon
DK96911262T DK0813545T3 (da) 1995-03-07 1996-03-07 Nukleotid- og proteinsekvenser af hvirveldyrs-Serrate-gener og fremgangsmåde baseret derpå
DE69638022T DE69638022D1 (de) 1995-03-07 1996-03-07 Aus wirbeltieren und darauf basierende verfahren
AU54202/96A AU718955B2 (en) 1995-03-07 1996-03-07 Nucleotide and protein sequences of vertebrate serrate genes and methods based thereon
CA2214830A CA2214830C (en) 1995-03-07 1996-03-07 Nucleotide and protein sequences of vertebrate serrate genes and methods based thereon
JP8527061A JPH11507203A (ja) 1995-03-07 1996-03-07 脊椎動物Serrate遺伝子のヌクレオチドおよびタンパク質配列およびそれらに基づく方法

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US08/400,159 US5869282A (en) 1991-12-11 1995-03-07 Nucleotide and protein sequences of the serrate gene and methods based thereon
US08/400,159 1995-03-07

Publications (1)

Publication Number Publication Date
WO1996027610A1 true WO1996027610A1 (en) 1996-09-12

Family

ID=23582455

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US1996/003172 Ceased WO1996027610A1 (en) 1995-03-07 1996-03-07 Nucleotide and protein sequences of vertebrate serrate genes and methods based thereon

Country Status (11)

Country Link
US (1) US5869282A (enExample)
EP (1) EP0813545B1 (enExample)
JP (4) JPH11507203A (enExample)
AT (1) ATE442381T1 (enExample)
AU (1) AU718955B2 (enExample)
CA (1) CA2214830C (enExample)
DE (1) DE69638022D1 (enExample)
DK (1) DK0813545T3 (enExample)
ES (1) ES2333384T3 (enExample)
PT (1) PT813545E (enExample)
WO (1) WO1996027610A1 (enExample)

Cited By (31)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1998020142A1 (en) * 1996-11-07 1998-05-14 Lorantis Limited Notch
WO1998051799A1 (en) * 1997-05-14 1998-11-19 Asahi Kasei Kogyo Kabushiki Kaisha Novel differentiation inhibitor
WO1998058958A3 (en) * 1997-06-25 1999-04-01 Univ Washington Human jagged polypeptide, encoding nucleic acids and methods of use
WO2000025809A1 (en) * 1998-10-30 2000-05-11 Smith & Nephew Plc Compositions comprising notch receptor manipulating agents
US6149902A (en) * 1995-09-29 2000-11-21 Yale University Manipulation of non-terminally differentiated cells using the notch pathway
WO2001035990A2 (en) 1999-11-18 2001-05-25 Lorantis Limited Method for enhancing t cell reactivity toward tumour antigens
US6262025B1 (en) 1995-06-28 2001-07-17 Imperial Cancer Research Technology, Ltd. Nucleotide and protein sequences of vertebrate delta genes and methods based thereon
EP0861894A4 (en) * 1995-11-17 2002-08-07 Asahi Chemical Ind POLYPEPTIDE THAT SUPPRESSES DIFFERENTIATION
US6436650B1 (en) 1997-07-23 2002-08-20 Yale University Activated forms of notch and methods based thereon
RU2197262C2 (ru) * 1996-11-07 2003-01-27 Лорантис Лимитед Лиганд notch
WO2003012441A1 (en) * 2001-07-25 2003-02-13 Lorantis Limited Method for detecting modulators of notch signalling
WO2002018544A3 (en) * 2000-08-31 2003-06-12 Univ Loyola Chicago Method and reagents for treatment of skin disorders by modulating the notch pathway
US6692919B1 (en) 1997-07-23 2004-02-17 Yale University Activated forms of notch and methods based thereon
EP0913404A4 (en) * 1996-07-16 2004-05-12 Asahi Chemical Ind DIFFERENTIATION INHIBITOR
AU773479B2 (en) * 1996-11-07 2004-05-27 Lorantis Limited Notch
WO2004062686A3 (en) * 2003-01-09 2004-11-18 Lorantis Ltd Therapeutic use of modulators of notch
WO2004087195A3 (en) * 2003-04-01 2005-02-24 Lorantis Ltd Therapeutic use of modulators of notch and/or kruppel-like factors
US6887475B1 (en) 1996-11-07 2005-05-03 Lorantis Limited Notch
EP2011877A2 (en) 2001-07-25 2009-01-07 Celldex Therapeutics Limited Conjugates for the modulation of immune responses
WO2011127472A1 (en) 2010-04-09 2011-10-13 Fred Hutchinson Cancer Research Center Compositions and methods for providing hematopoietic function
WO2011127470A1 (en) 2010-04-09 2011-10-13 Fred Hutchinson Cancer Research Center Compositions and methods for providing hematopoietic function without hla matching
WO2013086436A1 (en) 2011-12-08 2013-06-13 Fred Hutchinson Cancer Research Center Compositions and methods for enhanced generation of hematopoietic stem/progenitor cells
WO2014110020A1 (en) 2013-01-08 2014-07-17 Fred Hutchinson Cancer Research Center Compositions and methods for expansion of embryonic hematopoietic stem cells
US9127053B2 (en) 2012-06-22 2015-09-08 Cytomx Therapeutics, Inc. Anti-jagged 1/jagged 2 cross-reactive antibodies, activatable anti-jagged antibodies and methods of use thereof
WO2016118780A1 (en) 2015-01-21 2016-07-28 Fred Hutchinson Cancer Research Center Point-of-care and/or portable platform for gene therapy
WO2016176652A2 (en) 2015-04-29 2016-11-03 Fred Hutchinson Cancer Research Center Modified stem cells and uses thereof
WO2020037323A1 (en) * 2018-08-17 2020-02-20 Frequency Therapeutics, Inc. Compositions and methods for generating hair cells by upregulating jag-1
US10813949B2 (en) 2015-12-04 2020-10-27 Fred Hutchinson Cancer Research Center Uses of expanded populations of hematopoietic stem/progenitor cells
EP3995142A2 (en) 2015-04-29 2022-05-11 Fred Hutchinson Cancer Research Center Modified hematopoietic stem/progenitor and non-t effector cells, and uses thereof
EP4083062A1 (en) 2013-10-31 2022-11-02 Fred Hutchinson Cancer Center Modified hematopoietic stem/progenitor and non-t effector cells, and uses thereof
US11617745B2 (en) 2018-08-17 2023-04-04 Frequency Therapeutics, Inc. Compositions and methods for generating hair cells by downregulating FOXO

Families Citing this family (30)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5869282A (en) * 1991-12-11 1999-02-09 Imperial Cancer Research Technology, Ltd. Nucleotide and protein sequences of the serrate gene and methods based thereon
US6004924A (en) 1991-12-11 1999-12-21 Imperial Cancer Research Technology, Ltd. Protein sequences of serrate gene products
US20050112121A1 (en) * 1992-04-30 2005-05-26 Yale University Therapeutic and diagnostic methods and compositions based on notch proteins and nucleic acids
US20050158859A1 (en) * 1995-09-29 2005-07-21 Yale University Manipulation of non-terminally differentiated cells using the Notch pathway
US8084258B2 (en) * 1999-07-12 2011-12-27 University Of Basel Manipulation of tissue of organ type using the notch pathway
US6984522B2 (en) * 2000-08-03 2006-01-10 Regents Of The University Of Michigan Isolation and use of solid tumor stem cells
US8044259B2 (en) 2000-08-03 2011-10-25 The Regents Of The University Of Michigan Determining the capability of a test compound to affect solid tumor stem cells
US20050089518A1 (en) * 2001-12-07 2005-04-28 Clarke Michael F. Prospective identification and characterization of breast cancer stem cells
AU2001297693A1 (en) * 2000-12-08 2002-09-12 Coley Pharmaceutical Gmbh Cpg-like nucleic acids and methods of use thereof
US20030185829A1 (en) * 2002-03-12 2003-10-02 Erich Koller Jagged 2 inhibitors for inducing apoptosis
US20040102401A1 (en) * 2002-11-22 2004-05-27 Isis Pharmaceuticals Inc. Modulation of jagged 1 expression
EP2003196A3 (en) * 2003-06-09 2009-01-07 The Regents of the University of Michigan Compositions and methods for treating and diagnosing cancer
WO2005074633A2 (en) * 2004-02-03 2005-08-18 The Regents Of The University Of Michigan Compositions and methods for characterizing, regulating, diagnosing, and treating cancer
US20060252073A1 (en) * 2005-04-18 2006-11-09 Regents Of The University Of Michigan Compositions and methods for the treatment of cancer
WO2006138275A2 (en) * 2005-06-13 2006-12-28 The Regents Of The University Of Michigan Compositions and methods for treating and diagnosing cancer
US20070099209A1 (en) * 2005-06-13 2007-05-03 The Regents Of The University Of Michigan Compositions and methods for treating and diagnosing cancer
PT2500360E (pt) 2005-10-31 2015-10-15 Oncomed Pharm Inc Composições e métodos para diagnóstico e tratamento do cancro
US7723477B2 (en) 2005-10-31 2010-05-25 Oncomed Pharmaceuticals, Inc. Compositions and methods for inhibiting Wnt-dependent solid tumor cell growth
US7723112B2 (en) * 2005-10-31 2010-05-25 The Regents Of The University Of Michigan Compositions and methods for treating and diagnosing cancer
WO2008121102A2 (en) * 2006-02-21 2008-10-09 The Regents Of The University Of Michigan Hedgehog signaling pathway antagonist cancer treatment
WO2008092002A2 (en) * 2007-01-24 2008-07-31 The Regents Of The University Of Michigan Compositions and methods for treating and diagnosing pancreatic cancer
WO2008140826A1 (en) * 2007-05-15 2008-11-20 Oncomed Pharmaceuticals, Inc. Compositions and methods for diagnosing and treating cancer
ES2663536T3 (es) 2008-09-26 2018-04-13 Oncomed Pharmaceuticals, Inc. Agentes que se unen a receptores frizzled y usos de los mismos
US8945569B2 (en) 2009-11-19 2015-02-03 Oncomed Pharmaceuticals, Inc. Jagged-binding agents and uses thereof
TWI535445B (zh) 2010-01-12 2016-06-01 安可美德藥物股份有限公司 Wnt拮抗劑及治療和篩選方法
CN102971337B (zh) 2010-04-01 2016-09-21 昂考梅德药品有限公司 卷曲蛋白结合药剂及其应用
HK1212216A1 (en) 2012-10-23 2016-06-10 Oncomed Pharmaceuticals, Inc. Methods of treating neuroendocrine tumors using wnt pathway-binding agents
JP2016510411A (ja) 2013-02-04 2016-04-07 オンコメッド ファーマシューティカルズ インコーポレイテッド Wnt経路インヒビターによる処置の方法およびモニタリング
US9168300B2 (en) 2013-03-14 2015-10-27 Oncomed Pharmaceuticals, Inc. MET-binding agents and uses thereof
CN112680471B (zh) * 2019-10-17 2023-08-01 华南农业大学 ZmSPL基因在调控玉米柱头乳突细胞发育中的应用

Citations (8)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4683202A (en) 1985-03-28 1987-07-28 Cetus Corporation Process for amplifying nucleic acid sequences
US4683195A (en) 1986-01-30 1987-07-28 Cetus Corporation Process for amplifying, detecting, and/or-cloning nucleic acid sequences
US4795699A (en) 1987-01-14 1989-01-03 President And Fellows Of Harvard College T7 DNA polymerase
US4889818A (en) 1986-08-22 1989-12-26 Cetus Corporation Purified thermostable enzyme
US4946778A (en) 1987-09-21 1990-08-07 Genex Corporation Single polypeptide chain binding molecules
WO1990011364A1 (en) 1989-03-24 1990-10-04 University Patents, Inc. Rna ribozyme restriction endoribonucleases and methods
WO1993012141A1 (en) 1991-12-11 1993-06-24 Yale University Nucleotide and protein sequences of the serrate gene and methods based thereon
US8902545B2 (en) 2012-06-28 2014-12-02 Showa Denko K.K. Magnetic recording medium and magnetic storage apparatus

Family Cites Families (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4981784A (en) * 1987-12-02 1991-01-01 The Salk Institute For Biological Studies Retinoic acid receptor method
IL101728A (en) * 1991-05-03 2007-08-19 Univ Yale Human Abandonment and Delta, Restrictive Areas of Effect in Tophoric Proteins, and Methods Based on Them
US5869282A (en) * 1991-12-11 1999-02-09 Imperial Cancer Research Technology, Ltd. Nucleotide and protein sequences of the serrate gene and methods based thereon
US5786158A (en) * 1992-04-30 1998-07-28 Yale University Therapeutic and diagnostic methods and compositions based on notch proteins and nucleic acids
US6337387B1 (en) * 1995-11-17 2002-01-08 Asahi Kasei Kabushiki Kaisha Differentiation-suppressive polypeptide
JP2000512134A (ja) * 1996-05-31 2000-09-19 ザ ナショナル アメリカン レッド クロス Jagged/Notchタンパク質および核酸に基づく治療および診断の方法および組成物
AU8003400A (en) * 1999-10-06 2001-05-10 Ansgar H. Santel Mitofusins, fzo homologs and functional derivatives thereof

Patent Citations (10)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4683202A (en) 1985-03-28 1987-07-28 Cetus Corporation Process for amplifying nucleic acid sequences
US4683202B1 (enExample) 1985-03-28 1990-11-27 Cetus Corp
US4683195A (en) 1986-01-30 1987-07-28 Cetus Corporation Process for amplifying, detecting, and/or-cloning nucleic acid sequences
US4683195B1 (enExample) 1986-01-30 1990-11-27 Cetus Corp
US4889818A (en) 1986-08-22 1989-12-26 Cetus Corporation Purified thermostable enzyme
US4795699A (en) 1987-01-14 1989-01-03 President And Fellows Of Harvard College T7 DNA polymerase
US4946778A (en) 1987-09-21 1990-08-07 Genex Corporation Single polypeptide chain binding molecules
WO1990011364A1 (en) 1989-03-24 1990-10-04 University Patents, Inc. Rna ribozyme restriction endoribonucleases and methods
WO1993012141A1 (en) 1991-12-11 1993-06-24 Yale University Nucleotide and protein sequences of the serrate gene and methods based thereon
US8902545B2 (en) 2012-06-28 2014-12-02 Showa Denko K.K. Magnetic recording medium and magnetic storage apparatus

Non-Patent Citations (108)

* Cited by examiner, † Cited by third party
Title
"Computer Graphics and Molecular Modeling, in Current Communications in Molecular Biology", 1986, COLD SPRING HARBOR LABORATORY
"DNA Cloning: A Practical Approach", vol. I, II, 1985, MRL PRESS, LTD.
"Useful proteins from recombinant bacteria", SCIENTIFIC AMERICAN, vol. 242, 1980, pages 74 - 94
ADAMES ET AL., NATURE, vol. 318, 1985, pages 533 - 538
ALEXANDER ET AL., MOL. CELL. BIOL., vol. 7, 1987, pages 1436 - 1444
APPELLA ET AL., J. BIOL. CHEM., vol. 262, 1987, pages 4437 - 4440
ARTAVANIS-TSAKONAS, S., TRENDS GENET., vol. 4, 1988, pages 95 - 100
ARTAVANIS-TSAKONAS, TRENDS GENET., vol. 4, 1988, pages 95 - 100
BENTON, W.; DAVIS, R., SCIENCE, vol. 196, 1977, pages 180
BERNOIST; CHAMBON, NATURE, vol. 290, 1981, pages 304 - 310
BRINSTER ET AL., NATURE, vol. 296, 1982, pages 39 - 42
CAGAN; READY, GENES DEV., vol. 3, 1989, pages 1099 - 1112
CELL, 24 March 1995, Vol. 80, LINDSELL et al., "Jagged: A Mammalian Ligand that Activates Notch1", pages 909-917. *
CHOU, P.; FASMAN, G., BIOCHEMISTRY, vol. 13, 1974, pages 222
COLE ET AL.: "Monoclonal Antibodies and Cancer Therapy", 1985, ALAN R. LISS, INC., pages: 77 - 96
COLE ET AL.: "Monoclonal Antibodies and Cancer Therapy", 1985, ALAN R. LISS, pages: 77 - 96
COTE ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 80, 1983, pages 2026 - 2030
DE LA CONCHA ET AL., GENETICS, vol. 118, 1988, pages 499 - 508
DEBOER ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 80, 1983, pages 21 - 25
DOE; GOODMAN, DEV. BIOL., vol. 111, 1985, pages 206 - 219
ENGSTOM, A., BIOCHEM. EXP. BIOL., vol. 11, 1974, pages 7 - 13
FEHON ET AL., CELL, vol. 61, 1990, pages 523 - 534
FREEMAN ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 80, 1983, pages 4094 - 4098
FURIE; FURIE, CELL, vol. 53, 1988, pages 505 - 518
GARDNER ET AL., NUCL. ACIDS RES., vol. 9, 1981, pages 2871
GAUTIER ET AL., NUCL. ACIDS RES., vol. 15, 1987, pages 6625 - 6641
GROSSCHEDL ET AL., CELL, vol. 38, 1984, pages 647 - 658
GRUNSTEIN, M.; HOGNESS, D., PROC. NATL. ACAD. SCI. U.S.A., vol. 72, 1975, pages 3961
GYLLENSTEIN ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 85, 1988, pages 7652 - 7656
HAMBURGER; HAMILTON, J. EXP. ZOOL., vol. 88, 1951, pages 49 - 92
HAMMER ET AL., SCIENCE, vol. 235, 1987, pages 53 - 58
HANAHAN, NATURE, vol. 315, 1985, pages 115 - 122
HERRERA-ESTRELLA ET AL., NATURE, vol. 303, pages 209 - 213
HERRERA-ESTRELLA ET AL., NATURE, vol. 310, 1984, pages 115 - 120
HOPP, T.; WOODS, K., PROC. NATL. ACAD. SCI. U.S.A., vol. 78, 1981, pages 3824
HOPP; WOODS, PROC. NATL. ACAD. SCI. U.S.A., vol. 78, 1981, pages 3824 - 3828
HUNKAPILLER, M. ET AL., NATURE, vol. 310, 1984, pages 105 - 111
HUSE ET AL., SCIENCE, vol. 246, 1989, pages 1275 - 1281
HUTCHINSON, C. ET AL., J. BIOL. CHEM, vol. 253, 1978, pages 6551
INOUE ET AL., FEBS LETT., vol. 215, 1987, pages 327 - 330
INOUE ET AL., NUCL. ACIDS RES., vol. 15, 1987, pages 6131 - 6148
JURGENS ET AL., WILHELM ROUX'S ARCH. DEV. BIOL., vol. 193, 1984, pages 283 - 295
KELSEY ET AL., GENES AND DEVEL., vol. 1, 1987, pages 161 - 171
KIDD; YOUNG, MOL. CELL. BIOL., vol. 6, 1986, pages 3094 - 3108
KNUST ET AL., EMBO J., 1987, pages 761 - 766
KOHLER; MILSTEIN, NATURE, vol. 256, 1975, pages 495 - 497
KOLLIAS ET AL., CELL, vol. 46, 1986, pages 89 - 94
KOPCZYNSKI ET AL., GENES DEV., vol. 2, 1988, pages 1723 - 1735
KOZBOR ET AL., IMMUNOLOGY TODAY, vol. 4, 1983, pages 72
KRUMLAUF ET AL., MOL. CELL. BIOL., vol. 5, 1985, pages 1639 - 1648
KUROSAWA ET AL., J. BIOL. CHEM, vol. 263, 1988, pages 5993 - 5996
KYTE; DOOLITTLE, J. MOL. BIOL., vol. 157, 1982, pages 105 - 132
LARDELLI ET AL., MECHANISMS OF DEVELOPMENT, vol. 46, 1994, pages 123 - 136
LARDELLI; LENDAHL, EXP. CELL RES., vol. 20, no. 4, 1993, pages 364 - 372
LEDER ET AL., CELL, vol. 45, 1986, pages 485 - 495
LEHMANN ET AL., WILHELM ROUX'S ARCH. DEV. BIOL., vol. 192, 1983, pages 62 - 74
LOH ET AL., SCIENCE, vol. 243, 1989, pages 217 - 220
MACDONALD, HEPATOLOGY, vol. 7, 1987, pages 425 - 515
MANIATIS, T.: "Molecular Cloning, A Laboratory Manual", 1990, COLD SPRING HARBOR LABORATORY
MANIATIS, T.: "Molecular Cloning, A Laboratory", 1982, COLD SPRING HARBOR
MASON ET AL., SCIENCE, vol. 234, 1986, pages 1372 - 1378
MAXAM; GILBERT, METH. ENZYMOL., vol. 65, 1980, pages 499 - 560
MOGRAM ET AL., NATURE, vol. 315, 1985, pages 338 - 340
MORGAN ET AL., BIBLIOGR. GENET., vol. 2, 1925, pages 1 - 226
MORRISON ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 81, 1984, pages 6851 - 6855
NATURE, 29 June 1995, Vol. 375, CHITNIS et al., "Primary Neurogenesis in Xenopus Embryos Regulated by a Homologue of the Drosophila Neurogenic Gene Delta", pages 761-766. *
NATURE, 29 June 1995, Vol. 375, HENRIQUE et al., "Expression of a Delta Homologue in Prospective Neurons in the Chick", pages 787-790. *
NEUBERGER ET AL., NATURE, vol. 312, 1984, pages 604 - 608
NUSSLEIN-VOLHARD ET AL., WILHELM ROUX'S ARCH. DEV. BIOL., vol. 193, 1984, pages 267 - 282
OCHMAN ET AL., GENETICS, vol. 120, 1988, pages 621 - 623
ORNITZ ET AL., COLD SPRING HARBOR SYMP. QUANT. BIOL., vol. 50, 1986, pages 399 - 409
PINKERT ET AL., GENES AND DEVEL., vol. 1, 1987, pages 268 - 276
POULSON, PROC. NATL. ACAD. SCI., vol. 23, 1937, pages 133 - 137
PREISS ET AL., EMBO J., vol. 7, 1988, pages 3917 - 3927
READHEAD ET AL., CELL, vol. 48, 1987, pages 703 - 712
REBAY ET AL., CELL, vol. 67, 1991, pages 687 - 699
REES ET AL., EMBO J., vol. 7, 1988, pages 2053 - 2061
ROTHBERG ET AL., CELL, vol. 55, 1988, pages 1047 - 1059
SAMBROOK ET AL.: "Molecular Cloning, A Laboratory Manual", 1989, COLD SPRING HARBOR LABORATORY PRESS
SAMBROOK ET AL.: "Molecular Cloning: A Laboratory Manual", 1989, COLD SPRING HARBOR LABORATORY PRESS
SANGER, F. ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 74, 1977, pages 5463
SANI, NATURE, vol. 314, 1985, pages 283 - 286
SARIN ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 85, 1988, pages 7448 - 7451
SARVER ET AL., SCIENCE, vol. 247, 1990, pages 1222 - 1225
SHELLENBARGER; MOHLER, DEV. BIOL., vol. 62, 1978, pages 432 - 446
SHILO; WEINBERG, PROC. NATL. ACAD. SCI. USA, vol. 78, 1981, pages 6789 - 6792
SOCIETY FOR NEUROSCIENCE ABSTRACTS, 11 November 1995, Vol. 21, No. 1-3, Abstract 601.1, GRAY et al., "Human Ligands of the Notch Receptor", page 1524. *
SOUTHERN, E.M., J. MOL. BIOL., vol. 98, 1975, pages 503 - 517
STEIN ET AL., NUCL. ACIDS RES., vol. 16, 1988, pages 3209
SUDHOF ET AL., SCIENCE, vol. 228, 1985, pages 815 - 822
SUZUKI ET AL., EMBO J., vol. 6, 1987, pages 1891 - 1897
SWIFT ET AL., CELL, vol. 38, 1984, pages 639 - 646
TAKEDA ET AL., NATURE, vol. 314, 1985, pages 452 - 454
TECHNAU; CAMPOS-ORTEGA, DEV. BIOL., vol. 195, 1986, pages 445 - 454
TECHNAU; CAMPOS-ORTEGA, WILHELM ROUX'S DEV. BIOL., vol. 195, 1986, pages 445 - 454
TOMLISON; READY, DEV. BIOL., vol. 120, 1987, pages 366 - 376
VASSIN ET AL., EMBO J., vol. 6, 1987, pages 3431 - 3440
VASSIN ET AL., J. NEUROGENET., vol. 2, 1985, pages 291 - 308
VILLA-KAMAROFF ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 75, 1978, pages 3727 - 3731
WAGNER ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 78, 1981, pages 1441 - 1445
WEINMASTER ET AL., DEVELOPMENT, vol. 113, 1991, pages 199 - 205
WEINMASTER ET AL., DEVELOPMENT, vol. 116, 1992, pages 931 - 941
WELSHONS, DROS. I INF. SERV., vol. 30, 1956, pages 157 - 158
WHARTON ET AL., CELL, vol. 43, 1985, pages 567 - 581
WIESCHAUS ET AL., WILHELM ROUX'S ARCH. DEV. BIOL., vol. 193, 1984, pages 296 - 307
XU ET AL., GENES DEV., vol. 4, 1990, pages 464 - 475
YAMAMOTO ET AL., CELL, vol. 22, 1980, pages 787 - 797
YOCHEM ET AL., NATURE, vol. 335, 1988, pages 547 - 550

Cited By (61)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US7928071B2 (en) 1995-06-28 2011-04-19 Yale Universtiy Nucleotide and protein sequences of vertebrate delta genes and methods based thereon
US7118890B2 (en) 1995-06-28 2006-10-10 Yale University Antibodies to vertebrate delta proteins and fragments
US8415303B2 (en) 1995-06-28 2013-04-09 Imperial Cancer Research Technology, Ltd. Method of treatment using a soluble human delta protein fragment
US6262025B1 (en) 1995-06-28 2001-07-17 Imperial Cancer Research Technology, Ltd. Nucleotide and protein sequences of vertebrate delta genes and methods based thereon
US6783956B2 (en) 1995-06-28 2004-08-31 Yale University Nucleotide and protein sequences of vertebrate delta genes and methods based thereon
US6149902A (en) * 1995-09-29 2000-11-21 Yale University Manipulation of non-terminally differentiated cells using the notch pathway
US7179622B2 (en) 1995-11-17 2007-02-20 Asahi Kasei Kabushiki Kaisha Method of suppressing differentiation by administering a human serrate-1 polypeptide
US7253265B2 (en) 1995-11-17 2007-08-07 Asahi Kasei Kabushiki Kaisha Antibody and a method for producing an antibody that specifically binds to a full length amino acid sequence of human Delta-1
US7141379B2 (en) 1995-11-17 2006-11-28 Asahi Kasei Kabushiki Kaisha Method of suppressing differentiation by administering a human serrate-1 polypeptide
US7198918B2 (en) 1995-11-17 2007-04-03 Asahi Kasei Kabushiki Kaisha Nucleic acid encoding a human serrate-1 polypeptide
EP0861894A4 (en) * 1995-11-17 2002-08-07 Asahi Chemical Ind POLYPEPTIDE THAT SUPPRESSES DIFFERENTIATION
EP0913404A4 (en) * 1996-07-16 2004-05-12 Asahi Chemical Ind DIFFERENTIATION INHIBITOR
US7138276B2 (en) 1996-07-16 2006-11-21 Asahi Kasei Kabushiki Kaisha Differentiation-suppressive polypeptide serrate-2 and methods of use
AU736361B2 (en) * 1996-11-07 2001-07-26 Lorantis Limited Notch
WO1998020142A1 (en) * 1996-11-07 1998-05-14 Lorantis Limited Notch
GB2335194A (en) * 1996-11-07 1999-09-15 Lorantis Ltd Notch
RU2197262C2 (ru) * 1996-11-07 2003-01-27 Лорантис Лимитед Лиганд notch
EP1616958A3 (en) * 1996-11-07 2006-02-08 Lorantis Limited Notch-ligands for use in immunotherapy
US6887475B1 (en) 1996-11-07 2005-05-03 Lorantis Limited Notch
US7399741B2 (en) 1996-11-07 2008-07-15 Celldex Therapeutics Limited Notch
GB2335194B (en) * 1996-11-07 2001-04-25 Lorantis Ltd Notch
AU773479B2 (en) * 1996-11-07 2004-05-27 Lorantis Limited Notch
US7022499B2 (en) 1997-05-14 2006-04-04 Asahi Kasei Kabushiki Kaisha Nucleic acids encoding differentiation inhibitor delta 2
WO1998051799A1 (en) * 1997-05-14 1998-11-19 Asahi Kasei Kogyo Kabushiki Kaisha Novel differentiation inhibitor
US6664098B1 (en) 1997-05-14 2003-12-16 Asahi Kasei Kabushiki Kaisha Differentiation inhibitory agent
US6136952A (en) * 1997-06-25 2000-10-24 University Of Washington Human jagged polypeptide, encoding nucleic acids and methods of use
US6703198B1 (en) 1997-06-25 2004-03-09 The University Of Washington Methods of diagnosing alagille syndrome
WO1998058958A3 (en) * 1997-06-25 1999-04-01 Univ Washington Human jagged polypeptide, encoding nucleic acids and methods of use
US6436650B1 (en) 1997-07-23 2002-08-20 Yale University Activated forms of notch and methods based thereon
US8222213B2 (en) 1997-07-23 2012-07-17 Yale University Activated amino- and carboxy-terminal forms of Notch
US6692919B1 (en) 1997-07-23 2004-02-17 Yale University Activated forms of notch and methods based thereon
US7727732B2 (en) 1997-07-23 2010-06-01 Yale University Methods for identifying modulators of Notch activation
WO2000025809A1 (en) * 1998-10-30 2000-05-11 Smith & Nephew Plc Compositions comprising notch receptor manipulating agents
WO2001035990A2 (en) 1999-11-18 2001-05-25 Lorantis Limited Method for enhancing t cell reactivity toward tumour antigens
US7678758B2 (en) 1999-11-18 2010-03-16 Celldex Therapeutics Ltd. Method for enhancing T cell reactivity toward tumour antigens
WO2002018544A3 (en) * 2000-08-31 2003-06-12 Univ Loyola Chicago Method and reagents for treatment of skin disorders by modulating the notch pathway
WO2003012441A1 (en) * 2001-07-25 2003-02-13 Lorantis Limited Method for detecting modulators of notch signalling
WO2003011317A1 (en) * 2001-07-25 2003-02-13 Lorantis Limited Modulators of notch signalling for use in immunotherapy
EP2011877A2 (en) 2001-07-25 2009-01-07 Celldex Therapeutics Limited Conjugates for the modulation of immune responses
WO2004062686A3 (en) * 2003-01-09 2004-11-18 Lorantis Ltd Therapeutic use of modulators of notch
WO2004087195A3 (en) * 2003-04-01 2005-02-24 Lorantis Ltd Therapeutic use of modulators of notch and/or kruppel-like factors
EP3097917A1 (en) 2010-04-09 2016-11-30 Fred Hutchinson Cancer Research Center Compositions and methods for providing hematopoietic function without hla matching
WO2011127472A1 (en) 2010-04-09 2011-10-13 Fred Hutchinson Cancer Research Center Compositions and methods for providing hematopoietic function
WO2011127470A1 (en) 2010-04-09 2011-10-13 Fred Hutchinson Cancer Research Center Compositions and methods for providing hematopoietic function without hla matching
EP3590520A1 (en) 2010-04-09 2020-01-08 Fred Hutchinson Cancer Research Center Compositions for providing hematopoietic function without hla matching
EP3097916A1 (en) 2010-04-09 2016-11-30 Fred Hutchinson Cancer Research Center Compositions and methods for providing hematopoietic function
WO2013086436A1 (en) 2011-12-08 2013-06-13 Fred Hutchinson Cancer Research Center Compositions and methods for enhanced generation of hematopoietic stem/progenitor cells
US9834755B2 (en) 2011-12-08 2017-12-05 Fred Hutchinson Cancer Research Center Compositions and methods for enhanced generation of hematopoietic stem/progenitor cells
US10301380B2 (en) 2012-06-22 2019-05-28 Cytomx Therapeutics, Inc. Anti-jagged 1/jagged 2 cross-reactive antibodies, activatable anti-jagged antibodies and methods of use thereof
US9127053B2 (en) 2012-06-22 2015-09-08 Cytomx Therapeutics, Inc. Anti-jagged 1/jagged 2 cross-reactive antibodies, activatable anti-jagged antibodies and methods of use thereof
US9688748B2 (en) 2012-06-22 2017-06-27 Cytomx Therapeutics, Inc. Anti-jagged 1/jagged 2 cross-reactive antibodies, activatable anti-jagged antibodies and methods of use thereof
WO2014110020A1 (en) 2013-01-08 2014-07-17 Fred Hutchinson Cancer Research Center Compositions and methods for expansion of embryonic hematopoietic stem cells
EP4083062A1 (en) 2013-10-31 2022-11-02 Fred Hutchinson Cancer Center Modified hematopoietic stem/progenitor and non-t effector cells, and uses thereof
WO2016118780A1 (en) 2015-01-21 2016-07-28 Fred Hutchinson Cancer Research Center Point-of-care and/or portable platform for gene therapy
WO2016176652A2 (en) 2015-04-29 2016-11-03 Fred Hutchinson Cancer Research Center Modified stem cells and uses thereof
EP3995142A2 (en) 2015-04-29 2022-05-11 Fred Hutchinson Cancer Research Center Modified hematopoietic stem/progenitor and non-t effector cells, and uses thereof
US10813949B2 (en) 2015-12-04 2020-10-27 Fred Hutchinson Cancer Research Center Uses of expanded populations of hematopoietic stem/progenitor cells
WO2020037323A1 (en) * 2018-08-17 2020-02-20 Frequency Therapeutics, Inc. Compositions and methods for generating hair cells by upregulating jag-1
CN113195707A (zh) * 2018-08-17 2021-07-30 频率治疗公司 用于通过上调jag-1来生成毛细胞的组合物和方法
US11162071B2 (en) 2018-08-17 2021-11-02 Frequency Therapeutics, Inc. Compositions and methods for generating hair cells by upregulating JAG-1
US11617745B2 (en) 2018-08-17 2023-04-04 Frequency Therapeutics, Inc. Compositions and methods for generating hair cells by downregulating FOXO

Also Published As

Publication number Publication date
PT813545E (pt) 2009-12-16
JP2008099687A (ja) 2008-05-01
ES2333384T3 (es) 2010-02-19
CA2214830C (en) 2012-06-12
US5869282A (en) 1999-02-09
ATE442381T1 (de) 2009-09-15
JP2013150605A (ja) 2013-08-08
JPH11507203A (ja) 1999-06-29
DE69638022D1 (de) 2009-10-22
DK0813545T3 (da) 2009-12-14
AU718955B2 (en) 2000-05-04
EP0813545B1 (en) 2009-09-09
EP0813545A4 (en) 2002-04-24
JP2010273685A (ja) 2010-12-09
EP0813545A1 (en) 1997-12-29
AU5420296A (en) 1996-09-23
CA2214830A1 (en) 1996-09-12

Similar Documents

Publication Publication Date Title
CA2214830C (en) Nucleotide and protein sequences of vertebrate serrate genes and methods based thereon
US7928071B2 (en) Nucleotide and protein sequences of vertebrate delta genes and methods based thereon
US6703489B1 (en) Antibodies to vertebrate serrate proteins and fragments
CA2145778C (en) Therapeutic and diagnostic methods and compositions based on notch proteins and nucleic acids
US20050112121A1 (en) Therapeutic and diagnostic methods and compositions based on notch proteins and nucleic acids
US5750652A (en) Deltex proteins
WO1994007522A1 (en) Therapeutic and diagnostic methods and compositions based on transducin-like enhancer of split proteins and nucleic acids
WO1994007522A9 (en) Therapeutic and diagnostic methods and compositions based on transducin-like enhancer of split proteins and nucleic acids
AU728798B2 (en) Vertebrate deltex proteins, nucleic acids, and antibodies, and related methods and compositions
WO1997018822A9 (en) Vertebrate deltex proteins, nucleic acids, and antibodies, and related methods and compositions

Legal Events

Date Code Title Description
AK Designated states

Kind code of ref document: A1

Designated state(s): AL AM AU AZ BB BG BR BY CA CN CZ EE FI GE HU IS JP KG KP KR KZ LK LR LS LT LV MD MG MK MN MX NO NZ PL RO RU SG SI SK TJ TM TR TT UA US UZ VN AM AZ BY KG KZ MD RU TJ TM

AL Designated countries for regional patents

Kind code of ref document: A1

Designated state(s): KE LS MW SD SZ UG AT BE CH DE DK ES FI FR GB GR IE IT LU MC NL PT SE BF BJ CF CG CI CM GA GN ML MR NE SN TD TG

121 Ep: the epo has been informed by wipo that ep was designated in this application
DFPE Request for preliminary examination filed prior to expiration of 19th month from priority date (pct application filed before 20040101)
ENP Entry into the national phase

Ref document number: 2214830

Country of ref document: CA

Ref country code: JP

Ref document number: 1996 527061

Kind code of ref document: A

Format of ref document f/p: F

Ref country code: CA

Ref document number: 2214830

Kind code of ref document: A

Format of ref document f/p: F

WWE Wipo information: entry into national phase

Ref document number: 1996911262

Country of ref document: EP

WWP Wipo information: published in national office

Ref document number: 1996911262

Country of ref document: EP