WO1984000687A1 - Broad spectrum influenza antisera - Google Patents
Broad spectrum influenza antisera Download PDFInfo
- Publication number
- WO1984000687A1 WO1984000687A1 PCT/US1983/001291 US8301291W WO8400687A1 WO 1984000687 A1 WO1984000687 A1 WO 1984000687A1 US 8301291 W US8301291 W US 8301291W WO 8400687 A1 WO8400687 A1 WO 8400687A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- terminus
- peptide
- amino acid
- amino
- acid residue
- Prior art date
Links
- 206010022000 influenza Diseases 0.000 title description 18
- 108090000765 processed proteins & peptides Proteins 0.000 claims abstract description 177
- 101710154606 Hemagglutinin Proteins 0.000 claims abstract description 68
- 101710093908 Outer capsid protein VP4 Proteins 0.000 claims abstract description 68
- 101710135467 Outer capsid protein sigma-1 Proteins 0.000 claims abstract description 68
- 101710176177 Protein A56 Proteins 0.000 claims abstract description 68
- 239000000185 hemagglutinin Substances 0.000 claims abstract description 66
- 241000712461 unidentified influenza virus Species 0.000 claims abstract description 35
- 125000000539 amino acid group Chemical group 0.000 claims description 64
- 210000004899 c-terminal region Anatomy 0.000 claims description 33
- 229960005486 vaccine Drugs 0.000 claims description 28
- 241001465754 Metazoa Species 0.000 claims description 13
- 238000004519 manufacturing process Methods 0.000 claims description 10
- 125000000151 cysteine group Chemical group N[C@@H](CS)C(=O)* 0.000 claims description 8
- KKEBXNMGHUCPEZ-UHFFFAOYSA-N 4-phenyl-1-(2-sulfanylethyl)imidazolidin-2-one Chemical compound N1C(=O)N(CCS)CC1C1=CC=CC=C1 KKEBXNMGHUCPEZ-UHFFFAOYSA-N 0.000 claims description 7
- 230000002163 immunogen Effects 0.000 claims description 7
- 125000003396 thiol group Chemical group [H]S* 0.000 claims description 5
- 230000001939 inductive effect Effects 0.000 claims description 4
- 102000004196 processed proteins & peptides Human genes 0.000 abstract description 68
- 238000000034 method Methods 0.000 abstract description 11
- 208000015181 infectious disease Diseases 0.000 abstract description 6
- 241000700605 Viruses Species 0.000 description 61
- 230000003472 neutralizing effect Effects 0.000 description 29
- 210000004027 cell Anatomy 0.000 description 20
- 239000000562 conjugate Substances 0.000 description 20
- XUJNEKJLAYXESH-REOHCLBHSA-N L-Cysteine Chemical compound SC[C@H](N)C(O)=O XUJNEKJLAYXESH-REOHCLBHSA-N 0.000 description 19
- 229920002684 Sepharose Polymers 0.000 description 19
- 235000018417 cysteine Nutrition 0.000 description 18
- 238000006386 neutralization reaction Methods 0.000 description 18
- 230000002788 anti-peptide Effects 0.000 description 17
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 17
- 230000003053 immunization Effects 0.000 description 17
- 210000002966 serum Anatomy 0.000 description 17
- 238000002649 immunization Methods 0.000 description 15
- 230000000120 cytopathologic effect Effects 0.000 description 10
- 238000002347 injection Methods 0.000 description 10
- 239000007924 injection Substances 0.000 description 10
- 108010045069 keyhole-limpet hemocyanin Proteins 0.000 description 10
- 241000699670 Mus sp. Species 0.000 description 9
- 241000283973 Oryctolagus cuniculus Species 0.000 description 9
- 241000699666 Mus <mouse, genus> Species 0.000 description 8
- 239000002671 adjuvant Substances 0.000 description 8
- 238000010790 dilution Methods 0.000 description 8
- 239000012895 dilution Substances 0.000 description 8
- 230000000694 effects Effects 0.000 description 8
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 7
- 238000003556 assay Methods 0.000 description 7
- 239000002609 medium Substances 0.000 description 7
- 239000000203 mixture Substances 0.000 description 7
- 238000002255 vaccination Methods 0.000 description 7
- 238000006243 chemical reaction Methods 0.000 description 6
- 238000003776 cleavage reaction Methods 0.000 description 6
- 239000000463 material Substances 0.000 description 6
- 239000002243 precursor Substances 0.000 description 6
- 108090000623 proteins and genes Proteins 0.000 description 6
- 230000004044 response Effects 0.000 description 6
- 230000007017 scission Effects 0.000 description 6
- 108010001336 Horseradish Peroxidase Proteins 0.000 description 5
- 150000001413 amino acids Chemical class 0.000 description 5
- 210000003719 b-lymphocyte Anatomy 0.000 description 5
- 239000000969 carrier Substances 0.000 description 5
- 125000004122 cyclic group Chemical group 0.000 description 5
- 235000018102 proteins Nutrition 0.000 description 5
- 102000004169 proteins and genes Human genes 0.000 description 5
- ZDXPYRJPNDTMRX-VKHMYHEASA-N L-glutamine Chemical compound OC(=O)[C@@H](N)CCC(N)=O ZDXPYRJPNDTMRX-VKHMYHEASA-N 0.000 description 4
- 230000006052 T cell proliferation Effects 0.000 description 4
- 239000002253 acid Substances 0.000 description 4
- 229940037003 alum Drugs 0.000 description 4
- 239000003153 chemical reaction reagent Substances 0.000 description 4
- 230000028993 immune response Effects 0.000 description 4
- 239000011780 sodium chloride Substances 0.000 description 4
- 239000000243 solution Substances 0.000 description 4
- 229920000936 Agarose Polymers 0.000 description 3
- 108091003079 Bovine Serum Albumin Proteins 0.000 description 3
- 241000282465 Canis Species 0.000 description 3
- 102000001189 Cyclic Peptides Human genes 0.000 description 3
- 108010069514 Cyclic Peptides Proteins 0.000 description 3
- WHUUTDBJXJRKMK-GSVOUGTGSA-N D-glutamic acid Chemical compound OC(=O)[C@H](N)CCC(O)=O WHUUTDBJXJRKMK-GSVOUGTGSA-N 0.000 description 3
- 238000012286 ELISA Assay Methods 0.000 description 3
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 3
- WHUUTDBJXJRKMK-UHFFFAOYSA-N Glutamic acid Natural products OC(=O)C(N)CCC(O)=O WHUUTDBJXJRKMK-UHFFFAOYSA-N 0.000 description 3
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 3
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 3
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 3
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 3
- 239000004952 Polyamide Substances 0.000 description 3
- 108010008038 Synthetic Vaccines Proteins 0.000 description 3
- 210000001744 T-lymphocyte Anatomy 0.000 description 3
- 238000007792 addition Methods 0.000 description 3
- 230000005875 antibody response Effects 0.000 description 3
- 239000000427 antigen Substances 0.000 description 3
- 230000000890 antigenic effect Effects 0.000 description 3
- 102000036639 antigens Human genes 0.000 description 3
- 108091007433 antigens Proteins 0.000 description 3
- 230000036755 cellular response Effects 0.000 description 3
- 239000012897 dilution medium Substances 0.000 description 3
- 201000010099 disease Diseases 0.000 description 3
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 3
- 230000001900 immune effect Effects 0.000 description 3
- 230000005847 immunogenicity Effects 0.000 description 3
- 210000003734 kidney Anatomy 0.000 description 3
- 230000003647 oxidation Effects 0.000 description 3
- 238000007254 oxidation reaction Methods 0.000 description 3
- 229920002647 polyamide Polymers 0.000 description 3
- 230000010076 replication Effects 0.000 description 3
- 238000010254 subcutaneous injection Methods 0.000 description 3
- 239000007929 subcutaneous injection Substances 0.000 description 3
- 238000012360 testing method Methods 0.000 description 3
- 125000004035 thiopropyl group Chemical group [H]SC([H])([H])C([H])([H])C([H])([H])* 0.000 description 3
- 238000004448 titration Methods 0.000 description 3
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 3
- 239000004475 Arginine Substances 0.000 description 2
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 description 2
- 238000002965 ELISA Methods 0.000 description 2
- 108090000790 Enzymes Proteins 0.000 description 2
- 102000004190 Enzymes Human genes 0.000 description 2
- 229930182816 L-glutamine Natural products 0.000 description 2
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 description 2
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 2
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 2
- 239000004472 Lysine Substances 0.000 description 2
- 241000187479 Mycobacterium tuberculosis Species 0.000 description 2
- 239000013543 active substance Substances 0.000 description 2
- 239000003242 anti bacterial agent Substances 0.000 description 2
- 229940088710 antibiotic agent Drugs 0.000 description 2
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 2
- 235000009582 asparagine Nutrition 0.000 description 2
- 229960001230 asparagine Drugs 0.000 description 2
- 244000309464 bull Species 0.000 description 2
- 230000008878 coupling Effects 0.000 description 2
- 238000010168 coupling process Methods 0.000 description 2
- 238000005859 coupling reaction Methods 0.000 description 2
- 230000009260 cross reactivity Effects 0.000 description 2
- 210000002919 epithelial cell Anatomy 0.000 description 2
- 210000003743 erythrocyte Anatomy 0.000 description 2
- 239000012894 fetal calf serum Substances 0.000 description 2
- 239000012530 fluid Substances 0.000 description 2
- 235000013922 glutamic acid Nutrition 0.000 description 2
- 239000004220 glutamic acid Substances 0.000 description 2
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 2
- 230000008348 humoral response Effects 0.000 description 2
- 210000004408 hybridoma Anatomy 0.000 description 2
- 230000008105 immune reaction Effects 0.000 description 2
- 230000016784 immunoglobulin production Effects 0.000 description 2
- 230000002458 infectious effect Effects 0.000 description 2
- 239000002054 inoculum Substances 0.000 description 2
- 238000002955 isolation Methods 0.000 description 2
- AGPKZVBTJJNPAG-UHFFFAOYSA-N isoleucine Natural products CCC(C)C(N)C(O)=O AGPKZVBTJJNPAG-UHFFFAOYSA-N 0.000 description 2
- 229960000310 isoleucine Drugs 0.000 description 2
- 239000008363 phosphate buffer Substances 0.000 description 2
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 2
- 230000008569 process Effects 0.000 description 2
- 230000002285 radioactive effect Effects 0.000 description 2
- 230000006798 recombination Effects 0.000 description 2
- 238000013207 serial dilution Methods 0.000 description 2
- UCSJYZPVAKXKNQ-HZYVHMACSA-N streptomycin Chemical compound CN[C@H]1[C@H](O)[C@@H](O)[C@H](CO)O[C@H]1O[C@@H]1[C@](C=O)(O)[C@H](C)O[C@H]1O[C@@H]1[C@@H](NC(N)=N)[C@H](O)[C@@H](NC(N)=N)[C@H](O)[C@H]1O UCSJYZPVAKXKNQ-HZYVHMACSA-N 0.000 description 2
- 230000029812 viral genome replication Effects 0.000 description 2
- 230000009385 viral infection Effects 0.000 description 2
- PNDPGZBMCMUPRI-HVTJNCQCSA-N 10043-66-0 Chemical compound [131I][131I] PNDPGZBMCMUPRI-HVTJNCQCSA-N 0.000 description 1
- QGZKDVFQNNGYKY-OUBTZVSYSA-N Ammonia-15N Chemical compound [15NH3] QGZKDVFQNNGYKY-OUBTZVSYSA-N 0.000 description 1
- 206010003445 Ascites Diseases 0.000 description 1
- BVKZGUZCCUSVTD-UHFFFAOYSA-M Bicarbonate Chemical compound OC([O-])=O BVKZGUZCCUSVTD-UHFFFAOYSA-M 0.000 description 1
- 108700000434 Cannabis sativa edestin Proteins 0.000 description 1
- 241000283707 Capra Species 0.000 description 1
- 229930182847 D-glutamic acid Natural products 0.000 description 1
- KDXKERNSBIXSRK-RXMQYKEDSA-N D-lysine Chemical compound NCCCC[C@@H](N)C(O)=O KDXKERNSBIXSRK-RXMQYKEDSA-N 0.000 description 1
- 229920002307 Dextran Polymers 0.000 description 1
- 238000003072 Ellman's test Methods 0.000 description 1
- VGGSQFUCUMXWEO-UHFFFAOYSA-N Ethene Chemical compound C=C VGGSQFUCUMXWEO-UHFFFAOYSA-N 0.000 description 1
- 239000005977 Ethylene Substances 0.000 description 1
- PXGOKWXKJXAPGV-UHFFFAOYSA-N Fluorine Chemical compound FF PXGOKWXKJXAPGV-UHFFFAOYSA-N 0.000 description 1
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 1
- 239000004471 Glycine Substances 0.000 description 1
- 241000282412 Homo Species 0.000 description 1
- 108091006905 Human Serum Albumin Proteins 0.000 description 1
- 102000008100 Human Serum Albumin Human genes 0.000 description 1
- 241000712431 Influenza A virus Species 0.000 description 1
- 241000713196 Influenza B virus Species 0.000 description 1
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 1
- ODKSFYDXXFIFQN-BYPYZUCNSA-P L-argininium(2+) Chemical compound NC(=[NH2+])NCCC[C@H]([NH3+])C(O)=O ODKSFYDXXFIFQN-BYPYZUCNSA-P 0.000 description 1
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 1
- KDXKERNSBIXSRK-YFKPBYRVSA-N L-lysine Chemical compound NCCCC[C@H](N)C(O)=O KDXKERNSBIXSRK-YFKPBYRVSA-N 0.000 description 1
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 1
- COLNVLDHVKWLRT-QMMMGPOBSA-N L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=CC=C1 COLNVLDHVKWLRT-QMMMGPOBSA-N 0.000 description 1
- 101710180643 Leishmanolysin Proteins 0.000 description 1
- LSDPWZHWYPCBBB-UHFFFAOYSA-N Methanethiol Chemical compound SC LSDPWZHWYPCBBB-UHFFFAOYSA-N 0.000 description 1
- 238000005481 NMR spectroscopy Methods 0.000 description 1
- 108091028043 Nucleic acid sequence Proteins 0.000 description 1
- 229910019142 PO4 Inorganic materials 0.000 description 1
- 241001494479 Pecora Species 0.000 description 1
- 229930182555 Penicillin Natural products 0.000 description 1
- JGSARLDLIJGVTE-MBNYWOFBSA-N Penicillin G Chemical compound N([C@H]1[C@H]2SC([C@@H](N2C1=O)C(O)=O)(C)C)C(=O)CC1=CC=CC=C1 JGSARLDLIJGVTE-MBNYWOFBSA-N 0.000 description 1
- ONIBWKKTOPOVIA-UHFFFAOYSA-N Proline Natural products OC(=O)C1CCCN1 ONIBWKKTOPOVIA-UHFFFAOYSA-N 0.000 description 1
- 108020004511 Recombinant DNA Proteins 0.000 description 1
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 1
- 241000191967 Staphylococcus aureus Species 0.000 description 1
- NINIDFKCEFEMDL-AKLPVKDBSA-N Sulfur-35 Chemical compound [35S] NINIDFKCEFEMDL-AKLPVKDBSA-N 0.000 description 1
- 241000282898 Sus scrofa Species 0.000 description 1
- 230000005867 T cell response Effects 0.000 description 1
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 description 1
- 239000004473 Threonine Substances 0.000 description 1
- YZCKVEUIGOORGS-NJFSPNSNSA-N Tritium Chemical compound [3H] YZCKVEUIGOORGS-NJFSPNSNSA-N 0.000 description 1
- 102000004142 Trypsin Human genes 0.000 description 1
- 108090000631 Trypsin Proteins 0.000 description 1
- QIVBCDIJIAJPQS-UHFFFAOYSA-N Tryptophan Natural products C1=CC=C2C(CC(N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-UHFFFAOYSA-N 0.000 description 1
- 108010059722 Viral Fusion Proteins Proteins 0.000 description 1
- SXEHKFHPFVVDIR-UHFFFAOYSA-N [4-(4-hydrazinylphenyl)phenyl]hydrazine Chemical compound C1=CC(NN)=CC=C1C1=CC=C(NN)C=C1 SXEHKFHPFVVDIR-UHFFFAOYSA-N 0.000 description 1
- 238000010521 absorption reaction Methods 0.000 description 1
- 239000000654 additive Substances 0.000 description 1
- 230000000996 additive effect Effects 0.000 description 1
- 230000002411 adverse Effects 0.000 description 1
- 235000004279 alanine Nutrition 0.000 description 1
- 230000004075 alteration Effects 0.000 description 1
- 235000001014 amino acid Nutrition 0.000 description 1
- 229940024606 amino acid Drugs 0.000 description 1
- 238000004458 analytical method Methods 0.000 description 1
- 238000010171 animal model Methods 0.000 description 1
- 230000002155 anti-virotic effect Effects 0.000 description 1
- 239000007864 aqueous solution Substances 0.000 description 1
- 235000003704 aspartic acid Nutrition 0.000 description 1
- QVGXLLKOCUKJST-UHFFFAOYSA-N atomic oxygen Chemical compound [O] QVGXLLKOCUKJST-UHFFFAOYSA-N 0.000 description 1
- 239000007640 basal medium Substances 0.000 description 1
- OQFSQFPPLPISGP-UHFFFAOYSA-N beta-carboxyaspartic acid Natural products OC(=O)C(N)C(C(O)=O)C(O)=O OQFSQFPPLPISGP-UHFFFAOYSA-N 0.000 description 1
- 229940098773 bovine serum albumin Drugs 0.000 description 1
- 239000000872 buffer Substances 0.000 description 1
- 150000001720 carbohydrates Chemical class 0.000 description 1
- 229910052799 carbon Inorganic materials 0.000 description 1
- 239000013553 cell monolayer Substances 0.000 description 1
- 230000008859 change Effects 0.000 description 1
- 238000012512 characterization method Methods 0.000 description 1
- 230000002153 concerted effect Effects 0.000 description 1
- 108091036078 conserved sequence Proteins 0.000 description 1
- 229940028617 conventional vaccine Drugs 0.000 description 1
- 239000007822 coupling agent Substances 0.000 description 1
- 239000013078 crystal Substances 0.000 description 1
- 150000001945 cysteines Chemical class 0.000 description 1
- LEVWYRKDKASIDU-IMJSIDKUSA-N cystine group Chemical group C([C@@H](C(=O)O)N)SSC[C@@H](C(=O)O)N LEVWYRKDKASIDU-IMJSIDKUSA-N 0.000 description 1
- 230000009089 cytolysis Effects 0.000 description 1
- 230000007423 decrease Effects 0.000 description 1
- 238000012217 deletion Methods 0.000 description 1
- 230000037430 deletion Effects 0.000 description 1
- 238000013461 design Methods 0.000 description 1
- 238000003745 diagnosis Methods 0.000 description 1
- 239000003085 diluting agent Substances 0.000 description 1
- 238000004090 dissolution Methods 0.000 description 1
- 239000012153 distilled water Substances 0.000 description 1
- 239000000975 dye Substances 0.000 description 1
- 235000013601 eggs Nutrition 0.000 description 1
- 238000005516 engineering process Methods 0.000 description 1
- 230000002255 enzymatic effect Effects 0.000 description 1
- 238000002474 experimental method Methods 0.000 description 1
- 239000012847 fine chemical Substances 0.000 description 1
- 239000007850 fluorescent dye Substances 0.000 description 1
- 230000037406 food intake Effects 0.000 description 1
- 239000012634 fragment Substances 0.000 description 1
- 230000004927 fusion Effects 0.000 description 1
- 230000002068 genetic effect Effects 0.000 description 1
- 230000007614 genetic variation Effects 0.000 description 1
- 239000008103 glucose Substances 0.000 description 1
- 150000004676 glycans Polymers 0.000 description 1
- 239000001963 growth medium Substances 0.000 description 1
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 1
- MHAJPDPJQMAIIY-UHFFFAOYSA-N hydrogen peroxide Substances OO MHAJPDPJQMAIIY-UHFFFAOYSA-N 0.000 description 1
- 230000002209 hydrophobic effect Effects 0.000 description 1
- 230000036039 immunity Effects 0.000 description 1
- 230000000984 immunochemical effect Effects 0.000 description 1
- 238000000338 in vitro Methods 0.000 description 1
- 238000000099 in vitro assay Methods 0.000 description 1
- 238000011534 incubation Methods 0.000 description 1
- 230000001524 infective effect Effects 0.000 description 1
- 208000037797 influenza A Diseases 0.000 description 1
- 229960003971 influenza vaccine Drugs 0.000 description 1
- 238000011081 inoculation Methods 0.000 description 1
- ZCYVEMRRCGMTRW-YPZZEJLDSA-N iodine-125 Chemical compound [125I] ZCYVEMRRCGMTRW-YPZZEJLDSA-N 0.000 description 1
- 229940044173 iodine-125 Drugs 0.000 description 1
- 150000002500 ions Chemical class 0.000 description 1
- 231100000518 lethal Toxicity 0.000 description 1
- 230000001665 lethal effect Effects 0.000 description 1
- 230000007774 longterm Effects 0.000 description 1
- 230000034217 membrane fusion Effects 0.000 description 1
- 229930182817 methionine Natural products 0.000 description 1
- 238000005497 microtitration Methods 0.000 description 1
- 230000035772 mutation Effects 0.000 description 1
- 230000000869 mutational effect Effects 0.000 description 1
- 229910052760 oxygen Inorganic materials 0.000 description 1
- 239000001301 oxygen Substances 0.000 description 1
- 229940049954 penicillin Drugs 0.000 description 1
- 239000000863 peptide conjugate Substances 0.000 description 1
- 229940023041 peptide vaccine Drugs 0.000 description 1
- 210000005105 peripheral blood lymphocyte Anatomy 0.000 description 1
- COLNVLDHVKWLRT-UHFFFAOYSA-N phenylalanine Natural products OC(=O)C(N)CC1=CC=CC=C1 COLNVLDHVKWLRT-UHFFFAOYSA-N 0.000 description 1
- NBIIXXVUZAFLBC-UHFFFAOYSA-K phosphate Chemical compound [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 description 1
- 239000010452 phosphate Substances 0.000 description 1
- 239000008055 phosphate buffer solution Substances 0.000 description 1
- 229920001308 poly(aminoacid) Polymers 0.000 description 1
- 150000004804 polysaccharides Polymers 0.000 description 1
- 238000002360 preparation method Methods 0.000 description 1
- 230000002265 prevention Effects 0.000 description 1
- 230000035755 proliferation Effects 0.000 description 1
- 230000001681 protective effect Effects 0.000 description 1
- 230000035945 sensitivity Effects 0.000 description 1
- 238000007086 side reaction Methods 0.000 description 1
- 239000002356 single layer Substances 0.000 description 1
- 239000007790 solid phase Substances 0.000 description 1
- 125000006850 spacer group Chemical group 0.000 description 1
- 230000000638 stimulation Effects 0.000 description 1
- 229960005322 streptomycin Drugs 0.000 description 1
- 238000006467 substitution reaction Methods 0.000 description 1
- 239000000725 suspension Substances 0.000 description 1
- 230000002195 synergetic effect Effects 0.000 description 1
- 239000008399 tap water Substances 0.000 description 1
- 235000020679 tap water Nutrition 0.000 description 1
- 239000012588 trypsin Substances 0.000 description 1
- 210000000605 viral structure Anatomy 0.000 description 1
- 238000005406 washing Methods 0.000 description 1
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Chemical compound O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/005—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/08—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from viruses
- C07K16/10—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from viruses from RNA viruses
- C07K16/1018—Orthomyxoviridae, e.g. influenza virus
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2760/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses negative-sense
- C12N2760/00011—Details
- C12N2760/16011—Orthomyxoviridae
- C12N2760/16022—New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2760/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses negative-sense
- C12N2760/00011—Details
- C12N2760/16011—Orthomyxoviridae
- C12N2760/16111—Influenzavirus A, i.e. influenza A virus
- C12N2760/16122—New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2760/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses negative-sense
- C12N2760/00011—Details
- C12N2760/16011—Orthomyxoviridae
- C12N2760/16211—Influenzavirus B, i.e. influenza B virus
- C12N2760/16222—New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
Definitions
- This invention relates to immunochemistry, and, more specifically, to immunological reagents and reactions involving influenza viruses.
- Influenza remains a major epidemic disease worldwide despite intensive vaccination programs. Webster et al. , Nature, 296, 115-121 (1982) and Palese et al. , Science, 215, 1469-1474 (1982). To date, vaccines for these efforts have utilized whole virus as antigen to elicit antibody responses against the particular influenza strain in circulation. Tyrrel et al., Br. Med. Bull., 3_5, 77-83 (1979). These conventional vaccines suffer from several standpoints including poor characterization and non-uniformity due to production of virus in embryonated eggs, and can cause serious adverse side reactions. Most importantly, they suffer from a lack of generality required to be effective against the broad spectrum of influenza strains which can arise by genetic recombination. A well-defined vaccine which eliminates these problems is needed.
- the primary target of the neutralizaing response of vaccination is the hemagglutinin molecule which is the major surface glycoprotein of the virus.
- Dowdle et al. J.Virol. , 13, 269-275 (1974).
- This hemagglutinin is synthesized ⁇ n vivo as a precursor molecule (HA) , and is subsequently cleaved proteolytically to two subunits, HA. and HA-. Cleavage is necessary for the virus to be infective.
- Klenk et al. J. Virol. , 69, 426-439 (1975) and Lazarowitz et al. , Virology, 68, 440-454 (1975).
- HA genes of several epidemic strains of influenza have been described and indicate that there is rapid genetic variation occurring within these genes.
- Laver et al. Nature, 283, 454-457 (1980) ; Webster et al. Virology, 104, 139-148 (1980); Wiley et al. , Nature, 289, 373-378 (1981); and Gething et al. , Nature, 187, 373-378 (1981) .
- mutational changes are reflected as alterations of the antigenic structure of HA allowing escape of the virus from the protection of the previous immunization, and the subsequent rise of a new epidemic strain.
- serologically distinct viruses from previous epidemics occasionally reenter the population, possibly from non-human hosts, where they may have undergone genetic recombination.
- Antibodies made against synthetic peptides representing virtually all regions of the X-47 (H3N2) influenza virus hemagglutinin were [Min-Jou, Cell, 19, 683-696 (1980)] tested for their ability to neutralize virus infection in vitro.
- peptides particularly synthetic peptides (built-up -5- ⁇ from component amino acid residues) as compared to those materials cleaved from the hemagglutinin molecule or those prepared by recombinant DNA technology, are capable of eliciting the production of antibodies that neutralize more than one strain of influenza virus, and consider that neutralization a useful step in the prevention and treatment of influenza.
- Each of the peptides of this invention ⁇ has a molecular weight less than that of the intact hemagglutinin molecule, and typically has a length of about 8 to about 40 amino acid residues.
- the specific synthetic peptides which have been found to be most effective have amino acid residue sequences that correspond to portions of the influenza hemagglutinin molecule amino acid residue sequence. Those peptides are defined by the following amino residue acid sequence formulas, from left to right and in the direction of amino-terminus to carboxy-terminus: (a) SIMRSDAPIGTCSSECITPNGSIPNDKPFQNVNKITY;
- One additional synthetic peptide whose amino acid residue sequence corresponds to positions 306-330, the carboxy-terminus, of the H 1 molecule has also been found to (a) stimulate T-cell proliferation, (b) induce production of antibodies that cross-react with influenza strains other than X-47, as well as (c) protect animals from challenge with live virus when used in a vaccine.
- the amino acid residue sequence of that peptide, from left to right and in the direction from amino-terminus to carboxy-terminus, is shown in the formula below: (d) CPKYVKQNTLKLATGMRNVPEKQTR.
- Another peptide also induces the production of neutralizing antibodies to strain X-47 as well as antibodies that cross-react and neutralize, to some extent, other influenza strains.
- the amino acid residue sequence of this peptide, from left to right and in the direction of amino-terminus to carboxy-terminus is shown in formula (e) below: (e) CNNPHRIL.
- CKRGPDSGFFSRLNWLYKSGSC comprises, as compositions of matter, amino acid residue sequences containing the above defined peptides, or portions thereof, produced synthetically or isolated from proteins, and may be used either alone or together. Synthetic peptides are preferred. This invention also comprises the antisera resulting from the challenge of an organism by one or more peptides containing the above defined peptides, and compositions in which antibodies to the
- OMPI above peptides alone or combined, are an immunologically active agent.
- This invention further contemplates the processes of preparation of these compositions and the use of these compositions in immunological diagnosis or treatment.
- this invention in one facet comprises vaccines for use in conventional innoculation or ingestion or inhalation vaccination in which an immunologically active agent induced in the immunized host is one or more antibodies to the above defined peptides.
- Figure 1 depicts the amino acid residue sequence of the X-47 HA molecule derived from the neucleotide sequence [Min-Jou .et al. , Cell, 19, 683-696 (1980)];
- Figure 2 depicts. the results of the micro-titratio of X-47 influenza virus on Madin-Darby canine kidney (MDCK) epithelial cells;
- Figure 3 depicts the neutralization of X-47 virus by combinations of anti-peptide antisera. Description of the Best Mode The full names for individual amino acid residues are sometimes used herein as are the well-known three-letter abbreviations. The one-letter symbols for amino acid residues are used most often.
- the Table of Correspondence, below, provides the full name as well as the abbreviation and symbols for each amino acid residue named herein.
- FIG. 1 the amino acid residue sequence of the X-47 HA molecule [Min Jou et al.. Cell, 19, 683-696 (1980)] is depicted. The entire HA. and the amino-terminus of HA ⁇ are shown. The lines under the sequence represent the peptides which were synthesized and used for immunization. C or Y at ends of those lines represent additions of cysteine or tyrosine not found in the primary sequence. Disulfide bonds are
- OMP / -10- cells/milliliter in growth medium 50 Microliters of the suspension were added to each well of a 96 well flat-bottomed icrotiter plate (Falcon) containing an additional 50 microliters medium. The plates were incubated overnight at 37° C. allowing cell attachment for either virus or serum titrations on the following day.
- Virus was titrated by making 50 microliter two-fold serial dilutions in a 96 well microtiter plate in MEM containing antibiotics (dilution medium) . An additional 50 microliters of dilution medium were added to each well and the plate was incubated for 60 minutes at 37°C. (mock neutralization) . The medium covering the MDCK cell monolayers in the 96 well plate was aspirated and the cells were washed with 100 microliters of dilution medium.
- the titrated virus was then transferred to the corresponding wells of the plate containing the washed MDCK cells.
- the virus was allowed to absorb for 60 minutes at 37°C. , whereupon it was removed, and the cells were washed with 100 microliters of diultion medium.
- the cells were then overlayed with 100 microliters of overlay meidum consisting of Basal Medium (Eagle) containing antibiotics, 0.005%
- DEAE-dextran Pulacia
- 2 millimolar L-glutamine 2 millimolar L-glutamine, 0.05% fetal calf serum and 2 micrograms per milliliter trypsin (type III, 2x crystalized, Sigma) .
- the cells were incubated for 48 hours, at which time they were observed microscopically for cytopathic effect (CPE) , and were subsequently stained with 0.1% crystal violet in 20% ethanol, followed by rinsing in tap water. Each virus was screened for the last dilution which gave complete • lysis of the MDCK monolayer in 48 hours and this
- Figure 2A shows one and two day (24 and 48 hour) end points for a titration of X-47 virus.
- the end points of the CPE are quite easy to score visually.
- the plates can be mechanically read in a microtiter plate reader and the results plotted graphically as shown in Figure 2B.
- a two-day assay was chosen because it was found that the virus inoculum needed from a complete CPE in 48 hours allowed the best overall sensitivity in testing the neutralizing strenghts of the anti-peptide antisera.
- Figure 2B shows graphical displays of the stained plates in Figure 2A after reading in a Titertek Multiskan apparatus with a 492 nanometer filter.
- the extent of CPE was expressed as percent of the control well (C) which received no virus.
- Open and closed circles are the 24 and 48 hour end points, respectively.
- the CPE end point dilutions for X-47 virus are 1:5 and 1:300 for 24 and 48 hours respectively.
- the assay is based on the cytopathic effect (CPE) of influenza virus on monolayers of Madin-Darby canine kidney epithelial (MDCK) cells. Gaush et al. , Applied Microbiology, 16, 588-594 (1968) .
- the neutralization assay is accomplished by making serial dilutions of the sera in microtiter plates and then adding to each well an aliquot of virus at the dilution previously shown by titration to give a complete CPE in 48 hours. Thus for X-47 virus this was a 1:300 dilution of allantoic fluid. We have determined that this is approximately 10,000 plaque-forming units per well.
- Figure 3 depicts results of neutralization of X-47 virus by combinations of anti-peptide antisera.
- NRS Normal rabbit serum
- the antisera are, ( • ) anti-X47 virus; ( D ) normal rabbit serum; (O) anti-peptide 23; ( ⁇ ) anti-peptide-24; and ( - ⁇ ) anti-peptide-23 and -24.
- Regions of the molecule containing disulfide bridges including: a. The proposed antigenic site "C" of Wiley et al. [Wiley et al. , Nature, 289, 373-378 (1981)], which is a protruding bulge in the molecule formed by a disulfide bond between cysteine 53 and cysteine 278. Peptides in the regions of cysteine 53 (peptides 5, 6, and 7) and cysteine 278 (peptides 21 and 23) elicited neutralizing antibodies. b. The disulfide bridge between cysteine 282 and cysteine 306. Antisera against peptides 22 and 20 which encompass these cysteines were neutralizing. c.
- HA 2 is the most highly conserved sequence in HA. Waterfield et al. , Br.Med.Bull. , 35, 47-63 (1979). It is similar to the amino-terminus of the F. component of the Sendai virus fusion glycoprotein [Gething et al. , Proc.Natl.Acad.Sci. USA, 75,
- the amino acid sequences of a number of influenza virus HA molecules have been derived from the nucleotide sequences of their HA genes. Considerable conservation exists among the sequences despite variation in HA subtype. Webster et al. , Nature, 296, 115-121 (1982) ; Laver et al. , Nature, 283, 454-457 (1980) ; Webster et al. Virology, 104, 139-148 (1980); Wiley et al. , Nature, 289, 373-378 (1981); and Gething et al. , Nature, 187, 373-378 (1981) . These regions include those for which we have demonstrated neutralizing activity with our antipeptide antisera. Table 2 presents data demonstrating that antipeptide antisera containing antibodies of this invention are able to cross-neutralize heterologous virus.
- H3 strains show patterns of neutralization similar to those of X-47.
- the HI strains were not neutralized by the very high titered anti-X-47 virus serum, but they were neutralized by at least some of the antipeptide sera.
- Antipeptide sera to synthetic peptides 23, 24 and 26 were particularly effective.
- the degree to which A/WSN/33 (Virus B; H1N1) was neutralized by anti-X-47 antiserum was insignificant compared to the performance of the antivirus antiserum towards H3 subtype viruses. For those viruses for which HA sequences are available, the results appear to be in accord with the degree of amino acid sequence homology between the HI and H3 subtypes.
- the data imply that it is necessary to bind antibody to a site functional in the infection and replication process or to a structurally distinct site such as that formed by a disulfide bridge.
- the relatively low titers of the antipeptide sera relative to the anti-X-47 virus antiserum was probably a function of the limited proportion of antibodies in the antipeptide antiserum recognizing the conformation that the corresponding amino acid sequence attains in the infectious virus.
- the anti-X-47 virus antiserum contains antibodies to other viral components, e.g., neuramidase, which may enhance the neutralizing activity of the HA antibodies in this serum.
- the reason for this discrepancy may be due to the limited immunogenicity of the intact virus, or the effect of carbohydrate on the immune response to the intact virus.
- Peptide 20 CPKYVKQNTLKLATGMRNVPEKQTR; Peptide 23 SIMRSDAPIGTCSSECITPNGSIPNDKPFQNVNKITY; Peptide 24 RGIFGAIAGFIENGWEGMIDGWYGFRHQN; Peptide 26 EKQTRGIFGA.
- peptide 5 corresponds in amino acid residue sequence to positions 53-60 from the amino-terminus of the HA.
- molecule of the X-47 influenza virus corresponds in amino acid residue sequence to positions 306-330, from the amino-terminus and includes the carboxy-terminus of the HA.
- peptide of X-47 corresponds in amino acid residue sequence to positions 267-300 from the amino-terminus of the HA.
- peptide of X-47; peptide 24 corresponds in amino acid residue sequence to position 330, the carboxy-terminus, of the HA.
- peptide 26 corresponds to position 326 from the amino-terminus of the HA. molecule through the carboxy-terminus (position 330) and to position 6 of the HA 2 molecule of X-47.
- synthetic peptides whose amino acid residue sequences correspond to the above amino acid residue positions in hemagglutinin molecules of strains of influenza virus other than X-47 and listed in Table 2 also induce production of antibodies that cross-react and neutralize at least some of the influenza strains or subtypes of Table 2, above, in addition to neutralizing the strain or subtype to a portion of whose hemagglutinin molecule amino acid residue sequence such peptides correspond. While not wishing to be bound by theory, it is thus believed that production of cross-reactive, neutralizing antibodies induced by immunization with synthetic peptides is a function of the positional sequence of the immunizing synthetic peptide.
- OMFI -21- one of the above peptides corresponds to amino acid residue sequences.
- the word "corresponds" when used in conjunction with amino acid residue sequences means that the sequences of two peptides or of a peptide and protein are so similar that antibodies raised to a peptide of this invention cross-react and bind to both that peptide and to a second corresponding peptide or to a corresponding protein.
- the amino acid residue sequences are identical, although strict identity of sequences is not required. For example, conservative changes between amino acid residues such as lysine and arginine, or glutamic acid and aspartic acid, or leucine and isoleucine may be made. In additions and deletions of residues in the sequences may be made without destroying the cross-reactive antibody binding.
- Peptide 20 corresponds in amino acid residue sequence to positions 306 through 330, the carboxy-terminus of the HA., molecule. Stated differently, this peptide extends from the carboxy-terminus of the HA., toward the amino-terminus of the HA. to the residue adjacent the carboxy-terminal-most cysteine (cysteine 306) in the HA.. In the intact HA. molecule, cysteine 306 exists as a portion of a cystine residue forming a disulfide bond with the residue at position 282. Thus, cysteine 306 is more accurately referred to as half-cystine 306, as is known in the art. It is believed that this region of the HA., molecule is a region (position 306-330, or the position of the carboxy-terminus to the first half-cystine on the HA. molecule) that stimulates T-cell proliferation in influenza viruses generally.
- Another embodiment of this invention utilizes a peptide whose amino acid sequence corresponds to the amino acid residue sequence of synthetic peptide 20 alone or as a conjugate to stimulate T-cell proliferation and/or to also induce antibody production by B-cells. That peptide can be used for those purposes or it can be used in conjunction with one or more additional peptides or their conjugates to stimulate both T-cells and B-cells to provide both cellular as well as humoral responses.
- mice were immunized with a mixture of six synthetic peptide conjugates whose sequences
- M corresponded to amino acid residue sequences throughout the HA., molecule.
- Each mouse was given three injections containing 20 micrograms of mixed peptide each in complete Fruend's adjuvant. Serum titers after five weeks ranged from zero through 320 using the ELISA assay discussed by Green et al. , above. Analogous rabbit titers would have been about 5120.
- the peptide mixture utilized in the above protection determination contained peptides 2, 4, 7, 11, 19 and 20 (Table 1) in approximately equal amounts. Each peptide was conjugated to KLH.
- the vaccination protocol for the above determinations was as follows. Groups of 4-week old CAF. male mice were vaccinated with the peptide-containing vaccine or saline-containing vaccine in complete Freund's adjuvant on days 0, 14 and 28. Animals were bled to obtain serum titer data on day 35, and then challenged on day 38 with an intranasal inoculation of mouse-adapted X-47 influenza virus at a concentration designed to deliver an LD 5Q -LD 80 ; i.e., to kill 50% to 80% of the population.
- the challenged animals were then housed in an isolation facility and examined daily for signs of disease. After three weeks of isolation, the perecent mortality was calculated and compared to the control group.
- peptides were used alone or as a conjugates with KLH. Depending on their solubilites, peptides containing fewer than about 34 residues were typically used as conjugates while peptides longer than 35 residues were typically used alone.
- the peptides of this invention may be used alone or linked (coupled) to a carrier as a conjugate.
- KLH Keyhole limpet hemocyanin
- Additional carriers useful in preparing conjugates includes, but are not limited to, agarose, cross-linked agarose, edestin, curcubin, bovine serum albumin, human serum albumin, red blood cells such as sheep erythrocytes, and polyamino acids such as poly (D-lysine: D-glutamic acid) .
- Immunizations utilizing conjugates have been found to be more effective, than similar immunizations using the peptide alone, and not coupled to a carrier. A study was therefore carried out to examine the effects of the carrier on the B-cell, neutralizing antibody-producing (humoral) response in mice.
- the peptide used in these studies was synthetic peptide 20 which contains a Cys residue at its amino-terminus.
- the carriers in these studies were thiopropyl-Sepharose 6B and thiopropyl-Sepharose 4B available from Pharmacia Fine Chemicals, Piscataway, New Jersey.
- Mouse Number X-47 Titer Group 1 3 ip/sq injections of Sepharose 6B - Peptide 20 (at 50 micrograms of peptide (conjugate)/mouse with 4 milligrams of alum)
- ip/sq One intraperitioneal injection, and four subcutaneous injections (one subcutaneous injection in each hip and in each shoulder) .
- 2 sq Four subcutaneous injections as described above. 3
- the Sepharose carriers have several advantages over KLH as a carrier. These materials have a solid phase composed of cross-linked polysaccharide chains (agarose) , a spacer moiety and a protected thiol group (prior to the linking reaction with the peptide) .
- Thiopropyl Sepharose 6B has a higher binding capacity, a greater binding efficiency, e.g. yield of 60-65% vs. 40%, and shows apparently more immunogenicity as compared to thiopropyl Sepharose 4B.
- the immunogenicity of the thiopropyl Sepharose 6B - peptide 20 conjugate was greater in the presence of alum which can be used in humans than in the presence of compute Freund's adjuvant (CFA) which is not used for human vaccines.
- CFA compute Freund's adjuvant
- Peptides were coupled to Sepharose carriers in de-aerated 0.01 molar phosphate buffer solution additionally containing 0.5 molar NaCl, 0.001 molar ethylene diaminethetracetic acid and 0.2 percent NaN., at a pH value of 7.
- 0.01 molar phosphate buffer solution additionally containing 0.5 molar NaCl, 0.001 molar ethylene diaminethetracetic acid and 0.2 percent NaN., at a pH value of 7.
- For couplings to Sepharose 4B 1 milliliter of packed, swollen Sepharose 4B was added to 2 milliliters of the phosphate buffer further containing 5 milligrams per milliliter of peptide.
- For couplings to Sepharose 6B 0.5 milliliters of packed, swollen Sepharose 6B was added to 5 milliliters of the phosphate buffer further containing 5 milligrams per milliliter of peptide.
- the reaction solutions were gently agitated at a temperature
- Conjugates were prepared from about 40-50 micrograms of peptide and about 25-32 micrograms of KLH as desscribed in Green et al. , Cell, 28, 477-487 (1982). 100 Percent reaction was presumed. The immunization was carried out in complete Freunds* adjuvant that contained 0.6 milligrams of Mycobacterium Tuberculosis per mouse in a total volume of 0.2 milliliters per mouse.
- mice having antibody titers in the above, six-month, ranges were protected against infection by the virus.
- Cyclic peptides whose amino acid residue sequences correspond to HA., positions 306 to 330
- the first synthesized, straight chain cyclic peptide-precursors contained cysteine residues at the amino- and carboxy-terminii which were subsequently oxidized to form cyclic and/or oligomeric materials that are also referred to herein as cyclic peptides in as much as oxidations were continued until no free mercaptan could be detected by the Ellman test [Ellman, Arch. Bioche . Biophys.
- the cyclic peptides were prepared by dissolving the peptides in a 0.1 molar bicarbonate solution. Cyclic, monomeric or substantially monomeric peptides were prepared by dissolution of the peptide at a concentration of 0.1 milligrams per milliliter, while the oligomeric material was prepared at a concentration of 10 milligrams per milliliter. The peptide solutions so prepared were stirred overnight while being exposed to atmospheric oxygen to effect the cyclizing oxidations. The oxidized solutions were thereafter tested for completeness of reaction and then lyophylized. The -31- dried materials so prepared were thereafter used for immunizations.
- this invention comprises specifically defined peptides. It will be understood by those in the art that minor deviations from the exact sequences of the above-disclosed peptides may be made without substantially impairing the immunological characteristics of the peptides.
- neutralizing and protective antibody-producing peptides of this invention contain the following amino residue. acid sequences, from left to right and in the direction of amino-terminus to carboxy terminus,
- Biologically active receptor molecules constitute another embodiment of this invention. These molecules are antibodies, or idiotype-containing polyamide portions of antibodies,
- OMPI s WIPO -32- induced or raised to a synthetic peptide of this invention or to its conjugate with a carrier.
- the receptors are raised to the preferred synthetic peptides of this invention.
- the receptors are biologically active in that they bind at least with the synthetic peptide when admixed therewith in aqueous solution, at least at physiological pH values and ionic strengths.
- the receptors also bind with the naturally occurring virus or the hemaglutinin molecule under the same conditions. It is more preferred that the receptors bind to the synthetic peptide, hemagglutinin and virus within a pH value range of about 5 to about 9, and at ionic strengths such as that of distilled water to that of about one molar sodium chloride.
- Idiotype-containing polyamide portions of antibodies are the portions of antibodies that bind to an antigen. Such portions include the Fab, Fab' , and F(ab*) 2 fragments prepared from antibodies by well-known enzymatic cleavage techniques. Inasmuch as antibodies are discussed in the art as being “raised” or “induced”, idiotype-containing polyamide portions of antibodies will also be discussed herein as being “raised” or “induced” with the understanding that a subsequent cleavage step is normally required to prepare such materials from antibodies.
- the receptor molecules may be polyclonal as is the case for the ⁇ antibodies in antisera discussed hereinbefore, or the receptors may be monoclonal. Techniques for preparing monoclonal antibodies are well known, and monoclonal receptors of this invention may be prepared by using the synthetic peptides of this invention, preferably coupled to a carrier, as the immunogen as was done by Arnheiter et al.. Nature, 294, 278-280 (1981).
- OMP -33- Monoclonal antibodies are typically obtained from hybridoma tissue cultures or from ascites fluid obtained from animals into which the hybridoma -tissue was introduced. Nevertheless, monoclonal antibodies may be described as being “raised to” or “induced by” the synthetic peptides of this invention or their conjugates with a carrier.
- Receptors are utilized along with an "indicating group", also sometimes referred to as a "label".
- the indicating group or label is utilized in conjunction with the receptor as a means for determining whether an immune reaction has taken place, and in some instances for determining the extent of such a reaction.
- the indicating group may be a single atom as in the case of radioactive elements such as iodine 125 or 131, hydrogen 3 or sulfur 35, or elements active in nuclear magnetic resonance (NMR) spectroscopy such as fluorine 19 or nitrogen 15.
- the indicating group may also be a molecule such as a fluorescent dye like fluoresein, or an enzyme, such as horseradish peroxidase (HRP) , or the like.
- the indicating group may also constitute all or a portion of a separate molecule or atom that reacts with the receptor molecule such as HRP-linked to goat anti-rabbit antibodies where the antibody receptor was raised in a rabbit, or where a radioactive element such as 125I is bonded to protein A obtained from Staphylococcus Aureus.
- additional reagents are required to visualize the fact that an immune reaction has occurred.
- additional reagents for HRP include
- OMP -34- hydrogen peroxide and an oxidation dye precursor such as diaminobenzidine or 2,2'-azino-di-(3- athylbenzthiazolin sulfonat) from whom? + Where city, state or country, used herein.
- indicating group or “label” are used herein to include single atoms and molecules that are linked to the receptor or used separately, and whether those atoms or molecules are used alone or in conjunction with additional reagents. Such indicating groups or labels are themselves well-known in immunochemistry and constitute a part of this invention only insofar as they are utilized with otherwise novel receptors, methods and/or systems.
Landscapes
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Health & Medical Sciences (AREA)
- Organic Chemistry (AREA)
- Virology (AREA)
- Molecular Biology (AREA)
- Biophysics (AREA)
- General Health & Medical Sciences (AREA)
- Genetics & Genomics (AREA)
- Medicinal Chemistry (AREA)
- Biochemistry (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Gastroenterology & Hepatology (AREA)
- Communicable Diseases (AREA)
- Pulmonology (AREA)
- Immunology (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Medicines Containing Material From Animals Or Micro-Organisms (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
Priority Applications (3)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
NO841540A NO161002C (no) | 1982-08-23 | 1984-04-17 | Analogifremgangsmaate for fremstilling av terapeutisk aktive polypeptider. |
DK2036/84A DK203684D0 (da) | 1982-08-23 | 1984-04-18 | Bredspektrede influenza-antisera |
FI841583A FI841583A0 (fi) | 1982-08-23 | 1984-04-19 | Influensaantisera med brett spektrum. |
Applications Claiming Priority (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US41045582A | 1982-08-23 | 1982-08-23 |
Publications (1)
Publication Number | Publication Date |
---|---|
WO1984000687A1 true WO1984000687A1 (en) | 1984-03-01 |
Family
ID=23624803
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/US1983/001291 WO1984000687A1 (en) | 1982-08-23 | 1983-08-23 | Broad spectrum influenza antisera |
Country Status (16)
Country | Link |
---|---|
EP (1) | EP0116629A4 (it) |
JP (1) | JPS59501714A (it) |
KR (1) | KR840006198A (it) |
AU (1) | AU570929B2 (it) |
DK (1) | DK203684D0 (it) |
ES (1) | ES8505819A1 (it) |
FI (1) | FI841583A0 (it) |
GR (1) | GR78931B (it) |
IL (1) | IL69556A (it) |
IT (1) | IT1168636B (it) |
NO (1) | NO161002C (it) |
NZ (2) | NZ220612A (it) |
PH (1) | PH18872A (it) |
PT (1) | PT77230B (it) |
WO (1) | WO1984000687A1 (it) |
ZA (1) | ZA836080B (it) |
Cited By (30)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
EP0176493A1 (en) * | 1984-08-30 | 1986-04-02 | Smithkline Beecham Corporation | Vaccinal polypeptides |
WO1990008161A1 (en) * | 1989-01-12 | 1990-07-26 | The Blood Center Of Southeastern Wisconsin | Peptide-mediated modulation of t-cell recognition as a means of affecting immune responses |
EP0621339A2 (en) * | 1992-09-17 | 1994-10-26 | Takara Shuzo Co. Ltd. | Immunogenic human influenza A virus haemagglutinin polypeptides |
US6605448B1 (en) | 1985-08-28 | 2003-08-12 | George Pieczenik | Method and means for sorting and identifying biological information |
WO2007134327A2 (en) * | 2006-05-15 | 2007-11-22 | Sea Lane Biotechnologies, Llc. | Neutralizing antibodies to influenza viruses |
ITTO20090414A1 (it) * | 2009-06-01 | 2010-12-02 | Pomona Biotechnologies Llc | Anticorpi monoclonali come medicamento per il trattamento terapeutico e/o profilattico delle infezioni da virus influenzale a (h1n1) di origine suina (s-oiv) |
WO2010132604A3 (en) * | 2009-05-13 | 2011-03-24 | Sea Lane Biotechnologies, Llc | Neutralizing molecules to influenza viruses |
US8148085B2 (en) | 2006-05-15 | 2012-04-03 | Sea Lane Biotechnologies, Llc | Donor specific antibody libraries |
US8367061B2 (en) | 2007-01-30 | 2013-02-05 | Pomona Ricera S.R.L. | Anti-idiotype monoclonal antibodies mimicking the HIV gp120 CD4-binding (CD4bs) |
US20130209499A1 (en) * | 2010-02-18 | 2013-08-15 | Mount Sinai School Of Medicine | Vaccines for use in the prophylaxis and treatment of influenza virus disease |
US8623363B2 (en) | 2008-12-22 | 2014-01-07 | Pomona Ricerca S.R.L. | Anti-HCV monoclonal antibody as a medicament for the therapeutic treatment and prevention of HCV infections |
US8877200B2 (en) | 2012-05-10 | 2014-11-04 | Visterra, Inc. | HA binding agents |
US8975378B2 (en) | 2008-12-25 | 2015-03-10 | Osaka University | Human anti-human influenza virus antibody |
US9169318B2 (en) | 2008-03-28 | 2015-10-27 | Sea Lane Biotechnologies, Inc. | Neutralizing molecules to viral antigens |
US9175069B2 (en) | 2009-05-26 | 2015-11-03 | Icahn School Of Medicine At Mount Sinai | Monoclonal antibodies against influenza virus generated by cyclical administration and uses thereof |
US9200063B2 (en) | 2008-03-17 | 2015-12-01 | Pomona Ricerca S.R.L. | Monoclonal antibodies capable of reacting with a plurality of influenza virus A subtypes |
US9243054B2 (en) | 2008-05-27 | 2016-01-26 | Pomona Ricerca S.R.L. | Monoclonal antibodies having homosubtype cross-neutralization properties against influenza A viruses subtype H1 |
US9371366B2 (en) | 2012-12-18 | 2016-06-21 | Icahn School Of Medicine At Mount Sinai | Influenza virus vaccines and uses thereof |
US9708373B2 (en) | 2010-03-30 | 2017-07-18 | Icahn School Of Medicine At Mount Sinai | Influenza virus vaccine and uses thereof |
US9849172B2 (en) | 2009-03-30 | 2017-12-26 | Icahn School Of Medicine At Mount Sinai | Influenza virus vaccines and uses thereof |
US9908930B2 (en) | 2013-03-14 | 2018-03-06 | Icahn School Of Medicine At Mount Sinai | Antibodies against influenza virus hemagglutinin and uses thereof |
US9975956B2 (en) | 2011-12-22 | 2018-05-22 | I2 Pharmaceuticals, Inc. | Surrogate binding proteins which bind DR4 and/or DR5 |
US10131695B2 (en) | 2011-09-20 | 2018-11-20 | Icahn School Of Medicine At Mount Sinai | Influenza virus vaccines and uses thereof |
US10214580B2 (en) | 2007-03-27 | 2019-02-26 | I2 Pharmaceuticals, Inc. | Constructs and libraries comprising antibody surrogate light chain sequences |
US10300140B2 (en) | 2011-07-28 | 2019-05-28 | I2 Pharmaceuticals, Inc. | Sur-binding proteins against ERBB3 |
US10513553B2 (en) | 2015-11-13 | 2019-12-24 | Visterra, Inc. | Compositions and methods for treating and preventing influenza |
US10736956B2 (en) | 2015-01-23 | 2020-08-11 | Icahn School Of Medicine At Mount Sinai | Influenza virus vaccination regimens |
US11230593B2 (en) | 2019-03-25 | 2022-01-25 | Visterra, Inc. | Compositions and methods for treating and preventing influenza |
US11254733B2 (en) | 2017-04-07 | 2022-02-22 | Icahn School Of Medicine At Mount Sinai | Anti-influenza B virus neuraminidase antibodies and uses thereof |
US11266734B2 (en) | 2016-06-15 | 2022-03-08 | Icahn School Of Medicine At Mount Sinai | Influenza virus hemagglutinin proteins and uses thereof |
Families Citing this family (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
JP2996864B2 (ja) * | 1994-03-30 | 2000-01-11 | 寳酒造株式会社 | 抗体可変領域dna |
EA017203B1 (ru) * | 2006-09-07 | 2012-10-30 | Круселл Холланд Б.В. | Связывающие молекулы человека, способные нейтрализовать вирус гриппа h5n1, и их применение |
Family Cites Families (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
IL63224A (en) * | 1980-07-17 | 1985-05-31 | Scripps Clinic Res | Synthetic peptide specific antigenic determinant and method of manufacturing antigenic materials therefrom |
-
1983
- 1983-08-17 ZA ZA836080A patent/ZA836080B/xx unknown
- 1983-08-19 GR GR72254A patent/GR78931B/el unknown
- 1983-08-22 ES ES525088A patent/ES8505819A1/es not_active Expired
- 1983-08-22 IT IT48868/83A patent/IT1168636B/it active
- 1983-08-22 NZ NZ220612A patent/NZ220612A/xx unknown
- 1983-08-22 PT PT77230A patent/PT77230B/pt unknown
- 1983-08-22 NZ NZ205341A patent/NZ205341A/xx unknown
- 1983-08-23 EP EP19830902869 patent/EP0116629A4/en not_active Withdrawn
- 1983-08-23 JP JP58502916A patent/JPS59501714A/ja active Pending
- 1983-08-23 KR KR1019830003951A patent/KR840006198A/ko not_active Application Discontinuation
- 1983-08-23 AU AU19471/83A patent/AU570929B2/en not_active Ceased
- 1983-08-23 IL IL69556A patent/IL69556A/xx unknown
- 1983-08-23 WO PCT/US1983/001291 patent/WO1984000687A1/en not_active Application Discontinuation
- 1983-08-23 PH PH29428A patent/PH18872A/en unknown
-
1984
- 1984-04-17 NO NO841540A patent/NO161002C/no unknown
- 1984-04-18 DK DK2036/84A patent/DK203684D0/da not_active Application Discontinuation
- 1984-04-19 FI FI841583A patent/FI841583A0/fi not_active Application Discontinuation
Non-Patent Citations (5)
Title |
---|
Cell, Volume 28, issued 1982 (United States), GREEN et al., "Immunogenic Structure of the Influenza Virus Hemmagglutinin". see pages 477-487. * |
CHEMICAL ABSTRACTS, Volume 95, No. 21, issued 1981, (Columbus, Ohio, USA), ASCUM et al., "Antigenic Peptides of Influenza Virus Hemagglutinin: Reactivity with Virus-Neutralizing Antibodies". See page 493, Column 1, Abstract No. 1854225, Intervirology 1981, 15(3), 145-63 (Eng.) * |
CHEMICAL ABSTRACTS, Volume 98, No. 23. issued 1983 (Columbus, Ohio, USA), WABUKE-BUNOTI, et al., "Isolation and Characteriztion of a Cyanogen Bromide Cleavage Peptide of Influenza Viral Hemagglutinin Stimulatory for Mouse Cytolytic Lymphocytes". see page 471, Abstract No. 196118k, J. IMMUNOL. 1983, 130(5), 2386-91 (Eng.) * |
CHEMICAL ABSTRACTS, Volume 99. No. 1 issued 1983 (Columbus, Ohio, USA), LAMB et al., "Human T-Cell Clones Recognize Chemically Synthesized Peptides of Influenza Hemagglutinin". see pages 375, column 1, Abstract No. 3891w, Nature, 1982, 300(5887) 66-69 (Eng.) * |
Proc. Natl. Acad. Sci, Volume 79, issued 1982 (United States), MULLER et al., "Anti-Influenza Response Achieved by Immunization with a Synthetic Conjugate". seepages 569-573. * |
Cited By (50)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
EP0176493A1 (en) * | 1984-08-30 | 1986-04-02 | Smithkline Beecham Corporation | Vaccinal polypeptides |
US6605448B1 (en) | 1985-08-28 | 2003-08-12 | George Pieczenik | Method and means for sorting and identifying biological information |
WO1990008161A1 (en) * | 1989-01-12 | 1990-07-26 | The Blood Center Of Southeastern Wisconsin | Peptide-mediated modulation of t-cell recognition as a means of affecting immune responses |
EP0621339A2 (en) * | 1992-09-17 | 1994-10-26 | Takara Shuzo Co. Ltd. | Immunogenic human influenza A virus haemagglutinin polypeptides |
EP0621339A3 (en) * | 1992-09-17 | 1995-11-29 | Takara Shuzo Co | Immunogenic human influenza a virus haemagglutinin polypeptides. |
EP2522678A1 (en) * | 2006-05-15 | 2012-11-14 | Sea Lane Biotechnologies, LLC | Neutralizing antibodies to influenza viruses |
WO2007134327A3 (en) * | 2006-05-15 | 2008-10-02 | Sea Lane Biotechnologies Llc | Neutralizing antibodies to influenza viruses |
US8148085B2 (en) | 2006-05-15 | 2012-04-03 | Sea Lane Biotechnologies, Llc | Donor specific antibody libraries |
AU2007249160B2 (en) * | 2006-05-15 | 2013-09-12 | I2 Pharmaceuticals, Inc. | Neutralizing antibodies to influenza viruses |
WO2007134327A2 (en) * | 2006-05-15 | 2007-11-22 | Sea Lane Biotechnologies, Llc. | Neutralizing antibodies to influenza viruses |
CN103435697A (zh) * | 2006-05-15 | 2013-12-11 | 航道生物技术有限责任公司 | 流感病毒的中和抗体 |
US8367061B2 (en) | 2007-01-30 | 2013-02-05 | Pomona Ricera S.R.L. | Anti-idiotype monoclonal antibodies mimicking the HIV gp120 CD4-binding (CD4bs) |
US10214580B2 (en) | 2007-03-27 | 2019-02-26 | I2 Pharmaceuticals, Inc. | Constructs and libraries comprising antibody surrogate light chain sequences |
US9587011B2 (en) | 2008-03-17 | 2017-03-07 | Pomona Ricerca S.R.L. | Monoclonal antibodies capable of reacting with a plurality of influenza virus A subtypes |
US9200063B2 (en) | 2008-03-17 | 2015-12-01 | Pomona Ricerca S.R.L. | Monoclonal antibodies capable of reacting with a plurality of influenza virus A subtypes |
US9169318B2 (en) | 2008-03-28 | 2015-10-27 | Sea Lane Biotechnologies, Inc. | Neutralizing molecules to viral antigens |
US9243054B2 (en) | 2008-05-27 | 2016-01-26 | Pomona Ricerca S.R.L. | Monoclonal antibodies having homosubtype cross-neutralization properties against influenza A viruses subtype H1 |
US8623363B2 (en) | 2008-12-22 | 2014-01-07 | Pomona Ricerca S.R.L. | Anti-HCV monoclonal antibody as a medicament for the therapeutic treatment and prevention of HCV infections |
US9493550B2 (en) | 2008-12-25 | 2016-11-15 | Osaka University | Human anti-human influenza virus antibody |
US8975378B2 (en) | 2008-12-25 | 2015-03-10 | Osaka University | Human anti-human influenza virus antibody |
US9849172B2 (en) | 2009-03-30 | 2017-12-26 | Icahn School Of Medicine At Mount Sinai | Influenza virus vaccines and uses thereof |
WO2010132604A3 (en) * | 2009-05-13 | 2011-03-24 | Sea Lane Biotechnologies, Llc | Neutralizing molecules to influenza viruses |
US10017561B2 (en) | 2009-05-13 | 2018-07-10 | I2 Pharmaceuticals, Inc. | Neutralizing molecules to influenza viruses |
US9175069B2 (en) | 2009-05-26 | 2015-11-03 | Icahn School Of Medicine At Mount Sinai | Monoclonal antibodies against influenza virus generated by cyclical administration and uses thereof |
ITTO20090414A1 (it) * | 2009-06-01 | 2010-12-02 | Pomona Biotechnologies Llc | Anticorpi monoclonali come medicamento per il trattamento terapeutico e/o profilattico delle infezioni da virus influenzale a (h1n1) di origine suina (s-oiv) |
WO2010140114A1 (en) * | 2009-06-01 | 2010-12-09 | Pomona Biotechnologies Llc | Monoclonal antibodies as a medicament for the therapeutic and/or prophylactic treatment of swine -origin influenza a (h1n1) virus (s-oiv) infections |
US8486406B2 (en) | 2009-06-01 | 2013-07-16 | Pomona Ricerca S.R.L. | Monoclonal antibodies as a medicament for the therapeutic and/or prophylactic treatment of swine-origin influenza A (H1N1) virus (S-OIV) infections |
US20130209499A1 (en) * | 2010-02-18 | 2013-08-15 | Mount Sinai School Of Medicine | Vaccines for use in the prophylaxis and treatment of influenza virus disease |
US9701723B2 (en) * | 2010-02-18 | 2017-07-11 | Icahn School Of Medicine At Mount Sinai | Vaccines for use in the prophylaxis and treatment of influenza virus disease |
US10179806B2 (en) | 2010-03-30 | 2019-01-15 | Icahn School Of Medicine At Mount Sinai | Influenza virus vaccines and uses thereof |
US9708373B2 (en) | 2010-03-30 | 2017-07-18 | Icahn School Of Medicine At Mount Sinai | Influenza virus vaccine and uses thereof |
US10300140B2 (en) | 2011-07-28 | 2019-05-28 | I2 Pharmaceuticals, Inc. | Sur-binding proteins against ERBB3 |
US10131695B2 (en) | 2011-09-20 | 2018-11-20 | Icahn School Of Medicine At Mount Sinai | Influenza virus vaccines and uses thereof |
US9975956B2 (en) | 2011-12-22 | 2018-05-22 | I2 Pharmaceuticals, Inc. | Surrogate binding proteins which bind DR4 and/or DR5 |
US9969794B2 (en) | 2012-05-10 | 2018-05-15 | Visterra, Inc. | HA binding agents |
US9096657B2 (en) | 2012-05-10 | 2015-08-04 | Visterra, Inc. | HA binding agents |
US10800835B2 (en) | 2012-05-10 | 2020-10-13 | Visterra, Inc. | HA binding agents |
US8877200B2 (en) | 2012-05-10 | 2014-11-04 | Visterra, Inc. | HA binding agents |
US9371366B2 (en) | 2012-12-18 | 2016-06-21 | Icahn School Of Medicine At Mount Sinai | Influenza virus vaccines and uses thereof |
US10137189B2 (en) | 2012-12-18 | 2018-11-27 | Icahn School Of Medicine At Mount Sinai | Influenza virus vaccines and uses thereof |
US9968670B2 (en) | 2012-12-18 | 2018-05-15 | Icahn School Of Medicine At Mount Sinai | Influenza virus vaccines and uses thereof |
US10583188B2 (en) | 2012-12-18 | 2020-03-10 | Icahn School Of Medicine At Mount Sinai | Influenza virus vaccines and uses thereof |
US10544207B2 (en) | 2013-03-14 | 2020-01-28 | Icahn School Of Medicine At Mount Sinai | Antibodies against influenza virus hemagglutinin and uses thereof |
US9908930B2 (en) | 2013-03-14 | 2018-03-06 | Icahn School Of Medicine At Mount Sinai | Antibodies against influenza virus hemagglutinin and uses thereof |
US10736956B2 (en) | 2015-01-23 | 2020-08-11 | Icahn School Of Medicine At Mount Sinai | Influenza virus vaccination regimens |
US10513553B2 (en) | 2015-11-13 | 2019-12-24 | Visterra, Inc. | Compositions and methods for treating and preventing influenza |
US11266734B2 (en) | 2016-06-15 | 2022-03-08 | Icahn School Of Medicine At Mount Sinai | Influenza virus hemagglutinin proteins and uses thereof |
US11865173B2 (en) | 2016-06-15 | 2024-01-09 | Icahn School Of Medicine At Mount Sinai | Influenza virus hemagglutinin proteins and uses thereof |
US11254733B2 (en) | 2017-04-07 | 2022-02-22 | Icahn School Of Medicine At Mount Sinai | Anti-influenza B virus neuraminidase antibodies and uses thereof |
US11230593B2 (en) | 2019-03-25 | 2022-01-25 | Visterra, Inc. | Compositions and methods for treating and preventing influenza |
Also Published As
Publication number | Publication date |
---|---|
AU1947183A (en) | 1984-03-07 |
PT77230B (en) | 1986-02-04 |
IL69556A0 (en) | 1983-11-30 |
PH18872A (en) | 1985-10-21 |
NZ220612A (en) | 1988-07-28 |
NO161002B (no) | 1989-03-13 |
EP0116629A4 (en) | 1987-06-29 |
NO161002C (no) | 1989-06-21 |
NO841540L (no) | 1984-04-17 |
PT77230A (en) | 1983-09-01 |
IT1168636B (it) | 1987-05-20 |
KR840006198A (ko) | 1984-11-22 |
GR78931B (it) | 1984-10-02 |
AU570929B2 (en) | 1988-03-31 |
IL69556A (en) | 1988-05-31 |
FI841583A (fi) | 1984-04-19 |
IT8348868A0 (it) | 1983-08-22 |
ES525088A0 (es) | 1985-06-16 |
JPS59501714A (ja) | 1984-10-11 |
DK203684A (da) | 1984-04-18 |
ZA836080B (en) | 1984-04-25 |
ES8505819A1 (es) | 1985-06-16 |
DK203684D0 (da) | 1984-04-18 |
EP0116629A1 (en) | 1984-08-29 |
FI841583A0 (fi) | 1984-04-19 |
NZ205341A (en) | 1988-07-28 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
AU570929B2 (en) | Broad spectrum influenza antisera | |
US4625015A (en) | Broad spectrum influenza antisera | |
Katz et al. | Efficacy of inactivated influenza A virus (H3N2) vaccines grown in mammalian cells or embryonated eggs | |
CA2849822C (en) | Novel influenza hemagglutinin protein-based vaccines | |
Kodihalli et al. | Selection of a single amino acid substitution in the hemagglutinin molecule by chicken eggs can render influenza A virus (H3) candidate vaccine ineffective | |
US5136019A (en) | Synthetic peptides for diagnosis and prevention of influenza virus infection and their use | |
CA2950085A1 (en) | Stabilized influenza hemagglutinin stem region trimers and uses thereof | |
HUT71860A (en) | Retro-, inverso-, and retro-inverso synthetic peptide analogues | |
US20120014972A1 (en) | Influenza virus compositions and methods for universal vaccines | |
AU650911B2 (en) | Peptides for use in vaccination and induction of neutralizing antibodies against human immunodeficiency virus | |
CN105418738B (zh) | 口蹄疫病毒a型抗原多肽、融合抗原多肽及疫苗 | |
Hackett et al. | A synthetic decapeptide of influenza virus hemagglutinin elicits helper T cells with the same fine recognition specificities as occur in response to whole virus. | |
US5243030A (en) | Conjugates of a synthetic peptide for diagnosis and prevention of influenza virus infection | |
CN102397559B (zh) | 广谱型流感疫苗及其制备方法 | |
CN101879312B (zh) | 广谱型流感疫苗及其制备方法 | |
CN110003314B (zh) | H1n1流感病毒血凝素可诱发广谱保护性抗体的表位肽及其应用 | |
Nagy et al. | The intersubunit region of the influenza virus haemagglutinin is recognized by antibodies during infection | |
CN103087156B (zh) | 口蹄疫病毒抗原多肽及疫苗 | |
Pedersen et al. | Iscom immunization with synthetic peptides representing measles virus hemagglutinin | |
CN101087808A (zh) | 流行性感冒病毒蛋白质的组合物及其使用方法 | |
EP1476182A1 (en) | Immunogenic formulations of variable peptidic epitopes and process for preparation thereof | |
EP0370090A1 (en) | OF COMMON SEQUENCES OF ANTIGENS AND ANTIIDIOTYPICAL ANTIBODIES OR OF ANTIBODIES WITH SPECIFICITY FOR THE CELLULAR RECEPTORS OF THE ANTIQUE DERIVED IMMUNOGENIC AND BIOLOGICALLY ACTIVE PEPTIDES. | |
CN114053400A (zh) | 一种预防新型冠状病毒肺炎covid-19的疫苗及其制备方法 | |
TW201100094A (en) | An antigenic peptide derived from influenza virus and a method for selecting anti-influenza virus antibody | |
JP2004520331A (ja) | 日本脳炎ウイルスに対するキメラtヘルパー細胞−b細胞ペプチドワクチン |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
AK | Designated states |
Designated state(s): AT AU CH DE DK FI GB JP LU NL NO SE |
|
AL | Designated countries for regional patents |
Designated state(s): AT BE CH DE FR GB LU NL SE |
|
WWE | Wipo information: entry into national phase |
Ref document number: 1983902869 Country of ref document: EP |
|
WWE | Wipo information: entry into national phase |
Ref document number: 841583 Country of ref document: FI |
|
WWP | Wipo information: published in national office |
Ref document number: 1983902869 Country of ref document: EP |
|
REG | Reference to national code |
Ref country code: DE Ref legal event code: 8642 |
|
WWW | Wipo information: withdrawn in national office |
Ref document number: 1983902869 Country of ref document: EP |