US9453064B2 - Glucagon-like-peptide-2 (GLP-2) analogues - Google Patents
Glucagon-like-peptide-2 (GLP-2) analogues Download PDFInfo
- Publication number
- US9453064B2 US9453064B2 US14/398,297 US201314398297A US9453064B2 US 9453064 B2 US9453064 B2 US 9453064B2 US 201314398297 A US201314398297 A US 201314398297A US 9453064 B2 US9453064 B2 US 9453064B2
- Authority
- US
- United States
- Prior art keywords
- ser
- gly
- absent
- glp
- lys
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Active
Links
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/575—Hormones
- C07K14/605—Glucagons
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K35/00—Medicinal preparations containing materials or reaction products thereof with undetermined constitution
- A61K35/12—Materials from mammals; Compositions comprising non-specified tissues or cells; Compositions comprising non-embryonic stem cells; Genetically modified cells
- A61K35/22—Urine; Urinary tract, e.g. kidney or bladder; Intraglomerular mesangial cells; Renal mesenchymal cells; Adrenal gland
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K35/00—Medicinal preparations containing materials or reaction products thereof with undetermined constitution
- A61K35/12—Materials from mammals; Compositions comprising non-specified tissues or cells; Compositions comprising non-embryonic stem cells; Genetically modified cells
- A61K35/48—Reproductive organs
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K35/00—Medicinal preparations containing materials or reaction products thereof with undetermined constitution
- A61K35/12—Materials from mammals; Compositions comprising non-specified tissues or cells; Compositions comprising non-embryonic stem cells; Genetically modified cells
- A61K35/48—Reproductive organs
- A61K35/54—Ovaries; Ova; Ovules; Embryos; Foetal cells; Germ cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K35/00—Medicinal preparations containing materials or reaction products thereof with undetermined constitution
- A61K35/56—Materials from animals other than mammals
- A61K35/63—Arthropods
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K35/00—Medicinal preparations containing materials or reaction products thereof with undetermined constitution
- A61K35/56—Materials from animals other than mammals
- A61K35/63—Arthropods
- A61K35/64—Insects, e.g. bees, wasps or fleas
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/22—Hormones
- A61K38/26—Glucagons
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K45/00—Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
- A61K45/06—Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
- A61P1/04—Drugs for disorders of the alimentary tract or the digestive system for ulcers, gastritis or reflux esophagitis, e.g. antacids, inhibitors of acid secretion, mucosal protectants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
- A61P1/12—Antidiarrhoeals
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
- A61P1/14—Prodigestives, e.g. acids, enzymes, appetite stimulants, antidyspeptics, tonics, antiflatulents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P19/00—Drugs for skeletal disorders
- A61P19/02—Drugs for skeletal disorders for joint disorders, e.g. arthritis, arthrosis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
- A61P25/24—Antidepressants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
- A61P25/28—Drugs for disorders of the nervous system for treating neurodegenerative disorders of the central nervous system, e.g. nootropic agents, cognition enhancers, drugs for treating Alzheimer's disease or other forms of dementia
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P29/00—Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/04—Anorexiants; Antiobesity agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/06—Antihyperlipidemics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/08—Drugs for disorders of the metabolism for glucose homeostasis
- A61P3/10—Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P9/00—Drugs for disorders of the cardiovascular system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P9/00—Drugs for disorders of the cardiovascular system
- A61P9/10—Drugs for disorders of the cardiovascular system for treating ischaemic or atherosclerotic diseases, e.g. antianginal drugs, coronary vasodilators, drugs for myocardial infarction, retinopathy, cerebrovascula insufficiency, renal arteriosclerosis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P9/00—Drugs for disorders of the cardiovascular system
- A61P9/12—Antihypertensives
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
Definitions
- the present invention relates to glucagon-like-peptide-2 (GLP-2) analogues with altered GLP-1 activity and their medical use, for example in the prophylaxis, treatment or ameliorating of diseases and conditions such as metabolic endotoxemia, diabetes, obesity, and the metabolic syndrome.
- GLP-2 glucagon-like-peptide-2
- Atherosclerosis which involves the formation of fatty deposits (plaques) and activity of free radicals and infectious agents in the arteries, can be likened to arthritis of the bones and joints because they are both inflammatory disorders. Inflammation precedes the detection of insulin resistance and therefore may be a good predictor of diabetes.
- obese mice have a disrupted mucosal barrier function and increased systemic inflammation (Brun et al., Am J Physiol Gastrointest Liver Physiol 292:G518-G525, 2007. 5 Oct. 2006).
- C57BL6/J mice maintained on high-fat-diet (Cani et al., DIABETES, VOL. 57, JUNE 2008, p 1470-1481) and nonobese diabetic mouse (Hadjiyanni et al., 2009).
- Targeting ME and associated diseases is within the scope of this invention.
- Diseases including type II diabetes mellitus, atherosclerosis, Parkinson's disease and cancer metastasis arise in the context of chronic low-grade inflammation, of which the source has not clearly been defined.
- several recent studies have demonstrated significant correlations between disease development and plasma endotoxin levels (Chang 2011, J Med Sci 2011; 31(5):191-209).
- the hypothesized mechanism whereby a dual GLP2-GLP1 agonist will work in a obesity diabetes setting is depicted in FIG. 1 .
- the GLP2 component reduces inflammation and metabolic endotoxemia whereas the GLP1 component provided glucose control and weight loss through classical GLP1 dependent mechanisms.
- Human GLP-2 is a 33-amino-acid peptide derived from specific posttranslational processing of proglucagon in the enteroendocrine L cells of the intestine and in specific regions of the brainstem. It is co-secreted together with glucagon-like peptide 1 (GLP-1), oxyntomodulin, and glicentin, in response to nutrient ingestion.
- GLP-1 glucagon-like peptide 1
- oxyntomodulin oxyntomodulin
- glicentin glicentin
- GLP-2 induces significant growth of the small intestinal mucosal epithelium via the stimulation of stem cell proliferation in the crypts and inhibition of apoptosis in the villi (Drucker et al., Proc Natl Acad Sci USA 93:7911-7916 (1996)). GLP-2 also has growth effects on the colon. Furthermore, GLP-2 inhibits gastric emptying and gastric acid secretion (Wojdemann et al., J Clin Endocrinol Metab.
- GLP-2 binds to a single G protein-coupled receptor belonging to the class II glucagon secretin family.
- the GLP-2 receptor is expressed in the small intestine, colon and stomach, which also are sites that are known to be responsive to GLP-2 (Yusta et al., Gastroenterology 119:744-755 (2000)).
- the target cell type for GLP-2 receptor stimulation in the gastrointestinal tract remains unclear, and the downstream intracellular mediators coupled to the GLP-2 receptor are poorly understood.
- GLP-2 has been shown to prevent or reduce mucosal epithelial damage in a wide number of preclinical models of gut injury, including chemotherapy-induced enteritis, ischemic-reperfusion injury, dextran sulfate-induced colitis and genetic models of inflammatory bowel disease (Sinclair and Drucker Physiology 2005: 357-65).
- GLP-2R mRNA in the stomach (Yusta et al., 2000) together with the observation that GLP-2 reduces gastric motility and gastric acid secretion (Meier et al., GASTROENTEROLOGY 2006; 130:44-54) provides ample evidence that the stomach is either directly or indirectly responsive to GLP-2. Nonetheless, the use of GLP-2 or analogues of GLP-2 in conditions characterised by damage to the gastric lining has not yet been explored.
- GLP-2 is secreted as a 33 amino acid peptide with the following sequence His-Ala-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp (SEQ ID NO: 1) It is rapidly cleaved by the enzyme DPP IV at the alanine (Ala) at position 2 relative to the N-terminus to form an inactive human GLP-2 peptide (3-33).
- GLP-2 analogues are described, e.g., in U.S. Pat. Nos. 5,789,379; 5,994,500; 6,184,201; 8,184,208; International Publication Nos. WO 97/39031; WO 01/41779; WO 02/066511 and DaCambra et al. (Biochemistry 2000, 39, 8888-8894). All references cited herein are expressly incorporated by reference in their entirety.
- the present invention concerns GLP-2 analogues comprising one or more substitutions in comparison to wild-type GLP-2 and which may have the property of an altered, preferably increased GLP-1 activity, e.g., as assessed in in vitro efficacy assays.
- GLP-1 activity for example, can be measured by determining EC50 values at the GLP-1 receptor lower than for native GLP-2.
- GLP-2 analogues of the invention comprise one or more substitutions at an amino acid position corresponding to one or more of positions 2, 3, 5, 7, 8, 9, 10, 11, 12, 14, 15, 16, 19, 20, 21, 24, 27 and/or 28 of the wild-type GLP-2 sequence in combination with Gln, Lys or Glu in position 17.
- GLP-2 analogues of the invention comprise one or more substitutions at an amino acid position corresponding to one or more of positions 2, 3, 5, 7, 8, 9, 10, 11, 12, 15, 16, 20, 21, 24, 27 and/or 28 of the wild-type GLP-2 sequence in combination with Gln, Lys or Glu in position 17.
- GLP-2 analogues of the invention comprise a conservative or non-conservative substitutions at position 2 and/or a substitution or deletion of one or more of amino acids corresponding to an amino acid of positions 28 to 33 of the wild-type GLP-2 sequence.
- the GLP-2 analogues of the present invention optionally comprise lipophilic substituents conjugated to one or more of positions 12, 14, 16, 17, 19, 20, 24, 27, 28 and 32.
- the GLP-2 analogues of the present invention optionally comprise lipophilic substituents conjugated to one or more of positions 12, 16, 17, 20, 24, 27, 28 and 32.
- a GLP-2 analogue is represented by the general Formula I:
- X31 may also be Y1.
- X28 may also be Gly.
- X29 may also be Ala.
- Y1 may be present between X33 and R 2 .
- a position X34 may be envisaged, where X34 is Y1 or is absent.
- a GLP-2 analogue is a GLP-2 analogue according to Formula I or a pharmaceutically acceptable salt or solvate thereof, wherein:
- HGDGSFSDEMNTILDGQAARDFINWLIQTKITD HGDGSFSDEMNTILDNQAARDFINWLIQTKITD
- HGDGSFSDEMNTILDNQAARDFINWLIQTKITD HGDGSFSDEMNTILDNQAARDFINWLIQTKITD
- HGDGSFSDEMNTILDSQAARDFINWLIQTK HGDGSFSDEMNTILDSQAARDFINWLIQTK.
- X13 may be Ile, Leu, Val, Tyr, Phe or Gln.
- X28 may also be Gly.
- X29 may also be Ala.
- Y1 may be present between X33 and R 2 .
- X14 of Formula I is Leu.
- X14 of Formula I is Met.
- X17 of Formula I is Gln.
- X17 of Formula I is Lys.
- X17 of Formula I is Glu.
- X19 of Formula I is Ala.
- X19 of Formula I is Val.
- X16 of Formula I is Gly and X17 of Formula I is Gln.
- X16 of Formula I is Gly and X17 of Formula I is Lys.
- X16 of Formula I is Gly and X17 is of Formula I is Glu.
- X2 of Formula I is Aib
- X16 of Formula I is Gly
- X17 of Formula I is Gln.
- X2 of Formula I is Aib
- X16 of Formula I is Gly
- X17 of Formula I is Lys.
- X2 of Formula I is Aib
- X16 of Formula I is Gly
- X17 of Formula I is Glu.
- X2 of Formula I is Gly
- X16 of Formula I is Gly
- X17 of Formula I is Gln.
- X2 of Formula I is Gly
- X16 of Formula I is Gly
- X17 of Formula a is Lys.
- X2 of Formula I is Gly
- X16 of Formula I is Gly
- X17 of Formula I is Glu.
- a GLP-2 analogue is represented by the general Formula Ia:
- HGDGSFSDEMNTILDGQAARDFINWLIQTKITD HGDGSFSDEMNTILDNQAARDFINWLIQTKITD
- HGDGSFSDEMNTILDNQAARDFINWLIQTKITD HGDGSFSDEMNTILDNQAARDFINWLIQTKITD
- HGDGSFSDEMNTILDSQAARDFINWLIQTK HGDGSFSDEMNTILDSQAARDFINWLIQTK.
- X31 may also be Y1.
- Y1 may be present between X33 and R 2 .
- a position X34 may be envisaged, where X34 is Y1 or is absent.
- X28 may also be Gly.
- X29 may also be Ala.
- a GLP-2 analogue is a GLP-2 analogue according to Formula Ia or a pharmaceutically acceptable salt or solvate thereof,
- HGDGSFSDEMNTILDGQAARDFINWLIQTKITD HGDGSFSDEMNTILDNQAARDFINWLIQTKITD
- HGDGSFSDEMNTILDNQAARDFINWLIQTKITD HGDGSFSDEMNTILDNQAARDFINWLIQTKITD
- HGDGSFSDEMNTILDSQAARDFINWLIQTK HGDGSFSDEMNTILDSQAARDFINWLIQTK.
- X13 may be Ile, Leu, Val, Tyr, Phe or Gln.
- X28 may also be Gly.
- X29 may also be Ala.
- Y1 may be present between X33 and R 2 .
- X17 of Formula Ia is Gln.
- X17 of Formula Ia is Lys.
- X17 of Formula Ia is Glu.
- X16 of Formula Ia is Gly and X17 of Formula Ia is Gln.
- X16 of Formula Ia is Gly and X17 of Formula Ia is Lys.
- X16 of Formula Ia is Gly and X17 of Formula Ia is Glu.
- X2 of Formula Ia is Aib
- X16 of Formula Ia is Gly
- X17 of Formula Ia is Gln.
- X2 of Formula Ia is Aib
- X16 of Formula Ia is Gly
- X17 of Formula Ia is Lys.
- X2 of Formula Ia is Aib
- X16 of Formula Ia is Gly
- X17 of Formula Ia is Glu.
- X2 of Formula Ia is Gly
- X16 of Formula Ia is Gly
- X17 of Formula Ia is Gln.
- X2 of Formula Ia is Gly
- X16 of Formula Ia is Gly
- X17 of Formula Ia is Lys.
- X2 of Formula Ia is Gly
- X16 of Formula Ia is Gly
- X17 of Formula Ia is Glu.
- X8-X9-X10-X11 may be Ser-Glu-Leu-Ala.
- positions X28 to X33 may be selected from certain amino acid residues, or may be Y1, or may be absent. It is intended that the GLP-2 analogue contains no more than one Y1 moiety, and that if present, Y1 forms the C-terminal part of the molecule. Thus, if any of positions is X28 to X33 is Y1, all downstream positions are absent; i.e. those positions X29 to X33 (or X34) downstream of that Y1 are absent). In this context, positions “downstream” of a given position are those located C-terminal of that position.
- positions X28 to X33 are absent, then all positions downstream of that position are also absent (except that Y1 may be present).
- positions X32-X33 are also present.
- X31-X32-X33 is present
- X30-X31-X32-X33 is present
- X29-X30-X31-X32-X33 is also present.
- the GLP-2 analogue may be represented by the general Formula II:
- X16 of Formula II is Gly, Ser or Ala.
- X17 of Formula II may be Lys, or X17 of Formula II may be Gln.
- X2 of Formula II may be Gly or Ala.
- X16 of Formula II is Gly and X17 of Formula II is Gln.
- X16 of Formula II is Gly and X17 of Formula II is Lys.
- X2 of Formula II is Gly
- X16 of Formula II is Gly
- X17 of Formula II is Gln.
- X2 of Formula II is Gly
- X16 of Formula II is Gly
- X17 of Formula II is Lys.
- X2 of Formula II is Aib
- X16 of Formula II is Gly
- X17 of Formula II is Gln.
- X2 of Formula II is Aib
- X16 of Formula II is Gly
- X17 of Formula II is Lys.
- X16 is Gly and X17 is Gln.
- X16 is Gly and X17 is Lys.
- X2 is Gly
- X16 is Gly
- X17 is Gln.
- X2 is Gly
- X16 is Gly
- X17 is Lys.
- X2 is Aib
- X16 is Gly
- X17 is Gln.
- X2 is Aib
- X16 is Gly
- X17 is Lys.
- a GLP-2 analogue is represented by the general Formula III:
- the amino acid sequence of the GLP-2 analogue has not more than 5 amino changes, e.g. not more than 4, not more than 3, not more than 2 or not more than 1 change from the amino acid sequence HGDGSFSSELATILDGKAARDFINWLIQTKITD or HGDGSFSSELATILDGQAARDFIAWLIQTKITD.
- a GLP-2 analogue of the invention is represented by any one of the following sequences:
- a GLP-2 analogue of the invention comprises a lipophilic substituent conjugated to an amino acid at a position corresponding to one or more of positions 12, 14, 16, 17, 19, 20, 24, 27, 28 and 32 of native GLP-2.
- a GLP-2 analogue of the invention comprises a lipophilic substituent conjugated to an amino acid at a position corresponding to one or more of positions 12, 16, 17, 20, 24, 27, 28 and 32 of native GLP-2.
- a GLP-2 analogue of the invention may be used in a therapy.
- the invention provides a pharmaceutical composition comprising a GLP-2 analogue of the invention, or a salt or derivative thereof, in admixture with a carrier.
- the pharmaceutical composition may comprise a GLP-2 analogue that is a pharmaceutically acceptable acid addition salt.
- the pharmaceutical composition is formulated as a liquid suitable for administration by injection or infusion, or which is formulated to cause slow release of a GLP-2 analogue of the invention.
- the invention provides for the use of a GLP-2 analogue of the invention for the preparation of a medicament for the treatment and/or prevention of low grade inflammation.
- the invention provides for the use of a GLP-2 analogue of the invention for the preparation of a medicament for the treatment and/or prevention of low grade inflammation related to diabetes (which may be type I or type II diabetes, but particularly type II).
- the low grade inflammation is local or systemic low grade inflammation.
- the low grade inflammation includes the metabolic syndrome, obesity (e.g.
- ulcers of any aetiology e.g., peptic ulcers, Zollinger-Ellison Syndrome, drug-induced ulcers, ulcers related to infections or other pathogens
- digestion disorders malabsorption syndromes, short-bowel syndrome, cul-de-sac syndrome, inflammatory bowel disease (e.g., Crohns disease and ulcerative colitis), celiac sprue (for example arising from gluten induced enteropathy or celiac disease), tropical sprue, hypogammaglobulinemic sprue, and chemotherapy and/or radiationhemotherapy induced mucositis and diarrhea.
- Some of the above diseases, conditions and disorders may be characterized as being associated with low grade inflammation.
- the invention provides a nucleic acid molecule comprising a nucleic acid sequence encoding a GLP-2 analogue of the invention.
- the invention provides an expression vector comprising a nucleic acid molecule comprising a nucleic acid sequence encoding a GLP-2 analogue of the invention in combination with control sequences to direct the expression of the GLP-2 analogue.
- the invention provides a host cell transformed with the expression vector.
- the invention provides a method of producing a GLP-2 analogue of the invention, the method comprising culturing host cells expressing the GLP-2 analogue under conditions suitable for expression and purifying the GLP-2 analogue thus produced.
- nucleic acid molecule of the invention may be used in a therapy.
- an expression vector of the invention may be used in a therapy.
- host cell of the invention may be used in a therapy.
- the invention provides for the use of a nucleic acid molecule of the invention, an expression vector of the invention, or a host cell of the invention in the preparation of a medicament for the treatment and/or prevention of low grade inflammation.
- the low grade inflammation is local or systemic, and can include, for example, metabolic syndrome (broadest definition), obesity (e.g.
- abdominal obesity diabetes, cardiovascular diseases, gastrointestinal inflammation, depression, Alzheimer's disease, arthritis, hypertension, dyslipidaemia and stroke, gastro-intestinal disorders in the upper gastrointestinal tract of the oesophagus, the stomach, duodenum, the small intestine, colon and rectum including ulcers of any aetiology (e.g., peptic ulcers, Zollinger-Ellison Syndrome, drug-induced ulcers, ulcers related to infections or other pathogens), digestion disorders, malabsorption syndromes, short-bowel syndrome, cul-de-sac syndrome, inflammatory bowel disease (Crohns disease and ulcerative colitis), celiac sprue (for example arising from gluten induced enteropathy or celiac disease), tropical sprue, hypogammaglobulinemic sprue, and chemotherapy and/or radiationhemotherapy induced mucositis and diarrhea.
- aetiology e.g., peptic ulcers, Zollinger-Ellison Syndrome
- the invention provides a method of treating a gastrointestinal-related disorder (e.g., stomach or bowel) in a patient in need thereof by administering an effective amount a GLP-2 analogue of the invention, a nucleic acid molecule of the invention, an expression vector of the invention, or a host cell of the invention.
- a gastrointestinal-related disorder e.g., stomach or bowel
- the gastrointestinal related disorder is low grade inflammation.
- the low grad inflammation may be local or systemic, and may include the metabolic syndrome, obesity (e.g.
- abdominal obesity diabetes, cardiovascular diseases, gastrointestinal inflammation, depression, alzheimer, arthritis, hypertension, dyslipidaemia and stroke, gastrointestinal disorders in the upper gastrointestinal tract of the oesophagus, the stomach, duodenum, the small intestine, colon, or rectum, including ulcers of any aetiology (e.g., peptic ulcers, Zollinger-Ellison Syndrome, drug-induced ulcers, ulcers related to infections or other pathogens), digestion disorders, malabsorption syndromes, short-bowel syndrome, cul-de-sac syndrome, inflammatory bowel disease (e.g., Crohns disease and ulcerative colitis), celiac sprue (for example arising from gluten induced enteropathy or celiac disease), tropical sprue, hypogammaglobulinemic sprue, and chemotherapy and/or radiationhemotherapy induced mucositis and diarrhea.
- aetiology e.g., peptic ulcers, Zollinger-E
- the invention provides a therapeutic kit comprising a cancer chemotherapy drug and a GLP-2 analogue of the invention, a nucleic acid molecule of the invention, an expression vector of the invention or a host cell of the invention, each optionally in combination with a pharmaceutically acceptable carrier.
- FIG. 1 shows the effects of GLP-1 and GLP-2 on physiological pathways. (Adapted from Cani et al., Pharmacology and Therapeutics 130 (2011) 202-212.)
- FIG. 2 shows the effects of Compound 12 or vehicle administration on the oral glucose tolerance test (OGTT). One hour before glucose challenge, baseline measurements were taken and Compound 12/vehicle was administered. (A) Blood glucose levels during the experimental period (B) AUC of blood glucose measurements.
- FIG. 3 shows the effects of Compound 7 or vehicle administration on intestinal wet weight. Animals were treated with compound 7 or vehicle once daily, for four days and on day 5 the small intestine was removed and weighed.
- FIG. 4 shows effects of two weeks administration of test compound 7 or vehicle administration on intestinal weight.
- A Small intestinal wet weight
- B Large intestinal wet weight.
- FIG. 5 shows effects of two weeks administration of test compound 7 or vehicle administration on glucose homeostasis. Animals were fasted overnight, and blood drawn for analysis of (A) fasting blood glucose (B) fasting plasma insulin and (C) homeostatic model assessment-insulin resistance (HOMA-IR).
- A fasting blood glucose
- B fasting plasma insulin
- C homeostatic model assessment-insulin resistance
- patient ⁇ subject
- rodents e.g., mice and rats
- solvate in the context of the present invention refers to a complex of defined stoichiometry formed between a solute (in casu, a peptide conjugate or pharmaceutically acceptable salt thereof according to the invention) and a solvent.
- the solvent in this connection may, for example, be water, ethanol or another pharmaceutically acceptable, typically small-molecular organic species, such as, but not limited to, acetic acid or lactic acid.
- a solvate is normally referred to as a hydrate.
- agonist refers to a substance (ligand) that activates the receptor type in question.
- sequences disclosed herein are sequences incorporating an “Hy-” moiety at the amino terminus (N-terminus) of the sequence, and either an “—OH” moiety or an “—NH 2 ” moiety at the carboxy terminus (C-terminus) of the sequence.
- a C-terminal “—OH” moiety may be substituted for a C-terminal “—NH 2 ” moiety, and vice-versa.
- a “conservative substitution” means that an amino acid residue belonging to a certain position of the native human GLP-2 peptide sequence has been exchanged with an amino acid residue belonging to the same group (I, II, III, IV, V, 1, 2, 3) as defined in the following table:
- non-conservative substitution as used herein means any substitution other than a conservative substitution of an amino acid residue of the native human GLP-2 sequence, e.g., substitution with a non-protein non-natural amino acid (Sar, Nle, Aib) or substituting with an amino acid which does not belong to the same group.
- a compound of the invention has at least one GLP-2 and one GLP-1 biological activity.
- Exemplary activities include reducing the permeability of the intestine and altering inflammation in the intestine. This can be assessed in in vivo assays, for example as described in the examples, in which the mass and the permeability of the intestine, or a portion thereof, is determined after a test animal has been treated or exposed to a GLP-2 analogue.
- a GLP-2 analogue of the invention has at least 60% amino acid sequence identity to wild-type GLP-2 (1-33) having the sequence His-Ala-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr- Asp.
- a GLP-2 analogue of the invention may have from between about 50% to 88% sequence identity, e.g., between about 60%-80% and in certain embodiments, at least 63%, 66%, or 69% sequence identity.
- Percent (%) amino acid sequence identity with respect to the GLP-2 polypeptide sequences is defined as the percentage of amino acid residues in a candidate sequence that are identical to the amino acid residues in the wild-type GLP-2 sequence, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity, and not considering any conservative substitutions as part of the sequence identity. Sequence alignment can be carried out by the skilled person using techniques well known in the art for example using publicly available software such as BLAST, BLAST2 or Align software.
- percent sequence identities used herein and in accordance with the present invention may be determined using these programs with their default settings. More generally, the skilled worker can readily determine appropriate parameters for determining alignment, including any algorithms needed to achieve maximal alignment over the full length of the sequences being compared.
- a GLP-2 analogue of the invention comprises more than one substitution (i.e., more than one substitution relative to the wild type GLP-2 sequence given above) at positions X2, X3, X5, X7, X8, X9, X10, X11, X12, X13, X14, X15, X16, X17, X19, X20, X21, X24, X27, X28, X29, X30, X31, X32 and X33.
- a GLP-2 analogue of the invention comprises more than one substitution (i.e., more than one substitution relative to the wild type GLP-2 sequence given above) at positions X2, X3, X5, X7, X8, X9, X10, X11, X12, X13, X15, X16, X17, X20, X21, X24, X27, X28, X29, X30, X31, X32 and X33.
- amino acid residues in positions X28, X29, X30, X31, X32 and X33 are optionally deleted.
- a polar or charged residue e.g., Gln, Lys or Glu
- a polar or charged amino acid in position 17, thus, may alter the receptor selectivity of GLP-2 peptides or analogues thereof, resulting in dual agonistic peptides activating both the GLP-1 and GLP-2 receptors.
- a small amino acid residue e.g., Gly, Ser or Ala
- Gly, Ser or Ala may be preferable for introducing or enhancing GLP-1 receptor activity of a GLP-2 peptide analogue.
- a GLP-2 analogue as described above comprises a lipophilic substituent conjugated to one or more of positions 12, 14, 16, 17, 19, 20, 24, 27, 28 and 32.
- a GLP-2 analogue as described above comprises a lipophilic substituent conjugated to one or more of positions 12, 16, 17, 20, 24, 27, 28 and 32.
- the GLP-2 analogue as described above comprises a lipophilic substituent conjugated to one or more of positions 16, 17, 20 and 24.
- the present invention provides the use of GLP-2 analogues of the invention for the preparation of a medicament for the treatment and/or prevention of gastrointestinal inflammation, e.g., low level gastrointestinal inflammation related to diabetes.
- the present invention provides a nucleic acid molecule comprising a nucleic acid sequence encoding a GLP-2 analogue as defined herein.
- the present invention provides an expression vector comprising the above nucleic acid sequence, optionally in combination with sequences to direct its expression, and host cells transformed with the expression vectors.
- the host cells are capable of expressing and secreting the GLP-2 analogue.
- the present invention provides a method of producing the GLP-2 analogue, the method comprising culturing the host cells under conditions suitable for expressing the GLP-2 analogue and purifying the GLP-2 analogue thus produced.
- the invention further provides a nucleic acid of the invention, an expression vector of the invention, or a host cell capable of expressing and secreting a GLP-2 analogue of the invention, for use in therapy.
- the nucleic acid, expression vector and host cells may be used for treatment of any of the disorders described herein which may be treated with the GLP-2 analogues themselves.
- References to a therapeutic composition comprising a GLP-2 analogue of the invention, or administration of a GLP-2 analogue of the invention should therefore be construed to encompass administration of a nucleic acid, expression vector or host cell of the invention except where the context demands otherwise.
- the present invention provides the use of a nucleic acid molecule, an expression vector, or a host cell as defined herein, in the preparation of a medicament for the treatment and/or prevention of gastrointestinal inflammation.
- the present invention provides a method of treating a low level gastrointestinal inflammation related to diabetes
- the present invention provides a method of treating or preventing low level gastrointestinal inflammation related to diabetes in a patient in need thereof, the method comprising administering an effective amount a nucleic acid, expression vector or host cell of the invention.
- the GLP-2 analogues of the invention have one or more amino acid substitutions, deletions, inversions, or additions compared to native GLP-2.
- This definition also includes the synonym terms GLP-2 mimetics and/or GLP-2 agonists.
- an analogue of the present invention may additionally have a chemical modification of one or more of its amino acid side groups, ⁇ -carbon atoms, terminal amino group, or terminal carboxylic acid group.
- a chemical modification includes, but is not limited to, adding chemical moieties, creating new bonds, and removing chemical moieties.
- Modifications at amino acid side groups include, without limitation, acylation of lysine ⁇ -amino groups, N-alkylation of arginine, histidine, or lysine, alkylation of glutamic or aspartic carboxylic acid groups, and deamidation of glutamine or asparagine.
- Modifications of the N-terminal amino group includes, without limitation, des-amino, N-lower alkyl, N-di-lower alkyl, and N-acyl modifications.
- Modifications of the C-terminal carboxy group include, without limitation, amide, lower alkyl amide, dialkyl amide, and lower alkyl ester modifications.
- a lower alkyl is C 1 -C 4 alkyl.
- one or more functional groups in side chains or terminal groups may be protected by protective groups known to the skilled worker, in some embodiments, the alpha-carbon of an amino acid may be mono- or di-methylated.
- an oxidatively stable Met-replacement amino acid means one which is selected among the group consisting of Met(O) (methionine sulfoxide), Met(O) 2 (methionine sulfone), Val, Ile, Ser and preferably Ile, Leu, Val, Lys or Ser.
- One or more of the amino acid side chains in a compound employed in the context of the invention may be conjugated to a lipophilic substituent Z 1 .
- a lipophilic substituent binds albumin in the blood stream, thus shielding the compounds employed in the context of the invention from enzymatic degradation, which can enhance the half-life of the compounds.
- the lipophilic substituent may also modulate the potency of the compound, e.g., with respect to the GLP-2 receptor and/or the GLP-1 receptor.
- only one amino acid side chain is conjugated to a lipophilic substituent, in other embodiments, two amino acid side chains are each conjugated to a lipophilic substituent. In yet further embodiments, three or even more amino acid side chains are each conjugated to a lipophilic substituent. When a compound contains two or more lipophilic substituents, they may be the same or different substituents.
- the lipophilic substituent Z 1 may be covalently bonded to an atom in the amino acid &de chain, or alternatively may be conjugated to the amino acid side chain by one or more spacers Z 2 .
- conjugated is used here to describe the covalent attachment of one identifiable chemical moiety to another, and the structural relationship between such moieties. It should not be taken to imply any particular method of synthesis.
- the one or more spacers Z 2 when present, are used to provide a spacing between the compound and the lipophilic moiety.
- a lipophilic substituent may be attached to an amino acid side chain or to a spacer via an ester, a sulphonyl ester, a thioester, an amide or a sulphonamide.
- a lipophilic substituent may include an acyl group, a sulphonyl group, an N atom, an O atom or an S atom which forms part of the ester, sulphonyl ester, thioester, amide or sulphonamide.
- an acyl group in the lipophilic substituent forms part of an amide or ester with the amino acid side chain or the spacer.
- the lipophilic substituent may include a hydrocarbon chain having 10 to 24 carbon (C) atoms, e.g. 10 to 22 C atoms, e.g. 10 to 20 C atoms. Preferably, it has at least 11 C atoms, and preferably it has 18 C atoms or fewer.
- the hydrocarbon chain may contain 12, 13, 14, 15, 16, 17 or 18 carbon atoms.
- the hydrocarbon chain may be linear or branched and may be saturated or unsaturated.
- the hydrocarbon chain is preferably substituted with a moiety which forms part of the attachment to the amino acid side chain or the spacer, for example an acyl group, a sulphonyl group, an N atom, an O atom or an S atom.
- the hydrocarbon chain is substituted with an acyl group, and accordingly the hydrocarbon chain may be part of an alkanoyl group, for example a dodecanoyl, 2-butyloctanoyl, tetradecanoyl, hexadecanoyl, heptadecanoyl, octadecanoyl or eicosanoyl group.
- the lipophilic substituent Z 1 may be conjugated to the amino acid side chain by one or more spacers Z 2 .
- the spacer is attached to the lipophilic substituent and to the amino acid side chain.
- the spacer may be attached to the lipophilic substituent and to the amino acid side chain independently by an ester, a sulphonyl ester, a thioester, an amide or a sulphonamide. Accordingly, it may include two moieties independently selected from acyl, sulphonyl, an N atom, an O atom or an S atom.
- the spacer may consist of a linear C 1-10 hydrocarbon chain or more preferably a linear C 1-5 hydrocarbon chain.
- the spacer can be substituted with one or more substituents selected from C 1-6 alkyl, C 1-6 alkyl amine, C 1-6 alkyl hydroxy and C 1-6 alkyl carboxy.
- the spacer may be, for example, a residue of any naturally occurring or unnatural amino acid.
- the spacer may be a residue of Gly, Pro, Ala, Val, Leu, Ile, Met, Cys, Phe, Tyr, Trp, His, Lys, Arg, Gln, Asn, ⁇ -Glu, ⁇ -Glu, ⁇ -Lys, Asp, Ser, Thr, Gaba, Aib, ⁇ -Ala (i.e., 3-aminopropanoyl), 4-aminobutanoyl, 5-aminopentanoyl, 6-aminohexanoyl, 7-aminoheptanoyl, 8-aminooctanoyl, 9-aminononanoyl, 10-aminodecanoyl or 8-amino-3,6-dioxaoctanoyl.
- the spacer is a residue of Glu, ⁇ -Glu, ⁇ -Lys, ⁇ -Ala (i.e., 3-aminopropanoyl), 4-aminobutanoyl, 8-aminooctanoyl or 8-amino-3,6-dioxaoctanoyl.
- ⁇ -Glu and isoGlu are used interchangeably.
- the amino acid side chain to which the lipophilic substituent is conjugated may be a side chain of a Glu, Lys, Ser, Cys, Dbu, Dpr or Orn residue. For example, it may be a side chain of a Lys, Glu or Cys residue.
- the amino acid side chain includes an carboxy, hydroxyl, thiol, amide or amine group, for forming an ester, a sulphonyl ester, a thioester, an amide, or a sulphonamide with the spacer or lipophilic substituent.
- the side chain of a Lys residue is covalently attached to a ⁇ -Glu spacer (Z 2 ) via an amide linkage.
- a hexadecanoyl group (Z 1 ) is covalently attached to the ⁇ -Glu spacer via an amide linkage.
- This combination of lipophilic moiety and spacer, conjugated to a Lys residue may be referred to by the short-hand notation K(Hexadecanoyl- ⁇ -Glu), e.g., when shown in formulae of specific compounds.
- ⁇ -Glu can also be referred to as isoGlu, and a hexadecanoyl group as a palmitoyl group.
- a GLP2-analogue of the invention has a lipophilic substituent as described above conjugated to an amino acid at one or more of positions corresponding to positions 12, 14, 16, 17, 19, 20, 24, 27, 28 and 32 of native GLP-2.
- a GLP2-analogue of the invention has a lipophilic substituent as described above conjugated to an amino acid at one or more of positions corresponding to positions 12, 16, 17, 20, 24, 27, 28 and 32 of native GLP-2.
- Salts include pharmaceutically acceptable salts such as acid addition salts and basic salts.
- acid addition salts include hydrochloride salts, citrate salts, lactate salts, malate salts and acetate salts.
- Examples of basic salts include salts where the cation is selected from alkali metals, such as sodium and potassium, alkaline earth metals, such as calcium, and ammonium ions + N(R 3 ) 3 (R 4 ), where R 3 and R 4 independently designates optionally substituted C 1-6 -alkyl, optionally substituted C 2-6 -alkenyl, optionally substituted aryl, or optionally substituted heteroaryl.
- alkali metals such as sodium and potassium
- alkaline earth metals such as calcium
- R 3 and R 4 independently designates optionally substituted C 1-6 -alkyl, optionally substituted C 2-6 -alkenyl, optionally substituted aryl, or optionally substituted heteroaryl.
- R 3 and R 4 independently designates optionally substituted C 1-6 -alkyl, optionally substituted C 2-6 -alkenyl, optionally substituted aryl, or optional
- GLP-2 analogues of the invention include coordination complexes with metal ions such as Mn 2+ and Zn 2+ , esters such as in vivo hydrolysable esters, free acids or bases, hydrates, prodrugs or lipids.
- Esters can be formed between hydroxyl or carboxylic acid groups present in the compound and an appropriate carboxylic acid or alcohol reaction partner, using techniques well known in the art.
- Derivatives which are prodrugs of the compounds are convertible in vivo or in vitro into one of the parent compounds. Typically, at least one of the biological activities of compound will be reduced in the prodrug form of the compound, and can be activated by conversion of the prodrug to release the compound or a metabolite of it.
- prodrugs include the use of protecting groups which may be removed in situ releasing active compound or serve to inhibit clearance of the drug in vivo.
- GLP-2 analogues having an EC50 value of 1 nM or below, and preferably below 1 nM, are defined as GLP-2 agonists.
- the present invention includes the following peptides further described in the experiments below.
- the GLP-2 analogues may be synthesized in a number of ways including, for example, a method comprising:
- analogue of the invention it may be advantageous to exploit genetic engineering techniques. This may be the case when the peptide is sufficiently large (or produced as a fusion construct) and when the peptide only includes naturally occurring amino acids that can be translated from RNA in living organisms.
- nucleic acid fragments encoding the peptides of the invention are important chemical products.
- a further aspect of the present invention provides a nucleic acid molecule comprising a nucleic acid sequence encoding a GLP-2 analogue of the invention, where the peptide preferably is comprised of naturally occurring amino acids.
- the nucleic acid fragments of the invention may be either DNA or RNA fragments.
- the nucleic acid fragments of the invention will normally be inserted in suitable vectors to form cloning or expression vectors carrying the nucleic acid fragments of the invention.
- suitable vectors to form cloning or expression vectors carrying the nucleic acid fragments of the invention.
- Such novel vectors are also part of the invention. Details concerning the construction of these vectors of the invention will be discussed in context of transformed cells and microorganisms below.
- the vectors can, depending on purpose and type of application, be in the form of plasmids, phages, cosmids, mini-chromosomes, or viruses, but naked DNA which is only expressed transiently in certain cells also is an important vector.
- Preferred cloning and expression vectors (plasmid vectors) of the invention are capable of autonomous replication, thereby enabling high copy-numbers for the purposes of high-level expression or high-level replication for subsequent cloning.
- the general outline of a vector of the invention comprises the following features in the 5′ to 3′ direction and in operable linkage: a promoter for driving expression of the nucleic acid fragment of the invention, optionally a nucleic acid sequence encoding a leader peptide enabling secretion (to the extracellular phase or, where applicable, into the periplasma) of or a leader peptide for multiple use e.g. combined secretion, purification tag and enzymatic trimming to correct peptide or integration into the membrane of the polypeptide fragment, the nucleic acid fragment encoding the peptide of the invention, and optionally a nucleic acid sequence encoding a terminator.
- a promoter for driving expression of the nucleic acid fragment of the invention optionally a nucleic acid sequence encoding a leader peptide enabling secretion (to the extracellular phase or, where applicable, into the periplasma) of or a leader peptide for multiple use e.g. combined secretion, purification tag
- the vectors of the invention may be used to transform host cells to produce a GLP-2 analogue of the invention.
- Such transformed cells which are also part of the invention, can be cultured cells or cell ones used for propagation of the nucleic acid fragments and vectors of the invention, or used for recombinant production of the peptides of the invention.
- Preferred transformed cells of the invention are micro-organisms such as bacteria including, for example, bacteria from the genera Escherichia (e.g., E. coli ), Bacillus (e.g., Bacillus subtilis ), Salmonella , or Mycobacterium (preferably non-pathogenic, e.g., M. bovis BCG)), yeasts (such as Saccharomyces cerevisiae ), and protozoans.
- the transformed cells may be derived from a multicellular organism, e.g., fungal cells, insect cells, plant cells, or mammalian cells (e.g., cells derived from a human).
- the transformed cell is capable of replicating a nucleic acid fragment of the invention.
- Cells expressing a nucleic fragment of the invention are preferred useful embodiments of the invention. They can be used for small-scale or large-scale preparation of the peptides of the invention.
- this stable cell line which carries the vector of the invention and which expresses the nucleic acid fragment encoding the peptide.
- this stable cell line secretes or carries the peptide of the invention, thereby facilitating purification thereof.
- plasmid vectors containing replicon and control sequences which are derived from species compatible with the host cell, are used in connection with a host.
- the vector ordinarily carries a replication site, as well as marking sequences, which are capable of providing phenotypic selection in transformed cells.
- E. coli may typically be transformed using pBR322 (although numerous other useful plasmids exist), a plasmid derived from an E. coli species (see, e.g., Bolivar et al., 1977).
- the pBR322 plasmid contains genes for ampicillin and tetracycline resistance and, thus, provides easy means for identifying transformed cells.
- the pBR plasmid, or other microbial plasmid or phage must also contain, or be modified to contain, promoters, which can be used by the prokaryotic microorganism for expression.
- promoters most commonly used in prokaryotic recombinant DNA construction include the beta-lactamase (penicillinase) and lactose promoter systems (Chang et al., 1978; Itakura et al., 1977; Goeddel et al., 1979) and a tryptophan (trp) promoter system (Goeddel et al., 1979; EP 0 036 776 A). While these are the most commonly used, other microbial promoters have been discovered and utilized, and details concerning their nucleotide sequences have been published, enabling a skilled worker to ligate them functionally with plasmid vectors (Siebwenlist et al., 1980).
- eukaryotic microbes such as yeast cultures may also be used.
- a promoter also should be capable of driving expression.
- Saccharomyces cerevisiae or common baker's yeast, is the most commonly used among eukaryotic microorganisms, although a number of other strains are commonly available.
- Pichia stiptis and Schizosaccharomyces pombe also may be used.
- the plasmid YRp7 for example, is commonly used (Stinchcomb et al., 1979; Kingsman et al., 1979; Tschemper et al., 1980).
- This plasmid already contains the trpI gene which provides a selection marker for a mutant strain of yeast lacking the ability to grow in tryptophan (for example ATCC No. 44076 or PEP4-1) (Jones, 1977.
- tryptophan for example ATCC No. 44076 or PEP4-1
- the presence of the trpI lesion as a characteristic of the yeast host cell genome then provides an effective environment for detecting transformation by growth in the absence of tryptophan.
- Suitable promoting sequences in yeast vectors include the promoters for 3-phosphoglycerate kinase (Hitzman et al., 1980) or other glycolytic enzymes (Hess et al., 1968; Holland et al., 1978), such as enolase, glyceraldehyde-3-phosphate dehydrogenase, hexokinase, pyruvate decarboxylase, phosphofructokinase, glucose-6-phosphate isomerase, 3-phosphoglycerate mutase, pyruvate kinase, triosephosphate isomerase, phosphoglucose isomerase, and glucokinase.
- the termination sequences associated with these genes are also ligated into the expression vector 3′ of the sequence desired to be expressed to provide polyadenylation of the mRNA and termination.
- promoters which have the additional advantage of transcription controlled by growth conditions, are the promoter region for alcohol dehydrogenase 2, isocytochrome C, acid phosphatase, degradative enzymes associated with nitrogen metabolism, and the aforementioned glyceraldehyde-3-phosphate dehydrogenase, and enzymes responsible for maltose and galactose utilization.
- Any plasmid vector containing a yeast-compatible promoter, origin of replication and termination sequences is suitable.
- cultures of cells derived from multicellular organisms may also be used as hosts.
- any such cell culture is workable, whether from vertebrate or invertebrate culture.
- interest has been greatest in vertebrate cells, and propagation of vertebrate in culture (tissue culture) has become a routine procedure in recent years (Tissue Culture, 1973).
- useful host cell lines are VERO and HeLa cells, Chinese hamster ovary (CHO) cell lines, and W138, BHK, COS-7 293, Spodoptera frugiperda (SF) cells (commercially available as complete expression systems from i.a. Protein Sciences, 1000 Research Parkway, Meriden, Conn. 06450, U.S.A. and from Invitrogen), the D. melanogaster cell line S 2 available from Invitrogen, PO Box 2312, 9704 CH Groningen, The Netherlands, and MDCK cell lines.
- Expression vectors for such cells ordinarily include (if necessary) an origin of replication, a promoter located in front of the gene to be expressed, along with any necessary ribosome binding sites, RNA splice sites, polyadenylation site, and transcriptional terminator sequences.
- control functions on the expression vectors are often provided by viral material.
- promoters are derived from polyoma, Adenovirus 2, and most frequently Simian Virus 40 (SV40).
- the early and late promoters of SV40 virus are particularly useful because both are obtained easily from the virus as a fragment, which also contains the SV40 viral origin of replication (Fiers et al., 1978). Smaller or larger SV40 fragments may also be used, provided there is included the approximately 250 bp sequence extending from the HindIII site toward the BglI site located in the viral origin of replication.
- promoter or control sequences normally associated with the desired gene sequence provided such control sequences are compatible with the host cell systems.
- An origin of replication may be provided either by construction of the vector to include an exogenous origin, such as may be derived from SV40 or another virus (e.g., Polyoma, Adenovirus, VSV, and BPV), or it may be provided by the host cell chromosomal replication mechanism. If the vector is integrated into the host cell chromosome, the latter is often sufficient.
- analogues as fusion proteins, either by fusing the peptide to a fusion partner that can serve as an affinity tag (for ease of purification) and/or by having multiple repeats of the peptide.
- affinity tag for ease of purification
- These methods require presence of a suitable cleavage site for a peptidase. The skilled worker will know how to tailor the underlying genetic constructs.
- the peptides of the invention can be purified by methods generally known in the art, including multi-step chromatography (e.g., ion-exchange, size-exclusion, and affinity chromatographic techniques).
- multi-step chromatography e.g., ion-exchange, size-exclusion, and affinity chromatographic techniques.
- peptides comprised of naturally occurring amino acids can be prepared in vitro in cell free systems. This is especially expedient in cases where the peptides could be toxic for putative host cells.
- the present invention also contemplates use of cell-free in vitro translation/expression in order to prepare the peptides of the invention.
- peptide fragments are prepared using at least 2 separate steps or methods, followed by joining (e.g., ligating) the fragments to obtain the final peptide product.
- the GLP-2 analogues of the invention have activity at both the GLP-1 and GLP-2 receptors.
- EC 50 values may be used as a numerical measure of agonist potency at a given receptor.
- An EC 50 value is a measure of the concentration of a compound required to achieve half of that compound's maximal activity in a particular assay.
- a compound having an EC 50 at a particular receptor which is lower than the EC 50 of a reference compound in the same assay may be considered to have higher potency at that receptor than the reference compound.
- the GLP-2 analogues of the invention typically have higher activity at the GLP-1 receptor (e.g. the human GLP-1 receptor) than wild type human GLP-2 (hGLP-2).
- the GLP-2 analogues will have a lower EC 50 than wild type human GLP-2 or [Gly2]-hGLP-2 (i.e. human GLP-2 having glycine at position 2, also known as teduglutide).
- the ratio of the GLP-2 analogue's EC 50 to the EC 50 of hGLP-2 or [Gly2]-hGLP-2 is therefore typically less than 1. It may, for example, be less than 0.5 or less than 0.1, or less than 0.01.
- the EC 50 at the GLP-1 receptor may be below 100 nM, below 50 nM, below 10 nM, or more preferably below 1.0 nM, below 0.9 nM, below 0.8 nM, below 0.7 nM, below 0.6 nM, below 0.5 nM, below 0.4 nM, below 0.3 nM, below 0.2 nM, below 0.1 nM, below 0.09 nM, below 0.08 nM, below 0.07 nM, below 0.06 nM, below 0.05 nM, below 0.04 nM, below 0.03 nM, below 0.02 nM, below 0.01 nM, below 0.009 nM, below 0.008 nM, below 0.007 nM, below 0.006 nM, or below 0.005 nM, e.g. when assessed using the GLP-1 receptor efficacy assay described in Example 1.
- the GLP-2 analogues of the invention retain GLP-2 activity, although their potency at the GLP-2 receptor need not be the same as that of hGLP-2 or [Gly2]-hGLP-2. They may have lower potency as long as adequate levels of GLP-2 activity are retained. In any given assay for GLP-2 activity, the GLP-2 analogues may have a lower or higher EC 50 than wild type human GLP-2 or [Gly2]-hGLP-2.
- the ratio of the GLP-2 analogue's EC 50 to the EC 50 of hGLP-2 or [Gly2]-hGLP-2 in the same assay may, for example, be less than 200, less than 100, less than 10, less than 5, less than 1, less than 0.1, less than 0.5 or less than 0.1.
- the analogue of the invention may also be desirable to compare the ratio of EC 50 values at the GLP-2 and GLP-1 receptors for the analogue of the invention and for hGLP-2 or [Gly2]-hGLP-2.
- the analogue of the invention has an EC 50 [GLP-2]/EC 50 [GLP-1] which is higher than the equivalent ratio for hGLP-2 or [Gly2]-hGLP-2 in the same assays.
- the ratio for the analogue of the invention may be at least 2, at least 5 or at least 10 times greater than that for hGLP-2 or [Gly2]-hGLP-2.
- the GLP-2 analogues of the present invention, or salts or derivatives thereof may be formulated as pharmaceutical compositions prepared for storage or administration, and which comprise a therapeutically effective amount of a GLP-2 peptide of the present invention, or a salt or derivative thereof, in a pharmaceutically acceptable carrier.
- the therapeutically effective amount of a compound of the present invention will depend on the route of administration, the type of mammal being treated, and the physical characteristics of the specific mammal under consideration. These factors and their relationship to determining this amount are well known to skilled practitioners in the medical arts. This amount and the method of administration can be tailored to achieve optimal efficacy so as to deliver the peptide to the large intestine, but will depend on such factors as weight, diet, concurrent medication and other factors, well known those skilled in the medical arts.
- a pharmaceutical composition wherein a GLP-2 analogue of the invention, or a salt thereof, is present in an amount effective to treat or prevent stomach and bowel-related disorders.
- salts of the compounds of the invention having an acidic moiety can be formed using organic and inorganic bases.
- Suitable salts formed with bases include metal salts, such as alkali metal or alkaline earth metal salts, for example sodium, potassium, or magnesium salts; ammonia salts and organic amine salts, such as those formed with morpholine, thiomorpholine, piperidine, pyrrolidine, a mono-, di- or tri-lower alkylamine (e.g., ethyl-tert-butyl-, diethyl-, diisopropyl-, triethyl-, tributyl- or dimethylpropylamine), or a mono-, di- or trihydroxy lower alkylamine (e.g.
- salts can be formed using organic and inorganic acids.
- salts can be formed from the following acids: acetic, propionic, lactic, citric, tartaric, succinic, fumaric, maleic, malonic, mandelic, mac, phthalic, hydrochloric, hydrobromic, phosphoric, nitric, sulfuric, methanesulfonic, napthalenesulfonic, benzenesulfonic, toluenesulfonic, and camphorsulfonic as well as other known pharmaceutically acceptable acids.
- Amino acid addition salts can also be formed with amino acids such as lysine, glycine, and phenylalanine.
- a “therapeutically effective amount” of the peptides or pharmaceutical compositions of the present invention will vary depending upon the age, weight and mammalian species treated, the particular compounds employed, the particular mode of administration and the desired effects and the therapeutic indication. Because these factors and their relationship to determining this amount are well known, the determination of therapeutically effective dosage levels, the amount necessary to achieve the desired result of preventing and/or treating the intestine and stomach related diseases described herein, as well as other medical indications disclosed herein, will be within the skill of the skilled person.
- a therapeutically effective amount is one which reduces symptoms of a given condition or pathology, and preferably which normalizes physiological responses in an individual with the condition or pathology. Reduction of symptoms or normalization of physiological responses can be determined using methods routine in the art and may vary with a given condition or pathology.
- a therapeutically effective amount of one or more GLP-2 analogues of the invention or a pharmaceutical composition comprising one or more GLP-2 analogues of the invention is an amount which restores a measurable physiological parameter to substantially the same value (preferably to within 30%, more preferably to within 20%, and still more preferably, to within 10% of the value) of the parameter in an individual without the condition or pathology.
- administration of the compounds or pharmaceutical composition of the present invention is commenced at lower dosage levels, with dosage levels being increased until the desired effect of preventing/treating the relevant medical indication, such as intestine and stomach related diseases is achieved.
- This may define a therapeutically effective amount.
- doses may be between about 0.01 mg/kg and 100 mg/kg body weight, such as between about 0.01 mg/kg and 10 mg/kg body weight, for example between 10-100 micrograms/kg body weight.
- a GLP-2 analogue of the invention may be formulated with a carrier that is pharmaceutically acceptable and is appropriate for delivering the peptide by the chosen route of administration.
- peripheral parenteral routes include intravenous, intramuscular, subcutaneous, and intra peritoneal routes of administration.
- Certain compounds used in the present invention may also be amenable to administration by the oral, rectal, nasal, or lower respiratory routes. These are so-called non-parenteral routes.
- the present pharmaceutical composition comprises a GLP-2 analogue of the invention, or a salt or derivative thereof and a pharmaceutically acceptable carrier.
- Suitable pharmaceutically acceptable carriers are those used conventionally with peptide-based drugs, such as diluents, excipients and the like.
- Suitable pH buffering agents may be phosphate, citrate, acetate, tris/hydroxymethyl)aminomethane (TRIS), N-Tris(hydroxymethyl)methyl-3-aminopropanesulphonic acid (TAPS), ammonium bicarbonate, diethanolamine, histidine, which is a preferred buffer, arginine, lysine, or acetate or mixtures thereof.
- Preferred buffer ranges in certain embodiments are pH 4-8, pH 6.5-8, and more preferably pH 7-7.5.
- Preservatives such as para, meta, and ortho-cresol, methyl- and propylparaben, phenol, benzyl alcohol, sodium benzoate, benzoic acid, benzyl-benzoate, sorbic acid, propanoic acid, esters of p-hydroxybenzoic acid may be provided in the pharmaceutical composition.
- Stabilizers preventing aggregation, fibrillation and precipitation, such as Sodium dodecyl sulphate, polyethylene glycol, carboxymethyl cellulose, cyclodextrine may also be provided in the pharmaceutical composition.
- Organic modifiers for solubilization or preventing aggregation such as ethanol, acetic acid or acetate and salts thereof may be provided in the pharmaceutical composition.
- Isotonicity makers such as salts e.g. sodium chloride or most preferred carbohydrates e.g. dextrose, mannitol, lactose, trehalose, sucrose or mixtures thereof may be provided in the pharmaceutical composition.
- Detergents such as Tween 20, Tween 80, SDS, Poloxamers e.g. Pluronic F-68, Pluronic F-127, may be provided in a pharmaceutical composition of the invention.
- Dyes and flavoring agents also may be provided in the pharmaceutical composition.
- a pharmaceutically acceptable acid addition salt of a GLP-2 analogue of the invention is provided for.
- Suspending agents also may be used.
- Organic modifiers such as ethanol, tertiary-buthanol, 2-propanol, ethanol, glycerol, and polyethylene glycol may be provided in a pharmaceutical formulation for lyophilization of a lyophilized product.
- Bulking agents and isotonicity makers such as salt e.g. sodium chloride, carbohydrates e.g. dextrose, mannitol, lactose, trehalose, sucrose or mixtures thereof, amino acids (e.g., glycine and glutamate), or excipients such as cysteine, lecithin or human serum albumin, or mixtures thereof, may be provided in the pharmaceutical composition for lyophilization.
- compositions of the present invention may be formulated and used as tablets, capsules or elixirs for oral administration; suppositories for rectal administration; preferably sterile solutions or sterile powder or suspensions for injectable administration; and the like.
- the dose and method of administration may be tailored to achieve optimal efficacy, but will depend on factors such as weight, diet, concurrent medication, which are recognizable to the skilled worker.
- injectable pharmaceutical compositions can be prepared in conventional forms, either as aqueous solutions or suspensions; lyophilized, solid forms suitable for reconstitution immediately before use or suspension in liquid prior to injection, or as emulsions.
- Diluents for reconstitution of the lyophilized product may be, for example, chosen from the buffers listed above, or selected from water, saline, dextrose, mannitol, lactose, trehalose, sucrose, lecithin, albumin, sodium glutamate, cysteine hydrochloride, or water for injection with the addition of detergents such as Tween 20, Tween 80, poloxamers (e.g., pluronic F-68 or pluronic F-127), polyethylene glycol, and/or with the addition of preservatives such as para-, meta-, and ortho-cresol, methyl- and propylparaben, phenol, benzyl alcohol, sodium benzoate, benzoic acid, benzyl-benzoate, sorbic acid, propanoic acid, esters of p-hydroxybenzoic acid, and/or with addition of an organic modifier such as ethanol, acitic acid, citric acid, lactic acid or salts thereof.
- the injectable pharmaceutical compositions may contain minor amounts of non-toxic auxiliary substances, such as wetting agents, or pH buffering agents.
- Absorption enhancing preparations e.g., liposomes, detergents and organic acids also may be utilized.
- the compounds are formulated for administration by infusion, e.g., when used as liquid nutritional supplements for patients on total parenteral nutrition therapy (for example neonatals, or patients suffering from cachexia or anorexia), or by injection, for example subcutaneously, intraperitoneal or intravenously, and are accordingly utilized as aqueous solutions in sterile and pyrogen-free form and optionally buffered to physiologically tolerable pH, e.g., a slightly acidic or physiological pH.
- Formulation for intramuscular administration may be based on solutions or suspensions in plant oil, e.g. canola oil, corn oil or soy bean oil. These oil based formulations may be stabilized by antioxidants, e.g. BHA (butylated hydroxianisole) and BHT (butylated hydroxytoluene).
- the GLP-2 analogues of the invention may be administered in a vehicle, such as distilled water or in saline, phosphate buffered saline, 5% dextrose solutions or oils.
- a vehicle such as distilled water or in saline, phosphate buffered saline, 5% dextrose solutions or oils.
- the solubility of a GLP-2 analogue of the invention may be enhanced, if desired, by incorporating a solubility enhancer, such as a detergents and/or emulsifier.
- aqueous carrier or vehicle can be supplemented for injectable use with an amount of gelatin that serves to depot the GLP-2 analogue at or near the site of injection, to provide a slow release to the desired site of action.
- Gelling agents such as hyaluronic acid, may also be useful as depot agents.
- the peptide compounds of the present invention may be used alone or in combination with compounds having an anti-inflammatory effect. Without being bound by theory, such a combination treatment may reinforce the beneficial treatment effects of the peptide analogues of the invention.
- the therapeutic dosing and regimen most appropriate for patient treatment will, of course, vary with the disease or condition to be treated, and according to the patient's weight and other parameters. Without wishing to be bound by any particular theory, it is expected that doses, in the microgram/kg or mg/kg range, and shorter or longer duration or frequency of treatment may produce therapeutically useful results, such as a statistically significant increase, particularly in small bowel mass.
- the therapeutic regimen may include the administration of maintenance doses appropriate for preventing tissue regression that occurs following cessation of initial treatment.
- the dosage sizes and dosing regimen most appropriate for human use may be guided by the results obtained by the present invention, and may be confirmed in properly designed clinical trials.
- An effective dosage and treatment protocol may be determined by conventional means, starting with a low dose in laboratory animals and then increasing the dosage while monitoring the effects, and systematically varying the dosage regimen as well. Numerous factors may be taken into consideration by a clinician when determining an optimal dosage for a given subject. Such considerations are known to the skilled person.
- a human dose of a GLP-2 peptide according to the invention may in one embodiment be from about 10 microgram/kg body weight/day to about 10 mg/kg/day, preferably from about 50 microgram/kg/day to about 5 mg/kg/day, and most preferably about 100 microgram/kg/day to 1 mg/kg/day.
- the GLP-2 analogues of the present invention are useful as a pharmaceutical agent for preventing or treating an individual suffering from low grade inflammation, e.g., local or systemic low grade inflammation.
- Low grade inflammation may include, but is not limited to: metabolic syndrome, obesity (e.g. abdominal obesity), diabetes, cardiovascular diseases, gastrointestinal inflammation, depression, alzheimer, arthritis, hypertension, dyslipidaemia and stroke.
- Gastrointestinal disorders include the disorders of the upper gastrointestinal tract of the oesophagus, may be treated by administering an effective amount of a GLP-2 analogue of the invention, or a salt thereof as described herein.
- Stomach and intestinal-related disorders include ulcers of any aetiology (e.g., peptic ulcers, Zollinger-Ellison Syndrome, drug-induced ulcers, ulcers related to infections or other pathogens), digestion disorders, malabsorption syndromes, short-bowel syndrome, cul-de-sac syndrome, inflammatory bowel disease (Crohns disease and ulcerative colitis), celiac sprue (for example arising from gluten induced enteropathy or celiac disease), tropical sprue, hypogammaglobulinemic sprue, and chemotherapy and/or radiationhemotherapy induced mucositis and diarrhea.
- aetiology e.g., peptic ulcers, Zollinger-Ellison Syndrome, drug-induced ulcers, ulcers related to infections or other pathogens
- digestion disorders malabsorption syndromes
- short-bowel syndrome e.g., cul-de-sac syndrome
- inflammatory bowel disease Crohns disease and ulcerative colitis
- a compound for patients having gastrointestinal mucosal neoplasia, or an increased risk of gastrointestinal mucosal neoplasia, it may be desirable to select a compound so as to reduce or abrogate the risk of reduced side effects such as stimulation or aggravation of gastrointestinal mucosal neoplasia.
- Particular conditions that may be treated with a GLP-2 analogue of the invention include the various forms of sprue including celiac sprue which results from a toxic reaction to alpha-gliadin from heat and may be a result of gluten-induced enteropathy or celiac disease, and is marked by a significant loss of villae of the small bowel; tropical sprue which results from infection and is marked by partial flattening of the villae; hypogammaglobulinemic sprue which is observed commonly in patients with common variable immunodeficiency or hypogammaglobulinemia and is marked by significant decrease in villus height.
- the therapeutic efficacy of the GLP-2 analogue treatment may be monitored by enteric biopsy to examine the villus morphology, by biochemical assessment of nutrient absorption, by non invasive determination of intestinal permeability, by patient weight gain, or by amelioration of the symptoms associated with these conditions.
- the GLP-2 analogues of the present invention may be useful as pharmaceutical agents for preventing or treating stomach related disorders including ulcers of any aetiology (e.g., peptic ulcers, Zollinger-Ellison Syndrome, drug-induced ulcers, ulcers related to infections or other pathogens).
- stomach related disorders including ulcers of any aetiology (e.g., peptic ulcers, Zollinger-Ellison Syndrome, drug-induced ulcers, ulcers related to infections or other pathogens).
- GLP-2 analogues of the invention include in addition to the above mentioned radiation enteritis, infectious or post-infectious enteritis, and small intestinal damage due to cancer-chemotherapeutic or toxic agents.
- the GLP-2 analogues may also be used for the treatment of malnutrition, for example cachexia and anorexia.
- a particular embodiment of the invention is concerned with using the present peptides for the prevention and/or treatment of intestinal damage and dysfunction.
- the stem cells of the small intestinal mucosa are particularly susceptible to the cytotoxic effects of chemotherapy due to their rapid rate of proliferation (Keefe et al., Gut 2000; 47: 632-7).
- Administration of the present GLP-2 peptide agonists may enhance trophic effect in the intestinal crypts and rapidly provide new cells to replace the damaged intestinal epithelium following chemotherapy and/or radiation therapy.
- a goal to be achieved by administering the GLP-2 analogues of the invention is to reduce morbidity related to gastrointestinal damage of patients undergoing chemotherapy treatment while increasing tolerance to more aggressive chemotherapy, radiation and combination chemotherapy and radiation therapies.
- Concomitant prophylactic or therapeutic treatment may be provided in accordance with the present invention to patients undergoing or about to undergo radiation therapy.
- Gastrointestinal mucositis after anti-cancer chemotherapy is an increasing problem that is essentially untreatable once established, although it gradually remits.
- Studies conducted with the commonly used cytostatic cancer drugs 5-FU and irinotecan have demonstrated that effective chemotherapy with these drugs predominantly affects structural integrity and function of the small intestine, while the colon is less sensitive and mainly responds with increased mucus formation (Gibson et al., J Gastroenterol Hepatol. 18(9):1095-1100, 2003; Tamaki et al., J Int Med Res. 31(1):6-16, 2003).
- the invention describes a method of treating DPP-IV (dipeptidylpeptidase-IV) mediated conditions by administering to a patient in need thereof an effective amount of a GLP-2 analogue, or a salt thereof.
- DPP-IV dipeptidylpeptidase-IV
- Such diseases include conditions in which the DPP-IV enzyme is over expressed.
- the pharmaceutical composition may in one embodiment be formulated to cause slow release of said GLP-2 analogue, or a salt or derivative thereof as described above.
- the present peptides may be employed in a method of treating neo-natals by administering an effective amount of a GLP-2 analogue, or a salt thereof, of the invention. Complications with feeding neonatals due to the lack of development of the intestine may be overcome by using the peptide agonists of the invention.
- the invention describes a method of treating DPP-IV (dipeptidylpeptidase-IV) mediated conditions by administering to a patient in need thereof an effective amount of a GLP-2 analogue, or a salt thereof, of the invention.
- diseases include conditions in which the DPP-IV enzyme is over expressed.
- Peptides were synthesized batchwise in a polyethylene vessel equipped with a polypropylene filter for filtration using 9-fluorenylmethyloxycarbonyl (Fmoc) as N- ⁇ -amino protecting group and suitable common protection groups for side-chain functionalities.
- Fmoc 9-fluorenylmethyloxycarbonyl
- an Fmoc-amino acid in DMF/DCM (2:1; 0.2 M; 5 ml) was added to the resin in a CEM Discover microwave unit together with COMU/DMF (0.5 M; 2 ml) and DIPEA/DMF (2.0 M; 1 ml).
- the coupling mixture was heated to 75° C. for 5 min while nitrogen was bubbled through the mixture.
- the resin was then washed with NMP (4 ⁇ 10 ml).
- Piperidine/NMP (20%; 10 ml) was added to the resin for initial deprotection and the mixture was heated by microwaves (30 sec; 40° C.). The reaction vessel was drained and a second portion of piperidine/NMP (20%; 10 ml) was added and heated (75° C.; 3 min.) again. The resin was then washed with NMP (6 ⁇ 10 ml).
- piperidine/DMF (20%; 10 ml) was added to the resin for initial deprotection and the mixture was heated by microwaves (30 sec; 40° C.). The reaction vessel was drained and a second portion of piperidine/DMF (20%; 10 ml) was added and heated (75° C.; 3 min.) again. The resin was then washed with DMF (6 ⁇ 10 ml).
- Fmoc-Lys(ivDde)-OH or alternatively another amino acid with an orthogonal side chain protective group is introduced at the position of the acylation.
- the N-terminal of the peptide backbone is then Boc-protected using Boc2O or alternatively by using a Boc-protected amino acid in the last coupling.
- the orthogonal side chain protective group is selectively cleaved using freshly prepared hydrazine hydrate (2-4%) in NMP for 2 ⁇ 15 min.
- the unprotected lysine side chain is first coupled with Fmoc-Glu-OtBu or another spacer amino acid, which is deprotected with piperidine and acylated with a lipophilic moiety using the peptide coupling methodology as described above.
- Abbreviations employed are as follows:
- the resin was washed with EtOH (3 ⁇ 10 ml) and Et2O (3 ⁇ 10 ml) and dried to constant weight at room temperature (r.t.).
- the crude peptide was cleaved from the resin by treatment with TFA/TIS/water (95/2.5/2.5; 40 ml, 2 h; r.t.) or TFA/DODT (95/5; 40 ml, 2 h; r.t.). Most of the TFA was removed at reduced pressure and the crude peptide was precipitated and washed three times with diethylether and dried to constant weight at room temperature.
- the crude peptide was purified to approximately or greater than 90% by preparative reverse phase HPLC using a PerSeptive Biosystems VISION Workstation equipped with a C-18 column (5 cm; 10 ⁇ m) and a fraction collector and run at 35 ml/min with a gradient of buffer A (0.1% TFA, aq.) and buffer B (0.1% TFA, 90% MeCN, eq.). Fractions were analyzed by analytical HPLC and MS and relevant fractions were pooled and lyophilized. The final product was characterized by HPLC and S.
- Fmoc-protected amino acids were purchased from Advanced ChemTech (ACT) in suitable side-chain protected forms.
- Coupling reagent diisopropylcarbodiimide was purchased from Riedel de-Häen, Germany.
- TentaGel S resins 0.22-0.31 mmol/g.
- TentaGel S-Ram, TentaGel S RAM-Lys(Boc)Fmoc (Rapp polymere, Germany) were used in cases where a C-terminal amidated peptide was preferred, while TentaGel S PHB, for example TentaGel S PHB Asp(Boc)Fmoc were used when a C-terminal free carboxylic acid was preferred.
- DIEA Diisopropylethylamine
- piperidine and pyridine from Riedel-de Häen, Frankfurt, Germany.
- Ethandithiol was purchased from Riedel-de Häen, Frankfurt, Germany.
- 3,4-dihydro-3-hydroxy-4-oxo-1,2,3-benzotriazine (Dhbt-OH), 1-hydroxybenzotriazole (HOBt) (HOAt) were obtained from Fluke, Switzerland.
- the amino acids were coupled as in situ generated HObt or HOAt esters made from appropriate N- ⁇ -protected amino acids and HObt or HOAt by means of DIC in DMF. Acylations were checked by the ninhydrin test performed at 80° C. in order to prevent Fmoc deprotection during the test (Larsen, B. D. and Holm, A., Int. J. Peptide Protein Res. 43, 1994, 1-9).
- the crude peptide products were purified PerSeptive Biosystems VISION Workstation. VISION 3.0 software was used for instrument control and data acquisition. The following column and HPLC buffer system was used:
- the peptides were dissolved in super gradient methanol (Labscan, Dublin, Ireland), milli-Q water (Millipore, Bedford, Mass.) and formic acid (Merck, Damstadt, Germany) (50:50:0.1 v/v/v) to give concentrations between 1 and 10 mg/ml.
- the peptide solutions (20 ml) were analysed in positive polarity mode by ESI-TOF-MS using a LCT mass spectrometer (Micromass, Manchester, UK) accuracy of ⁇ 0.1 m/z.
- Piperidine/DMF (20%; 10 ml) was added to the resin for initial deprotection and the mixture was heated by microwaves (30 sec; 40° C.). The reaction vessel was drained and a second portion of piperidine/DMF (20%; 10 ml) was added and heated (75° C.; 3 min.) again. The resin was then washed with DMF (6 ⁇ 10 ml).
- the resin was washed with EtOH (3 ⁇ 10 ml) and Et2O (3 ⁇ 10 ml) and dried to constant weight at room temperature (r.t.).
- the crude peptide was cleaved from the resin by treatment with TFA/DODT (95/5; 60 ml, 2 h; r.t.). Most of the TFA was removed at reduced pressure and the crude peptide was precipitated and washed three times with diethylether and dried to constant weight at room temperature.
- a cAMP AlphaScreen® assay from Perkin Elmer was used to quantitate a cAMP response to a GLP-2 analogue.
- Teduglutide was the reference compound in this assay and has an EC 50 of approximately 0.01 nM.
- Test compounds inducing an increase in the intracellular level of cAMP were tested in this assay, and the response normalized relative to a positive and negative control to calculate the EC 50 and maximal response from the concentration response curve. The results are listed in Table 2.
- the cDNA encoding the human glucagon-like peptide 1 receptor (GLP-1R) was cloned from the cDNA BC112126 (MGC:138331/IMAGE:8327594).
- the DNA encoding the GLP-1-R was amplified by PCR using primers encoding terminal restriction sites for subcloning.
- the 5′-end primers additionally encoded a near Kozak consensus sequence to ensure efficient translation.
- the fidelity of the DNA encoding the GLP-1-R was confirmed by DNA sequencing.
- the PCR products encoding the GLP-1-R were subcloned into a mammalian expression vector containing a neomycin (G418) resistance marker.
- the mammalian expression vectors encoding the GLP-1-R were transfected into HEK293 cells by a standard calcium phosphate transfection method. 48 hours after transfection, cells were seeded for limited dilution cloning and selected with 1 mg/ml G418 in the culture medium. Three weeks later, 12 surviving colonies of GLP-1-R expressing cells were picked, propagated and tested in the GLP-1 receptor efficacy assays as described below. One GLP-1-R expressing clone was selected for compound profiling.
- the hGLP2-R was purchased from MRC-geneservice, Babraham, Cambridge as an Image done: 5363415 (11924-I17).
- primers for subcloning were obtained from DNA-Technology, Risskov, Denmark.
- the 5′ and 3′ primers used for the PCR reaction include terminal restriction sites for cloning and the context of the 5′ primer is modified to a Kozak consensus without changing the sequence of the product encoded by the ORF.
- a standard PCR reaction was run using Image done 5363415 (11924-I17) as a template with the above mentioned primers and Polymerase Herculase II Fusion in a total vol. of 50 ⁇ l.
- the generated PCR product was purified using GFX PCR and Gel band purification kit, digested with restriction enzymes and cloned into the mammalian expression vector using Rapid DNA Ligation Kit. Ligation reaction was transformed to XL10 Gold Ultracompetent cells and colonies were picked for DNA production using Endofree Plasmid maxi kit. Subsequent sequence analysis was conducted by MWG Eurofins, Germany. The clone was confirmed to be the hGLP-2 receptor, splice variant rs17681684.
- HEK293 cells were transfected using the Lipofectamine PLUS transfection method. The day before transfection, HEK293 cells were seeded in two T75 flasks at a density of 2 ⁇ 10 6 cells/T75 flask in cell culturing medium without antibiotics. On the day of transfection, cells were washed with 1 ⁇ DPBS and medium was replaced with Optimem to a volume of 5 mL/T75 flask before addition of Lipofectamine-plasmid complexes were added gently and drop wise to the cells in T75 flasks and replaced with growth medium after 3 hours and again to growth medium supplemented with 500 ⁇ g/mL G418 after 24 hours. After 4 weeks in G418 selection, colonies were picked and tested in a functional assay. One colony was selected for use in compound profiling.
- the cAMP AlphaScreen® assay from Perkin Elmer was used to quantitate the cAMP response to activation of the GLP1 and GLP2 receptor, respectively.
- Exendin-4 (ZP24) was used as reference compound for GLP1 receptor activation and Teduglutide (ZP1559) as reference compound for GLP2 receptor activation.
- Data from test compounds eliciting an increase in the intracellular level of cAMP were normalized relative to the positive and negative control (vehicle) to calculate the EC 50 and maximal response from the concentration response curve. The results are listed in Table 2.
- mice Normal chow-fed C57BL/6J male mice were used. The mice were kept in standard housing conditions (light-, temperature-, and humidity-controlled room (12:12 h light-dark cycle, with lights on at 06.00-18.00 h; 24° C.; 50% relative humidity)), and each dosing group consisted of 10 animals.
- OGTT oral glucose tolerance test
- Vehicle treated mice displayed a typical response to glucose challenge, with an increase in blood glucose levels in the first 30 minutes, followed by return to baseline levels after 120 minutes.
- Test compound significantly reduced the blood glucose response ( FIG. 2 ).
- Test compound increased intestinal weight in a dose dependant manner ( FIG. 3 ).
- Diet-induced obesity was generated by feeding C57BL/6J male mice with high fat diet (Research Diet 60% fat (D12492) Research Diet Inc., New Brunswick, USA). The mice were kept in standard housing conditions (light-, temperature-, and humidity-controlled room (12:12 h light-dark cycle, with lights on at 06.00-18.00 h; 24° C.; 50% relative humidity)).
- the vehicle treated dosing group contained 8 animals and the compound 7 treated groups consisted of 12 animals/group. All animals were mock treated for 7 days (once daily, SC, 100 ⁇ l vehicle) to acclimatize the animals to handling and injections, followed by treatment (vehicle or compound 7) for 14 days (twice daily, SC, 5 ml/kg). Animals were fasted overnight (day 11-12) and blood was drawn for analysis of glucose and insulin. On day 14, animals were sacrificed and small and large intestines removed, washed and weighed.
- Compound 7 dosed twice daily for 14 days, significantly increased the small and large intestinal mass when compared to vehicle treated controls ( FIG. 4 ).
- Compound 7 dosed twice daily for 14 days, reduced fasting blood glucose and plasma insulin levels, and gave a lower HOMA-IR index than vehicle treated controls ( FIG. 5 ).
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Pharmacology & Pharmacy (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Organic Chemistry (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Epidemiology (AREA)
- Zoology (AREA)
- Immunology (AREA)
- Biomedical Technology (AREA)
- Endocrinology (AREA)
- Diabetes (AREA)
- Cell Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Gastroenterology & Hepatology (AREA)
- Developmental Biology & Embryology (AREA)
- Insects & Arthropods (AREA)
- Hematology (AREA)
- Obesity (AREA)
- Biotechnology (AREA)
- Virology (AREA)
- Reproductive Health (AREA)
- Biophysics (AREA)
- Toxicology (AREA)
- Molecular Biology (AREA)
- Genetics & Genomics (AREA)
- Biochemistry (AREA)
- Neurosurgery (AREA)
- Neurology (AREA)
- Cardiology (AREA)
- Heart & Thoracic Surgery (AREA)
Priority Applications (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US14/398,297 US9453064B2 (en) | 2012-05-03 | 2013-05-03 | Glucagon-like-peptide-2 (GLP-2) analogues |
| US15/238,126 US9969787B2 (en) | 2012-05-03 | 2016-08-16 | Glucagon-like-peptide-2 (GLP-2) analogues |
Applications Claiming Priority (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201261642447P | 2012-05-03 | 2012-05-03 | |
| US201361785852P | 2013-03-14 | 2013-03-14 | |
| US14/398,297 US9453064B2 (en) | 2012-05-03 | 2013-05-03 | Glucagon-like-peptide-2 (GLP-2) analogues |
| PCT/EP2013/059320 WO2013164484A1 (en) | 2012-05-03 | 2013-05-03 | Glucagon-like-peptide-2 (glp-2) analogues |
Related Parent Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/EP2013/059320 A-371-Of-International WO2013164484A1 (en) | 2012-05-03 | 2013-05-03 | Glucagon-like-peptide-2 (glp-2) analogues |
Related Child Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US15/238,126 Continuation US9969787B2 (en) | 2012-05-03 | 2016-08-16 | Glucagon-like-peptide-2 (GLP-2) analogues |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| US20150125431A1 US20150125431A1 (en) | 2015-05-07 |
| US9453064B2 true US9453064B2 (en) | 2016-09-27 |
Family
ID=48428462
Family Applications (3)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US14/398,297 Active US9453064B2 (en) | 2012-05-03 | 2013-05-03 | Glucagon-like-peptide-2 (GLP-2) analogues |
| US15/238,126 Expired - Fee Related US9969787B2 (en) | 2012-05-03 | 2016-08-16 | Glucagon-like-peptide-2 (GLP-2) analogues |
| US15/950,235 Expired - Fee Related US10253080B2 (en) | 2012-05-03 | 2018-04-11 | Glucagon-like-peptide-2 (GLP-2) analogues |
Family Applications After (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US15/238,126 Expired - Fee Related US9969787B2 (en) | 2012-05-03 | 2016-08-16 | Glucagon-like-peptide-2 (GLP-2) analogues |
| US15/950,235 Expired - Fee Related US10253080B2 (en) | 2012-05-03 | 2018-04-11 | Glucagon-like-peptide-2 (GLP-2) analogues |
Country Status (13)
| Country | Link |
|---|---|
| US (3) | US9453064B2 (enExample) |
| EP (1) | EP2844670B1 (enExample) |
| JP (1) | JP6298044B2 (enExample) |
| KR (1) | KR20150006052A (enExample) |
| CN (1) | CN104540850B (enExample) |
| AU (1) | AU2013255752B2 (enExample) |
| BR (1) | BR112014027345A2 (enExample) |
| CA (1) | CA2872315A1 (enExample) |
| EA (1) | EA028929B1 (enExample) |
| IN (1) | IN2014DN09782A (enExample) |
| MX (1) | MX356958B (enExample) |
| TR (1) | TR201802689T4 (enExample) |
| WO (1) | WO2013164484A1 (enExample) |
Cited By (12)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US9969787B2 (en) | 2012-05-03 | 2018-05-15 | Zealand Pharma A/S | Glucagon-like-peptide-2 (GLP-2) analogues |
| US10092648B2 (en) | 2006-11-08 | 2018-10-09 | Zealand Pharma A/S | Selective glucagon-like-peptide-2 (GLP-2) analogues |
| US10336802B2 (en) | 2015-04-16 | 2019-07-02 | Zealand Pharma A/S | Acylated glucagon analogue |
| US10457714B2 (en) | 2013-10-17 | 2019-10-29 | Zealand Pharma A/S | Acylated glucagon analogues |
| WO2020165900A1 (en) | 2019-02-11 | 2020-08-20 | Opko Biologics Ltd. | Long-acting glp-2 analogs |
| US10905745B2 (en) | 2016-12-09 | 2021-02-02 | Zealand Pharma A/S | Acylated GLP-1/GLP-2 dual agonists |
| US11001619B2 (en) | 2014-10-29 | 2021-05-11 | Zealand Pharma A/S | GIP agonist compounds and methods |
| US11008375B2 (en) | 2013-11-06 | 2021-05-18 | Zealand Pharma A/S | GIP-GLP-1 dual agonist compounds and methods |
| US11034747B2 (en) | 2013-10-17 | 2021-06-15 | Zealand Pharma A/S | Glucagon analogues and methods of use |
| US11111285B2 (en) | 2013-11-06 | 2021-09-07 | Zealand Pharma A/S | Glucagon-GLP-1-GIP triple agonist compounds |
| US11795204B2 (en) | 2012-07-23 | 2023-10-24 | Zealand Pharma A/S | Glucagon analogues |
| US12297251B1 (en) | 2017-06-16 | 2025-05-13 | Zealand Pharma A/S | Injection pen for subcutaneous administration of a peptide |
Families Citing this family (34)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| UA116217C2 (uk) | 2012-10-09 | 2018-02-26 | Санофі | Пептидна сполука як подвійний агоніст рецепторів glp1-1 та глюкагону |
| RU2652783C2 (ru) | 2012-12-21 | 2018-05-03 | Санофи | Двойные агонисты glp1/gip или тройные агонисты glp1/gip/глюкагона |
| EP3080150B1 (en) | 2013-12-13 | 2018-08-01 | Sanofi | Exendin-4 peptide analogues as dual glp-1/gip receptor agonists |
| WO2015086730A1 (en) | 2013-12-13 | 2015-06-18 | Sanofi | Non-acylated exendin-4 peptide analogues |
| EP3080149A1 (en) | 2013-12-13 | 2016-10-19 | Sanofi | Dual glp-1/glucagon receptor agonists |
| EP3080154B1 (en) | 2013-12-13 | 2018-02-07 | Sanofi | Dual glp-1/gip receptor agonists |
| EP3080155A1 (en) * | 2013-12-13 | 2016-10-19 | Sanofi | Exendin-4 peptide analogues as dual glp-1/glucagon receptor agonists |
| TW201625669A (zh) | 2014-04-07 | 2016-07-16 | 賽諾菲公司 | 衍生自艾塞那肽-4(Exendin-4)之肽類雙重GLP-1/升糖素受體促效劑 |
| TW201625670A (zh) | 2014-04-07 | 2016-07-16 | 賽諾菲公司 | 衍生自exendin-4之雙重glp-1/升糖素受體促效劑 |
| TW201625668A (zh) | 2014-04-07 | 2016-07-16 | 賽諾菲公司 | 作為胜肽性雙重glp-1/昇糖素受體激動劑之艾塞那肽-4衍生物 |
| US9932381B2 (en) | 2014-06-18 | 2018-04-03 | Sanofi | Exendin-4 derivatives as selective glucagon receptor agonists |
| US20180280480A1 (en) * | 2014-10-31 | 2018-10-04 | Gubra Aps | Compositions and peptides having dual glp-1r and glp-2r agonist activity |
| AR105319A1 (es) | 2015-06-05 | 2017-09-27 | Sanofi Sa | Profármacos que comprenden un conjugado agonista dual de glp-1 / glucagón conector ácido hialurónico |
| AR105284A1 (es) | 2015-07-10 | 2017-09-20 | Sanofi Sa | Derivados de exendina-4 como agonistas peptídicos duales específicos de los receptores de glp-1 / glucagón |
| LT3393496T (lt) | 2015-12-23 | 2023-12-11 | The Johns Hopkins University | Ilgo veikimo glp-1r agonistas, kaip neurologinių ir neurodegeneracinių būklių terapija |
| JP6700150B2 (ja) * | 2016-10-03 | 2020-05-27 | 東京エレクトロン株式会社 | パーティクル捕集装置、パーティクル捕集方法、およびパーティクル捕集システム |
| WO2018104558A1 (en) | 2016-12-09 | 2018-06-14 | Zealand Pharma A/S | Acylated glp-1/glp-2 dual agonists |
| RU2756011C2 (ru) * | 2016-12-09 | 2021-09-24 | Зилэнд Фарма А/С | Glp-1/glp-2 двойные агонисты |
| WO2018103868A1 (en) | 2016-12-09 | 2018-06-14 | Zealand Pharma A/S | Acylated glp-1/glp-2 dual agonists |
| WO2018104559A1 (en) | 2016-12-09 | 2018-06-14 | Zealand Pharma A/S | Glp-1/glp-2 dual agonists |
| GB201710822D0 (en) * | 2017-07-05 | 2017-08-16 | Zealand Pharma As | Methods and medical uses relating to the treatment of hypoglycaemia |
| WO2019090209A1 (en) | 2017-11-06 | 2019-05-09 | Shire-Nps Pharmaceuticals, Inc. | Glp-2 analogs and peptibodies for administration before during, or after surgery |
| WO2020020904A1 (en) | 2018-07-23 | 2020-01-30 | Zealand Pharma A/S | Therapeutic uses of glp-2 agonists |
| AU2020293576B2 (en) | 2019-06-14 | 2025-04-10 | Zealand Pharma A/S | Pharmaceutical parenteral composition of dual GLP1/2 agonist |
| CA3156985A1 (en) | 2019-10-07 | 2021-04-15 | Kallyope, Inc. | Gpr119 agonists |
| CN111329995B (zh) * | 2020-02-18 | 2022-11-11 | 河南中医药大学 | Glp-2类似物在制备防治pd药物中的应用及防治pd的药物 |
| JP7745559B2 (ja) | 2020-02-28 | 2025-09-29 | キャリーオペ,インク. | Gpr40アゴニスト |
| JP2023520498A (ja) * | 2020-04-03 | 2023-05-17 | ハンミ ファーマシューティカル カンパニー リミテッド | Glp-2誘導体またはその持続型結合体を含む放射線療法、化学療法、またはこれらの組合わせにより誘発された粘膜炎の予防または治療用薬学的組成物 |
| CA3178994A1 (en) | 2020-05-19 | 2021-11-25 | Iyassu Sebhat | Ampk activators |
| CN116157413A (zh) | 2020-06-09 | 2023-05-23 | 维克蒂生物股份有限公司 | 阿普拉鲁肽的制造、配制和给药 |
| CN116390925A (zh) | 2020-06-26 | 2023-07-04 | 卡尔优普公司 | Ampk活化剂 |
| AU2023346836A1 (en) | 2022-09-19 | 2025-03-20 | Zealand Pharma A/S | Combination therapy |
| CN116478269A (zh) * | 2023-04-28 | 2023-07-25 | 成都奥达生物科技有限公司 | 一种长效替度鲁肽化合物 |
| CN118146350B (zh) * | 2024-03-13 | 2024-10-22 | 北京泽勤生物医药有限公司 | Glp-2肽类似物的制备方法及应用 |
Citations (34)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5432156A (en) | 1993-02-24 | 1995-07-11 | Nisshin Flour Milling Co., Ltd. | Therapeutic agent for digestive tract diseases |
| WO1996032414A1 (en) | 1995-04-14 | 1996-10-17 | 1149336 Ontario Inc. | Glucagon-like peptide-2 and its therapeutic use |
| WO1997031943A1 (en) | 1996-03-01 | 1997-09-04 | Novo Nordisk A/S | Use of a pharmaceutical composition comprising an appetite-suppressing peptide |
| WO1997039031A1 (en) | 1996-04-12 | 1997-10-23 | 1149336 Ontario Inc. | Glucagon-like peptide-2 analogs |
| WO1998003547A1 (en) | 1996-07-19 | 1998-01-29 | 1149336 Ontario Inc. | Antagonists of intestinotrophic glp-2 peptides |
| WO1998011125A1 (en) | 1996-09-09 | 1998-03-19 | Zealand Pharmaceuticals A/S | Improved solid-phase peptide synthesis and agent for use in such synthesis |
| US5789379A (en) | 1995-04-14 | 1998-08-04 | Allelix Biopharmaceutical Inc. | Glucagon-like peptide-2 analogs |
| US5834428A (en) | 1995-04-14 | 1998-11-10 | 1149336 Ontario Inc. | Glucagon-like peptide-2 and its therapeutic use |
| WO1998052600A1 (en) | 1997-05-16 | 1998-11-26 | 1149336 Ontario Inc. | Methods of enhancing functioning of the upper gastrointestinal tract |
| US5912229A (en) | 1996-03-01 | 1999-06-15 | Novo Nordisk Als | Use of a pharmaceutical composition comprising an appetite-suppressing peptide |
| US5952301A (en) | 1996-12-10 | 1999-09-14 | 1149336 Ontario Inc. | Compositions and methods for enhancing intestinal function |
| WO1999046283A1 (en) | 1998-03-09 | 1999-09-16 | Zealand Pharmaceuticals A/S | Pharmacologically active peptide conjugates having a reduced tendency towards enzymatic hydrolysis |
| US6051557A (en) | 1997-05-16 | 2000-04-18 | 1149336 Ontario Inc. | Methods of enhancing functioning of the upper gastrointestinal tract |
| WO2001004156A1 (en) | 1999-07-12 | 2001-01-18 | Zealand Pharmaceuticals A/S | Peptides that lower blood glucose levels |
| US6184208B1 (en) | 1994-06-29 | 2001-02-06 | Immunotech Developments Inc. | Peptide, a method for its preparation and a pharmaceutical composition containing the peptide |
| US6184201B1 (en) | 1995-04-14 | 2001-02-06 | Nps Allelix Corp. | Intestinotrophic glucagon-like peptide-2 analogs |
| WO2001041779A2 (en) | 1999-12-08 | 2001-06-14 | 1149336 Ontario Inc. | Combined use of glp-2 receptor agonist and chemotherapeutic agent in treatment |
| US6297214B1 (en) | 1997-05-02 | 2001-10-02 | 1149336 Ontario, Inc. | Methods of enhancing functioning of the large intestine |
| US20020025933A1 (en) | 1996-08-30 | 2002-02-28 | Knudsen Liselotte Bjerre | GLP-2 derivatives |
| WO2002066511A2 (en) | 2001-02-16 | 2002-08-29 | Conjuchem Inc. | Long lasting glucagon-like peptide 2 (glp-2) for the treatment of gastrointestinal diseases and disorders |
| WO2002098348A2 (en) | 2001-06-01 | 2002-12-12 | Eli Lilly And Company | Glp-1 formulations with protracted time action |
| US20040052862A1 (en) | 2000-09-18 | 2004-03-18 | Henriksen Dennis B. | Use of GLP for the treatment, prevention, diagnosis, and prognosis of bone-related and nutrition-related disorders |
| US20040122210A1 (en) | 2002-10-14 | 2004-06-24 | Lars Thim | GLP-2 compounds, formulations, and uses thereof |
| US6770620B2 (en) | 2000-09-18 | 2004-08-03 | Sanos Bioscience A/S | Use of GLP for the treatment, prevention, diagnosis, and prognosis of bone-related and nutrition-related disorders |
| US20040198642A1 (en) | 2001-02-01 | 2004-10-07 | 1149336 Ontario Inc. | Enhancement of GLP-2 activity |
| WO2005027978A2 (en) | 2003-09-19 | 2005-03-31 | Novo Nordisk A/S | Albumin-binding derivatives of therapeutic peptides |
| US20050282749A1 (en) | 2000-09-18 | 2005-12-22 | Henriksen Dennis B | Use of GLP-2 and related compounds for the treatment, prevention, diagnosis, and prognosis of bone-related disorders and calcium homeostasis related syndromes |
| US20060135424A1 (en) | 2004-11-01 | 2006-06-22 | Nps Allelix Corp. | Treatment of short bowel syndrome patients with colon-in-continuity |
| WO2006117565A2 (en) | 2005-05-04 | 2006-11-09 | Zealand Pharma A/S | Glucagon-like-peptide-2 (glp-2) analogues |
| WO2008056155A1 (en) | 2006-11-08 | 2008-05-15 | Zealand Pharma A/S | Selective glucagon-like-peptide-2 (glp-2) analogues |
| US20090082309A1 (en) | 1998-02-02 | 2009-03-26 | Trustees Of Tufts College | Method of Regulating Glucose Metabolism, and Reagents Related Thereto |
| WO2010070251A1 (en) * | 2008-12-15 | 2010-06-24 | Zealand Pharma A/S | Glucagon analogues |
| WO2011160630A2 (en) | 2010-06-23 | 2011-12-29 | Zealand Pharma A/S | Glucagon analogues |
| WO2012158965A2 (en) | 2011-05-18 | 2012-11-22 | Mederis Diabetes, Llc | Improved peptide pharmaceuticals for insulin resistance |
Family Cites Families (9)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| ZA811368B (en) | 1980-03-24 | 1982-04-28 | Genentech Inc | Bacterial polypedtide expression employing tryptophan promoter-operator |
| ATE356830T1 (de) | 1996-08-30 | 2007-04-15 | Novo Nordisk As | Glp-1 derivate |
| WO1999058144A1 (en) | 1998-05-11 | 1999-11-18 | 1149336 Ontario Inc. | Methods of enhancing functioning of the large intestine |
| US6451987B1 (en) | 1999-03-15 | 2002-09-17 | Novo Nordisk A/S | Ion exchange chromatography of proteins and peptides |
| CN1344248A (zh) | 1999-03-17 | 2002-04-10 | 诺沃挪第克公司 | 肽的酰化方法和新酰化剂 |
| CN1705681A (zh) * | 2002-10-14 | 2005-12-07 | 诺沃挪第克公司 | Glp-2化合物、制剂及其用途 |
| JP2006517389A (ja) * | 2002-10-14 | 2006-07-27 | ノボ ノルディスク アクティーゼルスカブ | Glp−2化合物、製剤、及びそれらの使用 |
| WO2005082404A2 (en) * | 2004-02-27 | 2005-09-09 | Novo Nordisk A/S | Glp-2 derivatives modified by lipophilic substituents |
| AU2013255752B2 (en) | 2012-05-03 | 2017-11-09 | Zealand Pharma A/S | Glucagon-like-peptide-2 (GLP-2) analogues |
-
2013
- 2013-05-03 AU AU2013255752A patent/AU2013255752B2/en not_active Ceased
- 2013-05-03 CN CN201380029907.4A patent/CN104540850B/zh not_active Expired - Fee Related
- 2013-05-03 WO PCT/EP2013/059320 patent/WO2013164484A1/en not_active Ceased
- 2013-05-03 TR TR2018/02689T patent/TR201802689T4/tr unknown
- 2013-05-03 EP EP13721953.1A patent/EP2844670B1/en active Active
- 2013-05-03 US US14/398,297 patent/US9453064B2/en active Active
- 2013-05-03 MX MX2014013319A patent/MX356958B/es active IP Right Grant
- 2013-05-03 EA EA201491934A patent/EA028929B1/ru not_active IP Right Cessation
- 2013-05-03 JP JP2015509462A patent/JP6298044B2/ja not_active Expired - Fee Related
- 2013-05-03 BR BR112014027345A patent/BR112014027345A2/pt not_active Application Discontinuation
- 2013-05-03 CA CA2872315A patent/CA2872315A1/en not_active Abandoned
- 2013-05-03 KR KR1020147033951A patent/KR20150006052A/ko not_active Abandoned
-
2014
- 2014-11-19 IN IN9782DEN2014 patent/IN2014DN09782A/en unknown
-
2016
- 2016-08-16 US US15/238,126 patent/US9969787B2/en not_active Expired - Fee Related
-
2018
- 2018-04-11 US US15/950,235 patent/US10253080B2/en not_active Expired - Fee Related
Patent Citations (66)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5432156A (en) | 1993-02-24 | 1995-07-11 | Nisshin Flour Milling Co., Ltd. | Therapeutic agent for digestive tract diseases |
| US6184208B1 (en) | 1994-06-29 | 2001-02-06 | Immunotech Developments Inc. | Peptide, a method for its preparation and a pharmaceutical composition containing the peptide |
| US20030162703A1 (en) | 1995-04-14 | 2003-08-28 | Nps Allelix Corporation | Glucagon-like peptide-2 analogs |
| US5990077A (en) | 1995-04-14 | 1999-11-23 | 1149336 Ontario Inc. | Glucagon-like peptide-2 and its therapeutic use |
| US7049284B2 (en) | 1995-04-14 | 2006-05-23 | 1149336 Ontario Inc. | Glucagon-like peptide-2 and its therapeutic use |
| US6184201B1 (en) | 1995-04-14 | 2001-02-06 | Nps Allelix Corp. | Intestinotrophic glucagon-like peptide-2 analogs |
| US5789379A (en) | 1995-04-14 | 1998-08-04 | Allelix Biopharmaceutical Inc. | Glucagon-like peptide-2 analogs |
| US5834428A (en) | 1995-04-14 | 1998-11-10 | 1149336 Ontario Inc. | Glucagon-like peptide-2 and its therapeutic use |
| WO1996032414A1 (en) | 1995-04-14 | 1996-10-17 | 1149336 Ontario Inc. | Glucagon-like peptide-2 and its therapeutic use |
| US20010021767A1 (en) | 1995-04-14 | 2001-09-13 | Drucker Daniel J. | Glucagon-like peptide-2 analogs |
| US20030158101A1 (en) | 1995-04-14 | 2003-08-21 | 1149336 Ontario Inc. | Glucagon-like peptide-2 and its therapeutic use |
| US20060105954A1 (en) | 1995-04-14 | 2006-05-18 | 1149336 Ontario Inc. | Glucagon-like peptide-2 and its therapeutic use |
| US5912229A (en) | 1996-03-01 | 1999-06-15 | Novo Nordisk Als | Use of a pharmaceutical composition comprising an appetite-suppressing peptide |
| WO1997031943A1 (en) | 1996-03-01 | 1997-09-04 | Novo Nordisk A/S | Use of a pharmaceutical composition comprising an appetite-suppressing peptide |
| WO1997039031A1 (en) | 1996-04-12 | 1997-10-23 | 1149336 Ontario Inc. | Glucagon-like peptide-2 analogs |
| EP1231219A1 (en) | 1996-04-12 | 2002-08-14 | 1149336 Ontario Inc. | GLucagon-like peptide-2 analogs |
| US6489295B1 (en) | 1996-07-19 | 2002-12-03 | 1149336 Ontario Inc. | Antagonists of intestinotrophic GLP-2 peptides |
| US20030109449A1 (en) | 1996-07-19 | 2003-06-12 | 1149336 Ontario Inc. | Antagonists of intestinotrophic GLP-2 peptides |
| WO1998003547A1 (en) | 1996-07-19 | 1998-01-29 | 1149336 Ontario Inc. | Antagonists of intestinotrophic glp-2 peptides |
| US5994500A (en) | 1996-07-19 | 1999-11-30 | 1149336 Ontario Inc. | Antagonists of intestinotrophic GLP-2 peptides |
| US20040127418A1 (en) | 1996-08-30 | 2004-07-01 | Knudsen Liselotte Bjerre | GLP-2 derivatives |
| US20020025933A1 (en) | 1996-08-30 | 2002-02-28 | Knudsen Liselotte Bjerre | GLP-2 derivatives |
| WO1998011125A1 (en) | 1996-09-09 | 1998-03-19 | Zealand Pharmaceuticals A/S | Improved solid-phase peptide synthesis and agent for use in such synthesis |
| US5952301A (en) | 1996-12-10 | 1999-09-14 | 1149336 Ontario Inc. | Compositions and methods for enhancing intestinal function |
| US7176182B2 (en) | 1997-05-02 | 2007-02-13 | 1149336 Ontario Inc. | Methods of enhancing functioning of the large intestine |
| US6586399B1 (en) | 1997-05-02 | 2003-07-01 | 1149336 Ontario, Inc. | Methods of enhancing functioning of the large intestine |
| US20030207809A1 (en) | 1997-05-02 | 2003-11-06 | Nps Allelix Corporation | Methods of enhancing functioning of the large intestine |
| US6297214B1 (en) | 1997-05-02 | 2001-10-02 | 1149336 Ontario, Inc. | Methods of enhancing functioning of the large intestine |
| WO1998052600A1 (en) | 1997-05-16 | 1998-11-26 | 1149336 Ontario Inc. | Methods of enhancing functioning of the upper gastrointestinal tract |
| US6051557A (en) | 1997-05-16 | 2000-04-18 | 1149336 Ontario Inc. | Methods of enhancing functioning of the upper gastrointestinal tract |
| US20090082309A1 (en) | 1998-02-02 | 2009-03-26 | Trustees Of Tufts College | Method of Regulating Glucose Metabolism, and Reagents Related Thereto |
| WO1999046283A1 (en) | 1998-03-09 | 1999-09-16 | Zealand Pharmaceuticals A/S | Pharmacologically active peptide conjugates having a reduced tendency towards enzymatic hydrolysis |
| WO2001004156A1 (en) | 1999-07-12 | 2001-01-18 | Zealand Pharmaceuticals A/S | Peptides that lower blood glucose levels |
| US20030040478A1 (en) | 1999-12-08 | 2003-02-27 | Drucker Daniel J | Chemotherapy treatment |
| WO2001041779A2 (en) | 1999-12-08 | 2001-06-14 | 1149336 Ontario Inc. | Combined use of glp-2 receptor agonist and chemotherapeutic agent in treatment |
| US20040052862A1 (en) | 2000-09-18 | 2004-03-18 | Henriksen Dennis B. | Use of GLP for the treatment, prevention, diagnosis, and prognosis of bone-related and nutrition-related disorders |
| US7186683B2 (en) | 2000-09-18 | 2007-03-06 | Sanos Bioscience A/S | Use of GLP for the treatment, prevention, diagnosis, and prognosis of bone-related and nutrition-related disorders |
| US7371721B2 (en) | 2000-09-18 | 2008-05-13 | Sanos Bioscience A/S | Use of GLP-2 and related compounds for the treatment, prevention, diagnosis, and prognosis of bone-related disorders and calcium homeostasis related syndromes |
| US6770620B2 (en) | 2000-09-18 | 2004-08-03 | Sanos Bioscience A/S | Use of GLP for the treatment, prevention, diagnosis, and prognosis of bone-related and nutrition-related disorders |
| US20050282749A1 (en) | 2000-09-18 | 2005-12-22 | Henriksen Dennis B | Use of GLP-2 and related compounds for the treatment, prevention, diagnosis, and prognosis of bone-related disorders and calcium homeostasis related syndromes |
| US20040198642A1 (en) | 2001-02-01 | 2004-10-07 | 1149336 Ontario Inc. | Enhancement of GLP-2 activity |
| US7737251B2 (en) | 2001-02-16 | 2010-06-15 | Conjuchem Biotechnologies Inc. | Long lasting glucagon-like peptide 2 (GLP-2) for the treatment of gastrointestinal diseases and disorders |
| WO2002066511A2 (en) | 2001-02-16 | 2002-08-29 | Conjuchem Inc. | Long lasting glucagon-like peptide 2 (glp-2) for the treatment of gastrointestinal diseases and disorders |
| US20040248782A1 (en) | 2001-02-16 | 2004-12-09 | BRIDON Dominique P. | Long lasting glucagon-like peptide2(glp-2)for the treatment of gastrointestinal diseases and disorders |
| WO2002098348A2 (en) | 2001-06-01 | 2002-12-12 | Eli Lilly And Company | Glp-1 formulations with protracted time action |
| US20040122210A1 (en) | 2002-10-14 | 2004-06-24 | Lars Thim | GLP-2 compounds, formulations, and uses thereof |
| US7411039B2 (en) | 2002-10-14 | 2008-08-12 | Novo Nordisk A/S | GLP-2 compounds, formulations, and uses thereof |
| WO2005027978A2 (en) | 2003-09-19 | 2005-03-31 | Novo Nordisk A/S | Albumin-binding derivatives of therapeutic peptides |
| US20060135424A1 (en) | 2004-11-01 | 2006-06-22 | Nps Allelix Corp. | Treatment of short bowel syndrome patients with colon-in-continuity |
| WO2006117565A2 (en) | 2005-05-04 | 2006-11-09 | Zealand Pharma A/S | Glucagon-like-peptide-2 (glp-2) analogues |
| US20110098222A1 (en) | 2005-05-04 | 2011-04-28 | Zealand Pharma A/S | Glucagon-like-peptide-2 (glp-2) analogues |
| US20070231308A1 (en) | 2005-05-04 | 2007-10-04 | Larsen Bjarne D | Glucagon-like-peptide-2 (GLP-2) analogues |
| US7563770B2 (en) | 2005-05-04 | 2009-07-21 | Zealand Pharma A/S | Glucagon-like-peptide-2 (GLP-2) analogues |
| US20070117752A1 (en) | 2005-05-04 | 2007-05-24 | Larsen Bjarne D | Glucagon-like-peptide-2 (GLP-2) analogues |
| US20120289466A1 (en) | 2005-05-04 | 2012-11-15 | Zealand Pharma A/S | Glucagon-like-peptide-2 (glp-2) analogues |
| US7745403B2 (en) | 2005-05-04 | 2010-06-29 | Zealand Pharma A/S | Methods of treating chemotherapy-induced diarrhea/mucositis using glucagon-like-peptide-2(GLP-2)analogues |
| US8263552B2 (en) | 2005-05-04 | 2012-09-11 | Zealand Pharma A/S | Glucagon-like-peptide-2 (GLP-2) analogues |
| US20110152186A1 (en) | 2005-05-04 | 2011-06-23 | Zealand Pharma A/S | Glucagon-like-peptide-2 (glp-2) analogues |
| US8163696B2 (en) | 2005-05-04 | 2012-04-24 | Zealand Pharma A/S | Treatment of inflammatory bowel disease using glucagon-like-peptide-2 (GLP-2) analogues |
| US20120004392A1 (en) | 2006-11-08 | 2012-01-05 | Zealand Pharma A/S | Selective glucagon-like-peptide-2 (glp-2) analogues |
| US20140154214A1 (en) | 2006-11-08 | 2014-06-05 | Zealand Pharma A/S | Selective glucagon-like-peptide-2 (glp-2) analogues |
| US8642727B2 (en) | 2006-11-08 | 2014-02-04 | Zealand Pharma A/S | Selective glucagon-like-peptide-2 (GLP-2) analogues |
| WO2008056155A1 (en) | 2006-11-08 | 2008-05-15 | Zealand Pharma A/S | Selective glucagon-like-peptide-2 (glp-2) analogues |
| WO2010070251A1 (en) * | 2008-12-15 | 2010-06-24 | Zealand Pharma A/S | Glucagon analogues |
| WO2011160630A2 (en) | 2010-06-23 | 2011-12-29 | Zealand Pharma A/S | Glucagon analogues |
| WO2012158965A2 (en) | 2011-05-18 | 2012-11-22 | Mederis Diabetes, Llc | Improved peptide pharmaceuticals for insulin resistance |
Non-Patent Citations (82)
Cited By (19)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US10092648B2 (en) | 2006-11-08 | 2018-10-09 | Zealand Pharma A/S | Selective glucagon-like-peptide-2 (GLP-2) analogues |
| US10253080B2 (en) | 2012-05-03 | 2019-04-09 | Zealand Pharma A/S | Glucagon-like-peptide-2 (GLP-2) analogues |
| US9969787B2 (en) | 2012-05-03 | 2018-05-15 | Zealand Pharma A/S | Glucagon-like-peptide-2 (GLP-2) analogues |
| US11795204B2 (en) | 2012-07-23 | 2023-10-24 | Zealand Pharma A/S | Glucagon analogues |
| US11034747B2 (en) | 2013-10-17 | 2021-06-15 | Zealand Pharma A/S | Glucagon analogues and methods of use |
| US12473339B2 (en) | 2013-10-17 | 2025-11-18 | Zealand Pharma A/S | Acylated glucagon analogues |
| US10457714B2 (en) | 2013-10-17 | 2019-10-29 | Zealand Pharma A/S | Acylated glucagon analogues |
| US11884713B2 (en) | 2013-10-17 | 2024-01-30 | Zealand Pharma A/S | Acylated glucagon analogues |
| US11091528B2 (en) | 2013-10-17 | 2021-08-17 | Zealand Pharma A/S | Acylated glucagon analogues |
| US11008375B2 (en) | 2013-11-06 | 2021-05-18 | Zealand Pharma A/S | GIP-GLP-1 dual agonist compounds and methods |
| US11111285B2 (en) | 2013-11-06 | 2021-09-07 | Zealand Pharma A/S | Glucagon-GLP-1-GIP triple agonist compounds |
| US11001619B2 (en) | 2014-10-29 | 2021-05-11 | Zealand Pharma A/S | GIP agonist compounds and methods |
| US11814417B2 (en) | 2014-10-29 | 2023-11-14 | Zealand Pharma A/S | GIP agonist compounds and methods |
| US11274136B2 (en) | 2015-04-16 | 2022-03-15 | Zealand Pharma A/S | Acylated glucagon analogue |
| US10336802B2 (en) | 2015-04-16 | 2019-07-02 | Zealand Pharma A/S | Acylated glucagon analogue |
| US11395847B2 (en) | 2016-12-09 | 2022-07-26 | Zealand Pharma A/S | Acylated GLP-1/GLP-2 dual agonists |
| US10905745B2 (en) | 2016-12-09 | 2021-02-02 | Zealand Pharma A/S | Acylated GLP-1/GLP-2 dual agonists |
| US12297251B1 (en) | 2017-06-16 | 2025-05-13 | Zealand Pharma A/S | Injection pen for subcutaneous administration of a peptide |
| WO2020165900A1 (en) | 2019-02-11 | 2020-08-20 | Opko Biologics Ltd. | Long-acting glp-2 analogs |
Also Published As
| Publication number | Publication date |
|---|---|
| AU2013255752A1 (en) | 2014-12-18 |
| BR112014027345A2 (pt) | 2019-09-03 |
| AU2013255752B2 (en) | 2017-11-09 |
| KR20150006052A (ko) | 2015-01-15 |
| JP2015517299A (ja) | 2015-06-22 |
| JP6298044B2 (ja) | 2018-03-20 |
| US9969787B2 (en) | 2018-05-15 |
| EP2844670B1 (en) | 2017-12-06 |
| MX2014013319A (es) | 2015-07-06 |
| CN104540850A (zh) | 2015-04-22 |
| CN104540850B (zh) | 2018-05-18 |
| CA2872315A1 (en) | 2013-11-07 |
| HK1208238A1 (en) | 2016-02-26 |
| EA028929B1 (ru) | 2018-01-31 |
| US20150125431A1 (en) | 2015-05-07 |
| WO2013164484A1 (en) | 2013-11-07 |
| US10253080B2 (en) | 2019-04-09 |
| IN2014DN09782A (enExample) | 2015-07-31 |
| EA201491934A1 (ru) | 2015-07-30 |
| US20180298077A1 (en) | 2018-10-18 |
| US20160355563A1 (en) | 2016-12-08 |
| TR201802689T4 (tr) | 2018-03-21 |
| EP2844670A1 (en) | 2015-03-11 |
| MX356958B (es) | 2018-06-20 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US10253080B2 (en) | Glucagon-like-peptide-2 (GLP-2) analogues | |
| US11111285B2 (en) | Glucagon-GLP-1-GIP triple agonist compounds | |
| US11884713B2 (en) | Acylated glucagon analogues | |
| US11008375B2 (en) | GIP-GLP-1 dual agonist compounds and methods | |
| US10092648B2 (en) | Selective glucagon-like-peptide-2 (GLP-2) analogues | |
| US9169310B2 (en) | Glucagon analogues | |
| US20160347813A1 (en) | Glucagon analogues | |
| HK1208238B (en) | Glucagon-like-peptide-2 (glp-2) analogues |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| AS | Assignment |
Owner name: ZEALAND PHARMA A/S, DENMARK Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:JUST, RASMUS;BOVBJERG, KIRSTEN LINDEGAARD;RIBER, DITTE;AND OTHERS;SIGNING DATES FROM 20130531 TO 20130604;REEL/FRAME:035269/0533 |
|
| FEPP | Fee payment procedure |
Free format text: PAYOR NUMBER ASSIGNED (ORIGINAL EVENT CODE: ASPN); ENTITY STATUS OF PATENT OWNER: SMALL ENTITY |
|
| STCF | Information on status: patent grant |
Free format text: PATENTED CASE |
|
| CC | Certificate of correction | ||
| MAFP | Maintenance fee payment |
Free format text: PAYMENT OF MAINTENANCE FEE, 4TH YR, SMALL ENTITY (ORIGINAL EVENT CODE: M2551); ENTITY STATUS OF PATENT OWNER: SMALL ENTITY Year of fee payment: 4 |
|
| AS | Assignment |
Owner name: ZOOLANDER SA LLC, NEW YORK Free format text: PATENT SECURITY AGREEMENT;ASSIGNOR:ZEALAND PHARMA A/S;REEL/FRAME:058593/0261 Effective date: 20211213 |
|
| AS | Assignment |
Owner name: ZEALAND PHARMA A/S, DENMARK Free format text: RELEASE BY SECURED PARTY;ASSIGNOR:ZOOLANDER SA LLC;REEL/FRAME:063624/0547 Effective date: 20230509 Owner name: ZEALAND PHARMA A/S, DENMARK Free format text: RELEASE OF SECURITY INTEREST;ASSIGNOR:ZOOLANDER SA LLC;REEL/FRAME:063624/0547 Effective date: 20230509 |
|
| AS | Assignment |
Owner name: ZEALAND PHARMA A/S, DENMARK Free format text: RELEASE BY SECURED PARTY;ASSIGNOR:ZOOLANDER SA LLC;REEL/FRAME:063672/0342 Effective date: 20230509 Owner name: ZEALAND PHARMA A/S, DENMARK Free format text: RELEASE OF SECURITY INTEREST;ASSIGNOR:ZOOLANDER SA LLC;REEL/FRAME:063672/0342 Effective date: 20230509 |
|
| MAFP | Maintenance fee payment |
Free format text: PAYMENT OF MAINTENANCE FEE, 8TH YR, SMALL ENTITY (ORIGINAL EVENT CODE: M2552); ENTITY STATUS OF PATENT OWNER: SMALL ENTITY Year of fee payment: 8 |