US20170247423A1 - Stapled intracellular-targeting antimicrobial peptides to treat infection - Google Patents

Stapled intracellular-targeting antimicrobial peptides to treat infection Download PDF

Info

Publication number
US20170247423A1
US20170247423A1 US15/445,502 US201715445502A US2017247423A1 US 20170247423 A1 US20170247423 A1 US 20170247423A1 US 201715445502 A US201715445502 A US 201715445502A US 2017247423 A1 US2017247423 A1 US 2017247423A1
Authority
US
United States
Prior art keywords
compound
independently
amino acid
bfstap
substituted
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Abandoned
Application number
US15/445,502
Other languages
English (en)
Inventor
Loren D. Walensky
Rida Mourtada
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Dana Farber Cancer Institute Inc
Original Assignee
Dana Farber Cancer Institute Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Dana Farber Cancer Institute Inc filed Critical Dana Farber Cancer Institute Inc
Priority to US15/445,502 priority Critical patent/US20170247423A1/en
Assigned to DANA-FARBER CANCER INSTITUTE, INC. reassignment DANA-FARBER CANCER INSTITUTE, INC. ASSIGNMENT OF ASSIGNORS INTEREST (SEE DOCUMENT FOR DETAILS). Assignors: MOURTADA, Rida, WALENSKY, LOREN D.
Publication of US20170247423A1 publication Critical patent/US20170247423A1/en
Priority to US16/813,528 priority patent/US11945846B2/en
Priority to US18/590,636 priority patent/US12391733B2/en
Abandoned legal-status Critical Current

Links

Images

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/46Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • C07K14/461Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from fish
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/04Peptides having up to 20 amino acids in a fully defined sequence; Derivatives thereof
    • A61K38/08Peptides having 5 to 11 amino acids
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/04Peptides having up to 20 amino acids in a fully defined sequence; Derivatives thereof
    • A61K38/10Peptides having 12 to 20 amino acids
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/1703Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/1703Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • A61K38/1706Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from fish
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/1703Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • A61K38/1709Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/1767Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from invertebrates
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K45/00Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
    • A61K45/06Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/04Antibacterial agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P43/00Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/43504Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from invertebrates
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/46Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • C07K14/463Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from amphibians
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/46Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • C07K14/47Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K7/00Peptides having 5 to 20 amino acids in a fully defined sequence; Derivatives thereof
    • C07K7/04Linear peptides containing only normal peptide links
    • C07K7/06Linear peptides containing only normal peptide links having 5 to 11 amino acids
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K7/00Peptides having 5 to 20 amino acids in a fully defined sequence; Derivatives thereof
    • C07K7/04Linear peptides containing only normal peptide links
    • C07K7/08Linear peptides containing only normal peptide links having 12 to 20 amino acids
    • YGENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
    • Y02TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
    • Y02ATECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
    • Y02A50/00TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
    • Y02A50/30Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change

Definitions

  • This disclosure relates to structural stabilization of intracellular-targeting antimicrobial peptides and methods for using such peptides to treat bacterial and other pathogenic infections.
  • AMPs are an evolutionarily conserved class of proteins that form an essential line of defense (in particular, as a key component of the humoral immune response) against microbial invasion [2]. These peptides are produced by many disparate organisms and have been found to exhibit a wide spectrum of activity against bacteria, fungi, protozoa, and even viruses.
  • AMPs can be divided into four main structural groups: stabilized ⁇ -sheet peptides with two to four disulfide bridges; loop peptides with a single disulfide bridge; ⁇ -helical peptides; and extended structures rich in arginine, glycine, proline, tryptophan, and histidine [2-4].
  • these peptides are usually cationic with amphipathic character.
  • I-TAMPs intracellular-targeting antimicrobial peptides
  • H-DAMP histone-derived AMP
  • I-TAMPs including buforin II
  • buforin II have reduced interest in further development of buforin II and/or other I-TAMPs as active pharmaceutical agents and have led to their being generally relegated to use as research reagents.
  • the stapled I-TAMPs of this document can, in some embodiments, have no or minimal lytic or cell growth-inhibiting activity against target microbial cells.
  • This disclosure shows that applying hydrocarbon stapling to discrete sequences within I-TAMPs results in structural stabilization, enhanced antimicrobial activity, and significantly lowered hemolytic activity.
  • the document provides an internally cross-linked (ICL) intra-microbial cell targeting anti-microbial peptide (I-TAMP) having the Formula (I),
  • each Xaa is independently an amino acid
  • each R 1 and R 2 is independently H, alkyl, alkenyl, alkynyl, arylalkyl, cycloalkylalkyl, heteroarylalkyl, or heterocyclylalkyl, any of which is substituted or unsubstituted;
  • each R 3 is independently alkylene, alkenylene, or alkynylene, any of which is substituted or unsubstituted;
  • each R 4 is independently —NH 3 or —OH, wherein each —NH 3 is optionally coupled with another chemical entity;
  • each x is independently 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10;
  • each w and y is independently 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20;
  • z is 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10, wherein the peptide exhibits an intracellular antimicrobial effect against at least one microbe.
  • each R 1 and R 2 are independently H or a C 1 to C 10 alkyl, alkenyl, alkynyl, or;
  • each R 3 is alkylene, alkenylene or alkynylene (e.g., a C 8 or C 11 alkenylene) substituted with 1-6 R 4 ;
  • each R 4 is, independently —NH 3 or —OH, wherein each —NH 3 is optionally coupled with a chemical entity such as benzylic acid derivatives, enzyme inhibitors, a carbohydrate group, a hydroxyl group, a phosphate group, a farnesyl group, an isofarnesyl group, a fatty acid group, or a linker for conjugation or functionalization;
  • a chemical entity such as benzylic acid derivatives, enzyme inhibitors, a carbohydrate group, a hydroxyl group, a phosphate group, a farnesyl group, an isofarnesyl group, a fatty acid group, or a linker for conjugation or functionalization;
  • x is 2, 3, or 6, R 3 replacing, relative to the corresponding parent non-internally cross-linked AMP, the side chains of at least one pair of amino acids;
  • w and y are independently an integer from 0-20;
  • z is an integer from 1-10 (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10);
  • each Xaa is independently an amino acid (e.g., one of the 20 naturally occurring amino acids or any non-naturally occurring amino acid),
  • R 3 is C 8 alkylene, alkenylene, or alkynylene; when x is 3, R 3 is C 8 alkylene, alkenylene, or alkynylene; and when x is 6, R 3 is C 11 alkylene, alkenylene, or alkynylene and provided that the sum of x, w, and y is at least 10, and
  • the ICL I-TAMP contains at least 10 contiguous amino acids of any one of SEQ ID NOs: 1-13 or a variant thereof having 1, 2, 3, 4, or 5 amino acid substitutions, or another polypeptide sequence described herein except that: (a) within the 10 contiguous amino acids the side chains of at least one pair (e.g., one or two pairs) of amino acids separated by 2, 3, or 6 amino acids are replaced, relative to the corresponding parent non-internally cross-linked AMP, by the linking group, R 3 , which connects the alpha carbons of the pair of amino acids as depicted in Formula I; and (b) the alpha carbon of the first of the pair of amino acids is substituted with R 1 as depicted in Formula I and the alpha carbon of the second of the pair of amino acids is substituted with R 2 as depicted in Formula I.
  • R 3 can be substituted with two R 4 and the R 4 can be —OH.
  • R 3 can be an optionally substituted —NH 3 and the other is —OH.
  • the document additionally provides an internally cross-linked (ICL) intra-microbial cell targeting anti-microbial peptide (I-TAMP) containing amino acids, the side chains of at least one pair (e.g., one or two pairs) of amino acids separated by 2, 3, or 6 amino acids being replaced, relative to the corresponding parent non-internally cross-linked AMP, by the linking group, R 3 , which connects the alpha carbons of the pair of amino acids such that:
  • each R 3 is independently alkylene, alkenylene, or alkynylene (e.g., a C 6 , C 7 , or C 11 alkenylene) optionally substituted with 1-6 R 4 ;
  • each R 4 is independently —NH 3 or —OH, wherein each —NH 3 is optionally substituted;
  • each R 1 and R 2 is independently C 1 to C 10 alkyl, alkenyl, alkynyl, arylalkyl, cycloalkylalkyl, heteroarylalkyl, or heterocyclylalkyl, any of which is substituted or unsubstituted.
  • the ICL I-TAMP contains at least 10 contiguous amino acids of any of SEQ ID NOs: 1-13 or a variant thereof having 1, 2, 3, 4, or 5 amino acid substitutions, or another polypeptide sequence described herein except that: (a) within the 10 contiguous amino acids the side chains of at least one pair (e.g., one or two pairs) of amino acids separated by 2, 3, or 6 amino acids are replaced, relative to the corresponding parent non-internally cross-linked AMP, by the linking group, R 3 , which connects the alpha carbons of the pair of amino acids and the H of the alpha carbon of each pair of amino acids having their side chains replaced by linking group R 3 is optionally, independently replaced by a C 1 to C 10 alkyl, alkenyl, or alkynyl.
  • This peptide can contain at least 10 contiguous amino acids of SEQ ID NO: 7.
  • ICL I-TAMPs can contain the sequence of any one of SEQ ID NOs: 14-60. They can, for example, contain the sequence of BFStap(i+4)2, BFStap(i+4)3, BFStap(i+4)4, BFStap(i+4)6, BFStap(i+4)7, BFStap(i+4)8, BFStap(i+4)11, BFStap(i+7)1, BFStap(i+7)2, BFStap(i+7)3, BFStap(i+7)4, BFStap(i+7)5, BFStap(i+7)6, BFStap(i+7)7, BFStap(i+7)8, or BFStap(i+7)9.
  • the above-described ICL I-TAMPs can contain the sequence of any one of SEQ ID NOs: 43, 47, or 55.
  • the document also features a method of treating or preventing a microbial infection, the method including administering an effective amount of any of the ICL I-TAMPs described above to a subject having, or at risk of having, an infection with a microbial organism.
  • the subject can be an animal or plant.
  • the animal can be a mammal, e.g., a human.
  • the microbial organism can be a bacterial organism, e.g., a gram-positive bacterial organism or a Gram-negative bacterial organism.
  • the method can further include administering an effective amount of at least one antibiotic.
  • the antibiotic can act synergistically with the ICL I-TAMP to inhibit or prevent infection with the microbial organism.
  • the ICL I-TAMP and the antibiotic can act synergistically to overcome or prevent resistance to the antibiotic.
  • compositions containing one or more of the any of the ICL I-TAMPs described above.
  • the composition can further contain a medical or hygienic device.
  • the one or more ICL I-TAMPs can be coated onto or impregnated into the medical or hygienic device.
  • the composition can also contain one or more antibiotics.
  • Also provided by the document is a method of inhibiting the growth of, or killing, a microbial organism that involves contacting the microbial organism with one or more of any of the above-described ICL I-TAMPS.
  • the microbial organism can be an extracellular microbial organism or an intracellular microbial organism.
  • the contacting can occur in a subject comprising the microbial organism.
  • the method can be an in vitro method. It is understood that the method can be implemented using any of the features described in the document (e.g., those described above for a method of treating or preventing a microbial infection).
  • Another feature of the document is a method of making any of the above-described ICL I-TAMPs, the method involving: synthesizing the ICL I-TAMP such that the ICL I-TAMP comprises an ⁇ -helical region comprising a first surface hydrophobic patch, the replacement with the linking groups maintaining or resulting in, relative to the corresponding parent non-internally crosslinked I-TAMP, discontinuity between the first hydrophobic patch and one or more additional surface hydrophobic patches on internally cross-linked peptide.
  • the method can further include adding to the linking group a hydrolyzing modification, e.g., dihydroxylation.
  • the terms “about” and “approximately” are defined as being within plus or minus 10% of a given value or state, preferably within plus or minus 5% of said value or state.
  • FIG. 1 is a chart showing the sequences of buforin II and exemplary stapled analogues.
  • Buforin II sequence aligned with the sequences of stapled derivatives demonstrate the position of the i, i+4 staple, which is represented by the pair: X,X, and the i, i+7 staple, which is represented by the pair: 8,X.
  • Other residues that were mutated are boxed.
  • the sequences listed from top to bottom correspond to SEQ ID NOs.: 37 to 60 and 7.
  • “8” is (R)-2-(7′-octenyl)alanine; and “X” is (S)-2-(4′-pentenyl)alanine.
  • FIG. 2 shows the circular dichroism (CD) spectra of buforin II and i, i+4 stapled analogues in the absence and presence of trifluoroethanol (TFE).
  • FIG. 2 PANEL A is a graph of a CD spectrum of buforin II (F10W) and i, i+4 stapled analogues in buffer solution.
  • FIG. 2 PANEL B is a graph of a CD spectrum of buforin II (F10W) and i, i+4 stapled analogues in TFE:buffer (1:1) mixture.
  • FIG. 3 shows the circular dichroism spectra of buforin II and i, i+7 stapled analogues in the absence and presence of trifluoroethanol (TFE).
  • FIG. 3 PANEL A is a graph of a CD spectrum of buforin II (F10W) and i, i+7 stapled analogues in buffer solution.
  • FIG. 3 PANEL B is a graph of a CD spectrum of buforin II (F10W) and i, i+7 stapled analogues in TFE:buffer (1:1) mixture.
  • FIG. 4 PANEL A shows the chemical structures of the unnatural amino acids used to generate various kinds of staples.
  • FIG. 4 PANEL B illustrates peptides with staples of various lengths.
  • FIG. 4 PANEL C illustrates a staple walk along a peptide sequence.
  • FIG. 5 is a schematic showing representations of various kinds of double and triple stapling strategies along with exemplary staple walks.
  • FIG. 6 is a schematic showing exemplary staple walks using various lengths of branched double staple moieties.
  • FIG. 7 is a schematic showing exemplary chemical alterations that are employed to generate stapled antimicrobial peptide derivatives.
  • FIG. 8 is a graph showing the hemolysis of stapled buforin II analogues.
  • Stapled buforin II analogs were incubated with 1% v/v human red blood cells (RBCs) in phosphate buffer for 1 hour at 37° C. and then the supernatant was collected and hemoglobin release was measured using UV absorbance at 570 nm.
  • the buforin II analogs displayed hemolysis levels below 5% at all the concentrations tested up to 50 ⁇ g/mL.
  • I-TAMP sequences possess the unique property of microbial cell translocation to achieve their anti-microbial activity inside the microbial cell.
  • This disclosure informs the development of structurally-stabilized I-TAMPS to optimize/maximize their antimicrobial potency and proteolytic stability for therapeutic development. It will be appreciated that such structurally stabilized I-TAMPS should have no or minimal lytic or cell growth-inhibiting activity against target microbial cells.
  • Such drug repurposing is another critically important avenue for transforming FDA-approved agents, such as methotrexate, into selective antimicrobials.
  • this invention addresses the previous limitations in developing I-TAMPS as antimicrobial agents by chemically-stabilizing I-TAMP structures and also adapting them for bacterial delivery of therapeutic cargos.
  • the mechanism of action of buforin II involving bacterial membrane transit enables the development of chimeric compounds that link buforin II to antibiotics, which are otherwise incapable of accessing the interior of Gram-negative bacteria.
  • the specific stapling strategy discovered for I-TAMPs reinforces both the bacterial uptake capacity of this AMP and the stability of the peptide for in vivo applications.
  • the invention further provides novel opportunities to harness the potential of intracellular AMPS to enable new therapeutics for overcoming treatment resistance. Since I-TAMPs like buforin II act on bacterial intracellular targets by translocating across their membranes, stapled I-TAMPs provide a new delivery platform for selective targeting of bacteria, enabling repurposing of previously ineffective antibiotics due to bacterial membrane impenetrance.
  • An exemplary class of cargo is Gram-positive antimicrobials, e.g., beta-lactam drugs, which are otherwise blocked by the outer membrane of Gram-negative bacteria. Additional classes of cargo include, e.g., antibiotics that are otherwise toxic for human use but could be selectively targeted to bacteria, and cancer therapeutics that have bacterial cross-targets, e.g., methotrexate [19].
  • I-TAMPs that function as antimicrobials in fish (including, e.g., in skin and/or intestinal secretions) and stapled analogs thereof.
  • the following sequences and exemplary stapled analogs are listed below. In these sequences and all the others listed below, “X” indicates the position of staples. Some of the sequences contain an “—NH 2 at the C-terminus; this indicates amidation of the C-terminal residue.
  • Pleurocidin (From winter flounder) (SEQ ID NO: 1) GWGSFFKKAAHVGKHVGKAALTHYL-NH 2 (SEQ ID NO: 14) GW X SFF X KAAH X GKH X GKAALTHYL-NH 2 (SEQ ID NO: 15) GWGSFFKK X AHV X KHVGK X ALTXYL-NNH 2 Hipposin (From Atlantic halibut) (SEQ ID NO: 2) SGRGKTGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAHRVGAGAP VYL (SEQ ID NO: 16) SGR X KTGGKA X AKAKTRSSRAGLQFPVGRVHRLLRKGNYAHRVGAGAP VYL (SEQ ID NO: 17) SGRGKTGGK X RAK X KTRSSRAGLQFP X GRV X RLLRKGNYAHRVGAGAP VYL Himanturin (From the Round Whip
  • I-TAMPs that function as antimicrobials in mollusks (including, e.g., in skin and/or intestinal secretions) and the stapled analogs thereof.
  • mollusks including, e.g., in skin and/or intestinal secretions
  • stapled analogs include, e.g., in skin and/or intestinal secretions
  • I-TAMPs that function as antimicrobials in amphibians (including, e.g., in secretions) and stapled analogs thereof.
  • amphibians including, e.g., in secretions
  • stapled analogs thereof.
  • sequences and exemplary stapled analogs are listed below:
  • Buforin II Simumach Secretion from Asian Toad Bufo garagrizans —Example below is Buforin II
  • I-TAMPs that function as antimicrobials in mammals (including, e.g., in secretions) and stapled analogs thereof.
  • mammals including, e.g., in secretions
  • stapled analogs thereof.
  • sequences and exemplary stapled analogs are listed below:
  • I-TAMPs that function as antimicrobials in Insects (including, e.g., in skin and/or intestinal secretions) and stapled analogs thereof.
  • I-TAMPs that function as antimicrobials in Insects (including, e.g., in skin and/or intestinal secretions) and stapled analogs thereof.
  • stapled analogs include, e.g., in skin and/or intestinal secretions
  • Drosocin (From Drosophila ) (SEQ ID NO: 12) GKPRPYSPRP(T*)SHPRPIRV T*: Threonine is glycosylated (SEQ ID NO: 33) X KPRPYS X RP(T*)SHPRPIRV (SEQ ID NO: 34) GKPRPY X PRP(T*)SH X RPIRV Apidaecin D3 (From honey bees) (SEQ ID NO: 13) GNNRPVYIPQPRPPHPRL (SEQ ID NO: 35) GNNRP X YIPQPR X PHPRL (SEQ ID NO: 36) GNNXPVYXPQPRPPXPRX
  • the present disclosure provides structurally stabilized peptides related to anti-bacterial peptides (AMP) (referred to at times as stabilized ⁇ -helices of AMP or stabilized AMP or STAMP) comprising at least two modified amino acids joined by an internal (intramolecular) cross-link (or staple), wherein the at least two amino acids are separated by 2, 3, or 6 amino acids.
  • Stabilized peptides herein include stapled peptides, including peptides having two staples and/or stitched peptides.
  • the structurally stabilized peptide of this disclosure are generally derived from I-TAMPs.
  • the compound exhibits at least a 1.25, 1.5, 1.75 or 2-fold increase in ⁇ -helicity as determined by circular dichroism compared to a corresponding uncrosslinked peptide.
  • the compound can exhibit about 10%, about 15%, about 20%, about 25%, about 30%, about 35%, about 40%, about 45%, about 50%, about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95%, or about 100% helicity.
  • Amino acids are the building blocks of the peptides herein.
  • the term “amino acid” refers to a molecule containing both an amino group and a carboxyl group as well as a side chain.
  • Amino acids suitable for inclusion in the peptides disclosed herein include, without limitation, natural alpha-amino acids such as D- and L-isomers of the 20 common naturally occurring alpha-amino acids found in peptides (e.g., Ala (A), Arg (R), Asn (N), Cys (C), Asp (D), Gln (Q), Glu (E), Gly (G), His (H), Ile (I), Leu (L), Lys (K), Met (M), Phe (F), Pro (P), Ser (S), Thr (T), Trp (W), Tyr (Y), and Val (V), unnatural alpha-amino acids (including, but not limited to ⁇ , ⁇ -disubstituted and N-alkylated amino acids
  • unnatural amino acids there are many known unnatural amino acids, any of which may be included in the peptides of the present invention.
  • Some non-limiting examples of unnatural amino acids are 4-hydroxyproline, desmosine, gamma-aminobutyric acid, beta-cyanoalanine, norvaline, 4-(E)-butenyl-4(R)-methyl-N-methyl-L-threonine, N-methyl-L-leucine, 1-amino-cyclopropanecarboxylic acid, 1-amino-2-phenyl-cyclopropanecarboxylic acid, 1-amino-cyclobutanecarboxylic acid, 4-amino-cyclopentenecarboxylic acid, 3-amino-cyclohexanecarboxylic acid, 4-piperidylacetic acid, 4-amino-1-methylpyrrole-2-carboxylic acid, 2,4-diaminobutyric acid, 2,3-diaminopropionic acid, 2,4-
  • a “peptide” or “polypeptide” comprises a polymer of amino acid residues linked together by peptide (amide) bonds.
  • the terms, as used herein, refer to proteins, polypeptides, and peptides of any size, structure, or function. Typically, a peptide or polypeptide will be at least three amino acids long.
  • a peptide or polypeptide may refer to an individual protein or a collection of proteins.
  • peptides can include only natural amino acids, although non-natural amino acids (i.e., compounds that do not occur in nature but that can be incorporated into a polypeptide chain) and/or amino acid analogs as are known in the art may alternatively be employed.
  • amino acids in a peptide or polypeptide may be modified, for example, by the addition of a chemical entity such as a carbohydrate group, a hydroxyl group, a phosphate group, a farnesyl group, an isofarnesyl group, a fatty acid group, a linker for conjugation, functionalization, or other modification, etc.
  • a peptide or polypeptide may also be a single molecule or may be a multi-molecular complex, such as a protein.
  • a peptide or polypeptide may be just a fragment of a naturally occurring protein or peptide.
  • a peptide or polypeptide may be naturally occurring, recombinant, or synthetic, or any combination thereof.
  • “Dipeptide” refers to two covalently linked amino acids.
  • a peptide has or can be induced to have alpha helical secondary structure.
  • a peptide is a modified peptide that includes 1, 2, 3, 4, or 5 amino acid substitutions (e.g., 1, 2, 3, 4, or 5 amino acids are replaced with A or 1, 2, 3, 4, or 5 amino acids are conservatively substituted).
  • stabilized peptides can be produced from I-TAMPs having at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, 99%, 99.5%, or 100%) identity to one of SEQ ID NOs: 1-13 or I-TAMPS that include one of SEQ ID NOs: 1-13 with one or more (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, preferably 1-2, 1-3, 1-4, or 1-5) conservative amino acid substitutions.
  • I-TAMPs having at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, 99%, 99.5%, or 100%) identity to one of SEQ ID NOs: 1-13 or I-TAMPS that include one of SEQ ID NOs: 1-13 with one or more (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, preferably 1-2, 1-3, 1-4, or 1-5) conservative amino acid substitutions.
  • stabilized peptides can have at least 80% (e.g., 80%, 85%, 90%, 95%, 98%, 99%, 99.5%, or 100%) identity to one of SEQ ID NOs: 14-36 or can include one of SEQ ID NOs: 1-13 with one or more (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, for example, 1-2, 1-3, 1-4, or 1-5) conservative amino acid substitutions.
  • the stabilized peptide has the sequence of one of SEQ ID NOs: 1-13 with one or two staples (e.g., one staple between two amino acids separated by 2 or 3 (or 6) amino acids or two staples each between two amino acids that are separated by 2 or 3 (or 6) amino acids).
  • 1, 2, 3, 4, or 5 of the amino acids (whose side chains are not replaced with a staple) in this stabilized peptide can be replaced by a conservative substitution or can be replaced by A.
  • the stabilized peptide has the sequence of one of SEQ ID NOs: 37-60.
  • the stabilized peptide has the sequence of one of SEQ ID NOs: 43, 47, or 55.
  • a “conservative amino acid substitution” can include substitutions in which one amino acid residue is replaced with another amino acid residue having a similar side chain.
  • Families of amino acid residues having similar side chains have been defined in the art. These families include amino acids with basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan), beta-branched side chains (e.g., threonine, valine, isoleucine) and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, hist
  • sequences are aligned for optimal comparison purposes (e.g., gaps can be introduced in one or both of a first and a second amino acid or nucleic acid sequence for optimal alignment and non-homologous sequences can be disregarded for comparison purposes).
  • the length of a reference sequence aligned for comparison purposes can be at least 30%, at least 40%, at least 50%, at least 60%, or at least 70%, 80%, 90%, or 100% of the length of the reference sequence.
  • the amino acid residues or nucleotides at corresponding amino acid positions or nucleotide positions are then compared.
  • peptides herein include at least two modified amino acids that together form an internal (intramolecular) cross-link (or staple), wherein the at least two modified amino acids are separated by: (A) two amino acids (i.e., i, 1+3), (B) three amino acid (i.e., i, 1+4), or (C) six amino acids (i.e., i, i+7).
  • the cross-link can be, for example, a C 7 alkylene or alkenylene.
  • the cross-link can be, for example, a C 8 alkylene or alkenylene.
  • the cross-link can be, for example, a C 11 , C 12 , or C 13 alkylene or alkenylene.
  • the cross-link can be, for example, a C 6 , C 7 , or C 8 alkylene or alkenylene (e.g., a C 6 alkenylene having one double bond).
  • the cross-link can be, for example, a C 8 alkylene or alkenylene.
  • the cross-link can be, for example, a C 11 , C 12 , or C 13 alkylene or alkenylene (e.g., a C 11 alkenylene having one double bond).
  • the cross-link is alkenylene, there can be one or more double bonds.
  • the cross-link can be optionally substituted with 1-5 substituents selected from —OH and —NH 3 .
  • “Peptide stapling” is a term coined from a synthetic methodology wherein two olefin-containing side-chains (e.g., cross-linkable side chains) present in a polypeptide chain are covalently joined (e.g., “stapled together”) using a ring-closing metathesis (RCM) reaction to form a cross-linked ring (Blackwell et al., J. Org. Chem., 66: 5291-5302, 2001; Angew et al., Chem. Int. Ed. 37:3281, 1994).
  • RCM ring-closing metathesis
  • peptide stapling includes the joining of two (e.g., at least one pair of) double bond-containing side-chains, triple bond-containing side-chains, or double bond-containing and triple bond-containing side chain, which may be present in a polypeptide chain, using any number of reaction conditions and/or catalysts to facilitate such a reaction, to provide a singly “stapled” polypeptide.
  • multiply stapled polypeptides refers to those polypeptides containing more than one individual staple, and may contain two, three, or more independent staples of various spacings and compositions.
  • peptide stitching refers to multiple and tandem “stapling” events in a single polypeptide chain to provide a “stitched” (e.g., tandem or multiply stapled) polypeptide, in which two staples, for example, are linked to a common residue.
  • Peptide stitching is disclosed, e.g., in WO 2008121767 and in WO 2010/068684, which are both hereby incorporated by reference in their entireties.
  • staples, as used herein can retain the unsaturated bond or can be reduced (e.g., as mentioned below in the stitching paragraph description).
  • peptide staples While many peptide staples have all-hydrocarbon cross-links, other type of cross-links or staples can be used.
  • triazole-containing (e.g., 1, 4 triazole or 1, 5 triazole) crosslinks can be used (see, e.g., Kawamoto et al. 2012 Journal of Medicinal Chemistry 55:1137; WO 2010/060112).
  • Stapling the polypeptide herein by an all-hydrocarbon crosslink predisposed to have an alpha-helical secondary structure can improve stability and various pharmacokinetic properties.
  • Stabilized peptides herein include at least two internally cross-linked or stapled amino acids, wherein the at least two amino acids are separated, for example, by two (i.e., i, 1+3), three (i.e., i, 1+4), or six (i.e., i, i+7) amino acids. While at least two amino acids are required to support an internal cross-link (e.g., a staple), additional pairs of internally cross-linked amino acids can be included in a peptide, e.g., to support additional internal cross-links (e.g., staples). For example, peptides can include 1, 2, 3, 4, 5, or more staples.
  • FIG. 4 PANEL A shows example chemical structures of unnatural amino acids that can be used to generate various crosslinked compounds.
  • FIG. 4 PANEL B illustrates peptides with hydrocarbon crosslinks between i and i+3, i and i+4, and i and i+7 residues.
  • FIG. 4 PANEL C illustrates a staple walk along a peptide sequence.
  • FIG. 5 illustrates various peptide sequences with double and triple stapling strategies, and exemplary staple walks.
  • peptides can include three internally cross-linked or stitched amino acids, e.g., yielding two staples arising from a common origin.
  • a peptide stitch includes at least three internally cross-linked amino acids, wherein the middle of the three amino acids (referred to here as the core or central amino acid) forms an internal cross-link (between alpha carbons) with each of the two flanking modified amino acids.
  • the alpha carbon of the core amino acid has side chains that are internal cross-links to the alpha carbons of other amino acids in the peptide, which can be saturated or not saturated.
  • Amino acids cross-linked to the core amino acid can be separated from the core amino acid in either direction by 2, 3, or 6 amino acids (e.g., i, i ⁇ 3, i, i ⁇ 4, i, i ⁇ 7, i, i+3, i, i+4, i, i+7, where “i” is the core amino acid).
  • the number of amino acids on either side of the core e.g., between the core amino acid and an amino acid cross-linked to the core
  • peptides herein can include a combination of at least one (e.g., 1, 2, 3, 4, or 5) staple and at least one (e.g., 1, 2, 3, 4, or 5) stitch.
  • FIG. 6 illustrates example staple walks using various lengths of branched stitched moieties.
  • staple scanning refers to the synthesis of a library of stapled peptides whereby the location of the i and 1+3; i and 1+4; and i and i+7 single and multiple staple, or stitches, are positioned sequentially down the length of the peptide sequence, sampling all possible positions, to identify desired, effective, suitable, or optimal properties and activities for the stapled or stitched constructs. Examples of staple scanning methods are illustrated in the figures. Suitable tethers are described herein and in, e.g., US2005/0250680, PCT/US2008/058575, WO 2009/108261, and WO 2010/148335.
  • amino acid side chains suitable for use in the peptides disclosed herein are known in the art.
  • suitable amino acid side chains include methyl (as the alpha-amino acid side chain for alanine is methyl), 4-hydroxyphenylmethyl (as the alpha-amino acid side chain for tyrosine is 4-hydroxyphenylmethyl) and thiomethyl (as the alpha-amino acid side chain for cysteine is thiomethyl), etc.
  • a “terminally unsaturated amino acid side chain” refers to an amino acid side chain bearing a terminal unsaturated moiety, such as a substituted or unsubstituted, double bond (e.g., olefinic) or a triple bond (e.g., acetylenic), that participates in crosslinking reaction with other terminal unsaturated moieties in the polypeptide chain.
  • a “terminally unsaturated amino acid side chain” is a terminal olefinic amino acid side chain.
  • a “terminally unsaturated amino acid side chain” is a terminal acetylenic amino acid side chain.
  • the terminal moiety of a “terminally unsaturated amino acid side chain” is not further substituted.
  • an internal tether or cross-link can extend across the length of one helical turn (i.e., about 3.4 amino acids (i.e., i, i+3, or i, 1+4) or two helical turns (i.e., about 7 amino acids (i.e., i, i+7).
  • amino acids positioned at i and 1+3; i and 1+4; or i and 1+7 are ideal candidates for chemical modification and cross-linking.
  • a peptide has the sequence . . .
  • cross-links between Xaa 1 and Xaa 4 , or between Xaa 1 and Xaa 5 , or between Xaa 1 and Xaa 8 are useful as are cross-links between Xaa 2 and Xaa 5 , or between Xaa 2 and Xaa 6 , or between Xaa 2 and Xaa 9 , etc.
  • Polypeptides can include more than one crosslink within the polypeptide sequence to either further stabilize the sequence or facilitate the stabilization of longer polypeptide stretches. If the polypeptides are too long to be readily synthesized in one part, independently synthesized, cross-linked peptides can be conjoined by a technique called native chemical ligation (see, e.g., Bang, et al., J. Am. Chem. Soc. 126:1377). Alternately, large peptides are routinely synthesized using a convergent approach whereby fully protected fragments are specifically and sequentially reacted to form the full length desired product, after final deprotection, such as in the industrial synthesis of Fuzeon.
  • FIG. 7 is a schematic showing example chemical alterations that are employed to generate stapled antimicrobial peptide derivatives.
  • the invention features a modified polypeptide of Formula (I),
  • each Xaa is independently an amino acid
  • each R 1 and R 2 are independently H or a C 1 to C 10 alkyl, alkenyl, alkynyl, arylalkyl, cycloalkylalkyl, heteroarylalkyl, or heterocyclylalkyl;
  • each R 3 is independently alkylene, alkenylene or alkynylene (e.g., a C 6 , C 7 , or Cu alkenylene) substituted with 1-6 R 4 ;
  • each R 4 is independently —NH 3 or —OH, wherein each —NH 3 is optionally substituted;
  • a “corresponding parent (i.e., unmodified) non-internally cross-linked AMP” can be a wild-type AMP, or any of the variants of a wild-type AMP disclosed in the present document, except that such a variant would not include an internal cross-link as described herein.
  • R 3 can be, for example, a C 7 alkylene or alkenylene. Where it is an alkenylene there can one or more double bonds.
  • R 3 can be, for example, a C 11 , C 12 , or C 13 alkylene or alkenylene. Where it is an alkenylene, there can one or more double bonds.
  • R 3 can be, for example, a C 8 alkylene or alkenylene. Where it is an alkenylene, there can one or more double bonds.
  • the two alpha, alpha disubstituted stereocenters are both in the R configuration or S configuration (e.g., i, i+4 cross-link), or one stereocenter is R and the other is S (e.g., i, i+7 cross-link).
  • the C′ and C′′ disubstituted stereocenters can both be in the R configuration or they can both be in the S configuration, for example when x is 3.
  • x 6
  • the C′ disubstituted stereocenter is in the R configuration and the C′′ disubstituted stereocenter is in the S configuration or the C′ disubstituted stereocenter is in the S configuration and the C′′ disubstituted stereocenter is in the R configuration.
  • An R 3 double bond may be in the E or Z stereochemical configuration. Similar configurations are possible for the carbons in Formula II corresponding to C′ and C′′ in the formula depicted immediately above.
  • the polypeptide includes an amino acid sequence which, in addition to the amino acids side chains that are replaced by a cross-link, have 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, or 12 amino acid changes (e.g., conservative amino acid changes) in any of SEQ ID NOs: 1-13.
  • a compound has the Formula (II):
  • each v and w is independently 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20.
  • each w is independently an integer from 3-1000, for example 3-500, 3-200, 3-100, 3-50, 3-30, 3-20, or 3-10.
  • w is an integer from 3-10, for example 3-6, 3-8, 6-8, or 6-10.
  • w is 3.
  • w is 6.
  • each v is independently an integer from 1-1000, for example 1-500, 1-200, 1-100, 1-50, 1-30, 1-20, or 1-10.
  • v is 2.
  • At least one of R 1 and R 2 is alkyl that is unsubstituted or substituted with halo-. In another example, both R 1 and R 2 are independently alkyl that is unsubstituted or substituted with halo-. In some embodiments, at least one of R 1 and R 2 is methyl. In other embodiments, R 1 and R 2 are methyl.
  • x+y+z is at least 2 or at least 3. In other embodiments, x+y+z is 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10. In some embodiments, the sum of x+y+z is 3 or 6. In some embodiments, the sum of x+y+z is 3. In other embodiments, the sum of x+y+z is 6.
  • A, B, C, D, or E in a macrocycle or macrocycle precursor is independently selected.
  • a sequence represented by the formula [A] x when x is 3, encompasses embodiments where the amino acids are not identical, e.g. Gln-Asp-Ala, as well as embodiments where the amino acids are identical, e.g.
  • each compound can encompass compounds that are the same or different.
  • a compound can comprise compounds comprising different linker lengths or chemical compositions.
  • the compound comprises a secondary structure that is an ⁇ -helix where R 8 is —H, allowing for intrahelical hydrogen bonding.
  • at least one of A, B, C, D, or E is an ⁇ , ⁇ -disubstituted amino acid.
  • B is an ⁇ , ⁇ -disubstituted amino acid.
  • at least one of A, B, C, D, or E is 2-aminoisobutyric acid.
  • at least one of A, B, C, D, or E is
  • the length of the macrocycle-forming linker L as measured from a first C ⁇ to a second C ⁇ is selected to stabilize a desired secondary peptide structure, such as an ⁇ -helix formed by residues of the compound including, but not necessarily limited to, those between the first C ⁇ to a second C ⁇ .
  • a compound of Formula (II) has the Formula (IIa):
  • L is a macrocycle-forming linker of the formula -L 1 -L 2 -.
  • L 1 and L 2 are independently alkylene, alkenylene, alkynylene, heteroalkylene, cycloalkylene, heterocycloalkylene, arylene, heteroarylene, or [—R 4 —K—R 4 —] n , any of which is unsubstituted or substituted.
  • At least one of R 1 and R 2 is alkyl that is unsubstituted or substituted with halo-. In another example, both R 1 and R 2 are independently alkyl that is unsubstituted or substituted with halo-. In some embodiments, at least one of R 1 and R 2 is methyl. In other embodiments, R 1 and R 2 are methyl.
  • x+y+z is at least 2 or at least 3. In other embodiments, x+y+z is 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10.
  • Each occurrence of A, B, C, D, or E in a macrocycle or macrocycle precursor is independently selected.
  • a sequence represented by the formula [A] x when x is 3, encompasses embodiments where the amino acids are not identical, e.g. Gln-Asp-Ala as well as embodiments where the amino acids are identical, e.g. Gln-Gln-Gln. This applies for any value of x, y, or z in the indicated ranges.
  • each compound may encompass moieties which are the same or different.
  • a compound may comprise moieties comprising different linker lengths or chemical compositions.
  • the compound comprises a secondary structure that is a helix where R 8 is —H, allowing intrahelical hydrogen bonding.
  • at least one of A, B, C, D, or E is an ⁇ , ⁇ -disubstituted amino acid.
  • B is an ⁇ , ⁇ -disubstituted amino acid.
  • at least one of A, B, C, D, or E is 2-aminoisobutyric acid.
  • at least one of A, B, C, D or E is
  • the length of the macrocycle-forming linker L as measured from a first C ⁇ to a second C ⁇ is selected to stabilize a desired secondary peptide structure, such as a helix formed by residues of the compound including, but not necessarily limited to, those between the first C ⁇ to a second C ⁇ .
  • the compound of Formula (II) has the Formula (IIb):
  • the sum of x′+y′+z′ is 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10, for example 3 or 6, at least 2, or at least 3.
  • the compounds have the Formula (IIc):
  • At least one of R 1 and R 2 is alkyl that is unsubstituted or substituted with halo-. In another example, both R 1 and R 2 are independently alkyl that is unsubstituted or substituted with halo-. In some embodiments, at least one of R 1 and R 2 is methyl. In other embodiments, R 1 and R 2 are methyl.
  • x+y+z is at least 2 or at least 3. In other embodiments, x+y+z is 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10.
  • Each occurrence of A, B, C, D, or E in a macrocycle or macrocycle precursor is independently selected.
  • a sequence represented by the formula [A] x when x is 3, encompasses embodiments where the amino acids are not identical, e.g. Gln-Asp-Ala as well as embodiments where the amino acids are identical, e.g. Gln-Gln-Gln. This applies for any value of x, y, or z in the indicated ranges.
  • each of the first two amino acid represented by E comprises an uncharged side chain or a negatively charged side chain. In some embodiments, each of the first three amino acid represented by E comprises an uncharged side chain or a negatively charged side chain. In some embodiments, each of the first four amino acid represented by E comprises an uncharged side chain or a negatively charged side chain. In some embodiments, one or more or each of the amino acid that is 1+1, i+2, i+3, i+4, i+5, and/or i+6 with respect to E comprises an uncharged side chain or a negatively charged side chain.
  • the first C-terminal amino acid and/or the second C-terminal amino acid represented by E comprise a hydrophobic side chain.
  • the first C-terminal amino acid and/or the second C-terminal amino acid represented by E comprises a hydrophobic side chain, for example a small hydrophobic side chain.
  • the first C-terminal amino acid, the second C-terminal amino acid, and/or the third C-terminal amino acid represented by E comprise a hydrophobic side chain.
  • the first C-terminal amino acid, the second C-terminal amino acid, and/or the third C-terminal amino acid represented by E comprises a hydrophobic side chain, for example a small hydrophobic side chain.
  • one or more or each of the amino acid that is i+1, i+2, i+3, i+4, i+5, and/or i+6 with respect to E comprises an uncharged side chain or a negatively charged side chain.
  • each w is independently an integer from 1 to 1000.
  • the first amino acid represented by E comprises a small hydrophobic side chain.
  • w is between 2 and 1000.
  • the second amino acid represented by E comprises a small hydrophobic side chain.
  • w is between 3 and 1000.
  • the third amino acid represented by E comprises a small hydrophobic side chain.
  • the third amino acid represented by E comprises a small hydrophobic side chain.
  • w is between 4 and 1000.
  • w is between 5 and 1000.
  • w is between 6 and 1000.
  • w is between 7 and 1000.
  • w is between 8 and 1000.
  • the compound comprises a secondary structure that is a helix where R 8 is —H, allowing intrahelical hydrogen bonding.
  • at least one of A, B, C, D, or E is an ⁇ , ⁇ -disubstituted amino acid.
  • B is an ⁇ , ⁇ -disubstituted amino acid.
  • at least one of A, B, C, D, or E is 2-aminoisobutyric acid.
  • at least one of A, B, C, D, or E is
  • the length of the macrocycle-forming linker L as measured from a first C ⁇ to a second C ⁇ is selected to stabilize a desired secondary peptide structure, such as a helix formed by residues of the compound including, but not necessarily limited to, those between the first C ⁇ to a second C ⁇ .
  • L is a macrocycle-forming linker of the formula
  • L is a macrocycle-forming linker of the formula
  • Amino acids that are used in the formation of triazole crosslinkers are represented according to the legend indicated below. Stereochemistry at the ⁇ -position of each amino acid is S unless otherwise indicated.
  • azide amino acids the number of carbon atoms indicated refers to the number of methylene units between the ⁇ -carbon and the terminal azide.
  • alkyne amino acids the number of carbon atoms indicated is the number of methylene units between the ⁇ -position and the triazole moiety plus the two carbon atoms within the triazole group derived from the alkyne.
  • the linkage contains approximately 4 atoms to 12 atoms, approximately 6 atoms to 10 atoms, or approximately 8 atoms. Where the macrocycle-forming linker spans approximately 2 turns of the ⁇ -helix, the linkage contains approximately 7 atoms to 15 atoms, approximately 9 atoms to 13 atoms, or approximately 11 atoms. Where the macrocycle-forming linker spans approximately 3 turns of the ⁇ -helix, the linkage contains approximately 13 atoms to 21 atoms, approximately 15 atoms to 19 atoms, or approximately 17 atoms.
  • the linkage contains approximately 19 atoms to 27 atoms, approximately 21 atoms to 25 atoms, or approximately 23 atoms.
  • the linkage contains approximately 25 atoms to 33 atoms, approximately 27 atoms to 31 atoms, or approximately 29 atoms.
  • the resulting macrocycle forms a ring containing approximately 17 members to 25 members, approximately 19 members to 23 members, or approximately 21 members.
  • the resulting macrocycle forms a ring containing approximately 29 members to 37 members, approximately 31 members to 35 members, or approximately 33 members.
  • the resulting macrocycle forms a ring containing approximately 44 members to 52 members, approximately 46 members to 50 members, or approximately 48 members.
  • the macrocycle-forming linker spans approximately 4 turns of the ⁇ -helix
  • the resulting macrocycle forms a ring containing approximately 59 members to 67 members, approximately 61 members to 65 members, or approximately 63 members.
  • the resulting macrocycle spans approximately 5 turns of the ⁇ -helix, the resulting macrocycle forms a ring containing approximately 74 members to 82 members, approximately 76 members to 80 members, or approximately 78 members.
  • each v, w, v′, and w′ can be, independently, 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, or 50.
  • each v, w, v′, and w′ can be, independently, 0-1000, 0-500, 0-400, 0-300, 0-200, 0-100, 0-50, 0-40, 0-30, 0-25, 0-20, 0-15, 0-10, 0-8, 0-6, 0-5, 1-1000, 1-500, 1-400, 1-300, 1-200, 1-100, 1-50, 1-40, 1-30, 1-25, 1-20, 1-15, 1-10, 1-8, 1-6, 1-5, 3-1000, 3-500, 3-400, 3-300, 3-200, 3-100, 3-50, 3-40, 3-30, 3-25, 3-20, 3-15, 3-10, 3-8, 3-6, or 3-5.
  • the compound of Formula (II) is:
  • each R 1 and R 2 is independently —H, alkyl, alkenyl, alkynyl, arylalkyl, cycloalkyl, cycloalkylalkyl, heteroalkyl, or heterocycloalkyl, any of which is unsubstituted or substituted.
  • the compound comprises a structure of Formula (II) which is:
  • the compound of Formula (II) is:
  • each R 1 and R 2 is independently —H, alkyl, alkenyl, alkynyl, arylalkyl, cycloalkyl, cycloalkylalkyl, heteroalkyl, or heterocycloalkyl, unsubstituted or substituted with halo-.
  • the compound of Formula (II) is:
  • each R 1 ′ and R 2 ′ is independently an amino acid side chain.
  • the compound of Formula (II) is a compound of any of the formulas shown below:
  • AA represents any natural or non-natural amino acid side chain
  • “ ” is [D] v or [E] w as defined above
  • n is an integer from 0 to 20, 50, 100, 200, 300, 400 or 500.
  • the substituent “n” shown in the preceding paragraph is 0. In other embodiments, the substituent “n” shown in the preceding paragraph is less than 50, 40, 30, 20, 10, or 5.
  • [D] and/or [E] in the compound of Formula (II) are further modified in order to facilitate cellular uptake.
  • lipidating or PEGylating a compound facilitates cellular uptake, increases bioavailability, increases blood circulation, alters pharmacokinetics, decreases immunogenicity, and/or decreases the needed frequency of administration.
  • At least one of [D] and [E] in the compound of Formula (II) represents a moiety comprising an additional macrocycle-forming linker such that the compound comprises at least two macrocycle-forming linkers.
  • a compound comprises two macrocycle-forming linkers.
  • u is 2.
  • L is a macrocycle-forming linker of the formula -L 1 -L 2 -.
  • L 1 and L 2 are independently alkylene, alkenylene, alkynylene, heteroalkylene, cycloalkylene, heterocycloalkylene, arylene, heteroarylene, or [—R 4 —K—R 4 —] n , any of which is unsubstituted or substituted; each R 4 is alkylene, alkenylene, alkynylene, heteroalkylene, cycloalkylene, heterocycloalkylene, arylene, or heteroarylene, any of which is unsubstituted or substituted; each K is independently O, S, SO, SO 2 , CO, CO 2 , CONR 3 , OSO 2 NR 3 , NR 3q , CONR 3q , OCONR 3q , or OSO 2 NR 3q , wherein each R 3q is independently a point of attachment to R 1 or
  • L 1 and L 2 either alone or in combination, form a triazole or a thioether.
  • L 1 and L 2 either alone or in combination, do not form a triazole or a thioether.
  • the length of the macrocycle-forming linker L as measured from a first ⁇ -carbon to a second ⁇ -carbon is selected to stabilize a desired secondary peptide structure, such as a helix formed by residues of the compound including, but not necessarily limited to, those between the first ⁇ -carbon to a second ⁇ -carbon.
  • At least one of R 1 and R 2 is alkyl, unsubstituted or substituted with halo-.
  • both R 1 and R 2 are independently alkyl, unsubstituted or substituted with halo-. In some embodiments, at least one of R 1 and R 2 is methyl. In other embodiments, R 1 and R 2 are methyl.
  • x+y+z is at least 2 or at least 3. In other embodiments, x+y+z is 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10.
  • Each occurrence of A, B, C, D, or E in a macrocycle or macrocycle precursor is independently selected.
  • a sequence represented by the formula [A] x when x is 3, encompasses embodiments where the amino acids are not identical, e.g. Gln-Asp-Ala, as well as embodiments where the amino acids are identical, e.g. Gln-Gln-Gln. This applies for any value of x, y, or z in the indicated ranges.
  • each compound may encompass compounds which are the same or different.
  • a compound may comprise compounds comprising different linker lengths or chemical compositions.
  • the compound comprises a secondary structure that is a helix where R 8 is —H, allowing intrahelical hydrogen bonding.
  • at least one of A, B, C, D, or E is an ⁇ , ⁇ -disubstituted amino acid.
  • B is an ⁇ , ⁇ -disubstituted amino acid.
  • at least one of A, B, C, D, or E is 2-aminoisobutyric acid.
  • at least one of A, B, C, D or E is
  • w is from 1 to 1000.
  • the first amino acid represented by E comprises a small hydrophobic side chain.
  • w is from 2 to 1000.
  • the second amino acid represented by E comprises a small hydrophobic side chain.
  • w is from 3 to 1000.
  • the third amino acid represented by E can comprise a small hydrophobic side chain.
  • the third amino acid represented by E can comprise a small hydrophobic side chain.
  • w is from 4 and 1000.
  • w is from 5 and 1000.
  • w is from 6 and 1000.
  • w is from 7 and 1000.
  • w is from 8 and 1000.
  • w is an integer from 3-10, for example 3-6, 3-8, 6-8, or 6-10. In some embodiments, w is 3. In other embodiments, w is 6. In some embodiments, v is an integer from 1-10, for example 2-5. In some embodiments, v is 2. In some embodiments, v is 3.
  • each of the first two amino acid represented by E comprises an uncharged side chain or a negatively charged side chain. In some embodiments, each of the first three amino acid represented by E comprises an uncharged side chain or a negatively charged side chain. In some embodiments, each of the first four amino acid represented by E comprises an uncharged side chain or a negatively charged side chain.
  • the first C-terminal amino acid and/or the second C-terminal amino acid represented by E comprise a hydrophobic side chain.
  • the first C-terminal amino acid and/or the second C-terminal amino acid represented by E comprises a hydrophobic side chain, for example a small hydrophobic side chain.
  • the first C-terminal amino acid, the second C-terminal amino acid, and/or the third C-terminal amino acid represented by E comprise a hydrophobic side chain.
  • the first C-terminal amino acid, the second C-terminal amino acid, and/or the third C-terminal amino acid represented by E comprises a hydrophobic side chain, for example a small hydrophobic side chain.
  • one or more or each of the amino acid that is 1+1, 1+2, 1+3, 1+4, 1+5, and/or 1+6 with respect to a first E comprises an uncharged side chain or a negatively charged side chain.
  • each E is independently an amino acid selected from the group consisting of Ala (alanine), D-Ala (D-alanine), Aib ( ⁇ -aminoisobutyric acid), Sar (N-methyl glycine), and Ser (serine).
  • [D] and/or [E] in the compound of Formula I, Ia, Ib, or Ic are further modified in order to facilitate cellular uptake.
  • lipidating or PEGylating a compound facilitates cellular uptake, increases bioavailability, increases blood circulation, alters pharmacokinetics, decreases immunogenicity and/or decreases the needed frequency of administration.
  • At least one of [D] and [E] in the compound of Formula I, Ia, Ib, or Ic represents a moiety comprising an additional macrocycle-forming linker such that the compound comprises at least two macrocycle-forming linkers.
  • a compound comprises two macrocycle-forming linkers.
  • u is 2.
  • the invention provides compounds of Formula
  • the length of the macrocycle-forming linker [-L 1 -S-L 2 -S-L 3 -] as measured from a first ⁇ -carbon to a second ⁇ -carbon is selected to stabilize a desired secondary peptide structure, such as a helix (including, but not limited to a 3 10 helix or an ⁇ -helix) formed by residues of the compound including, but not necessarily limited to, those between the first ⁇ -carbon to a second ⁇ -carbon.
  • a desired secondary peptide structure such as a helix (including, but not limited to a 3 10 helix or an ⁇ -helix) formed by residues of the compound including, but not necessarily limited to, those between the first ⁇ -carbon to a second ⁇ -carbon.
  • the thiol moieties are the side chains of the amino acid residues L-cysteine, D-cysteine, ⁇ -methyl-L cysteine, ⁇ -methyl-D-cysteine, L-homocysteine, D-homocysteine, ⁇ -methyl-L-homocysteine, or ⁇ -methyl-D-homocysteine.
  • a bis-alkylating reagent is of the general formula X-L 2 -Y, wherein L 2 is a linker moiety and X and Y are leaving groups that are displaced by —SH moieties to form bonds with L 2 .
  • X and Y are halogens, such as I, Br, or Cl.
  • the invention provides compounds of Formula (IV) or (IVa):
  • L 1 and L 2 either alone or in combination, do not form a triazole or a thioether.
  • At least one of R 1 and R 2 is alkyl that is unsubstituted or substituted with halo-. In another example, both R 1 and R 2 are independently alkyl that is unsubstituted or substituted with halo-. In some embodiments, at least one of R 1 and R 2 is methyl. In other embodiments, R 1 and R 2 are methyl.
  • x+y+z is at least 1. In other embodiments, x+y+z is at least 2. In other embodiments, x+y+z is 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10.
  • Each occurrence of A, B, C, D, or E in a macrocycle or macrocycle precursor is independently selected.
  • a sequence represented by the formula [A] x when x is 3, encompasses embodiments where the amino acids are not identical, e.g. Gln-Asp-Ala, as well as embodiments where the amino acids are identical, e.g. Gln-Gln-Gln. This applies for any value of x, y, or z in the indicated ranges.
  • the compound comprises a secondary structure which is an ⁇ -helix and R 8 is —H, allowing intrahelical hydrogen bonding.
  • at least one of A, B, C, D or E is an ⁇ , ⁇ -disubstituted amino acid.
  • B is an ⁇ , ⁇ -disubstituted amino acid.
  • at least one of A, B, C, D or E is 2-aminoisobutyric acid.
  • at least one of A, B, C, D or E is
  • the length of the macrocycle-forming linker L as measured from a first C ⁇ to a second C ⁇ is selected to stabilize a desired secondary peptide structure, such as an ⁇ -helix formed by residues of the compound including, but not necessarily limited to, those between the first C ⁇ to a second C ⁇ .
  • the compound has the Formula (V) or Formula (Va):
  • the compound of the invention has the formula defined above, wherein:
  • the compound has the formula defined above wherein each L a and L b is independently a triazole-containing macrocycle-forming linker. In some embodiments, the compound has the formula defined above, wherein:
  • the compound has the formula defined above, wherein:
  • the compound has the formula defined above wherein one or both L a and L b is independently a bis-thioether-containing macrocycle-forming linker. In some embodiments, each L a and L b is independently a macrocycle-forming linker of the formula -L 1 -S-L 2 -S-L 3 -.
  • the compound has the formula defined above wherein one or both L a and L b is independently a bis-sulfone-containing macrocycle-forming linker. In some embodiments, each L a and L b is independently a macrocycle-forming linker of the formula -L 1 -SO 2 -L 2 -SO 2 -L 3 -.
  • the compound has the formula defined above wherein one or both L a and L b is independently a bis-sulfoxide-containing macrocycle-forming linker. In some embodiments, each L a and L b is independently a macrocycle-forming linker of the formula -L 1 -S(O)-L 2 -S(O)-L 3 -.
  • a compound of the invention comprises one or more secondary structures.
  • the compound comprises a secondary structure that is an ⁇ -helix.
  • the compound comprises a secondary structure that is a ⁇ -hairpin turn.
  • u a is 0. In some embodiments, u a is 0, and L b is a triazole-containing macrocycle-forming linker that crosslinks an ⁇ -helical secondary structure. In some embodiments, u a is 0, and L b is a hydrocarbon-containing macrocycle-forming linker that crosslinks an ⁇ -helical secondary structure.
  • u b is 0. In some embodiments, u b is 0, and L a is a triazole-containing macrocycle-forming linker that crosslinks an ⁇ -helical secondary structure. In some embodiments, u b is 0, and L a is a hydrocarbon-containing macrocycle-forming linker that crosslinks an ⁇ -helical secondary structure.
  • the compound comprises only ⁇ -helical secondary structures. In other embodiments, the compound comprises a combination of secondary structures, wherein the secondary structures are ⁇ -helical and ⁇ -hairpin structures.
  • L a and L b are a combination of hydrocarbon-, triazole, or sulfur-containing macrocycle-forming linkers. In some embodiments, the compound comprises L a and L b , wherein L a is a hydrocarbon-containing macrocycle-forming linker that crosslinks a ⁇ -hairpin structure, and L b is a triazole-containing macrocycle-forming linker that crosslinks an ⁇ -helical structure.
  • the compound comprises L a and L b , wherein L a is a hydrocarbon-containing macrocycle-forming linker that crosslinks an ⁇ -helical structure, and L b is a triazole-containing macrocycle-forming linker that crosslinks a ⁇ -hairpin structure. In some embodiments, the compound comprises L a and L b , wherein L a is a triazole-containing macrocycle-forming linker that crosslinks an ⁇ -helical structure, and L b is a hydrocarbon-containing macrocycle-forming linker that crosslinks a ⁇ -hairpin structure.
  • the compound comprises L a and L b , wherein L a is a triazole-containing macrocycle-forming linker that crosslinks a ⁇ -hairpin structure, and L b is a hydrocarbon-containing macrocycle-forming linker that crosslinks an ⁇ -helical structure.
  • u a is 1, and u b is 1.
  • u a is 1, u b is 1, L a is a triazole-containing macrocycle-forming linker that crosslinks an ⁇ -helical secondary structure, and L b is a triazole-containing macrocycle-forming linker that crosslinks an ⁇ -helical secondary structure.
  • u a is 1, u b is 1, L a is a triazole-containing macrocycle-forming linker that crosslinks an ⁇ -helical secondary structure, and L b is a triazole-containing macrocycle-forming linker that crosslinks a ⁇ -hairpin secondary structure.
  • ua is 1
  • u b is 1
  • L a is a triazole-containing macrocycle-forming linker that crosslinks a ⁇ -hairpin secondary structure
  • L b is a triazole-containing macrocycle-forming linker that crosslinks an ⁇ -helical secondary structure.
  • u a is 1, u b is 1, L a is a triazole-containing macrocycle-forming linker that crosslinks an ⁇ -helical secondary structure, and L b is a hydrocarbon-containing macrocycle-forming linker that crosslinks an ⁇ -helical structure.
  • u a is 1, u b is 1, L a is a triazole-containing macrocycle-forming linker that crosslinks an ⁇ -helical secondary structure, and L b is a hydrocarbon-containing macrocycle-forming linker that crosslinks a ⁇ -hairpin structure.
  • u a is 1, u b is 1, L a is a triazole-containing macrocycle-forming linker that crosslinks a ⁇ -hairpin secondary structure, and L b is a hydrocarbon-containing macrocycle-forming linker that crosslinks an ⁇ -helical structure.
  • u a is 1, u b is 1, L a is a hydrocarbon-containing macrocycle-forming linker that crosslinks an ⁇ -helical secondary structure, and L b is a triazole-containing macrocycle-forming linker that crosslinks an ⁇ -helical secondary structure.
  • u a is 1, u b is 1, L a is a hydrocarbon-containing macrocycle-forming linker that crosslinks an ⁇ -helical secondary structure, and L b is a triazole-containing macrocycle-forming linker that crosslinks a ⁇ -hairpin secondary structure.
  • u a is 1, u b is 1, L a is a hydrocarbon-containing macrocycle-forming linker that crosslinks a ⁇ -hairpin secondary structure, and L b is a triazole-containing macrocycle-forming linker that crosslinks an ⁇ -helical secondary structure.
  • u a is 1
  • u b is 1
  • L a is a triazole-containing macrocycle-forming linker that crosslinks an ⁇ -helical secondary structure
  • L b is a sulfur-containing macrocycle-forming linker.
  • u a is 1
  • u b is 1
  • L a is a sulfur-containing macrocycle-forming linker
  • L b is a triazole-containing macrocycle-forming linker with an ⁇ -helical secondary structure.
  • u a is 1
  • u b is 1
  • L a is a hydrocarbon-containing macrocycle-forming linker with an ⁇ -helical secondary structure
  • L b is a sulfur-containing macrocycle-forming linker.
  • u a is 1
  • u b is 1
  • L a is a sulfur-containing macrocycle-forming linker
  • L b is a hydrocarbon-containing macrocycle-forming linker with an ⁇ -helical secondary structure.
  • u a is 1
  • u b is 1
  • L a is a sulfur-containing macrocycle-forming linker
  • L b is a sulfur-containing macrocycle-forming linker
  • u a is 1, u b is 1, L a is a hydrocarbon-containing macrocycle-forming linker that crosslinks an ⁇ -helical structure, and L b is a hydrocarbon-containing macrocycle-forming linker that crosslinks an ⁇ -helical structure.
  • u a is 1, u b is 1, L a is a hydrocarbon-containing macrocycle-forming linker that crosslinks an ⁇ -helical structure, and L b is a hydrocarbon-containing macrocycle-forming linker that crosslinks a (3-hairpin structure.
  • u a is 1
  • u b is 1
  • L a is a hydrocarbon-containing macrocycle-forming linker that crosslinks a ⁇ -hairpin structure
  • L b is a hydrocarbon-containing macrocycle-forming linker that crosslinks an ⁇ -helical structure.
  • R b1 is H.
  • each v and w is 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20.
  • w is an integer from 3-1000, for example 3-500, 3-200, 3-100, 3-50, 3-30, 3-20, or 3-10.
  • the sum of x+y+z is 3 or 6.
  • the sum of x+y+z is 3.
  • the sum of x+y+z is 6.
  • any compounds are also meant to encompass compounds which differ only in the presence of one or more isotopically enriched atoms.
  • compounds having the described structures except for the replacement of a hydrogen by a deuterium or tritium, or the replacement of a carbon by 13 C- or 14 C-enriched carbon are within the scope of this disclosure.
  • the compounds disclosed herein can contain unnatural proportions of atomic isotopes at one or more of atoms that constitute such compounds.
  • the compounds can be radiolabeled with radioactive isotopes, such as for example tritium ( 3 H), iodine-125 ( 125 I) or carbon-14 ( 14 C).
  • radioactive isotopes such as for example tritium ( 3 H), iodine-125 ( 125 I) or carbon-14 ( 14 C).
  • one or more carbon atoms are replaced with a silicon atom. All isotopic variations of the compounds disclosed herein, whether radioactive or not, are contemplated herein.
  • a compound described herein can be at least 1% pure, at least 2% pure, at least 3% pure, at least 4% pure, at least 5% pure, at least 6% pure, at least 7% pure, at least 8% pure, at least 9% pure, at least 10% pure, at least 11% pure, at least 12% pure, at least 13% pure, at least 14% pure, at least 15% pure, at least 16% pure, at least 17% pure, at least 18% pure, at least 19% pure, at least 20% pure, at least 21% pure, at least 22% pure, at least 23% pure, at least 24% pure, at least 25% pure, at least 26% pure, at least 27% pure, at least 28% pure, at least 29% pure, at least 30% pure, at least 31% pure, at least 32% pure, at least 33% pure, at least 34% pure, at least 35% pure, at least 36% pure, at least 37% pure, at least 38% pure, at least 39% pure, at least 40% pure, at least 41% pure, at least 42% pure, at
  • Two or more peptides can share a degree of homology.
  • a pair of peptides can have, for example, up to about 20% pairwise homology, up to about 25% pairwise homology, up to about 30% pairwise homology, up to about 35% pairwise homology, up to about 40% pairwise homology, up to about 45% pairwise homology, up to about 50% pairwise homology, up to about 55% pairwise homology, up to about 60% pairwise homology, up to about 65% pairwise homology, up to about 70% pairwise homology, up to about 75% pairwise homology, up to about 80% pairwise homology, up to about 85% pairwise homology, up to about 90% pairwise homology, up to about 95% pairwise homology, up to about 96% pairwise homology, up to about 97% pairwise homology, up to about 98% pairwise homology, up to about 99% pairwise homology, up to about 99.5% pairwise homology, or up to about 99.9% pairwise homology.
  • a pair of peptides can have, for example, at least about 20% pairwise homology, at least about 25% pairwise homology, at least about 30% pairwise homology, at least about 35% pairwise homology, at least about 40% pairwise homology, at least about 45% pairwise homology, at least about 50% pairwise homology, at least about 55% pairwise homology, at least about 60% pairwise homology, at least about 65% pairwise homology, at least about 70% pairwise homology, at least about 75% pairwise homology, at least about 80% pairwise homology, at least about 85% pairwise homology, at least about 90% pairwise homology, at least about 95% pairwise homology, at least about 96% pairwise homology, at least about 97% pairwise homology, at least about 98% pairwise homology, at least about 99% pairwise homology, at least about 99.5% pairwise homology, at least about 99.9% pairwise homology.
  • Various methods and software programs can be used to determine the homology between two or more peptides, such as NCBI BLAST, Clustal W, MAFFT, Clustal Omega, AlignMe, Praline, or another suitable method or algorithm.
  • the compound comprises at least one helical motif, such as a 3 10 or an ⁇ -helix motif.
  • A, B and/or C in the compound of Formula I, II, or III include one or more helices.
  • helices include from 3 to 4 amino acid residues per turn.
  • the helix of the compound includes 1 to 5 turns and, therefore, 3 to 20 amino acid residues.
  • the helix includes 1 turn, 2 turns, 3 turns, 4 turns, or 5 turns.
  • the macrocycle-forming linker stabilizes a helix motif included within the compound.
  • the length of the macrocycle-forming linker L from a first ⁇ -carbon to a second ⁇ -carbon is selected to increase the stability of a helix.
  • the macrocycle-forming linker spans from 1 turn to 5 turns of the helix. In some embodiments, the macrocycle-forming linker spans approximately 1 turn, 2 turns, 3 turns, 4 turns, or 5 turns of the helix. In some embodiments, the length of the macrocycle-forming linker is approximately 5 ⁇ to 9 ⁇ per turn of the helix, or approximately 6 ⁇ to 8 ⁇ per turn of the helix.
  • the length is equal to approximately 5 carbon-carbon bonds to 13 carbon-carbon bonds, approximately 7 carbon-carbon bonds to 11 carbon-carbon bonds, or approximately 9 carbon-carbon bonds.
  • the length is equal to approximately 8 carbon-carbon bonds to 16 carbon-carbon bonds, approximately 10 carbon-carbon bonds to 14 carbon-carbon bonds, or approximately 12 carbon-carbon bonds.
  • the macrocycle-forming linker spans approximately 3 turns of a helix, the length is equal to approximately 14 carbon-carbon bonds to 22 carbon-carbon bonds, approximately 16 carbon-carbon bonds to 20 carbon-carbon bonds, or approximately 18 carbon-carbon bonds.
  • the length is equal to approximately 20 carbon-carbon bonds to 28 carbon-carbon bonds, approximately 22 carbon-carbon bonds to 26 carbon-carbon bonds, or approximately 24 carbon-carbon bonds.
  • the macrocycle-forming linker spans approximately 5 turns of a helix, the length is equal to approximately 26 carbon-carbon bonds to 34 carbon-carbon bonds, approximately 28 carbon-carbon bonds to 32 carbon-carbon bonds, or approximately 30 carbon-carbon bonds.
  • the linkage contains approximately 4 atoms to 12 atoms, approximately 6 atoms to 10 atoms, or approximately 8 atoms.
  • the linkage contains approximately 7 atoms to 15 atoms, approximately 9 atoms to 13 atoms, or approximately 11 atoms.
  • the linkage contains approximately 13 atoms to 21 atoms, approximately 15 atoms to 19 atoms, or approximately 17 atoms.
  • the linkage contains approximately 19 atoms to 27 atoms, approximately 21 atoms to 25 atoms, or approximately 23 atoms.
  • the linkage contains approximately 25 atoms to 33 atoms, approximately 27 atoms to 31 atoms, or approximately 29 atoms.
  • the resulting macrocycle forms a ring containing approximately 17 members to 25 members, approximately 19 members to 23 members, or approximately 21 members.
  • the macrocycle-forming linker spans approximately 2 turns of the helix, the resulting macrocycle forms a ring containing approximately 29 members to 37 members, approximately 31 members to 35 members, or approximately 33 members.
  • the resulting macrocycle forms a ring containing approximately 44 members to 52 members, approximately 46 members to 50 members, or approximately 48 members.
  • the resulting macrocycle forms a ring containing approximately 59 members to 67 members, approximately 61 members to 65 members, or approximately 63 members.
  • the macrocycle-forming linker spans approximately 5 turns of the helix, the resulting macrocycle forms a ring containing approximately 74 members to 82 members, approximately 76 members to 80 members, or approximately 78 members.
  • the stabilized peptides can have 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, or 30 amino acids.
  • Peptides can contain one or more asymmetric centers and thus occur as racemates and racemic mixtures, single enantiomers, individual diastereomers and diastereomeric mixtures and geometric isomers (e.g. Z or cis and E or trans) of any olefins present.
  • peptides disclosed herein can exist in particular geometric or stereoisomeric forms, including, for example, cis- and trans-isomers, R- and S-enantiomers, diastereomers, (D)-isomers, (L)-isomers, the racemic mixtures thereof, and other mixtures thereof.
  • Enantiomers can be free (e.g., substantially free) of their corresponding enantiomer, and/or may also be optically enriched. “Optically enriched,” as used herein, means that the compound is made up of a significantly greater proportion of one enantiomer. In certain embodiments substantially free means that a composition contains at least about 90% by weight of a preferred enantiomer.
  • the compound is made up of at least about 95%, 98%, or 99% by weight of a preferred enantiomer.
  • Preferred enantiomers may be isolated from racemic mixtures using techniques known in the art, including, but not limited to, for example, chiral high pressure liquid chromatography (HPLC) and the formation and crystallization of chiral salts or prepared by asymmetric syntheses (see, e.g., Jacques, et al, Enantiomers, Racemates and Resolutions (Wiley Interscience, New York, 1981); Wilen, S. H., et al., Tetrahedron 33:2725 (1977); Eliel, EX.
  • HPLC high pressure liquid chromatography
  • Peptides can also be represented in multiple tautomeric forms, in such instances, the invention expressly includes all tautomeric forms of the compounds described herein (e.g., isomers in equilibrium (e.g., keto-enol), wherein alkylation at multiple sites can yield regioisomers), regioisomers, and oxidation products of the compounds disclosed herein (the invention expressly includes all such reaction products). All such isomeric forms of such compounds are included as are all crystal forms.
  • tautomeric forms of the compounds described herein e.g., isomers in equilibrium (e.g., keto-enol), wherein alkylation at multiple sites can yield regioisomers), regioisomers, and oxidation products of the compounds disclosed herein (the invention expressly includes all such reaction products). All such isomeric forms of such compounds are included as are all crystal forms.
  • halo refers to any radical of fluorine, chlorine, bromine or iodine.
  • alkyl refers to a hydrocarbon chain that may be a straight chain or branched chain, containing the indicated number of carbon atoms. For example, C 1 -C 10 indicates that the group may have from 1 to 10 (inclusive) carbon atoms in it. In the absence of any numerical designation, “alkyl” is a chain (straight or branched) having 1 to 20 (inclusive) carbon atoms in it.
  • alkylene refers to a divalent alkyl (i.e., —R—).
  • alkenyl refers to a hydrocarbon chain that may be a straight chain or branched chain having one or more carbon-carbon double bonds in either Z or E geometric configurations.
  • the alkenyl moiety contains the indicated number of carbon atoms.
  • C 2 -C 10 indicates that the group may have from 2 to 10 (inclusive) carbon atoms in it.
  • lower alkenyl refers to a C 2 -C 8 alkenyl chain. In the absence of any numerical designation, “alkenyl” is a chain (straight or branched) having 2 to 20 (inclusive) carbon atoms in it.
  • alkynyl refers to a hydrocarbon chain that may be a straight chain or branched chain having one or more carbon-carbon triple bonds.
  • the alkynyl moiety contains the indicated number of carbon atoms.
  • C 2 -C 10 indicates that the group may have from 2 to 10 (inclusive) carbon atoms in it.
  • lower alkynyl refers to a C 2 -C 8 alkynyl chain.
  • alkynyl is a chain (straight or branched) having 2 to 20 (inclusive) carbon atoms in it.
  • aryl refers to a 6-carbon monocyclic or 10-carbon bicyclic aromatic ring system wherein 0, 1, 2, 3, 4, or 5 atoms of each ring may be substituted by a substituent. Examples of aryl groups include phenyl, naphthyl and the like.
  • arylalkyl or the term “aralkyl” refers to alkyl substituted with an aryl.
  • arylalkoxy refers to an alkoxy substituted with aryl.
  • cycloalkyl as employed herein includes saturated and partially unsaturated cyclic hydrocarbon groups having 3 to 12 carbons, preferably 3 to 8 carbons, and more preferably 3 to 6 carbons, wherein the cycloalkyl group additionally may be optionally substituted.
  • Preferred cycloalkyl groups include, without limitation, cyclopropyl, cyclobutyl, cyclopentyl, cyclopentenyl, cyclohexyl, cyclohexenyl, cyclohexadienyl, cycloheptyl, cycloheptadienyl, cycloheptatrienyl, cyclooctyl, cyclooctenyl, cyclooctadienyl, cyclooctatrienyl, and cyclooctynyl.
  • heteroaryl refers to an aromatic 5-8 membered monocyclic, 8-12 membered bicyclic, or 11-14 membered tricyclic ring system having 1-3 heteroatoms if monocyclic, 1-6 heteroatoms if bicyclic, or 1-9 heteroatoms if tricyclic, said heteroatoms selected from O, N, or S (e.g., carbon atoms and 1-3, 1-6, or 1-9 heteroatoms of N, O, or S if monocyclic, bicyclic, or tricyclic, respectively), wherein 0, 1, 2, 3, or 4 atoms of each ring may be substituted by a substituent.
  • heteroaryl groups include pyrrolyl, pyridyl, furyl or furanyl, imidazolyl, 1,2,3-triazolyl, 1,2,4-triazolyl, benzimidazolyl, pyridazyl, pyrimidyl, thiophenyl, quinolinyl, indolyl, thiazolyl, oxazolyl, isoxazolyl and the like.
  • heteroarylalkyl or the term “heteroaralkyl” refers to an alkyl substituted with a heteroaryl.
  • heteroarylalkoxy refers to an alkoxy substituted with heteroaryl.
  • heterocyclyl refers to a nonaromatic 5-8 membered monocyclic, 8-12 membered bicyclic, or 11-14 membered tricyclic ring system having 1-3 heteroatoms if monocyclic, 1-6 heteroatoms if bicyclic, or 1-9 heteroatoms if tricyclic, said heteroatoms selected from O, N, or S (e.g., carbon atoms and 1-3, 1-6, or 1-9 heteroatoms of N, O, or S if monocyclic, bicyclic, or tricyclic, respectively), wherein 0, 1, 2 or 3 atoms of each ring may be substituted by a substituent.
  • heterocyclyl groups include piperazinyl, pyrrolidinyl, dioxanyl, aziridinyl, oxiryl, thiiryl, morpholinyl, tetrahydrofuranyl, and the like.
  • substituted refers to a group “substituted” on an alkyl, cycloalkyl, aryl, heterocyclyl, or heteroaryl group at any atom of that group.
  • Suitable substituents include, without limitation, halo, hydroxy, mercapto, oxo, nitro, haloalkyl, alkyl, alkaryl, aryl, aralkyl, alkoxy, thioalkoxy, aryloxy, amino, alkoxycarbonyl, amido, carboxy, alkanesulfonyl, alkylcarbonyl, azido, and cyano groups.
  • the tether can include one or more of an ether, thioether, ester, amine, or amide moiety.
  • a naturally occurring amino acid side chain can be incorporated into the tether.
  • a tether can be coupled with a functional group such as the hydroxyl in serine, the thiol in cysteine, the primary amine in lysine, the acid in aspartate or glutamate, or the amide in asparagine or glutamine. Accordingly, it is possible to create a tether using naturally occurring amino acids rather than using a tether that is made by coupling two non-naturally occurring amino acids. It is also possible to use a single non-naturally occurring amino acid together with a naturally occurring amino acid.
  • the length of the tether can be varied. For instance, a shorter length of tether can be used where it is desirable to provide a relatively high degree of constraint on the secondary alpha-helical structure, whereas, in some instances, it is desirable to provide less constraint on the secondary alpha-helical structure, and thus a longer tether may be desired.
  • tethers spanning from amino acids i to i+3, i to i+4, and i to i+7 have been described in order to provide a tether that is primarily on a single face of the alpha helix, the tethers can be synthesized to span any combinations of numbers of amino acids.
  • alpha disubstituted amino acids are used in the polypeptide to improve the stability of the alpha helical secondary structure.
  • alpha disubstituted amino acids are not required, and instances using mono-alpha substituents (e.g., in the tethered amino acids) are also envisioned.
  • the stapled polypeptides can include a drug (e.g., an antibiotic; see below), a toxin, a derivative of polyethylene glycol; a second polypeptide; a carbohydrate, etc. Where a polymer or other agent is linked to the stapled polypeptide is can be desirable for the composition to be substantially homogeneous.
  • PEG polyethelene glycol
  • n 2 to 10,000 and X is H or a terminal modification, e.g., a C 1-4 alkyl; and Y is an amide, carbamate or urea linkage to an amine group (including but not limited to, the epsilon amine of lysine or the N-terminus) of the polypeptide. Y may also be a maleimide linkage to a thiol group (including but not limited to, the thiol group of cysteine).
  • Other methods for linking PEG to a polypeptide, directly or indirectly, are known to those of ordinary skill in the art.
  • the PEG can be linear or branched.
  • Various forms of PEG including various functionalized derivatives are commercially available.
  • PEG having degradable linkages in the backbone can be used.
  • PEG can be prepared with ester linkages that are subject to hydrolysis.
  • Conjugates having degradable PEG linkages are described, e.g., in WO 99/34833; WO 99/14259, and U.S. Pat. No. 6,348,558.
  • macromolecular polymer e.g., PEG
  • the linker is made up of from 1 to 20 amino acids linked by peptide bonds, wherein the amino acids are selected from the 20 naturally occurring amino acids. Some of these amino acids may be glycosylated, as is well understood by those in the art.
  • the 1 to 20 amino acids are selected from glycine, alanine, proline, asparagine, glutamine, and lysine.
  • a linker is made up of a majority of amino acids that are sterically unhindered, such as glycine and alanine. Non-peptide linkers are also possible.
  • lower alkyl e.g., C 1 -C 6
  • halogen e.g., Cl, Br
  • CN e.g., NH 2 , phenyl, etc.
  • U.S. Pat. No. 5,446,090 describes a bifunctional PEG linker and its use in forming conjugates having a peptide at each of the PEG linker termini.
  • peptides of this invention can be made by chemical synthesis methods, which are well known to the ordinarily skilled artisan. See, e.g., Fields et al., Chapter 3 in Synthetic Peptides: A User's Guide, ed. Grant, W. H. Freeman & Co., New York, N.Y., 1992, p. 77. Hence, peptides can be synthesized using the automated Merrifield techniques of solid phase synthesis with the ⁇ -NH 2 protected by either t-Boc or Fmoc chemistry using side chain protected amino acids on, e.g., an Applied Biosystems Peptide SynthesizerTM Model 430A or 431.
  • SPPS solid phase peptide synthesis
  • the C-terminal amino acid is attached to a cross-linked polystyrene resin via an acid labile bond with a linker molecule.
  • This resin is insoluble in the solvents used for synthesis, making it relatively simple and fast to wash away excess reagents and by-products.
  • the N-terminus is protected with the Fmoc group, which is stable in acid, but removable by base. Any side chain functional groups are protected with base stable, acid labile groups.
  • peptides could be made by conjoining individual synthetic peptides using native chemical ligation. Alternatively, the longer synthetic peptides can be synthesized by well-known recombinant DNA techniques. Such techniques are provided in well-known standard manuals with detailed protocols.
  • a gene encoding a peptide of this invention the amino acid sequence is reverse translated to obtain a nucleic acid sequence encoding the amino acid sequence, preferably with codons that are optimum for the organism in which the gene is to be expressed.
  • a synthetic gene is made, typically by synthesizing oligonucleotides which encode the peptide and any regulatory elements, if necessary.
  • the synthetic gene is inserted in a suitable cloning vector and transfected into a host cell.
  • the peptide is then expressed under suitable conditions appropriate for the selected expression system and host.
  • the peptide is purified and characterized by standard methods.
  • the peptides can be made in a high-throughput, combinatorial fashion, e.g., using a high-throughput multiple channel combinatorial synthesizer available from Advanced Chemtech.
  • Peptide bonds can be replaced, e.g., to increase physiological stability of the peptide, by: a retro-inverso bonds (C(O)—NH); a reduced amide bond (NH—CH 2 ); a thiomethylene bond (S—CH 2 or CH 2 —S); an oxomethylene bond (O—CH 2 or CH 2 —O); an ethylene bond (CH 2 —CH 2 ); a thioamide bond (C(S)—NH); a trans-olefin bond (CH ⁇ CH); a fluoro substituted trans-olefin bond (CF ⁇ CH); a ketomethylene bond (C(O)—CHR) or CHR—C(O) wherein R is H or CH 3 ; and a fluoro-ketomethylene bond (C(O)—CFR or CFR—C(O) wherein R is H or F or CH 3 .
  • C(O)—NH retro-inverso bonds
  • a reduced amide bond NH—CH
  • polypeptides can be further modified by: acetylation, amidation, biotinylation, cinnamoylation, farnesylation, fluoresceination, formylation, myristoylation, palmitoylation, phosphorylation (Ser, Tyr or Thr), stearoylation, succinylation and sulfurylation.
  • peptides can be conjugated to, e.g., polyethylene glycol (PEG); alkyl groups (e.g., C 1 -C 20 straight or branched alkyl groups); fatty acid radicals; and combinations thereof.
  • ⁇ , ⁇ -Disubstituted non-natural amino acids containing olefinic side chains of varying length can be synthesized by known methods (Williams et al. J. Am. Chem. Soc., 113:9276, 1991; Schafmeister et al., J. Am. Chem Soc., 122:5891, 2000; and Bird et al., Methods Enzymol., 446:369, 2008; Bird et al, Current Protocols in Chemical Biology, 2011).
  • peptides where an i linked to i+7 staple is used either: a) one S 8 amino acid and one R 8 is used or b) one S 8 amino acid and one R 8 amino acid is used.
  • R 8 is synthesized using the same route, except that the starting chiral auxiliary confers the R-alkyl-stereoisomer. Also, 8-iodooctene is used in place of 5-iodopentene.
  • Inhibitors are synthesized on a solid support using solid-phase peptide synthesis (SPPS) on MBHA resin (see, e.g., WO 2010/148335).
  • SPPS solid-phase peptide synthesis
  • Fmoc-protected ⁇ -amino acids other than the olefinic amino acids Fmoc-S 5 —OH, Fmoc-R 8 —OH, Fmoc-R 8 —OH, Fmoc-S 8 —OH and Fmoc-R 8 —OH
  • Rink Amide MBHA are commercially available from, e.g., Novabiochem (San Diego, Calif.).
  • DMF Dimethylformamide
  • NMP N-methyl-2-pyrrolidinone
  • DIEA N,N-diisopropylethylamine
  • TFA trifluoroacetic acid
  • DCE 1,2-dichloroethane
  • FITC fluorescein isothiocyanate
  • piperidine is commercially available from, e.g., Sigma-Aldrich. Olefinic amino acid synthesis is reported in the art (see, e.g., Williams et al., Org. Synth., 80:31, 2003).
  • the compounds of this invention may be modified by appending appropriate functionalities to enhance selective biological properties (including, e.g., hydrophobicity and/or the position/occurrence of hydrophobic patches).
  • appropriate functionalities including, e.g., hydrophobicity and/or the position/occurrence of hydrophobic patches.
  • modifications are known in the art and include those which increase biological penetration into a given biological compartment (e.g., blood, lymphatic system, central nervous system), increase oral availability, increase solubility to allow administration by injection, alter metabolism and alter rate of excretion.
  • An antimicrobial peptide selective for microbial versus mammalian membranes may, e.g., possess a MIC for one or more microbes more than about 1.5-fold lower, more than about 2-fold lower, more than about 2.5-fold lower, more than about 3-fold lower, more than about 4-fold lower, more than about 5-fold lower, more than about 6-fold lower, more than about 7-fold lower, more than about 8-fold lower, more than about 9-fold lower, more than about 10-fold lower, more than about 15-fold lower, or more than about 20-fold lower than the MIC of the corresponding parent (i.e., unmodified) non-internally cross-linked peptide for the same one or more microbes.
  • An antimicrobial peptide selective for microbial versus mammalian membranes can have a MIC of, for example, about 1 ⁇ g/ml, about 2 ⁇ g/ml, about 3 ⁇ g/ml, about 4 ⁇ g/ml, about 5 ⁇ g/ml, about 6 ⁇ g/ml, about 7 ⁇ g/ml, about 8 ⁇ g/ml, about 9 ⁇ g/ml, about 10 ⁇ g/ml, about 12 ⁇ g/ml, about 14 ⁇ g/ml, about 16 ⁇ g/ml, about 18 ⁇ g/ml, about 20 ⁇ g/ml, about 22 ⁇ g/ml, about 24 ⁇ g/ml, about 26 ⁇ g/ml, about 28 ⁇ g/ml, or about 30 ⁇ g/ml.
  • an antimicrobial peptide selective for microbial versus mammalian membranes may lyse, e.g., less than about 50%, less than about 40%, less than about 30%, less than about 25%, less than about 20%, less than about 15%, less than about 10%, less than about 5%, less than about 2.5%, less than about 2%, or less than about 1% of red blood cells (RBCs) in a RBC hemolytic activity assay when administered at its MIC for one or more microbes.
  • RBCs red blood cells
  • An antimicrobial peptide selective for microbial versus mammalian membranes may lyse, e.g., less than about 50%, less than about 40%, less than about 30%, less than about 25%, less than about 20%, less than about 15%, less than about 10%, less than about 5%, less than about 2.5%, less than about 2%, or less than about 1% of red blood cells (RBCs) in a RBC hemolytic activity assay when administered at a concentration, e.g., greater than or approximately equal to 1.5-fold, 2-fold, 2.5-fold, 3-fold, 4-fold, 5-fold, 6-fold, 7-fold, 8-fold, 9-fold, or 10-fold its MIC for one or more microbes.
  • RBCs red blood cells
  • the RBC hemolytic activity of an antimicrobial peptide selective for microbial versus mammalian membranes may be less than, approximately equal to, less than 1.5-fold greater, less than 2-fold greater, less than 2.5-fold greater, less than 3-fold greater, less than 4-fold greater, less than 5-fold greater, less than 6-fold greater, less than 7-fold greater, less than 8-fold greater, less than 9-fold greater, or less than 10-fold greater than the RBC hemolytic activity of the corresponding parent (i.e., unmodified) non-internally cross-linked peptide.
  • Hydrophobic patches within a peptide or protein may be identified using techniques generally known in the art, including, e.g., computational prediction/simulation (e.g., using ExPASy ProtScale, Scooby-domain prediction, PSIPRED, hydrophobic cluster analysis, Kyte Doolittle plotting, and/or SPLIT) and/or experimental determination (e.g., using techniques involving NMR spectroscopy, electron microscopy, homology modeling, small-angle X-ray and/or neutron scattering (SAXS/SANS), and/or X-ray crystallography) of the structure of the peptide or protein.
  • computational prediction/simulation e.g., using ExPASy ProtScale, Scooby-domain prediction, PSIPRED, hydrophobic cluster analysis, Kyte Doolittle plotting, and/or SPLIT
  • experimental determination e.g., using techniques involving NMR spectroscopy, electron microscopy, homology modeling, small-angle X
  • Pharmaceutically acceptable salts of the compounds of this invention include those derived from pharmaceutically acceptable inorganic and organic acids and bases.
  • suitable acid salts include acetate, adipate, benzoate, benzenesulfonate, butyrate, citrate, digluconate, dodecylsulfate, formate, fumarate, glycolate, hemisulfate, heptanoate, hexanoate, hydrochloride, hydrobromide, hydroiodide, lactate, maleate, malonate, methanesulfonate, 2-naphthalenesulfonate, nicotinate, nitrate, palmoate, phosphate, picrate, pivalate, propionate, salicylate, succinate, sulfate, tartrate, tosylate, trifluoromethylsulfonate, and undecanoate.
  • Salts derived from appropriate bases include alkali metal (e.g., sodium), alkaline earth metal (e.g., magnesium), ammonium and N-(alkyl)4+ salts.
  • alkali metal e.g., sodium
  • alkaline earth metal e.g., magnesium
  • ammonium e.g., sodium
  • N-(alkyl)4+ salts e.g., sodium
  • This invention also envisions the quaternization of any basic nitrogen-containing groups of the compounds disclosed herein. Water or oil-soluble or dispersible products may be obtained by such quaternization.
  • the peptides are substantially free of non-stapled peptide contaminants or are isolated.
  • Methods for purifying peptides include, for example, synthesizing the peptide on a solid-phase support. Following cyclization, the solid-phase support may be isolated and suspended in a solution of a solvent such as DMSO, DMSO/dichloromethane mixture, or DMSO/NMP mixture.
  • a solvent such as DMSO, DMSO/dichloromethane mixture, or DMSO/NMP mixture.
  • the DMSO/dichloromethane or DMSO/NMP mixture may comprise about 30%, 40%, 50%, or 60% DMSO. In a specific embodiment, a 50%/50% DMSO/NMP solution is used.
  • the solution may be incubated for a period of 1, 6, 12 or 24 hours, following which the resin may be washed, for example with dichloromethane or NMP. In one embodiment, the resin is washed with NMP. Shaking and bubbling an inert gas into the solution may be performed.
  • Properties of the cross-linked polypeptides of the invention can be assayed, for example, using the methods described below.
  • Circular dichroism (CD) spectra are obtained on a spectropolarimeter (e.g., Jasco J-710, Aviv) using standard measurement parameters (e.g. temperature, 20° C.; wavelength, 190-260 nm; step resolution, 0.5 nm; speed, 20 nm/sec; accumulations, 10; response, 1 sec; bandwidth, 1 nm; path length, 0.1 cm).
  • the ⁇ -helical content of each peptide is calculated by dividing the mean residue ellipticity by the reported value for a model helical decapeptide (Yang et al., Methods Enzymol. 130:208 (1986)).
  • Cross-linked or the unmodified template peptides are dissolved in distilled H 2 O or other buffer or solvent (e.g. at a final concentration of 50 ⁇ M) and Tm is determined by measuring the change in ellipticity over a temperature range (e.g. 4 to 95° C.) on a spectropolarimeter (e.g., Jasco J-710, Aviv) using standard parameters (e.g. wavelength 222 nm; step resolution, 0.5 nm; speed, 20 nm/sec; accumulations, 10; response, 1 sec; bandwidth, 1 nm; temperature increase rate: 1° C./min; path length, 0.1 cm).
  • standard parameters e.g. wavelength 222 nm; step resolution, 0.5 nm; speed, 20 nm/sec; accumulations, 10; response, 1 sec; bandwidth, 1 nm; temperature increase rate: 1° C./min; path length, 0.1 cm).
  • the amide bond of the peptide backbone is susceptible to hydrolysis by proteases, thereby rendering peptidic compounds vulnerable to rapid degradation in vivo. Peptide helix formation, however, typically buries and/or twists and/or shields the amide backbone and therefore may prevent or substantially retard proteolytic cleavage.
  • the peptidomimetic macrocycles of the present invention may be subjected to in vitro enzymatic proteolysis (e.g. trypsin, chymotrypsin, pepsin) to assess for any change in degradation rate compared to a corresponding uncrosslinked or alternatively stapled polypeptide.
  • the peptidomimetic macrocycle and a corresponding uncrosslinked polypeptide are incubated with trypsin agarose and the reactions quenched at various time points by centrifugation and subsequent HPLC injection to quantitate the residual substrate by ultraviolet absorption at 280 nm.
  • the peptidomimetic macrocycle and peptidomimetic precursor (5 mcg) are incubated with trypsin agarose (Pierce) (S/E ⁇ 125) for 0, 10, 20, 90, and 180 minutes. Reactions are quenched by tabletop centrifugation at high speed; remaining substrate in the isolated supernatant is quantified by HPLC-based peak detection at 280 nm.
  • the proteolytic reaction displays first order kinetics and the rate constant, k, is determined from a plot of ln[S] versus time.
  • Peptidomimetic macrocycles and/or a corresponding uncrosslinked polypeptide can be each incubated with fresh mouse, rat and/or human serum (e.g. 1-2 mL) at 37° C. for, e.g., 0, 1, 2, 4, 8, and 24 hours.
  • Samples of differing macrocycle concentration may be prepared by serial dilution with serum.
  • the samples are extracted, for example, by transferring 100 ⁇ L of sera to 2 ml centrifuge tubes followed by the addition of 10 ⁇ L of 50% formic acid and 500 ⁇ L acetonitrile and centrifugation at 14,000 RPM for 10 min at 4+/ ⁇ 2° C.
  • the supernatants are then transferred to fresh 2 ml tubes and evaporated on Turbovap under N 2 ⁇ 10 psi, 37° C.
  • the samples are reconstituted in 100 ⁇ L of 50:50 acetonitrile:water and submitted to LC-MS/MS analysis. Equivalent or similar procedures for testing ex vivo stability are known and may be used to determine stability of macrocycles in serum.
  • a key benefit of peptide stapling is the translation of in vitro protease resistance into markedly improved pharmacokinetics in vivo.
  • Structurally-stabilized I-TAMPS with potent and selective antimicrobial activity are screened for protease stability in vivo, e.g., using previously published methods (see, e.g., Bird et al, PNAS, 2010).
  • One or more of the stabilized peptides disclosed herein can be formulated for use as or in pharmaceutical compositions.
  • Such compositions can be formulated or adapted for administration to a subject via any route, e.g., any route approved by the Food and Drug Administration (FDA). Exemplary methods are described in the FDA Data Standards Manual (DSM).
  • FDA Food and Drug Administration
  • compositions of this invention may be administered, e.g., orally, parenterally, by inhalation spray or nebulizer, topically, rectally, nasally, buccally, vaginally, via an implanted reservoir, by injection (e.g., intravenously, intra-arterially, subdermally, intraperitoneally, intramuscularly, and/or subcutaneously), in an ophthalmic preparation, or via transmucosal administration. Suitable dosages may range from about 0.001 to about 100 mg/kg of body weight, or according to the requirements of the particular drug.
  • the pharmaceutical compositions of this invention may contain any conventional non-toxic pharmaceutically-acceptable carriers, adjuvants or vehicles.
  • the pH of the formulation may be adjusted with pharmaceutically acceptable acids, bases or buffers to enhance the stability of the formulated compound or its delivery form.
  • parenteral as used herein includes subcutaneous, intracutaneous, intravenous, intramuscular, intraarticular, intra-arterial, intrasynovial, intrasternal, intrathecal, intralesional and intracranial injection or infusion techniques.
  • the present invention may be administered according to any of the methods as described in the FDA DSM.
  • the compounds of this invention including the compounds of formulae described herein, are defined to include pharmaceutically acceptable derivatives or prodrugs thereof.
  • a “pharmaceutically acceptable derivative or prodrug” means any pharmaceutically acceptable salt, ester, salt of an ester, or other derivative of a compound or agent disclosed herein which, upon administration to a recipient, is capable of providing (directly or indirectly) a compound of this invention.
  • Particularly favored derivatives and prodrugs are those that increase the bioavailability of the compounds of this invention when such compounds are administered to a mammal (e.g., by allowing an orally administered compound to be more readily absorbed into the blood) or which enhance delivery of the parent compound to a biological compartment (e.g., the brain or lymphatic system) relative to the parent species.
  • Preferred prodrugs include derivatives where a group which enhances aqueous solubility or active transport through the gut membrane is appended to the structure of formulae described herein.
  • compositions can include an effective amount of one or more stabilized peptides.
  • effective amount and “effective to treat,” as used herein, refer to an amount or a concentration of one or more compounds or a pharmaceutical composition described herein utilized for a period of time (including acute or chronic administration and periodic or continuous administration) that is effective within the context of its administration for causing an intended effect or physiological outcome (e.g., treatment of infection).
  • compositions of this invention will be administered from about 1 to about 6 times per day or alternatively, as a continuous infusion. Such administration can be used as a chronic or acute therapy.
  • amount of active ingredient that may be combined with the carrier materials to produce a single dosage form will vary depending upon the host treated and the particular mode of administration.
  • a typical preparation will contain from about 5% to about 95% active compound (w/w). Alternatively, such preparations contain from about 20% to about 80% active compound.
  • Dosing can be determined using various techniques.
  • the selected dosage level can depend upon a variety of factors including the activity of the particular compound employed, the route of administration, the time of administration, the rate of excretion or metabolism of the particular compound being employed, the duration of the treatment, other drugs, compounds and/or materials used in combination with the particular compound employed, the age, sex, weight, condition, general health and prior medical history of the patient being treated, and like factors well known in the medical arts.
  • the dosage values can also vary with the severity of the condition to be alleviated. For any particular subject, specific dosage regimens can be adjusted over time according to the individual need and the professional judgment of the person administering or supervising the administration of the compositions.
  • a suitable daily dose of a compound of the disclosure can be that amount of the compound which is the lowest dose effective to produce a therapeutic effect.
  • Such an effective dose will generally depend upon the factors described above.
  • the precise time of administration and amount of any particular compound that will yield the most effective treatment in a given patient will depend upon the activity, pharmacokinetics, and bioavailability of a particular compound, physiological condition of the patient (including age, sex, disease type and stage, general physical condition, responsiveness to a given dosage and type of medication), route of administration, and the like.
  • a physician or veterinarian can prescribe the effective amount of the pharmaceutical composition required.
  • the physician or veterinarian could start doses of the compounds of the disclosure employed in the pharmaceutical composition at levels lower than that required in order to achieve the desired therapeutic effect and gradually increase the dosage until the desired effect is achieved.
  • compositions described herein can be in unit dosage forms suitable for single administration of precise dosages.
  • the formulation is divided into unit doses containing appropriate quantities of one or more compounds.
  • the unit dosage can be in the form of a package containing discrete quantities of the formulation.
  • Non-limiting examples are liquids in vials or ampoules.
  • Aqueous suspension compositions can be packaged in single-dose non-reclosable containers. Multiple-dose reclosable containers can be used, for example, in combination with a preservative.
  • Formulations for parenteral injection can be presented in unit dosage form, for example, in ampoules, or in multi dose containers with a preservative.
  • a compound described herein can be present in a composition in a range of from about 1 mg to about 2000 mg; from about 100 mg to about 2000 mg; from about 10 mg to about 2000 mg; from about 5 mg to about 1000 mg, from about 10 mg to about 500 mg, from about 50 mg to about 250 mg, from about 100 mg to about 200 mg, from about 1 mg to about 50 mg, from about 50 mg to about 100 mg, from about 100 mg to about 150 mg, from about 150 mg to about 200 mg, from about 200 mg to about 250 mg, from about 250 mg to about 300 mg, from about 300 mg to about 350 mg, from about 350 mg to about 400 mg, from about 400 mg to about 450 mg, from about 450 mg to about 500 mg, from about 500 mg to about 550 mg, from about 550 mg to about 600 mg, from about 600 mg to about 650 mg, from about 650 mg to about 700 mg, from about 700 mg to about 750 mg, from about 750 mg to about 800 mg, from about 800 mg to about 850 mg, from about 850 mg to about 900 mg, from
  • a compound described herein can be present in a composition in an amount of about 1 mg, about 2 mg, about 3 mg, about 4 mg, about 5 mg, about 10 mg, about 15 mg, about 20 mg, about 25 mg, about 30 mg, about 35 mg, about 40 mg, about 45 mg, about 50 mg, about 55 mg, about 60 mg, about 65 mg, about 70 mg, about 75 mg, about 80 mg, about 85 mg, about 90 mg, about 95 mg, about 100 mg, about 125 mg, about 150 mg, about 175 mg, about 200 mg, about 250 mg, about 300 mg, about 350 mg, about 400 mg, about 450 mg, about 500 mg, about 550 mg, about 600 mg, about 650 mg, about 700 mg, about 750 mg, about 800 mg, about 850 mg, about 900 mg, about 950 mg, about 1000 mg, about 1050 mg, about 1100 mg, about 1150 mg, about 1200 mg, about 1250 mg, about 1300 mg, about 1350 mg, about 1400 mg, about 1450 mg, about 1500 mg, about 1550 mg
  • a dose can be expressed in terms of an amount of the drug divided by the mass of the subject, for example, milligrams of drug per kilograms of subject body mass.
  • a compound is administered in an amount ranging from about 5 mg/kg to about 50 mg/kg, 250 mg/kg to about 2000 mg/kg, about 10 mg/kg to about 800 mg/kg, about 50 mg/kg to about 400 mg/kg, about 100 mg/kg to about 300 mg/kg, or about 150 mg/kg to about 200 mg/kg.
  • Dosage can be based on the amount of the compound per kg body weight of the patient.
  • the dosage of the subject disclosure can be determined by reference to the plasma concentrations of the compound.
  • the maximum plasma concentration (C max ) and the area under the plasma concentration-time curve from time 0 to infinity (AUC) can be used.
  • the subject is a human subject and the amount of the compound administered is 0.01-100 mg per kilogram body weight of the human subject.
  • the amount of the compound administered is about 0.01-50 mg/kg, about 0.01-20 mg/kg, about 0.01-10 mg/kg, about 0.1-100 mg/kg, about 0.1-50 mg/kg, about 0.1-20 mg/kg, about 0.1-10 mg/kg, about 0.5-100 mg/kg, about 0.5-50 mg/kg, about 0.5-20 mg/kg, about 0.5-10 mg/kg, about 1-100 mg/kg, about 1-50 mg/kg, about 1-20 mg/kg, about 1-10 mg/kg body weight of the human subject.
  • about 0.5 mg-10 mg of the compound per kilogram body weight of the human subject is administered.
  • the amount of the compound administered is about 0.16 mg, about 0.32 mg, about 0.64 mg, about 1.28 mg, about 3.56 mg, about 7.12 mg, about 14.24 mg, or about 20 mg per kilogram body weight of the human subject.
  • the amount of the compound administered is about 0.16 mg, about 0.32 mg, about 0.64 mg, about 1.28 mg, about 3.56 mg, about 7.12 mg, or about 14.24 mg per kilogram body weight of the human subject.
  • the amount of the compound administered is about 0.16 mg per kilogram body weight of the human subject.
  • the amount of the compound administered is about 0.32 mg per kilogram body weight of the human subject.
  • the amount of the compound administered is about 0.64 mg per kilogram body weight of the human subject. In some examples the amount of the compound administered is about 1.28 mg per kilogram body weight of the human subject. In some examples the amount of the compound administered is about 3.56 mg per kilogram body weight of the human subject. In some examples the amount of the compound administered is about 7.12 mg per kilogram body weight of the human subject. In some examples the amount of the compound administered is about 14.24 mg per kilogram body weight of the human subject.
  • about 0.5- about 20 mg or about 0.5- about 10 mg of the compound per kilogram body weight of the human subject is administered two times a week.
  • about 0.5- about 1 mg, about 0.5- about 5 mg, about 0.5- about 10 mg, about 0.5- about 15 mg, about 1- about 5 mg, about 1- about 10 mg, about 1- about 15 mg, about 1- about 20 mg, about 5- about 10 mg, about 1- about 15 mg, about 5- about 20 mg, about 10- about 15 mg, about 10- about 20 mg, or about 15- about 20 mg of the compound per kilogram body weight of the human subject is administered about twice a week.
  • the amount of the compound administered is about 1.25 mg, about 2.5 mg, about 5 mg, about 10 mg, or about 20 mg per kilogram body weight of the human subject and the compound is administered two times a week. In some examples, the amount of the compound administered is about 1.25 mg, about 2.5 mg, about 5 mg or about 10 mg per kilogram body weight of the human subject.
  • the compound can be administered once a week, two times a week, three, four, five, six, or seven times a week. The compound can be administered once every 3 weeks.
  • the compound is administered gradually over a period of time.
  • a desired amount of compound can, for example can be administered gradually over a period of from about 0.1 h-24 h.
  • a desired amount of compound is administered gradually over a period of 0.1 h, 0.5 h, 1 h, 1.5 h, 2 h, 2.5 h, 3 h, 3.5 h, 4 h, 4.5 h, 5 h, 6 h, 7 h, 8 h, 9 h, 10 h, 11 h, 12 h, 13 h, 14 h, 15 h, 16 h, 17 h, 18 h, 19 h, 20 h, 21 h, 22 h, 23 h, or 24 h.
  • a desired amount of compound is administered gradually over a period of 0.25-12 h, for example over a period of 0.25-1 h, 0.25-2 h, 0.25-3 h, 0.25-4 h, 0.25-6 h, 0.25-8 h, or 0.25-10 h. In some examples, a desired amount of compound is administered gradually over a period of 0.25-2 h. In some examples, a desired amount of compound is administered gradually over a period of 0.25-1 h.
  • a desired amount of compound is administered gradually over a period of 0.25 h, 0.3 h, 0.4 h, 0.5 h, 0.6 h, 0.7 h, 0.8 h, 0.9 h, 1.0 h, 1.1 h, 1.2 h, 1.3 h, 1.4 h, 1.5 h, 1.6 h, 1.7 h, 1.8 h, 1.9 h, or 2.0 h.
  • a desired amount of compound is administered gradually over a period of 1 h.
  • a desired amount of compound is administered gradually over a period of 2 h.
  • one or more compound of the disclosure is administered for more than 1 day, more than 1 week, more than 1 month, more than 2 months, more than 3 months, more than 4 months, more than 5 months, more than 6 months, more than 7 months, more than 8 months, more than 9 months, more than 10 months, more than 11 months, more than 12 months, more than 13 months, more than 14 months, more than 15 months, more than 16 months, more than 17 months, more than 18 months, more than 19 months, more than 20 months, more than 21 months, more than 22 months, more than 23 months, or more than 24 months.
  • one or more compound of the disclosure is administered for less than 1 week, less than 1 month, less than 2 months, less than 3 months, less than 4 months, less than 5 months, less than 6 months, less than 7 months, less than 8 months, less than 9 months, less than 10 months, less than 11 months, less than 12 months, less than 13 months, less than 14 months, less than 15 months, less than 16 months, less than 17 months, less than 18 months, less than 19 months, less than 20 months, less than 21 months, less than 22 months, less than 23 months, or less than 24 months.
  • the compound is administered on day 1, 8, 15, and 28 of a 28 day cycle. In some embodiments, the compound is administered on day 1, 8, 15, and 28 of a 28 day cycle and administration is continued for two cycles. In some embodiments, the compound is administered on day 1, 8, 15, and 28 of a 28 day cycle and administration is continued for three cycles. In some embodiments, the compound is administered on day 1, 8, 15, and 28 of a 28 day cycle and administration is continued for 4, 5, 6, 7, 8, 9, 10, or more cycles.
  • the compound is administered on day 1, 8, 11, and 21 of a 21-day cycle. In some embodiments, the compound is administered on day 1, 8, 11, and 21 of a 21-day cycle and administration is continued for two cycles. In some embodiments, the compound is administered on day 1, 8, 11, and 21 of a 21-day cycle and administration is continued for three cycles. In some embodiments, the compound is administered on day 1, 8, 11, and 21 of a 21-day cycle and administration is continued for 4, 5, 6, 7, 8, 9, 10, or more cycles.
  • an effective dose of a stapled AMP can include, but is not limited to, e.g., about, 0.00001, 0.0001, 0.001, 0.01, 0.1, 1 or 10-10000; 0.00001, 0.0001, 0.001, 0.01, 0.1, 1 or 10-5000; 0.00001, 0.0001, 0.001, 0.01, 0.1, 1 or 10-2500; 0.00001, 0.0001, 0.001, 0.01, 0.1, 1 or 10-1000; 0.00001, 0.0001, 0.001, 0.01, 0.1, 1 or 10-900; 0.00001, 0.0001, 0.001, 0.01, 0.1, 1 or 10-800; 0.00001, 0.0001, 0.001, 0.01, 0.1, 1 or 10-700; 0.00001, 0.0001, 0.001, 0.01, 0.1, 1 or 10-700; 0.00001, 0.0001, 0.001, 0.01, 0.1, 1 or
  • compositions of this invention can include one or more peptides and any pharmaceutically acceptable carrier and/or vehicle.
  • pharmaceuticals can further include one or more additional therapeutic agents in amounts effective for achieving a modulation of disease or disease symptoms.
  • additional therapeutic agents can also be administered chemically (covalently or non-covalently) bound to the stabilized I-TAMPs of this document
  • additional therapeutic agents may include antimicrobial agents (e.g., antibiotics) known in the art.
  • stapled AMPs of the invention operate in conjunction with antimicrobial agents to produce mechanistically additive or synergistic antimicrobial effects.
  • antibiotics suitable for co-administration with (as separate entities or chemically bound (covalently or non-covalently) to) the stapled peptides disclosed herein (as separate agents or chemically bound to the stapled peptides) include, but are not limited to, quinolones (e.g., levofloxacin, norfloxacin, ofloxacin, ciprofloxacin, perfloxacin, lomefloxacin, fleroxacin, sparfloxacin, grepafloxacin, trovafloxacin, clinafloxacin, gemifloxacin, enoxacin, sitafloxacin, nadifloxacin, tosulfloxacin, cinnoxacin, rosoxacin, miloxacin, moxifloxacin, gatifloxacin, cinnoxacin, enoxacin, fleroxacin, lomafloxacin, lomefloxaci
  • compositions of this invention comprise a combination of a compound of the formulae described herein and one or more additional therapeutic or prophylactic agents
  • both the compound and the additional agent should be present at dosage levels of between about 1% to about 100%, or between about 5% to about 95% of the dosage normally administered in a monotherapy regimen.
  • the additional agents may be administered separately, as part of a multiple dose regimen, from the compounds of this invention. Alternatively, those agents may be part of a single dosage form, mixed together with the compounds of this invention in a single composition.
  • pharmaceutically acceptable carrier or adjuvant refers to a carrier or adjuvant that may be administered to a patient, together with a compound of this invention, and which does not destroy the pharmacological activity thereof and is nontoxic when administered in doses sufficient to deliver a therapeutic amount of the compound.
  • Pharmaceutically acceptable carriers, adjuvants and vehicles that may be used in the pharmaceutical compositions of this invention include, but are not limited to, ion exchangers, alumina, aluminum stearate, lecithin, self-emulsifying drug delivery systems (SEDDS) such as d- ⁇ -tocopherol polyethyleneglycol 1000 succinate, surfactants used in pharmaceutical dosage forms such as Tweens or other similar polymeric delivery matrices, serum proteins, such as human serum albumin, buffer substances such as phosphates, glycine, sorbic acid, potassium sorbate, partial glyceride mixtures of saturated vegetable fatty acids, water, salts or electrolytes, such as protamine sulfate, disodium hydrogen phosphate, potassium hydrogen phosphate, sodium chloride, zinc salts, colloidal silica, magnesium trisilicate, polyvinyl pyrrolidone, cellulose-based substances, polyethylene glycol, sodium carboxymethylcellulose, polyacrylates, waxes, polyethylene-
  • compositions of this invention may contain any conventional non-toxic pharmaceutically-acceptable carriers, adjuvants or vehicles.
  • pH of the formulation may be adjusted with pharmaceutically acceptable acids, bases or buffers to enhance the stability of the formulated compound or its delivery form.
  • parenteral as used herein includes parenteral, epidural, subcutaneous, intra-cutaneous, intra-venous, intra-muscular, intra-articular, intra-arterial, intra-synovial, intra-sternal, intra-thecal, intra-lesional and intra-cranial injection or infusion techniques.
  • an effective amount of a compound of the disclosure can be administered in either single or multiple doses by any of the accepted modes of administration. Regardless of the route of administration selected, the compounds of the present disclosure, and/or the pharmaceutical compositions of the present disclosure, are formulated into pharmaceutically-acceptable dosage forms.
  • the compounds according to the disclosure can be formulated for administration in any convenient way for use in human or veterinary medicine, by analogy with other pharmaceuticals.
  • the disclosure provides pharmaceutical formulation comprising a therapeutically-effective amount of one or more of the compounds described above, formulated together with one or more pharmaceutically acceptable carriers (additives) and/or diluents.
  • one or more of the compounds described herein are formulated for parenteral administration for parenteral administration, one or more compounds disclosed herein can be formulated as aqueous or nonaqueous solutions, dispersions, suspensions or emulsions or sterile powders which can be reconstituted into sterile injectable solutions or dispersions just prior to use.
  • Such formulations can comprise sugars, alcohols, antioxidants, buffers, bacteriostats, solutes which render the formulation isotonic with the blood of the intended recipient or suspending or thickening agents.
  • These compositions can also contain adjuvants such as preservatives, wetting agents, emulsifying agents and dispersing agents. Prevention of the action of microorganisms upon the subject compounds can be ensured by the inclusion of various antibacterial and antifungal agents, for example, paraben, chlorobutanol, phenol sorbic acid, and the like. It can also be desirable to include isotonic agents, such as sugars, sodium chloride, and the like into the compositions.
  • the injectable pharmaceutical form can be brought about by the inclusion of agents which delay absorption such as aluminum monostearate and gelatin.
  • the formulation can be diluted prior to use with, for example, an isotonic saline solution or a dextrose solution.
  • the compound is formulated as an aqueous solution and is administered intravenously.
  • compositions can be in the form of a solution or powder for injection. Such compositions may be formulated according to techniques known in the art using suitable dispersing or wetting agents (such as, for example, Tween 80) and suspending agents.
  • the sterile injectable preparation may also be a sterile injectable solution or suspension in a non-toxic parenterally acceptable diluent or solvent, for example, as a solution in 1,3-butanediol.
  • acceptable vehicles and solvents that may be employed are mannitol, water, Ringer's solution and isotonic sodium chloride solution.
  • sterile, fixed oils are conventionally employed as a solvent or suspending medium.
  • any bland fixed oil may be employed including synthetic mono- or diglycerides.
  • Fatty acids, such as oleic acid and its glyceride derivatives are useful in the preparation of injectables, as are natural pharmaceutically-acceptable oils, such as olive oil or castor oil, especially in their polyoxyethylated versions.
  • These oil solutions or suspensions may also contain a long-chain alcohol diluent or dispersant, or carboxymethyl cellulose or similar dispersing agents which are commonly used in the formulation of pharmaceutically acceptable dosage forms such as emulsions and or suspensions.
  • surfactants such as Tweens, Spans, and/or other similar emulsifying agents or bioavailability enhancers which are commonly used in the manufacture of pharmaceutically acceptable solid, liquid, or other dosage forms may also be used for the purposes of formulation.
  • compositions can be orally administered in any orally acceptable dosage form including, but not limited to, capsules, tablets, emulsions and aqueous suspensions, dispersions and solutions.
  • carriers which are commonly used include lactose and corn starch.
  • Lubricating agents such as magnesium stearate, are also typically added.
  • useful diluents include lactose and dried corn starch.
  • compositions of this invention may also be administered in the form of suppositories for rectal administration.
  • These compositions can be prepared by mixing a compound of this invention with a suitable non-irritating excipient which is solid at room temperature but liquid at the rectal temperature and therefore will melt in the rectum to release the active components.
  • suitable non-irritating excipient include, but are not limited to, cocoa butter, beeswax and polyethylene glycols.
  • compositions can be administered by nasal aerosol or inhalation.
  • Such compositions are prepared according to techniques well-known in the art of pharmaceutical formulation and may be prepared as solutions in saline, employing benzyl alcohol or other suitable preservatives, absorption promoters to enhance bioavailability, fluorocarbons, and/or other solubilizing or dispersing agents known in the art.
  • one or more peptides disclosed herein can be conjugated, for example, to a carrier protein.
  • conjugated compositions can be monovalent or multivalent.
  • conjugated compositions can include one peptide disclosed herein conjugated to a carrier protein.
  • conjugated compositions can include two or more peptides disclosed herein conjugated to a carrier.
  • association is covalent. In other embodiments, the association is non-covalent. Non-covalent interactions include hydrogen bonding, van der Waals interactions, hydrophobic interactions, magnetic interactions, electrostatic interactions, etc.
  • An indirect covalent interaction is when two entities are covalently connected, optionally through a linker group.
  • Carrier proteins can include any protein that increases or enhances immunogenicity in a subject. Exemplary carrier proteins are described in the art (see, e.g., Fattom et al., Infect. Immun., 58:2309-2312, 1990; Devi et al., Proc. Natl. Acad. Sci. USA 88:7175-7179, 1991; L 1 et al., Infect. Immun. 57:3823-3827, 1989; Szu et al., Infect. Immun. 59:4555-4561, 1991; Szu et al., J. Exp. Med. 166:1510-1524, 1987; and Szu et al., Infect. Immun. 62:4440-4444, 1994). Polymeric carriers can be a natural or a synthetic material containing one or more primary and/or secondary amino groups, azido groups, or carboxyl groups. Carriers can be water soluble.
  • the disclosure includes methods of using the peptides herein for the prophylaxis and/or treatment of infection.
  • treat refers to partially or completely alleviating, inhibiting, ameliorating, and/or relieving the disease or condition from which the subject is suffering. This means any manner in which one or more of the symptoms of a disease or disorder (e.g., cancer) are ameliorated or otherwise beneficially altered.
  • amelioration of the symptoms of a particular disorder refers to any lessening, whether permanent or temporary, lasting or transient that can be attributed to or associated with treatment by the compositions and methods of the present invention.
  • treatment can promote or result in, for example, a decrease in the number of microbial cells or organisms (e.g., in a subject) relative to the number of microbial cells or organisms prior to treatment; a decrease in the viability (e.g., the average/mean viability) of microbial cells or organisms (e.g., in a subject) relative to the viability (e.g., the average/mean viability) of microbial cells or organisms (e.g., in the subject) prior to treatment; and/or reductions in one or more symptoms associated with one or more infections in a subject relative to the subject's symptoms prior to treatment.
  • bacteria internally cross-linked AMPs are active against include, without limitation, Staphylococci (e.g., S. aureus, S. intermedius, S. epidermidis , and other coagulase negative Staphylococci), Neisseriae (e.g., N. gonorrheae and N. meningitidis ), Streptococci (e.g., Group A Streptococcus (e.g., S. pyogenes ), Group B Streptococcus (e.g., S. agalactiae ), Group C Streptococcus , Group G Streptococcus, S.
  • Staphylococci e.g., S. aureus, S. intermedius, S. epidermidis , and other coagulase negative Staphylococci
  • Neisseriae e.g., N. gonorrheae and N. meningitidis
  • Mycoplasmal organisms AMPs are active against include, e.g., M. pneumoniae, M. fermentans, M. hominis , and M. penetrans.
  • fungal (including yeast) organisms internally cross-linked AMPs are active against include, but are not limited to, Candida albicans , other Candida species, Cryptococcus neoformans, Histoplasma capsulatum , and Pneumocystis carinii.
  • Examples of protozoan parasites internally cross-linked AMPs are active against include, without limitation, Trichomonas vaginalis, Plasmodium falciparum, P. vivax, P. ovale, P. malariae, Entamoeba histolytica, Toxoplasma brucei, Toxoplasma gondii , and Leishmania major.
  • viruses internally cross-linked AMPs may be employed against include, but are not limited to cells infected with, human immunodeficiency virus (HIV) 1 and 2, human lymphotropic virus (HTLV), measles virus, rabies virus, hepatitis virus A, B, and C, rotaviruses, rhinoviruses, influenza virus, parainfluenza virus, respiratory syncytial virus, adenoviruses, parvoviruses (e.g., parvovirus B19), roseola virus, enteroviruses, papilloma viruses, retroviruses, herpesviruses (e.g., herpes simplex virus, varicella zoster virus, Epstein Barr virus (EBV), human cytomegalovirus (CMV), human herpesvirus 6, 7 and 8), poxviruses (e.g., variola major and variola minor, vaccinia, and monkeypox virus), feline leukemia virus, feline immunodefic
  • structurally stabilized I-TAMPs translocate into microbial cell and exert their biological activities within the microbial cells
  • structurally stabilized AMPs having appropriate intra-mammalian cell activities (e.g., anti-intracellular virus or other intra-mammalian cell anti-microbial activity) with the ability to translocate into relevant mammalian cells, without causing significant lysis of the mammalian cells, can be developed.
  • disorders that can be treated by the compositions, formulations, and/or methods described herein include, but are not limited to, infectious diseases.
  • Infectious diseases can be caused by pathogens, such as bacteria, viruses, fungi or parasites.
  • an infectious disease can be passed from person to person.
  • an infectious disease can be transmitted by bites from insects or animals.
  • an infectious disease can be acquired by ingesting contaminated food or water or being exposed to organisms in the environment. Some infectious diseases can be prevented by vaccines.
  • infectious diseases that can be treated by the compositions, formulations, and/or methods described herein include, but are not limited to, Acinetobacter infections, Actinomycosis, African sleeping sickness (African trypanosomiasis), AIDS
  • the pathogen can be a virus, bacterium, prion, a fungus, or a parasite.
  • the pathogen described herein include, but are not limited to, Acinetobacter baumannii, Actinomyces israelii, Actinomyces gerencseriae and Propionibacterium propionicus, Trypanosoma brucei , HIV (Human immunodeficiency virus), Entamoeba histolytica, Anaplasma species, Angiostrongylus, Anisakis, Bacillus anthracis, Arcanobacterium haemolyticum, Junin virus, Ascaris lumbricoides, Aspergillus species, Astroviridae family, Babesia species, Bacillus cereus , bacterial vaginosis microbiota, Bacteroides species, Balantidium coli, Bartone
  • enterica serovar typhi, Rickettsia, Ureaplasma urealyticum, Coccidioides immitis, Coccidioides posadasii, Venezuelan equine encephalitis virus, Guanarito virus, Vibrio vulnificus, Vibrio parahaemolyticus , multiple viruses, West Nile virus, Trichosporon beigelii, Yersinia pseudotuberculosis, Yersinia enterocolitica , Yellow fever virus, Mucorales order (Mucormycosis), and Entomophthorales order (Entomophthoramycosis).
  • the compounds of the invention can be toxic to one microbe. In some embodiments, the compounds of the invention can be toxic to two microbes. In some embodiments, the compounds of the invention can be toxic to three microbes. In some embodiments, the compounds of the invention can be toxic to four microbes. In some embodiments, the compounds of the invention can be toxic to five microbes.
  • the compounds of the invention can be used to treat a microbe without damaging the host subject. In some embodiments, the compounds of the invention can be used to treat two microbes without damaging the host subject. In some embodiments, the compounds of the invention can be used to treat three microbes without damaging the host subject. In some embodiments, the compounds of the invention can be used to treat four microbes without damaging the host subject. In some embodiments, the compounds of the invention can be used to treat five microbes without damaging the host subject.
  • methods include selecting a subject and administering to the subject an effective amount of one or more of the peptides herein, e.g., in or as a pharmaceutical composition, and optionally repeating administration as required for the prophylaxis or treatment of a microbial infection and can be administered, e.g., orally, intravenously or topically.
  • Specific dosage and treatment regimens for any particular patient will depend upon a variety of factors, including the activity of the specific compound employed, the age, body weight, general health status, sex, diet, time of administration, rate of excretion, drug combination, the severity and course of the disease, condition or symptoms, the patient's disposition to the disease, condition or symptoms, and the judgment of the treating physician.
  • An effective amount can be administered in one or more administrations, applications or dosages.
  • a therapeutically effective amount of a therapeutic compound depends on the therapeutic compounds selected.
  • the compositions can be administered one from one or more times per day to one or more times per week; including once every other day. The skilled artisan will appreciate that certain factors may influence the dosage and timing required to effectively treat a subject, including but not limited to the severity of the disease or disorder, previous treatments, the general health and/or age of the subject, and other diseases present.
  • treatment of a subject with a therapeutically effective amount of the therapeutic compounds described herein can include a single treatment or a series of treatments.
  • effective amounts can be administered at least once.
  • a maintenance dose of a compound, composition or combination of this invention may be administered, if necessary.
  • the dosage or frequency of administration, or both may be reduced, as a function of the symptoms, to a level at which the improved condition is retained.
  • Patients may, however, require intermittent treatment on a long-term basis upon any recurrence of disease symptoms.
  • the peptides herein can further be co-administered with one or more additional therapeutic agents in amounts effective for achieving a modulation of disease or disease symptoms.
  • additional therapeutic agents may include conventional antimicrobial agents (e.g., antibiotics) known in the art.
  • stapled AMPs of the invention operate in conjunction with conventional antimicrobial agents to produce mechanistically additive or synergistic antimicrobial effects.
  • certain internally cross-linked (e.g., stapled) AMPs having the ability to produce “pores” in the membranes of certain microbial organisms (including, e.g., Gram-negative bacteria) can act to facilitate and/or enhance the passage of appropriate conventional antimicrobial agents to the interiors of relevant microbial cells.
  • the internally cross-linked AMPs can be conjugated (covalently or non-covalently) to appropriate antimicrobial agents, the resulting conjugates being administered to appropriate subjects.
  • microbial organisms e.g., any of those disclosed herein
  • relevant microbial organisms can be contacted either in a subject or in vitro to an internally cross-linked AMP with the ability to produce “pores” or even lysis of the microbial organism.
  • nucleic acids e.g., DNA and/or RNA
  • This phenomenon can be used as a basis for accurate, rapid, and inexpensive identification of the microbial organism.
  • any of a variety of bodily fluids e.g., blood, lymph, urine, feces, mucus, or tears
  • body lavages e.g., body lavages
  • any of a variety of bodily fluids e.g., blood, lymph, urine, feces, mucus, or tears
  • body lavages e.g., body lavages
  • culture medium e.g., culture medium
  • the antimicrobial peptides of the invention can be applied to, or incorporated into, various medical and/or hygienic devices (e.g., as a coating, or impregnated within a biodegradable device for exposure or release as the device degrades or dissolves after the device is inserted into a bodily canal of a vertebrate subject, inserted into a bodily cavity of a vertebrate subject, or applied to a tissue or organ of a vertebrate animal) to prevent or inhibit microbial (e.g., bacterial or biofilm) growth.
  • various medical and/or hygienic devices e.g., as a coating, or impregnated within a biodegradable device for exposure or release as the device degrades or dissolves after the device is inserted into a bodily canal of a vertebrate subject, inserted into a bodily cavity of a vertebrate subject, or applied to a tissue or organ of a vertebrate animal
  • microbial e.g.,
  • Medical or hygienic devices suitable for use with the stapled peptides disclosed herein include, but are not limited to, devices that are inserted into a bodily canal of a vertebrate subject, inserted into a bodily cavity of a vertebrate subject, or applied to a tissue or organ of a vertebrate animal for the purpose of: (a) wound protection; (b) preventing or reducing unwanted, or overcoming restricted, release from the body of the vertebrate subject of a bodily fluid, bodily secretion, or excreta (e.g., blood, menses, urine, lymphatic fluid, cerebrospinal fluid, semen, saliva, vaginal secretions, mucus, or feces); (c) delivering a drug or some other therapeutic or prophylactic agent to a subject; (d) replacing absent or supplementing defective organ functions; or (e) maintaining the patency of a bodily canal (e.g., a blood vessel).
  • a bodily canal e.g., a blood vessel
  • medical or hygienic devices include, without limitation: rectal devices such as suppositories, enemas, and catheters; nasal, tracheal, or esophageal delivery devices; vaginal devices such as vaginal tampons and contraceptive devices (e.g., diaphragms or intrauterine devices (IUDs)); venous, arterial, intracranial and other needles, catheters and stents; renal dialysis accesses; surgical bandages, sutures, or dressings; ostomy devices; natural and synthetic implantable tissue matrices (see, for example, U.S. Pat. No.
  • pace makers and pace maker wires and leads pace makers and pace maker wires and leads; synthetic and natural prostheses such as hip and knee prostheses and heart valves; osmotic pumps (e.g., mini osmotic pumps) that are implanted in body cavity (e.g., the peritoneal cavity) and provide slow delivery of a drug or some other therapeutic or prophylactic agent.
  • body cavity e.g., the peritoneal cavity
  • suitable animals for treatment include (but are not limited to), e.g., poultry and other birds (including chickens, turkeys, ducks, ostrich, emu, quail), ruminants (including goats, sheep, and cattle), fish, pigs, rabbits, mice, rats, horses, donkeys, monkeys, apes, felines (including cats), hamsters, ferrets, guinea pigs, and canines (including dogs).
  • poultry and other birds including chickens, turkeys, ducks, ostrich, emu, quail
  • ruminants including goats, sheep, and cattle
  • fish pigs
  • mice mice
  • rats horses
  • donkeys monkeys
  • apes apes
  • felines including cats
  • ferrets ferrets
  • guinea pigs guinea pigs
  • canines including dogs.
  • suitable plants for treatment include (but are not limited to), e.g., almond, apple, amaranth, artichoke, asparagus, avocado, banana and plantain, barley, beet, berries (including blueberry, blackberry, strawberry, and raspberry), breadfruit and jackfruit, brussels sprout, cabbage, carrot, cassava, cauliflower and broccoli, celery, chayote, cherry, coconut, collard and kale, corn (maize), cucumber and zucchini, dandelion, eggplant, endive and chicory, garlic, kohlrabi, grape, legume, lettuce, melons (including honeydew, cantaloupe, and watermelon), mustard, oat, oca, olive, okra, onion, orange and grapefruit, oyster plant, pear, peach, pemmican, pepper, potato and other tubers, quinoa, radish, rice, rhubarb, rye, sago, sorghum, soybean, spinach, pumpkin
  • suitable foods for treatment include (but are not limited to), e.g., algae, mushrooms, and products derived from animals (e.g., beef, butter, eggs, (ice) cream, gravy, milk, pork, veal, yogurt) and/or plants (e.g., beer, bread, cereal, chocolate, coffee, ketchup, mustard sauce, oatmeal, juice, monosodium glutamate, salad, soda, soft drinks, soymilk, soy sauce, tea, tofu, fries, vinegar, wine) as described above.
  • animals e.g., beef, butter, eggs, (ice) cream, gravy, milk, pork, veal, yogurt
  • plants e.g., beer, bread, cereal, chocolate, coffee, ketchup, mustard sauce, oatmeal, juice, monosodium glutamate, salad, soda, soft drinks, soymilk, soy sauce, tea, tofu, fries, vinegar, wine
  • the peptides herein can also be applied in the personal care and/or consumer products context (e.g., to health or beauty products in sterilization processes) to reduce or eliminate the risk of microbial (e.g., bacterial) contamination.
  • suitable products for treatment include (but are not limited to), e.g., brushes, conditioners, clips, clippers, curling irons, shampoos, soaps, lotions, topical acne ointments, oils, colorants, dyes, perfumes, pins, fragrances, razors, shaving devices, deodorants, cosmetics, kitchen and/or dining devices (e.g., cutting boards, racks, containers, pots, pans, utensils), and cleaning products (e.g., brooms, mops, dustpans, sweepers) and cleaning solutions.
  • the ⁇ -helical content increased for some of the stapled analogues and the parent I-TAMP (F10W), but not as dramatically as we previously observed for ⁇ -helical AMPs ( FIG. 2 Panel B), consistent with the incorporation of a helix-breaking proline within the buforin II sequence.
  • the i, i+7 stapled analogues displayed higher levels of ⁇ -helicity when compared to their i, i+4 counterparts, both in the presence and absence of TFE ( FIG. 3 ).
  • BFStap(i+4)7 and BFStap(i+4)11 Balancing antimicrobial potency and suppression of hemolytic activity, we identified BFStap(i+4)7 and BFStap(i+4)11 as specific exemplary candidates for further development, as they displayed the greatest increase in antimicrobial activity while maintaining low hemolytic activity.
  • FIG. 8 is a graph showing the hemolysis of stapled buforin II analogues.
  • Stapled buforin II analogs were incubated with 1% v/v human red blood cells (RBCs) in phosphate buffer for 1 hour at 37° C. and then the supernatant was collected and hemoglobin release was measured using UV absorbance at 570 nm.
  • the buforin II analogs displayed hemolysis levels below 5% at all the concentrations tested up to 50 ⁇ g/mL.
  • Fmoc-based solid-phase peptide synthesis was used to synthesize the antimicrobial peptides and their stapled derivatives.
  • ⁇ -methyl, ⁇ -alkenyl amino acids were used flanking two, three or six residues.
  • an R 5 or R 3 residue can be incorporated at position i and S 5 at position 1+3, while two S 5 residues can be used at the i and i+4 locations, and an R 8 at position i and S 5 at i+7 (or S 8 at position i and R 8 at i+7) [20].
  • Grubbs 1 st generation ruthenium catalyst dissolved in dichloroethane was added to the peptides on resin.
  • the mean molar ellipticities of each peptide was determined using circular dichroism (CD) spectroscopy on an Aviv Biomedical spectrometer. Peptide stock solutions (100 ⁇ M) in 10 mM phosphate buffer (pH 7.4) and in a mixture of buffer:2,2,2-trifluoroethanol (1:1 v/v) were loaded into 1-mm fused silica cells and their ellipticity scanned from 195 to 260 nm.
  • CD circular dichroism
  • microbroth dilution protocol was adapted to determine the MIC of each peptide.
  • MHB Mueller-Hinton broth
  • This refined broth was then used in the standard microbroth dilution protocol devised by Hancock et al. for 96 well plates [21]. Note that no BSA was used in the adapted protocol described herein, since initial studies revealed that it could interfere with peptide activity.
  • bacterial cells were grown overnight in refined MHB at 37° C. and then diluted and allowed to grow again for several hours.
  • Serial dilutions of peptide stocks in water (10 ⁇ l) were prepared using clear round-bottom polypropylene 96-well plates.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Organic Chemistry (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • Epidemiology (AREA)
  • Zoology (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Immunology (AREA)
  • Marine Sciences & Fisheries (AREA)
  • Biophysics (AREA)
  • Molecular Biology (AREA)
  • Genetics & Genomics (AREA)
  • Biochemistry (AREA)
  • Toxicology (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Tropical Medicine & Parasitology (AREA)
  • Communicable Diseases (AREA)
  • Oncology (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Peptides Or Proteins (AREA)
  • Medicinal Preparation (AREA)
US15/445,502 2016-02-29 2017-02-28 Stapled intracellular-targeting antimicrobial peptides to treat infection Abandoned US20170247423A1 (en)

Priority Applications (3)

Application Number Priority Date Filing Date Title
US15/445,502 US20170247423A1 (en) 2016-02-29 2017-02-28 Stapled intracellular-targeting antimicrobial peptides to treat infection
US16/813,528 US11945846B2 (en) 2016-02-29 2020-03-09 Stapled intracellular-targeting antimicrobial peptides to treat infection
US18/590,636 US12391733B2 (en) 2016-02-29 2024-02-28 Stapled intracellular-targeting antimicrobial peptides to treat infection

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201662301426P 2016-02-29 2016-02-29
US15/445,502 US20170247423A1 (en) 2016-02-29 2017-02-28 Stapled intracellular-targeting antimicrobial peptides to treat infection

Related Child Applications (1)

Application Number Title Priority Date Filing Date
US16/813,528 Continuation US11945846B2 (en) 2016-02-29 2020-03-09 Stapled intracellular-targeting antimicrobial peptides to treat infection

Publications (1)

Publication Number Publication Date
US20170247423A1 true US20170247423A1 (en) 2017-08-31

Family

ID=59679412

Family Applications (3)

Application Number Title Priority Date Filing Date
US15/445,502 Abandoned US20170247423A1 (en) 2016-02-29 2017-02-28 Stapled intracellular-targeting antimicrobial peptides to treat infection
US16/813,528 Active 2037-11-21 US11945846B2 (en) 2016-02-29 2020-03-09 Stapled intracellular-targeting antimicrobial peptides to treat infection
US18/590,636 Active US12391733B2 (en) 2016-02-29 2024-02-28 Stapled intracellular-targeting antimicrobial peptides to treat infection

Family Applications After (2)

Application Number Title Priority Date Filing Date
US16/813,528 Active 2037-11-21 US11945846B2 (en) 2016-02-29 2020-03-09 Stapled intracellular-targeting antimicrobial peptides to treat infection
US18/590,636 Active US12391733B2 (en) 2016-02-29 2024-02-28 Stapled intracellular-targeting antimicrobial peptides to treat infection

Country Status (7)

Country Link
US (3) US20170247423A1 (enExample)
EP (1) EP3423075B1 (enExample)
JP (2) JP7105696B2 (enExample)
CN (1) CN109069578A (enExample)
AU (1) AU2017228333C1 (enExample)
CA (1) CA3014442A1 (enExample)
WO (1) WO2017151617A1 (enExample)

Cited By (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2019118893A1 (en) 2017-12-15 2019-06-20 Dana-Farber Cancer Institute, Inc. Stabilized peptide-mediated targeted protein degradation
WO2019157131A1 (en) 2018-02-07 2019-08-15 Dana-Farber Cancer Institute, Inc. Cell-permeable stapled peptide modules for cellular delivery
WO2019178313A1 (en) 2018-03-14 2019-09-19 Dana-Farber Cancer Institute, Inc. Stabilized peptides for biomarker detection
US10464975B2 (en) * 2015-07-02 2019-11-05 Dana-Farber Cancer Institute, Inc. Stabilized anti-microbial peptides
US11325955B2 (en) 2017-07-19 2022-05-10 Dana-Farber Cancer Institute, Inc. Stabilized anti-microbial peptides for the treatment of antibiotic-resistant bacterial infections
US11945846B2 (en) 2016-02-29 2024-04-02 Dana-Farber Cancer Institute, Inc. Stapled intracellular-targeting antimicrobial peptides to treat infection

Families Citing this family (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2019090015A1 (en) * 2017-11-03 2019-05-09 Yale University Peptidic materials that traffic efficiently to the cell cytosol and nucleus
CN109870583B (zh) * 2019-04-15 2020-03-06 德阳市人民医院 急性胰腺炎相关的代谢物及其应用

Family Cites Families (68)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5861478A (en) 1987-07-06 1999-01-19 Helix Biomedix, Inc. Lytic peptides
EP0761684A3 (en) 1989-07-07 1997-07-02 Scripps Research Inst Replacement analogs for magainin peptides containing alanine residue
US5912231A (en) 1989-07-07 1999-06-15 Scripps Clinic And Research Foundation Substitution analogues of magainin peptides
US5607914A (en) 1993-01-13 1997-03-04 Pioneer Hi-Bred International, Inc. Synthetic antimicrobial peptides
US5561107A (en) 1993-06-04 1996-10-01 Demeter Biotechnologies, Ltd. Method of enhancing wound healing by stimulating fibroblast and keratinocyte growth in vivo, utilizing amphipathic peptides
US5446090A (en) 1993-11-12 1995-08-29 Shearwater Polymers, Inc. Isolatable, water soluble, and hydrolytically stable active sulfones of poly(ethylene glycol) and related polymers for modification of surfaces and molecules
EP0915967A1 (en) 1996-05-28 1999-05-19 The Board Of Regents Of The University Of Michigan Engineering oral tissues
US20020064546A1 (en) 1996-09-13 2002-05-30 J. Milton Harris Degradable poly(ethylene glycol) hydrogels with controlled half-life and precursors therefor
KR100263583B1 (ko) * 1997-05-28 2000-08-01 박종헌 항균 펩타이드의 대량 제조방법 및 그에 유용한 플라즈미드 벡타
ES2211033T3 (es) 1998-01-07 2004-07-01 Debio Recherche Pharmaceutique S.A. Acrilatos de polietilenglicol heterobifuncionales degradables y geles y conjugados derivados de dichos acrilatos.
GEP20032868B (en) 1998-01-21 2003-01-27 Merck Sharp & Dohme Triazolo-Pyridazine Derivatives as Ligands for Gaba Receptors, Methods for Their Production, Pharmaceutical Compositions Containing the Same for Treatment and/or Prevention of disorders of Central Nervous System
KR100314721B1 (ko) 1998-01-22 2001-11-23 김일웅 생물학적 활성이 있는 신규한 펩타이드
AU5006499A (en) 1998-07-23 2000-02-14 Intrabiotics Pharmaceuticals, Inc. Compositions and methods for the treatment or prevention of pulmonary infections
US6288212B1 (en) * 1998-08-28 2001-09-11 The University Of British Columbia Anti-endotoxic, antimicrobial cationic peptides and methods of use therefor
US6562785B1 (en) * 1999-03-23 2003-05-13 Howard M. Shapiro Method for overcoming bacterial antibiotic resistance
DE19914817A1 (de) 1999-03-31 2000-10-05 Petry Genmedics Gmbh Dr Wirkstoffe zur Bekämpfung von bakteriellen Infektionserkrankungen
US6262071B1 (en) 1999-06-29 2001-07-17 Smithkline Beecham Corporation Methods of use of antimicrobial compounds against pathogenic amycoplasma bacteria
JP2003531101A (ja) 1999-06-29 2003-10-21 スミスクライン・ビーチャム・コーポレイション 細菌に対するフルオロキノロン化合物の使用法
US20030143234A1 (en) * 1999-08-20 2003-07-31 Wenyuan Shi Anti-microbial targeting chimeric pharmaceutical
US6348558B1 (en) 1999-12-10 2002-02-19 Shearwater Corporation Hydrolytically degradable polymers and hydrogels made therefrom
BR0001870B1 (pt) 2000-05-29 2014-02-25 Peptídeo, processo de obtenção de peptídeo, formulação compreendendo peptídeo, método de prevenção de crescimento de parasitas, fungos e bactérias, método para inativar a endotoxina de bactérias gram-negativas
JP4310107B2 (ja) 2001-03-28 2009-08-05 ヘリックス バイオメディックス,インコーポレイテッド 生物活性を有する短ペプチド及び該ペプチドの使用方法
CN1158304C (zh) 2001-05-10 2004-07-21 上海华谊生物技术有限公司 蛙皮抗菌肽衍生物
MXPA03011453A (es) 2001-06-15 2004-04-05 Hoffmann La Roche Acetilacion de fragmentos de gp41.
US6620954B1 (en) 2002-03-25 2003-09-16 Eastman Chemical Company Phosphinometallocenylamides as novel ligands for asymmetric catalysis
AU2003231980A1 (en) 2002-03-29 2003-10-13 Buck Institute Identification of apoptotic peptides and methods of use thereof
PT2332968T (pt) 2003-11-05 2016-08-17 Harvard College Péptidos alfa-helicoidais adequados para a activação ou inibição da morte celular
US7745390B2 (en) * 2005-05-23 2010-06-29 The Board Of Trustees Of The Leland Stanford Junior University Antimicrobial peptides
ES2487967T3 (es) 2006-04-20 2014-08-25 Pfizer Products Inc. Compuestos amido heterocíclicos condensados con fenilo para la prevención y el tratamiento de enfermedades mediadas por la glucoquinasa
WO2008058575A1 (de) 2006-11-17 2008-05-22 Osram Gesellschaft mit beschränkter Haftung Modulares flächen- leuchtsystem
WO2008086042A2 (en) 2007-01-10 2008-07-17 Chisari Francis V Preventing infection by a measles or respiratory syncytial virus
EP2118123B1 (en) 2007-01-31 2015-10-14 Dana-Farber Cancer Institute, Inc. Stabilized p53 peptides and uses thereof
EP3159352B1 (en) 2007-03-28 2023-08-02 President and Fellows of Harvard College Stitched polypeptides
EP2146698A2 (en) 2007-05-24 2010-01-27 New York Blood Center, Inc. Rapidly dispersible vaginal tablet that provides a bioadhesive gel
CA2700925C (en) 2007-09-26 2016-08-23 Dana Farber Cancer Institute Methods and compositions for modulating bcl-2 family polypeptides
EP2247606B1 (en) 2008-01-23 2019-08-21 Dana-Farber Cancer Institute, Inc. Compositions and methods for the treatment of viral infections
US20100069308A1 (en) 2008-06-06 2010-03-18 Chorny Iiya Surfaces containing antibacterial polymers
US8586707B2 (en) 2008-09-16 2013-11-19 The Research Foundation Of State University Of New York Stapled peptides and method of synthesis
US20100099614A1 (en) 2008-10-06 2010-04-22 Hodges Robert S Antimicrobial Peptides and Methods of Use
EP2352507A4 (en) 2008-11-24 2012-04-25 Aileron Therapeutics Inc PEPTIDOMIMETIC MACROCYCLES WITH IMPROVED PROPERTIES
GB0821687D0 (en) 2008-11-28 2008-12-31 Secr Defence Peptides
KR20100065639A (ko) 2008-12-08 2010-06-17 건국대학교 산학협력단 새로운 피시딘 유도체 항생 펩타이드 및 그 용도
EP3124494B1 (en) 2008-12-09 2019-06-19 Dana-Farber Cancer Institute, Inc. Methods and compositions for specific modulation of mcl-1
WO2012006598A2 (en) 2010-07-09 2012-01-12 Dana-Farber Cancer Institute, Inc. Stabilized insulinotropic peptides and methods of use
US9822165B2 (en) 2009-06-18 2017-11-21 Dana-Farber Cancer Institute, Inc. Hydrocarbon stapled stabilized alpha-helices of the HIV-1 GP41 membrane proximal external region
ES2579806T3 (es) * 2009-06-26 2016-08-16 Katholieke Universiteit Leuven, K.U. Leuven R&D Agentes antimicrobianos
US20130139930A1 (en) 2009-12-18 2013-06-06 Latitude 18, Inc. Inorganic phosphate corrosion resistant coatings
AU2012242502B2 (en) 2011-04-15 2016-07-28 Dana-Farber Cancer Institute, Inc. Targeting deregulated WNT signaling in cancer using stabilized alpha-helices of BCL-9
DE102012203547A1 (de) * 2012-03-07 2013-09-12 Robert Bosch Gesellschaft Für Medizinische Forschung Mbh Antimikrobielle Peptide
WO2013039857A1 (en) 2011-09-12 2013-03-21 modeRNA Therapeutics Engineered nucleic acids and methods of use thereof
WO2013049567A1 (en) 2011-09-29 2013-04-04 The Broad Institute, Inc. Compounds for the treatment of mycobacterial infections
US8669226B2 (en) * 2011-10-07 2014-03-11 Morehouse School Of Medicine Antimicrobial compositions and methods of use thereof
US10077290B2 (en) 2011-12-29 2018-09-18 Dana-Farber Cancer Institute, Inc. Stabilized antiviral fusion helices
WO2013148677A1 (en) * 2012-03-26 2013-10-03 University Of Florida Research Foundation, Inc. Antimicrobial compounds and their use in treating plant disease
RU2694758C2 (ru) 2012-12-20 2019-07-16 Раджив Бхушан Антимикробные композиции
CN103164738B (zh) 2013-02-06 2015-09-30 厦门盛华电子科技有限公司 一种基于移动支付多通道数字认证的手机用户识别卡
EP2991665A4 (en) 2013-03-13 2016-11-09 Harvard College STACKED AND GRAFTED POLYPEPTIDES AND USES THEREOF
US10308926B2 (en) 2013-03-15 2019-06-04 Dana-Farber Cancer Institute, Inc. Stablized EZH2 peptides
US10087215B2 (en) 2013-03-15 2018-10-02 Dana-Farber Cancer Institute, Inc. Stabilized SOS1 peptides
WO2015070912A1 (en) 2013-11-14 2015-05-21 Lysando Ag Modified el188 endolysin sequence
WO2015112980A2 (en) 2014-01-24 2015-07-30 The Regents Of The University Of Colorado, A Body Corporate Dermaseptin-type and piscidin-type antimicrobial peptides
WO2015138494A1 (en) * 2014-03-10 2015-09-17 Georges Belfort Anti-microbial peptides and method for designing novel anti-microbial peptides
US10507227B2 (en) 2014-04-15 2019-12-17 The Hospital For Sick Children Cationic antimicrobial peptides
JP6918712B2 (ja) 2015-07-02 2021-08-11 デイナ ファーバー キャンサー インスティチュート,インコーポレイテッド 安定化抗微生物性ペプチド
WO2017147283A1 (en) 2016-02-23 2017-08-31 Dana-Farber Cancer Institute, Inc. Method for generating cell-penetrating stapled peptides that lack nonspecific membrane-lytic properties for therapeutic targeting
JP7105696B2 (ja) 2016-02-29 2022-07-25 デイナ ファーバー キャンサー インスティチュート,インコーポレイテッド 感染症を治療するステープル化細胞内ターゲティング抗微生物ペプチド
JP7305614B2 (ja) * 2017-07-19 2023-07-10 デイナ ファーバー キャンサー インスティチュート,インコーポレイテッド 抗生物質耐性細菌感染症の処置のための安定化抗菌ペプチド
US20230116760A1 (en) 2019-12-16 2023-04-13 Dana-Farber Cancer Institute, Inc. Structurally-stabilized oncolytic peptides and uses thereof

Cited By (8)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US10464975B2 (en) * 2015-07-02 2019-11-05 Dana-Farber Cancer Institute, Inc. Stabilized anti-microbial peptides
US11945846B2 (en) 2016-02-29 2024-04-02 Dana-Farber Cancer Institute, Inc. Stapled intracellular-targeting antimicrobial peptides to treat infection
US12391733B2 (en) 2016-02-29 2025-08-19 Dana-Farber Cancer Institute, Inc. Stapled intracellular-targeting antimicrobial peptides to treat infection
US11325955B2 (en) 2017-07-19 2022-05-10 Dana-Farber Cancer Institute, Inc. Stabilized anti-microbial peptides for the treatment of antibiotic-resistant bacterial infections
WO2019118893A1 (en) 2017-12-15 2019-06-20 Dana-Farber Cancer Institute, Inc. Stabilized peptide-mediated targeted protein degradation
WO2019157131A1 (en) 2018-02-07 2019-08-15 Dana-Farber Cancer Institute, Inc. Cell-permeable stapled peptide modules for cellular delivery
US11952432B2 (en) 2018-02-07 2024-04-09 Dana-Farber Cancer Institute, Inc. Cell-permeable stapled peptide modules for cellular delivery
WO2019178313A1 (en) 2018-03-14 2019-09-19 Dana-Farber Cancer Institute, Inc. Stabilized peptides for biomarker detection

Also Published As

Publication number Publication date
AU2017228333B2 (en) 2021-09-23
JP2022095666A (ja) 2022-06-28
CA3014442A1 (en) 2017-09-08
EP3423075B1 (en) 2024-04-03
EP3423075A1 (en) 2019-01-09
AU2017228333C1 (en) 2022-03-10
CN109069578A (zh) 2018-12-21
US12391733B2 (en) 2025-08-19
WO2017151617A1 (en) 2017-09-08
AU2017228333A1 (en) 2018-08-23
JP7105696B2 (ja) 2022-07-25
EP3423075A4 (en) 2019-11-20
JP2019513696A (ja) 2019-05-30
JP7432640B2 (ja) 2024-02-16
US11945846B2 (en) 2024-04-02
US20200308236A1 (en) 2020-10-01
US20240343765A1 (en) 2024-10-17

Similar Documents

Publication Publication Date Title
JP7360419B2 (ja) 安定化抗微生物性ペプチド
US12391733B2 (en) Stapled intracellular-targeting antimicrobial peptides to treat infection
US20170360881A1 (en) Peptidomimetic macrocycles and uses thereof
US11325955B2 (en) Stabilized anti-microbial peptides for the treatment of antibiotic-resistant bacterial infections
US20150231199A1 (en) Peptides and their uses
EP3911668A1 (en) Amphipathic alpha-helical antimicrobial peptides treat infections by gram-negative pathogens
HK1252893B (en) Stabilized anti-microbial peptides

Legal Events

Date Code Title Description
AS Assignment

Owner name: DANA-FARBER CANCER INSTITUTE, INC., MASSACHUSETTS

Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:WALENSKY, LOREN D.;MOURTADA, RIDA;REEL/FRAME:041532/0701

Effective date: 20170308

STPP Information on status: patent application and granting procedure in general

Free format text: FINAL REJECTION MAILED

STPP Information on status: patent application and granting procedure in general

Free format text: DOCKETED NEW CASE - READY FOR EXAMINATION

STPP Information on status: patent application and granting procedure in general

Free format text: NON FINAL ACTION MAILED

STCB Information on status: application discontinuation

Free format text: ABANDONED -- FAILURE TO RESPOND TO AN OFFICE ACTION