US20170198051A1 - Multivalent and multispecific ox40-binding fusion proteins - Google Patents

Multivalent and multispecific ox40-binding fusion proteins Download PDF

Info

Publication number
US20170198051A1
US20170198051A1 US15/404,167 US201715404167A US2017198051A1 US 20170198051 A1 US20170198051 A1 US 20170198051A1 US 201715404167 A US201715404167 A US 201715404167A US 2017198051 A1 US2017198051 A1 US 2017198051A1
Authority
US
United States
Prior art keywords
seq
isolated polypeptide
polypeptide
amino acid
acid sequence
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Abandoned
Application number
US15/404,167
Other languages
English (en)
Inventor
Brendan P. Eckelman
John C. Timmer
Chelsie Hata
Kyle S. Jones
Abrahim Hussain
Amir S. Razai
Bryan Becklund
Rajay Pandit
Mike Kaplan
Lucas Rason
Quinn Deveraux
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Inhibrx Biosciences Inc
Original Assignee
Inhibrx Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Inhibrx Inc filed Critical Inhibrx Inc
Priority to US15/404,167 priority Critical patent/US20170198051A1/en
Publication of US20170198051A1 publication Critical patent/US20170198051A1/en
Assigned to INHIBRX LP reassignment INHIBRX LP ASSIGNMENT OF ASSIGNORS INTEREST (SEE DOCUMENT FOR DETAILS). Assignors: BECKLUND, BRIAN, DEVERAUX, QUINN, ECKELMAN, BRENDAN P., HATA, CHELSIE, HUSSAIN, Abrahim, JONES, Kyle S., KAPLAN, MIKE, PANDIT, RAJAY, RASON, LUCAS, RAZAI, Amir S., TIMMER, JOHN C.
Assigned to Inhibrx, Inc. reassignment Inhibrx, Inc. MERGER AND CHANGE OF NAME (SEE DOCUMENT FOR DETAILS). Assignors: INHIBRX LP, TENIUM THERAPEUTICS, INC.
Priority to US16/295,332 priority patent/US11117972B2/en
Assigned to Inhibrx, Inc. reassignment Inhibrx, Inc. ASSIGNMENT OF ASSIGNORS INTEREST (SEE DOCUMENT FOR DETAILS). Assignors: Rascon, Lucas
Priority to US17/398,851 priority patent/US12227584B2/en
Assigned to INHIBRX BIOSCIENCES, INC. reassignment INHIBRX BIOSCIENCES, INC. ASSIGNMENT OF ASSIGNORS INTEREST (SEE DOCUMENT FOR DETAILS). Assignors: Inhibrx, Inc.
Abandoned legal-status Critical Current

Links

Images

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2878Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the NGF-receptor/TNF-receptor superfamily, e.g. CD27, CD30, CD40, CD95
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P29/00Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • A61P37/04Immunostimulants
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • C07K16/2827Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against B7 molecules, e.g. CD80, CD86
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/24Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/31Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/33Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/35Valency
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/52Constant or Fc region; Isotype
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/569Single domain, e.g. dAb, sdAb, VHH, VNAR or nanobody®
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/75Agonist effect on antigen
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76Antagonist effect on antigen, e.g. neutralization or inhibition of binding
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide

Definitions

  • This invention relates generally to molecules that specifically engage OX40, a member of the TNF receptor superfamily (TNFRSF). More specifically this invention relates to multivalent and multispecific molecules that bind at least OX40.
  • TNFRSF TNF receptor superfamily
  • the tumor necrosis factor receptor superfamily consists of several structurally related cell surface receptors. Activation by multimeric ligands is a common feature of many of these receptors. Many members of the TNFRSF have therapeutic utility in numerous pathologies if activated properly. Agonism of this receptor family often requires higher order clustering and conventional bivalent antibodies are not ideal for this. Therefore, there exists a therapeutic need for more potent agonist molecules of the TNFRSF.
  • the disclosure provides multivalent and multispecific TNF receptor superfamily (TNFRSF) binding fusion polypeptides that bind at least OX40 (also known as tumor necrosis factor receptor superfamily, member 4 (TNFRSF4) and/or CD134)).
  • OX40 also known as tumor necrosis factor receptor superfamily, member 4 (TNFRSF4) and/or CD134.
  • OX40 also known as tumor necrosis factor receptor superfamily, member 4 (TNFRSF4) and/or CD134
  • OX40-targeting molecules molecules that bind at least OX40 are referred to herein as “OX40-targeting molecules” or “OX40-targeting fusions” or “OX40-targeting proteins” or “OX40-targeting fusion polypeptides” or “OX40-targeting fusion proteins.”
  • the OX40-targeting molecule is a multivalent molecule, for example, a multivalent OX40-targeting fusion protein.
  • the OX40-targeting molecule is a multispecific molecule, for example, a multispecific OX40-targeting fusion protein.
  • the OX40-targeting molecule is a multivalent and multispecific molecule, for example, a multivalent and multispecific OX40-targeting fusion protein.
  • fusion protein or “fusion polypeptide” or “OX40-targeting fusion protein” or “OX40-targeting fusion polypeptide,” unless otherwise specifically denoted, refers to any fusion protein embodiment of the disclosure, including, but not limited to, multivalent fusion proteins, multispecific fusion proteins, or multivalent and multispecific fusion proteins.
  • the disclosure also provides multivalent and multispecific fusion polypeptides that bind at least programmed death ligand 1 (PDL1), also known as PD-L1, CD274, B7 homolog 1 and/or B7-H1.
  • PDL1 programmed death ligand 1
  • the use of the term “PDL1” is intended to cover any variation thereof, such as, by way of non-limiting example, PD-L1 and/or PDL-1, all variations are used herein interchangeably.
  • PDL1-targeting molecules molecules that bind at least PDL1 are referred to herein as “PDL1-targeting molecules” or “PDL1-targeting fusions” or “PDL1-targeting proteins” or “PDL1-targeting fusion polypeptides” or “PDL1-targeting fusion proteins.”
  • the PDL1-targeting molecule is a multivalent molecule, for example, a multivalent PDL1-targeting fusion protein.
  • the PDL1-targeting molecule is a multispecific molecule, for example, a multispecific PDL1-targeting fusion protein.
  • the PDL1-targeting molecule is a multivalent and multispecific molecule, for example, a multivalent and multispecific PDL1-targeting fusion protein.
  • fusion protein or “fusion polypeptide” or “PDL1-targeting fusion protein” or “PDL1-targeting fusion polypeptide,” unless otherwise specifically denoted, refers to any fusion protein embodiment of the disclosure, including, but not limited to, multivalent fusion proteins, multispecific fusion proteins, or multivalent and multispecific fusion proteins.
  • the disclosure also provides multivalent and multispecific fusion polypeptides that bind at least PDL1 and OX40.
  • These molecules that bind at least PDL1 are referred to herein as “PDL1xOX40-targeting molecules” or “PDL1xOX40-targeting fusions” or “PDL1xOX40-targeting proteins” or “PDL1xOX40-targeting fusion polypeptides” or “PDL1xOX40-targeting fusion proteins.”
  • the PDL1xOX40-targeting molecule is a multivalent molecule, for example, a multivalent PDL1xOX40-targeting fusion protein.
  • the PDL1xOX40-targeting molecule is a multispecific molecule, for example, a multispecific PDL1xOX40-targeting fusion protein. In some embodiments, the PDL1xOX40-targeting molecule is a multivalent and multispecific molecule, for example, a multivalent and multispecific PDL1-targeting fusion protein.
  • fusion protein or “fusion polypeptide” or “PDL1xOX40-targeting fusion protein” or “PDL1xOX40-targeting fusion polypeptide,” unless otherwise specifically denoted, refers to any fusion protein embodiment of the disclosure, including, but not limited to, multivalent fusion proteins, multispecific fusion proteins, or multivalent and multispecific fusion proteins.
  • the present disclosure provides multivalent TNFRSF binding fusion proteins, which comprise 2 or more TNFRSF binding domains (TBDs) where at least one TBD binds OX40.
  • TBDs TNFRSF binding domains
  • the fusion proteins of the present disclosure have utility in treating neoplasms.
  • the fusion protein contains two or more different TBDs, where each TBD binds OX40. In some embodiments, the fusion protein contains multiple copies of a TBD that binds OX40. For example, in some embodiments, the fusion protein contains at least two copies of a TBD that binds OX40. In some embodiments, the fusion protein contains at least three copies of a TBD that binds OX40. In some embodiments, the fusion protein contains at least four copies of a TBD that binds OX40. In some embodiments, the fusion protein contains at least five copies of a TBD that binds OX40. In some embodiments, the fusion protein contains at least six copies of a TBD that binds OX40. In some embodiments, the fusion protein contains six or more copies of a TBD that binds OX40.
  • the fusion proteins of the present disclosure bind OX40 and a second TNFRSF member such as, for example, GITR, CD137, CD27, TNFR2, and/or CD40.
  • the fusion proteins of the present disclosure modulate immune cells leading to enhanced tumor destruction.
  • the fusion proteins of the present disclosure have utility in treating inflammatory conditions.
  • the fusion proteins of the present disclosure modulate immune cells leading to dampening of the inflammatory insult. For example, specifically agonizing TNFR2 can enhance Treg proliferation leading to immune suppression.
  • the fusion proteins of the present disclosure are capable of enhanced clustering of TNFRSF members compared to non-cross-linked bivalent antibodies.
  • the enhanced clustered of TNFRSF members mediated by the fusion proteins of the present disclosure induce enhanced TNFRSF-dependent signaling compared to non-cross-linked bivalent antibodies.
  • the fusion protein will incorporate more than 2 TBDs, for example, three, four, five, or six.
  • the fusion proteins are multispecific containing a TBD and a binding domain directed toward a second antigen.
  • the binding to the second antigen is capable of providing the additional crosslinking function and TNFRSF activation can be achieved with only one or two TBDs.
  • the TNFRSF signaling is enhanced and focused by the presence of the second antigen.
  • the present disclosure provides isolated polypeptides that specifically bind OX40.
  • the isolated polypeptide is derived from antibodies or antibody fragments including scFv, Fabs, single domain antibodies (sdAb), V NAR , or VHHs.
  • the isolated polypeptide is human or humanized sdAb.
  • the sdAb fragments can be derived from VHH, V NAR , engineered VH or VK domains.
  • VHHs can be generated from camelid heavy chain only antibodies.
  • V NARS can be generated from cartilaginous fish heavy chain only antibodies.
  • Various methods have been implemented to generate monomeric sdAbs from conventionally heterodimeric VH and VK domains, including interface engineering and selection of specific germline families.
  • the isolated polypeptides are derived from non-antibody scaffold proteins for example but not limited to designed ankyrin repeat proteins (darpins), avimers, anticalin/lipocalins, centyrins and fynomers.
  • non-antibody scaffold proteins for example but not limited to designed ankyrin repeat proteins (darpins), avimers, anticalin/lipocalins, centyrins and fynomers.
  • the isolated polypeptide includes an amino acid sequence selected from the group consisting of SEQ ID NO: 16-29 and 377-386.
  • the isolated polypeptide includes an amino acid sequence that is at least 50%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to an amino acid sequence selected from the group consisting of SEQ ID NO: 16-29 and 377-386.
  • the isolated polypeptide comprises a complementarity determining region 1 (CDR1) comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 30, 36, and 44; a complementarity determining region 2 (CDR2) comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 31, 35, and 37; and a complementarity determining region 3 (CDR3) comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 32-34, 48-43, and 45.
  • CDR1 complementarity determining region 1
  • CDR2 complementarity determining region 2
  • CDR3 complementarity determining region 3
  • the present disclosure provides multivalent fusion proteins, which comprise two or more binding domains (BDs) where at least one BD binds PDL1.
  • the fusion proteins of the present disclosure have utility in treating neoplasms.
  • the fusion protein contains two or more different BDs, where each BD binds PDL1. In some embodiments, the fusion protein contains multiple copies of a BD that binds PDL1. For example, in some embodiments, the fusion protein contains at least two copies of a BD that binds PDL1. In some embodiments, the fusion protein contains at least three copies of a BD that binds PDL1. In some embodiments, the fusion protein contains at least four copies of a BD that binds PDL1. In some embodiments, the fusion protein contains at least five copies of a BD that binds PDL1. In some embodiments, the fusion protein contains at least six copies of a BD that binds PDL1. In some embodiments, the fusion protein contains six or more copies of a BD that binds PDL1.
  • the present disclosure provides isolated polypeptides that specifically bind OX40.
  • the isolated polypeptide is derived from antibodies or antibody fragments including scFv, Fabs, single domain antibodies (sdAb), V NAR , or VHHs.
  • the isolated polypeptide is human or humanized sdAb.
  • the sdAb fragments can be derived from VHH, V NAR , engineered VH or VK domains.
  • VHHs can be generated from camelid heavy chain only antibodies.
  • V NARS can be generated from cartilaginous fish heavy chain only antibodies.
  • Various methods have been implemented to generate monomeric sdAbs from conventionally heterodimeric VH and VK domains, including interface engineering and selection of specific germline families.
  • the isolated polypeptides are derived from non-antibody scaffold proteins for example but not limited to designed ankyrin repeat proteins (darpins), avimers, anticalin/lipocalins, centyrins and fynomers.
  • non-antibody scaffold proteins for example but not limited to designed ankyrin repeat proteins (darpins), avimers, anticalin/lipocalins, centyrins and fynomers.
  • the isolated polypeptide includes an amino acid sequence selected from the group consisting of SEQ ID NO: 46-57. In some embodiments, the isolated polypeptide includes an amino acid sequence selected from the group consisting of SEQ ID NO: 52-57.
  • the isolated polypeptide includes an amino acid sequence that is at least 50%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to an amino acid sequence selected from the group consisting of SEQ ID NO: 46-57. In some embodiments, the isolated polypeptide includes an amino acid sequence that is at least 50%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to an amino acid sequence selected from the group consisting of SEQ ID NO: 52-57.
  • the isolated polypeptide comprises a complementarity determining region 1 (CDR1) comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 58, 61, and 64; a complementarity determining region 2 (CDR2) comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 59, 62, 65, and 69; and a complementarity determining region 3 (CDR3) comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 60, 63, 66-68, and 70.
  • CDR1 complementarity determining region 1
  • CDR2 complementarity determining region 2
  • CDR3 complementarity determining region 3
  • each binding domain (BD) in the isolated polypeptide is derived from antibodies or antibody fragments including scFv, Fabs, single domain antibodies (sdAb), V NAR , or VHHs.
  • each BD is human or humanized sdAb.
  • the sdAb fragments can be derived from VHH, V NAR , engineered VH or VK domains.
  • VHHs can be generated from camelid heavy chain only antibodies.
  • V NARS can be generated from cartilaginous fish heavy chain only antibodies.
  • the isolated polypeptides are derived from non-antibody scaffold proteins for example but not limited to designed ankyrin repeat proteins (darpins), avimers, anticalin/lipocalins, centyrins and fynomers.
  • non-antibody scaffold proteins for example but not limited to designed ankyrin repeat proteins (darpins), avimers, anticalin/lipocalins, centyrins and fynomers.
  • the isolated polypeptide includes a first amino acid sequence that binds 4B11 selected from the group consisting of SEQ ID NO: 16-29 and 377-386, and a second amino acid sequence that binds PDL1 selected from the group consisting of SEQ ID NO: 46-57.
  • the isolated polypeptide includes a first amino acid sequence that binds 4B11 selected from the group consisting of SEQ ID NO: 16-29 and 377-386, and a second amino acid sequence that binds PDL1 selected from the group consisting of SEQ ID NO: 52-57.
  • the isolated polypeptide includes a first amino acid sequence that is at least 50%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to an amino acid sequence that binds 4B11 selected from the group consisting of SEQ ID NO: 16-29 and 377-386, and a second amino acid sequence that is at least 50%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to an amino acid sequence that binds PDL1 selected from the group consisting of SEQ ID NO: 46-57.
  • the isolated polypeptide includes a first amino acid sequence that is at least 50%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to an amino acid sequence that binds 4B11 selected from the group consisting of SEQ ID NO: 16-29 and 377-386, and a second amino acid sequence that is at least 50%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to an amino acid sequence that binds PDL1 selected from the group consisting of SEQ ID NO: 52-57.
  • the isolated polypeptide includes (i) a first amino acid sequence that binds 4B11 and comprises a complementarity determining region 1 (CDR1) comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 30, 36, and 44; a complementarity determining region 2 (CDR2) comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 31, 35, and 37; and a complementarity determining region 3 (CDR3) comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 32-34, 48-43, and 45; and (ii) a second amino acid sequence that binds PDL1 and comprises a CDR1 comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 58, 61, and 64; a CDR2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 59, 62, 65, and 69; and a CDR3 comprising an amino acid sequence selected from the group consisting of SEQ ID
  • the binding domains (BDs) of the present disclosure are derived from antibodies or antibody fragments including scFv, Fabs, single domain antibodies (sdAb), V NAR , or VHHs.
  • the BDs are human or humanized sdAb.
  • the sdAb fragments can be derived from VHH, V NAR , engineered VH or VK domains.
  • VHHs can be generated from camelid heavy chain only antibodies.
  • V NARS can be generated from cartilaginous fish heavy chain only antibodies.
  • Various methods have been implemented to generate monomeric sdAbs from conventionally heterodimeric VH and VK domains, including interface engineering and selection of specific germline families.
  • the DBs are derived from non-antibody scaffold proteins for example, but not limited to designed ankyrin repeat proteins (darpins), avimer, anticalin/lipocalins, centyrins and fynomers.
  • ankyrin repeat proteins darpins
  • avimer avimer
  • anticalin/lipocalins centyrins and fynomers.
  • the fusion proteins of the present disclosure consist of at least two or more BDs operably linked via a linker polypeptide.
  • the utilization of sdAb fragments as the specific BD within the fusion protein of the present disclosure has the benefit of avoiding the heavy chain:light chain mis-pairing problem common to many bi/multispecific antibody approaches.
  • the fusion proteins of the present disclosure avoid the use of long linkers necessitated by many bispecific antibodies.
  • all of the TBDs of the fusion protein recognize the same epitope on the given TNFRSF member.
  • the fusion proteins of present disclosure may incorporate 2, 3, 4, 5, or 6 TBDs with identical specificity to OX40.
  • the fusion protein incorporates TBDs that recognize distinct epitopes on the given TNFRSF member.
  • the fusion proteins of present disclosure may incorporate 2, 3, 4, 5, or 6 TBDs with distinct recognition specificities toward various epitopes on OX40.
  • the fusion proteins of the present disclosure contain multiple TBDs that target distinct regions of the particular TNFRSF member.
  • the TBDs may recognize different epitopes on the same TNFRSF member or recognize epitopes on distinct TNFRSF members.
  • the present disclosure provides multispecific fusion proteins incorporating TBDs that bind GITR and OX40 or CD137 and OX40.
  • all of the BDs of the fusion protein recognize the same epitope on PDL1.
  • the fusion proteins of present disclosure may incorporate 2, 3, 4, 5, or 6 BDs with identical specificity to PDL1.
  • the fusion protein incorporates BDs that recognize distinct epitopes on PDL1.
  • the fusion proteins of present disclosure may incorporate 2, 3, 4, 5, or 6 BDs with distinct recognition specificities toward various epitopes on PDL1.
  • the BDs may recognize different epitopes on PDL1.
  • the multispecific fusion protein is a bispecific molecule that targets OX40 and PDL1 and comprises an amino acid sequence that is selected from the group consisting of SEQ ID NO: 387-394.
  • the multispecific fusion protein is a bispecific molecule that targets OX-40 and PDL1 and comprises an amino acid sequence that is at least 50%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to an amino acid sequence selected from the group consisting of SEQ ID NO: 387-394.
  • the fusion protein of the present disclosure is composed of a single polypeptide. In other embodiments, the fusion protein of the present disclosure is composed of more than one polypeptide. For example, wherein a heterodimerization domain is incorporated into the fusion protein so as the construct an asymmetric fusion protein. For example, if an immunoglobulin Fc region is incorporated into the fusion protein the CH3 domain can be used as a homodimerization domain, or the CH3 dimer interface region can be mutated so as to enable heterodimerization.
  • the fusion protein contains the BDs at opposite ends.
  • the BDs are located on both the amino-terminal (N-terminal) portion of the fusion protein and the carboxy-terminal (C-terminal) portion of the fusion protein.
  • all the TBDs reside on the same end of the fusion protein.
  • BDs reside on either the amino- or carboxy-terminal portions of the fusion protein.
  • the linker polypeptide contains an immunoglobulin Fc region.
  • the immunoglobulin Fc region is an IgG isotype selected from the group consisting of IgG1 isotype, IgG2 isotype, IgG3 isotype, and IgG4 isotype.
  • the immunoglobulin Fc region or immunologically active fragment thereof is an IgG isotype.
  • the immunoglobulin Fc region of the fusion protein is of human IgG1 isotype, having an amino acid sequence:
  • the immunoglobulin Fc region or immunologically active fragment thereof comprises a human IgG1 polypeptide sequence that is at least 50%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to the amino acid sequence of SEQ ID NO: 1.
  • the human IgG1 Fc region is modified at amino acid Asn297 (Boxed in SEQ ID NOs: 1-4, Kabat Numbering) to prevent to glycosylation of the fusion protein, e.g., Asn297Ala (N297A) or Asn297Asp (N297D).
  • the Fc region of the fusion protein is modified at amino acid Leu235 (Bold in SEQ ID NO: 1, Kabat Numbering) to alter Fc receptor interactions, e.g., Leu235Glu (L235E) or Leu235Ala (L235A).
  • the Fc region of the fusion protein is modified at amino acid Leu234 (Bold in SEQ ID NO: 1, Kabat Numbering) to alter Fc receptor interactions, e.g., modified at amino acid Leu234 (Boxed, Kabat Numbering) to alter Fc receptor interactions, e.g., Leu235Glu (L235E).
  • the Fc region of the fusion protein is Leu234Ala (L234A).
  • the Fc region of the fusion protein is altered at both amino acid 234 and 235, e.g., Leu234Ala and Leu235Ala (L234A/L235A) or Leu234Val and Leu235Ala (L234V/L235A).
  • the Fc region of the fusion protein is lacking an amino acid at one or more of the following positions to reduce Fc receptor binding: Glu233 (E233, Bold in SEQ ID NO: 1), Leu234 (L234), or Leu235 (L235).
  • the Fc region of the fusion protein is altered at Gly235 to reduce Fc receptor binding. For example, wherein Gly235 is deleted from the fusion protein.
  • the human IgG1 Fc region is modified at amino acid Gly236 (Boxed in SEQ ID NO: 1) to enhance the interaction with CD32A, e.g., Gly236Ala (G236A).
  • the human IgG1 Fc region lacks Lys447 (EU index of Kabat et al 1991 Sequences of Proteins of Immunological Interest ).
  • the Fc region of the fusion protein is altered at one or more of the following positions to reduce Fc receptor binding: Leu 234 (L234), Leu235 (L235), Asp265 (D265), Asp270 (D270), Ser298 (S298), Asn297 (N297), Asn325 (N325) orAla327 (A327).
  • Leu 234Ala (L234A), Leu235Ala (L235A), Asp265Asn (D265N), Asp270Asn (D270N), Ser298Asn (S298N), Asn297Ala (N297A), Asn325Glu (N325E) orAla327Ser (A327S).
  • modifications within the Fc region reduce binding to Fc-receptor-gamma receptors while have minimal impact on binding to the neonatal Fc receptor (FcRn).
  • the Fc region of the fusion protein is lacking an amino acid at one or more of the following positions to reduce Fc receptor binding: Glu233 (E233), Leu234 (L234), or Leu235 (L235).
  • Fc deletion of these three amino acids reduces the complement protein C1q binding.
  • PAPGGPSVFL FPPKPKDTLM ISRTPEVTCV VVDVSHEDPE VKFNWYVDGV EVHNAKTKPR EEQYNSTYRV VSVLTVLHQD WLNGKEYKCK VSNKALPAPI EKTISKAKGQ PREPQVYTLP PSRDELTKNQ VSLTCLVKGF YPSDIAVEWE SNGQPENNYK TTPPVLDSDG SFFLYSKLTV DKSRWQQGNV FSCSVMHEAL HNHYTQKSLS LSPGK
  • the immunoglobulin Fc region or immunologically active fragment thereof comprises a human IgG1 polypeptide sequence that is at least 50%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to the amino acid sequence of SEQ ID NO: 2.
  • the immunoglobulin Fc region or immunologically active fragment of the fusion protein is of human IgG2 isotype, having an amino acid sequence:
  • the fusion or immunologically active fragment thereof comprises a human IgG2 polypeptide sequence that is at least 50%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to the amino acid sequence of SEQ ID NO: 3.
  • the human IgG2 Fc region is modified at amino acid Asn297 (Boxed in SEQ ID NOs: 1, 3, 4, and 5, to prevent to glycosylation of the antibody, e.g., Asn297Ala (N297A).
  • the human IgG2 Fc region lacks Lys447, which corresponds to residue 217 of SEQ ID NO: 3 (EU index of Kabat et al 1991 Sequences of Proteins of Immunological Interest ).
  • the immunoglobulin Fc region or immunologically active fragment of the fusion protein is of human IgG3 isotype, having an amino acid sequence:
  • the antibody or immunologically active fragment thereof comprises a human IgG3 polypeptide sequence that is at least 50%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to the amino acid sequence of SEQ ID NO: 4.
  • the human IgG3 Fc region is modified at amino acid Asn297 (Boxed in SEQ ID NOs: 1-4, Kabat Numbering) to prevent to glycosylation of the antibody, e.g., Asn297Ala (N297A).
  • the human IgG3 Fc region is modified at amino acid 435 to extend the half-life, e.g., Arg435His (R435H, Boxed in SEQ ID NO: 3).
  • the human IgG3 Fc region lacks Lys447, which corresponds to residue of 218 SEQ ID NO: 4 (EU index of Kabat et al 1991 Sequences of Proteins of Immunological Interest ).
  • the immunoglobulin Fc region or immunologically active fragment of the fusion protein is of human IgG4 isotype, having an amino acid sequence:
  • the antibody or immunologically active fragment thereof comprises a human IgG4 polypeptide sequence that is at least 50%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to the amino acid sequence of SEQ ID NO: 5.
  • the human IgG4 Fc region is modified at amino acid 235 to alter Fc receptor interactions, e.g., Leu235Glu (L235E).
  • the human IgG4 Fc region is modified at amino acid Asn297 (Boxed in SEQ ID NOs: 1-4, Kabat Numbering) to prevent to glycosylation of the antibody, e.g., Asn297Ala (N297A).
  • the human IgG4 Fc region lacks Lys447, which corresponds to residue 218 of SEQ ID NO: 4 (EU index of Kabat et al 1991 Sequences of Proteins of Immunological Interest ).
  • the immunoglobulin Fc region or immunologically active fragment of the fusion protein is of human IgG4 isotype, having an amino acid sequence:
  • the antibody or immunologically active fragment thereof comprises a human IgG4 polypeptide sequence that is at least 50%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to the amino acid sequence of SEQ ID NO: 6.
  • the human IgG Fc region is modified to enhance FcRn binding.
  • Fc mutations that enhance binding to FcRn are Met252Tyr, Ser254Thr, Thr256Glu (M252Y, S254T, T256E, respectively) (Kabat numbering, Dall'Acqua et al 2006, 1 Biol Chem Vol. 281(33) 23514-23524), Met428Leu and Asn434Ser (M428L, N434S) (Zalevsky et al 2010 Nature Biotech, Vol.
  • Met252 corresponds to residue 23 in SEQ ID NOs: 1, 4, and 5 and residue 22 in SEQ ID NO: 3.
  • Ser254 corresponds to corresponds to residue 25 in SEQ ID NOs: 1, 4, and 5 and residue 24 in SEQ ID NO: 3.
  • Thr256 corresponds to residue 27 in SEQ ID NOs: 1, 4, and 5 and residue 26 in SEQ ID NO: 3.
  • Met428 corresponds to residue 199 in SEQ ID NOs: 1, 4, and 5 and residue 198 in SEQ ID NO: 3.
  • Asn434 corresponds to residue 205 in SEQ ID NOs: 1, 4, and 5 and residue 204 in SEQ ID NO: 3.
  • the Fc polypeptide is mutated or modified.
  • the mutated or modified Fc polypeptide includes the following mutations: Met252Tyr and Met428Leu (M252Y, M428L) using the Kabat numbering system.
  • the human IgG Fc region is modified to alter antibody-dependent cellular cytotoxicity (ADCC) and/or complement-dependent cytotoxicity (CDC), e.g., the amino acid modifications described in Natsume et al., 2008 Cancer Res, 68(10): 3863-72; Idusogie et al., 2001 J Immunol, 166(4): 2571-5; Moore et al., 2010 mAbs, 2(2): 181-189; Lazar et al., 2006 PNAS, 103(11): 4005-4010, Shields et al., 2001 JBC, 276(9): 6591-6604; Stavenhagen et al., 2007 Cancer Res, 67(18): 8882-8890; Stavenhagen et al., 2008 Advan.
  • ADCC antibody-dependent cellular cytotoxicity
  • CDC complement-dependent cytotoxicity
  • mutations that enhance ADCC include modification at Ser239 and Ile332, for example Ser239Asp and Ile332Glu (S239D, 1332E).
  • mutations that enhance CDC include modifications at Lys326, which corresponds to residue 97 of SEQ ID NOs: 1, 4, and 5 and residue 96 of SEQ ID NO: 3, and Glu333, which corresponds to residue 104 of SEQ ID NOs: 1, 4, and 5 and residue 103 of SEQ ID NO: 3.
  • the Fc region is modified at one or both of these positions, for example, Lys326Ala and/or Glu333Ala (K326A and E333A).
  • the human IgG Fc region is modified to induce heterodimerization.
  • having an amino acid modification within the CH3 domain at Thr366, which when replaced with a more bulky amino acid, e.g., Trp (T366W) is able to preferentially pair with a second CH3 domain having amino acid modifications to less bulky amino acids at positions Thr366, which corresponds to residue 137 of SEQ ID NOs: 1, 4, and 5 and residue 136 of SEQ ID NO: 3, Leu368, which corresponds to residue 139 of SEQ ID NOs: 1, 4, and 5 and residue 138 of SEQ ID NO: 3, and Tyr407, which corresponds to residue 178 of SEQ ID NOs: 1, 4, and 5 and residue 177 of SEQ ID NO: 3, e.g., Ser, Ala and Val, respectively (T366S/L368A/Y407V).
  • Heterodimerization via CH3 modifications can be further stabilized by the introduction of a disulfide bond, for example, by changing Ser354, which corresponds to residue 125 of SEQ ID NOs: 1, 4, and 5 and residue 124 of SEQ ID NO: 3, to Cys (S354C) and Tyr349, which corresponds to residue 120 of SEQ ID NOs: 1, 4, and 5 and residue 119 of SEQ ID NO: 3, to Cys (Y349C) on opposite CH3 domains (Reviewed in Carter, 2001 Journal of Immunological Methods, 248: 7-15).
  • the Fc region may be modified at the protein-A binding site on one member of the heterodimer so as to prevent protein-A binding and thereby enable more efficient purification of the heterodimeric fusion protein.
  • An exemplary modification within this binding site is Ile253, which corresponds to residue 24 of SEQ ID NOs: 1, 4, and 5 and residue 23 of SEQ ID NO: 3, for example, Ile253Arg (I253R).
  • I253R modification maybe combined with either the T366S/L368A/Y407V modifications or with the T366W modifications.
  • the T366S/L368A/Y407V modified Fc is capable of forming homodimers as there is no steric occlusion of the dimerization interface as there is in the case of the T336W modified Fc. Therefore, in some embodiments, the I253R modification is combined with the T366S/L368A/Y407V modified Fc to disallow purification any homodimeric Fc that may have formed.
  • the human IgG Fc region is modified to prevent dimerization.
  • the fusion proteins of the present disclosure are monomeric. For example, modification at residue Thr366 to a charged residue, e.g. Thr366Lys, Thr366Arg, Thr366Asp, or Thr366Glu (T366K, T366R, T366D, or T366E, respectively), prevents CH3-CH3 dimerization.
  • the Fc region of the fusion protein is altered at one or more of the following positions to reduce Fc receptor binding: Leu 234 (L234), Leu235 (L235), Asp265 (D265), Asp270 (D270), Ser298 (S298), Asn297 (N297), Asn325 (N325) orAla327 (A327).
  • Leu 234Ala (L234A), Leu235Ala (L235A), Asp265Asn (D265N), Asp270Asn (D270N), Ser298Asn (S298N), Asn297Ala (N297A), Asn325Glu (N325E) orAla327Ser (A327S).
  • modifications within the Fc region reduce binding to Fc-receptor-gamma receptors while have minimal impact on binding to the neonatal Fc receptor (FcRn).
  • the fusion protein contains a polypeptide derived from an immunoglobulin hinge region.
  • the hinge region can be selected from any of the human IgG isotypes.
  • the fusion protein may contain a modified IgG1 hinge having the sequence of EPKSSDKTHTCPPC (SEQ ID NO: 7), where in the Cys220 that forms a disulfide with the C-terminal cysteine of the light chain is mutated to serine, e.g., Cys220Ser (C220S).
  • the fusion protein contains a truncated hinge having a sequence DKTHTCPPC (SEQ ID NO: 8).
  • the fusion protein has a modified hinge from IgG4, which is modified to prevent or reduce strand exchange, e.g., Ser228Pro (S228P), having the sequence ESKYGPPCPPC (SEQ ID NO: 9).
  • the fusion protein contains one or more linker polypeptides. In other embodiments, the fusion protein contains one or more linker and hinge polypeptides.
  • the fusion proteins of the present disclosure lack or have reduced Fucose attached to the N-linked glycan-chain at N297.
  • Fucose attached to the N-linked glycan-chain at N297.
  • There are numerous ways to prevent fucosylation including but not limited to production in a FUT8 deficient cell line; addition inhibitors to the mammalian cell culture media, for example, Castanospermine, 2-deoxy-fucose, 2-flurofucose; the use of production cell lines with naturally reduced fucosylation pathways, and metabolic engineering of the production cell line.
  • the single domain antibody, VHH, or humanized single domain antibody, or human single domain antibody is engineered to eliminate recognition by pre-existing antibodies found in humans.
  • single domain antibodies of the present disclosure are modified by mutation of position Leu11, for example, Leu11Glu (L11E) or Leu11Lys (L11K).
  • single domain antibodies of the present disclosure are modified by changes in carboxy-terminal region, for example, the terminal sequence consists of GQGTLVTVKPGG (SEQ ID NO: 14) or GQGTLVTVEPGG (SEQ ID NO: 15) or modification thereof.
  • the single domain antibodies of the present disclosure are modified by mutation of position 11 and by changes in carboxy-terminal region.
  • the TBDs of the fusion proteins of the present disclosure are operably linked via amino acid linkers.
  • these linkers are composed predominately of the amino acids Glycine and Serine, denoted as GS-linkers herein.
  • the GS-linkers of the fusion proteins of the present disclosure can be of various lengths, for example, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20 amino acids in length.
  • the GS-linker comprises an amino acid sequence selected from the group consisting of GGSGGS, i.e., (GGS) 2 (SEQ ID NO: 10); GGSGGSGGS, i.e., (GGS) 3 (SEQ ID NO: 11); GGSGGSGGSGGS, i.e., (GGS) 4 (SEQ ID NO: 12); and GGSGGSGGSGGSGGS, i.e., (GGS) 5 (SEQ ID NO: 13).
  • GGSGGS i.e., (GGS) 2 (SEQ ID NO: 10
  • GGSGGSGGS i.e., (GGS) 3 (SEQ ID NO: 11
  • GGSGGSGGSGGS i.e., (GGS) 4
  • GGSGGSGGSGGSGGS i.e., (GGS) 5 (SEQ ID NO: 13).
  • the multivalent binding fusion protein is tetravalent.
  • the tetravalent fusion protein has the following structure: BD-Linker-BD-Linker-Hinge-Fc.
  • the tetravalent fusion protein has the following structure: BD-Linker-Hinge-Fc-Linker-BD.
  • the BD of the tetravalent fusion protein is a single domain antibody or VHH. In some embodiments, each BD of the tetravalent fusion protein is a single domain antibody or VHH. In some embodiments, the tetravalent fusion protein has the following structure: VHH-Linker-VHH-Linker-Hinge-Fc, where the VHH is a humanized or fully human VHH sequence. In some embodiments, the tetravalent fusion protein has the following structure: VHH-Linker-Hinge-Fc-Linker-VHH, where the VHH is a humanized or fully human VHH sequence.
  • the multivalent TNFRSF binding fusion protein is tetravalent.
  • the tetravalent TNFRSF binding fusion protein has the following structure: TBD-Linker-TBD-Linker-Hinge-Fc.
  • the tetravalent TNFRSF binding fusion protein has the following structure: TBD-Linker-Hinge-Fc-Linker-TBD.
  • the TBD of the tetravalent TNFRSF binding fusion protein is a single domain antibody or VHH. In some embodiments, each TBD of the multivalent TNFRSF binding fusion protein is single domain antibody or VHH. In some embodiments, the multivalent TNFRSF binding fusion protein is tetravalent. In some embodiments, the tetravalent TNFRSF binding fusion protein has the following structure: VHH-Linker-VHH-Linker-Hinge-Fc, where the VHH is a humanized or fully human VHH sequence. In some embodiments, the tetravalent TNFRSF binding fusion protein has the following structure: VHH-Linker-Hinge-Fc-Linker-VHH, where the VHH is a humanized or fully human VHH sequence.
  • the GS-linker comprises an amino acid sequence selected from the group consisting of GGSGGS, i.e., (GGS) 2 (SEQ ID NO: 10); GGSGGSGGS, i.e., (GGS) 3 (SEQ ID NO: 11); GGSGGSGGSGGS, i.e., (GGS) 4 (SEQ ID NO: 12); and GGSGGSGGSGGSGGS, i.e., (GGS) 5 (SEQ ID NO: 13).
  • GGSGGS i.e., (GGS) 2 (SEQ ID NO: 10
  • GGSGGSGGS i.e., (GGS) 3 (SEQ ID NO: 11
  • GGSGGSGGSGGS i.e., (GGS) 4
  • GGSGGSGGSGGSGGS i.e., (GGS) 5 (SEQ ID NO: 13).
  • the TBD of the tetravalent TNFRSF binding fusion protein is a single domain antibody or VHH. In some embodiments, each TBD of the multivalent TNFRSF binding fusion protein is single domain antibody or VHH. In some embodiments, the multivalent fusion protein is hexavalent. In some embodiments, the hexavalent fusion protein has the following structure: BD-Linker-TBD-Linker-BD-Linker-Hinge-Fc. In some embodiments, the hexavalent fusion protein has the following structure: BD-Linker-BD-Linker-Hinge-Fc-Linker-BD, or BD-Linker-Hinge-Fc-Linker-BD-Linker-BD.
  • the BD of the hexavalent fusion protein is a single domain antibody or VHH. In some embodiments, each BD of the hexavalent fusion protein is a single domain antibody or VHH. In some embodiments, the hexavalent fusion protein has the following structure: VHH-Linker-VHH-Linker-VHH-Linker-Hinge-Fc, where the VHH is a humanized or fully human VHH sequence.
  • the hexavalent fusion protein has the following structure: VHH-Linker-VHH-Linker-Hinge-Fc-Linker-VHH, or VHH-Linker-Hinge-Fc-Linker-VHH-Linker-VHH where the VHH is a humanized or fully human VHH sequence.
  • the multivalent TNFRSF binding fusion protein is hexavalent.
  • the hexavalent TNFRSF binding fusion protein has the following structure: TBD-Linker-TBD-Linker-TBD-Linker-Hinge-Fc.
  • the hexavalent TNFRSF binding fusion protein has the following structure: TBD-Linker-TBD-Linker-Hinge-Fc-Linker-TBD, or TBD-Linker-Hinge-Fc-Linker-TBD-Linker-TBD.
  • the multivalent TNFRSF binding fusion protein is hexavalent.
  • the hexavalent TNFRSF binding fusion protein has the following structure: VHH-Linker-VHH-Linker-VHH-Linker-Hinge-Fc, where the VHH is a humanized or fully human VHH sequence.
  • the hexavalent TNFRSF binding fusion protein has the following structure: VHH-Linker-VHH-Linker-Hinge-Fc-Linker-VHH, or VHH-Linker-Hinge-Fc-Linker-VHH-Linker-VHH where the VHH is a humanized or fully human VHH sequence.
  • the multivalent fusion protein lacks an Fc region.
  • the fusion protein is tetravalent and has the following structure BD-Linker-BD-Linker-BD-Linker-BD-Linker.
  • the fusion protein is pentavalent and has the following structure BD-Linker-BD-Linker-BD-Linker-BD-Linker-BD-Linker-BD.
  • the fusion protein is hexavalent and has the following structure BD-Linker-BD-Linker-BD-Linker-BD-Linker-BD-Linker-BD-Linker-BD.
  • the multivalent TNFRSF binding fusion protein lacks an Fc region.
  • the TNFRSF binding fusion protein is tetravalent and has the following structure TBD-Linker-TBD-Linker-TBD-Linker-TBD-Linker.
  • the TNFRSF binding fusion protein is pentavalent and has the following structure TBD-Linker-TBD-Linker-TBD-Linker-TBD-Linker-TBD-Linker-TBD.
  • the TNFRSF binding fusion protein is hexavalent and has the following structure TBD-Linker-TBD-Linker-TBD-Linker-TBD-Linker-TBD-Linker-TBD-Linker-TBD.
  • the BD of a multivalent fusion protein is a single domain antibody or VHH.
  • the multivalent fusion protein lacks an Fc region.
  • the fusion protein is tetravalent and has the following structure VHH-Linker-VHH-Linker-VHH-Linker-VHH-Linker.
  • the fusion protein is pentavalent and has the following structure VHH-Linker-VHH-Linker-VHH-Linker-VHH-Linker-VHH-Linker-VHH.
  • the fusion protein is hexavalent and has the following structure VHH-Linker-VHH-Linker-VHH-Linker-VHH-Linker-VHH-Linker-VHH-Linker-VHH-Linker-VHH.
  • the VHH is a humanized or fully human VHH sequence.
  • the TBD of the a multivalent TNFRSF binding fusion protein is a single domain antibody or VHH.
  • the multivalent TNFRSF binding fusion protein lacks an Fc region.
  • the TNFRSF binding fusion protein is tetravalent and has the following structure VHH-Linker-VHH-Linker-VHH-Linker-VHH-Linker.
  • the TNFRSF binding fusion protein is pentavalent and has the following structure VHH-Linker-VHH-Linker-VHH-Linker-VHH-Linker-VHH.
  • the TNFRSF binding fusion protein is hexavalent and has the following structure VHH-Linker-VHH-Linker-VHH-Linker-VHH-Linker-VHH-Linker-VHH-Linker-VHH-Linker-VHH.
  • the VHH is a humanized or fully human VHH sequence.
  • the GS-linker comprises an amino acid sequence selected from the group consisting of GGSGGS, i.e., (GGS) 2 (SEQ ID NO: 10); GGSGGSGGS, i.e., (GGS) 3 (SEQ ID NO: 11); GGSGGSGGSGGS, i.e., (GGS) 4 (SEQ ID NO: 12); and GGSGGSGGSGGSGGS, i.e., (GGS) 5 (SEQ ID NO: 13).
  • GGSGGS i.e., (GGS) 2 (SEQ ID NO: 10
  • GGSGGSGGS i.e., (GGS) 3 (SEQ ID NO: 11
  • GGSGGSGGSGGS i.e., (GGS) 4
  • GGSGGSGGSGGSGGS i.e., (GGS) 5 (SEQ ID NO: 13).
  • the fusion proteins are multispecific containing a TBD and a binding domain directed toward a second antigen.
  • the second antigen binding domain can be positioned at numerous positions within the molecule relative to the TBD.
  • the second antigen binding domain is located N-terminal TBD.
  • the second antigen binding domain is located to C-terminal to the TBD.
  • the second antigen binding domain is located on a distinct polypeptide that associates with a first polypeptide containing the TBD.
  • the fusion proteins are multispecific containing an anti-OX40 binding domain and a binding domain directed toward a second antigen.
  • the second antigen binding domain can be positioned at numerous positions within the molecule relative to the an anti-OX40 binding domain.
  • the second antigen binding domain is located N-terminal an anti-OX40 binding domain.
  • the second antigen binding domain is located to C-terminal to the an anti-OX40 binding domain.
  • the second antigen binding domain is located on a distinct polypeptide that associates with a first polypeptide containing the an anti-OX40 binding domain.
  • the fusion proteins are multispecific containing an anti-PDL1 binding domain and a binding domain directed toward a second antigen.
  • the second antigen binding domain can be positioned at numerous positions within the molecule relative to the an anti-PDL1 binding domain.
  • the second antigen binding domain is located N-terminal an anti-PDL1 binding domain.
  • the second antigen binding domain is located to C-terminal to the an anti-PDL1 binding domain.
  • the second antigen binding domain is located on a distinct polypeptide that associates with a first polypeptide containing the an anti-PDL1 binding domain.
  • the TBD within the multispecific TNFRSF binding fusion protein is a single domain antibody or VHH.
  • the TBD within the multispecific TNFRSF binding fusion protein is a composed of antibody variable heavy (VH) chain and variable light (VL) chain region.
  • VH and VL of the TBD are formatted as a single chain variable fragment (scFv) connected via a linker region.
  • the VH and VL of the TBD are formatted as a FAB fragment that associates via a constant heavy 1 (CH1) domain and a constant light chain (CL) domain.
  • non-antibody heterodimerization domains are utilized to enable the proper association of the VH and VL of the TBD.
  • the TBD within the multispecific TNFRSF binding fusion protein is derived from non-antibody scaffold proteins for example but not limited to designed ankyrin repeat proteins (darpins), avimer, anticalin/lipocalins, centyrins and fynomers.
  • the TBD within the multispecific TNFRSF binding fusion protein is a single domain antibody or VHH that binds OX40.
  • the anti-OX40 binding domain within the multispecific TNFRSF binding fusion protein is a composed of antibody variable heavy (VH) chain and variable light (VL) chain region.
  • VH and VL of the anti-OX40 binding domain are formatted as a single chain variable fragment (scFv) connected via a linker region.
  • the VH and VL of the anti-OX40 binding domain are formatted as a Fab fragment that associates via a constant heavy 1 (CH1) domain and a constant light chain (CL) domain.
  • non-antibody heterodimerization domains are utilized to enable the proper association of the VH and VL of the anti-OX40 binding domain.
  • the anti-OX40 binding domain within the multispecific TNFRSF binding fusion protein is derived from non-antibody scaffold proteins for example but not limited to designed ankyrin repeat proteins (darpins), avimer, anticalin/lipocalins, centyrins and fynomers.
  • the binding domain within the multispecific fusion protein is a single domain antibody or VHH that binds PDL1.
  • the anti-PDL1 binding domain within the multispecific TNFRSF binding fusion protein is a composed of antibody variable heavy (VH) chain and variable light (VL) chain region.
  • VH and VL of the anti-PDL1 binding domain are formatted as a single chain variable fragment (scFv) connected via a linker region.
  • the VH and VL of the anti-PDL1 binding domain are formatted as a Fab fragment that associates via a constant heavy 1 (CH1) domain and a constant light chain (CL) domain.
  • non-antibody heterodimerization domains are utilized to enable the proper association of the VH and VL of the anti-PDL1 binding domain.
  • the anti-PDL1 binding domain within the multispecific fusion protein is derived from non-antibody scaffold proteins for example but not limited to designed ankyrin repeat proteins (darpins), avimer, anticalin/lipocalins, centyrins and fynomers.
  • the anti-OX40 binding domain of the multispecific TNFRSF binding fusion protein is a bispecific antibody or antigen-binding fragment thereof.
  • the anti-PDL1 binding domain of the multispecific fusion protein is a bispecific antibody or antigen-binding fragment thereof.
  • the bispecific antibody or antigen-fragment thereof can be any suitable bispecific format known in the art, including, by way of non-limiting example, formats based on antibody fragments such as, e.g., X-Link Fab, cross-linked Fab fragments; tascFv/BiTE, tandem-scFv/Bispecific T cell Engager; Db, diabody; taDb, tandem diabody; formats based on Fc-fusions such as, e.g., Db-Fc, diabody-Fc fusion; taDb-Fc fusion, tandem diabody-Fc fusion; taDb-CH3, tandem diabody-CH3 fusion; (scFv)4-Fc, tetra scFv-Fc fusion; DVD-Ig, dual variable domain immunoglobulin; IgG formats such as, e.g., knob-hole and SEED, strand exchange engineered domain; Cross
  • At least one TBD comprises an amino acid sequence selected from the group consisting of SEQ ID NO: 16-29 and 377-386.
  • At least one TBD comprises a complementarity determining region 1 (CDR1) comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 30, 36, and 44; a complementarity determining region 2 (CDR2) comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 31, 35, and 37; and a complementarity determining region 3 (CDR3) comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 32-34, 48-43, and 45.
  • CDR1 complementarity determining region 1
  • CDR2 complementarity determining region 2
  • CDR3 complementarity determining region 3
  • At least one BD comprises an amino acid sequence selected from the group consisting of SEQ ID NO: 46-57.
  • At least one BD comprises an amino acid sequence selected from the group consisting of SEQ ID NO: 52-57.
  • At least one BD comprises a CDR1 comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 58, 61, and 64; a CDR2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 59, 62, 65, and 69; and a CDR3 comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 60, 63, 66-68, and 70.
  • At least one TBD comprises an amino acid sequence selected from the group consisting of SEQ ID NO: 16-29 and 377-386, and at least one BD comprises an amino acid sequence selected from the group consisting of SEQ ID NO: 46-57.
  • At least one TBD comprises an amino acid sequence selected from the group consisting of SEQ ID NO: 16-29 and 377-386, and at least one BD comprises an amino acid sequence selected from the group consisting of SEQ ID NO: 52-57.
  • At least one TBD comprises a complementarity determining region 1 (CDR1) comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 30, 36, and 44; a complementarity determining region 2 (CDR2) comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 31, 35, and 37; and a complementarity determining region 3 (CDR3) comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 32-34, 48-43, and 45, and at least one BD comprises a CDR1 comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 58, 61, and 64; a CDR2 comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 59, 62, 65, and 69; and a CDR3 comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 60, 63, 66-68, and 70.
  • CDR1 comprising an amino acid sequence selected from the group consisting of SEQ
  • FIG. 1 is schematic of exemplary multivalent and multispecific fusion proteins of the present disclosure.
  • FIGS. 2A and 2B are graphs demonstrating the ability of OX40 single domain antibodies (VHHs) to bind cell surface OX40. Binding was assessed by flow cytometry using OX40 expressing CHO cells and data is presented as median fluorescence intensity.
  • VHHs OX40 single domain antibodies
  • FIG. 3 is a graph demonstrating the capacity of OX40 single domain antibodies (VHHs) to block the interaction between OX40 and OX40L.
  • VHHs OX40 single domain antibodies
  • 2E4 blocks the interaction between OX40 and OX40L, while the other single domain antibodies do not.
  • a single domain antibody that binds GITR was included as a negative control. Blocking was assessed by flow cytometry using a OX40L-citrine fusion protein and data is presented as median fluorescence intensity.
  • FIG. 4 is a graph depicting the ability of OX40 single domain antibodies to bind cynomolgus monkey OX40. Binding was assessed by flow cytometry using cynoOX40 expressing CHO cells and data is presented as median fluorescence intensity.
  • FIG. 5A is schematic depicting the format of multivalent OX40 binding fusion proteins and estimated molecular weights.
  • FIG. 5B is a photograph of a Coomassie blue stain SDS-PAGE gel of multivalent OX40 binding fusion proteins under reducing and non-reducing conditions.
  • FIG. 6 is a graph demonstrating enhanced OX40 signaling is mediated by higher valency binding. Shown here is the comparison between tetravalent and bivalent binding of OX40 using the fusion proteins of the present disclosure. OX40 signaling was monitored using an NF-kB reporter 293 cell line expressing OX40. Fusion proteins incorporating 1D10 as the TBD were used in these assays.
  • FIGS. 7A and 7B are graphs demonstrating enhanced OX40 signaling is mediated by higher valency binding. Shown in FIG. 7A is the comparison between tetravalent and hexavalent binding of OX40 using the fusion proteins of the present disclosure. Shown in FIG. 7B is the comparison between hexavalent binding of OX40 using a fusion protein of the present disclosure and a hexameric OX40L-fusion protein (described in U.S. Pat. No. 7,959,925).
  • the multivalent OX40 binding fusion proteins of the present disclosure display equivalent or enhanced OX40 agonistic activity compared to the hexameric OX40L fusion protein. OX40 signaling was monitored using a NF-kB reporter 293 cell line expressing OX40. Fusion proteins incorporating 1D10 as the TBD were used in these assays.
  • FIGS. 8A and 8B are a series of graphs depicting the elution profile from a size exclusion chromatography (SEC) column (Superdex 200) for tetravalent ( FIG. 8A ) and hexavalent ( FIG. 8B ) 1D10. Calculated molecular weights based on the retention volume (standard curve) are also shown.
  • SEC size exclusion chromatography
  • FIG. 9 is a graph demonstrating OX40 signaling is mediated by various multivalent formats of the fusion proteins of the present disclosure, including hexavalent with three tandem OX40 VHHs linked to an Fc region, tetravalent with two tandem OX40 VHHs linked to an Fc region and tetravalent with an N-terminal and C-terminal OX40 VHH separated by an Fc region.
  • OX40 signaling was monitored using an NF-kB reporter 293 cell line expressing OX40. Fusion proteins incorporating 1D10 as the TBD were used in for these assays.
  • FIGS. 10A, 10B, and 10C depict PDL1-dependent OX40 agonism mediated by bispecific PDL1-OX40 targeting fusion proteins of the present disclosure.
  • FIGS. 10 A and B are conceptual schematics wherein the bispecific fusion protein have minimal OX40 agonistic properties ( FIG. 10A ) unless bound by a PDL1 expressing cell ( FIG. 10B ).
  • FIG. 10C is graph demonstrating the ability of a PDL1-positive cell (here PDL1 transfected CHO cells) to mediate OX40 signaling and the inability of PDL1-negative cell (here untransfected CHO cells) to mediate OX40 signaling.
  • OX40 signaling was monitored using a NF-kB reporter 293 cell line expressing OX40. Numerous distinct bispecific fusion proteins are shown in this figure, each containing a distinct OX40 binding VHH (e.g., G3, 2E4, 3G9, 1D10) and the same PDL1 VHH, 28A10.
  • VHH e.g., G3, 2E4, 3G9, 1D10
  • FIG. 11 depicts FR ⁇ -dependent OX40 agonists signaling mediated by bispecific FR ⁇ -OX40 targeting fusion proteins of the present disclosure.
  • OX40 signaling was monitored using a NF-kB reporter 293 cell line expressing OX40.
  • Numerous distinct bispecific fusion proteins are shown in this figure, each containing a distinct FR ⁇ binding VHH (e.g., 1G10, 1A3, 57, 5) and the same OX40 VHH, 1D10.
  • FIGS. 12A and 12B are a series of graphs depicting the ability of humanized OX40 single domain antibodies to bind human OX40 and cynomolgus OX40. Binding was assessed by flow cytometry using OX40 expressing CHO cells and data is presented as median fluorescence intensity.
  • FIGS. 13A and 13B are a pair of graphs depicting the ability of humanized OX40 single domain antibodies to bind various TNFRSF members.
  • Various humanized sdAbs of the disclosure as the TBD were used in the tetravalent and hexavalent molecules for these assays.
  • FIGS. 14A and 14B are a pair of graphs demonstrating OX40 signaling is mediated by various multivalent formats of the fusion proteins of the present disclosure, including hexavalent with three tandem OX40 VHHs linked to an Fc region, tetravalent with two tandem OX40 VHHs linked to an Fc region and tetravalent with an N-terminal and C-terminal OX40 VHH separated by an Fc region.
  • OX40 signaling was monitored using an NF-kB reporter 293 cell line expressing OX40.
  • Various humanized sdAbs of the disclosure as the TBD were used in the tetravalent and hexavalent molecules for these assays.
  • the terms “dual-targeting fusion protein” and “antibody” can be synonyms.
  • the term “antibody” refers to immunoglobulin molecules and immunologically active portions of immunoglobulin (Ig) molecules, i.e., molecules that contain an antigen binding site that specifically binds (immunoreacts with) an antigen.
  • immunoglobulin immunoglobulin
  • Ig immunoglobulin
  • By “specifically bind” or “immunoreacts with” “or directed against” is meant that the antibody reacts with one or more antigenic determinants of the desired antigen and does not react with other polypeptides or binds at much lower affinity (K d >10 ⁇ 6 ).
  • Antibodies include, but are not limited to, polyclonal, monoclonal, chimeric, dAb (domain antibody), single chain, Fab, Fab′ and F(ab′) 2 fragments, Fv, scFvs, a Fab expression library, and single domain antibody (sdAb) fragments, for example, V H H, V NAR , engineered V H or V K .
  • the basic antibody structural unit is known to comprise a tetramer.
  • Each tetramer is composed of two identical pairs of polypeptide chains, each pair having one “light” (about 25 kDa) and one “heavy” chain (about 50-70 kDa).
  • the amino-terminal portion of each chain includes a variable region of about 100 to 110 or more amino acids primarily responsible for antigen recognition.
  • the carboxy-terminal portion of each chain defines a constant region primarily responsible for effector function.
  • antibody molecules obtained from humans relate to any of the classes IgG, IgM, IgA, IgE and IgD, which differ from one another by the nature of the heavy chain present in the molecule. Certain classes have subclasses (also known as isotypes) as well, such as IgG 1 , IgG 2 , and others.
  • the light chain may be a kappa chain or a lambda chain.
  • MAb monoclonal antibody
  • CDRs complementarity determining regions
  • antigen binding site refers to the part of the immunoglobulin molecule that participates in antigen binding.
  • the antigen binding site is formed by amino acid residues of the N-terminal variable (“V”) regions of the heavy (“H”) and light (“L”) chains.
  • V N-terminal variable
  • L light
  • hypervariable regions Three highly divergent stretches within the V regions of the heavy and light chains, referred to as “hypervariable regions,” are interposed between more conserved flanking stretches known as “framework regions,” or “FRs”.
  • FR refers to amino acid sequences which are naturally found between, and adjacent to, hypervariable regions in immunoglobulins.
  • the three hypervariable regions of a light chain and the three hypervariable regions of a heavy chain are disposed relative to each other in three-dimensional space to form an antigen-binding surface.
  • the antigen-binding surface is complementary to the three-dimensional surface of a bound antigen, and the three hypervariable regions of each of the heavy and light chains are referred to as “complementarity-determining regions,” or “CDRs.”
  • CDRs complementarity-determining regions
  • single domain antibody (sdAb) fragments portions of the fusion proteins of the present disclosure are referred to interchangeably herein as targeting polypeptides herein.
  • epitopic determinants include any protein determinant capable of specific binding to/by an immunoglobulin or fragment thereof, or a T-cell receptor.
  • epitopic determinants usually consist of chemically active surface groupings of molecules such as amino acids or sugar side chains and usually have specific three dimensional structural characteristics, as well as specific charge characteristics.
  • An antibody is said to specifically bind an antigen when the dissociation constant is ⁇ 1 mM, for example, in some embodiments, ⁇ 1 ⁇ M; e.g., ⁇ 100 nM, ⁇ 10 nM or ⁇ 1 nM.
  • immunological binding refers to the non-covalent interactions of the type which occur between an immunoglobulin molecule and an antigen for which the immunoglobulin is specific.
  • the strength, or affinity of immunological binding interactions can be expressed in terms of the dissociation constant (K d ) of the interaction, wherein a smaller K d represents a greater affinity.
  • Immunological binding properties of selected polypeptides can be quantified using methods well known in the art. One such method entails measuring the rates of antigen-binding site/antigen complex formation and dissociation, wherein those rates depend on the concentrations of the complex partners, the affinity of the interaction, and geometric parameters that equally influence the rate in both directions.
  • both the “on rate constant” (k on ) and the “off rate constant” (k off ) can be determined by calculation of the concentrations and the actual rates of association and dissociation. (See Nature 361:186-87 (1993)).
  • the ratio of k off /k on enables the cancellation of all parameters not related to affinity, and is equal to the dissociation constant K d . (See, generally, Davies et al. (1990) Annual Rev Biochem 59:439-473).
  • An antibody of the present disclosure is said to specifically bind to an antigen, when the equilibrium binding constant (K d ) is ⁇ 1 mM, in some embodiments, ⁇ 1 ⁇ M, ⁇ 100 nM, ⁇ 10 nM, or ⁇ 100 pM to about 1 pM, as measured by assays such as radioligand binding assays, surface plasmon resonance (SPR), flow cytometry binding assay, or similar assays known to those skilled in the art.
  • assays such as radioligand binding assays, surface plasmon resonance (SPR), flow cytometry binding assay, or similar assays known to those skilled in the art.
  • isolated polynucleotide shall mean a polynucleotide of genomic, cDNA, or synthetic origin or some combination thereof, which by virtue of its origin the “isolated polynucleotide” (1) is not associated with all or a portion of a polynucleotide in which the “isolated polynucleotide” is found in nature, (2) is operably linked to a polynucleotide which it is not linked to in nature, or (3) does not occur in nature as part of a larger sequence.
  • isolated protein means a protein of cDNA, recombinant RNA, or synthetic origin or some combination thereof, which by virtue of its origin, or source of derivation, the “isolated protein” (1) is not associated with proteins found in nature, (2) is free of other proteins from the same source, e.g., free of marine proteins, (3) is expressed by a cell from a different species, or (4) does not occur in nature.
  • polypeptide is used herein as a generic term to refer to native protein, fragments, or analogs of a polypeptide sequence. Hence, native protein fragments, and analogs are species of the polypeptide genus.
  • naturally-occurring refers to the fact that an object can be found in nature.
  • a polypeptide or polynucleotide sequence that is present in an organism (including viruses) that can be isolated from a source in nature and which has not been intentionally modified by man in the laboratory or otherwise is naturally-occurring.
  • operably linked refers to positions of components so described are in a relationship permitting them to function in their intended manner.
  • a control sequence “operably linked” to a coding sequence is ligated in such a way that expression of the coding sequence is achieved under conditions compatible with the control sequences.
  • control sequence refers to polynucleotide sequences which are necessary to effect the expression and processing of coding sequences to which they are ligated. The nature of such control sequences differs depending upon the host organism in prokaryotes, such control sequences generally include promoter, ribosomal binding site, and transcription termination sequence in eukaryotes, generally, such control sequences include promoters and transcription termination sequence.
  • control sequences is intended to include, at a minimum, all components whose presence is essential for expression and processing, and can also include additional components whose presence is advantageous, for example, leader sequences and fusion partner sequences.
  • polynucleotide refers to a polymeric boron of nucleotides of at least 10 bases in length, either ribonucleotides or deoxynucleotides or a modified form of either type of nucleotide.
  • the term includes single and double stranded forms of DNA.
  • oligonucleotide includes naturally occurring, and modified nucleotides linked together by naturally occurring, and non-naturally occurring oligonucleotide linkages. Oligonucleotides are a polynucleotide subset generally comprising a length of 200 bases or fewer. In some embodiments, oligonucleotides are 10 to 60 bases in length and in some embodiments, 12, 13, 14, 15, 16, 17, 18, 19, or 20 to 40 bases in length. Oligonucleotides are usually single stranded, e.g., for probes, although oligonucleotides may be double stranded, e.g., for use in the construction of a gene mutant. Oligonucleotides of the disclosure are either sense or antisense oligonucleotides.
  • nucleotides includes deoxyribonucleotides and ribonucleotides.
  • modified nucleotides referred to herein includes nucleotides with modified or substituted sugar groups and the like.
  • oligonucleotide linkages includes oligonucleotides linkages such as phosphorothioate, phosphorodithioate, phosphoroselerloate, phosphorodiselenoate, phosphoroanilothioate, phoshoraniladate, phosphoronmidate, and the like. See e.g., LaPlanche et al. Nucl. Acids Res.
  • oligonucleotide can include a label for detection, if desired.
  • the term “selectively hybridize” referred to herein means to detectably and specifically bind.
  • Polynucleotides, oligonucleotides and fragments thereof in accordance with the disclosure selectively hybridize to nucleic acid strands under hybridization and wash conditions that minimize appreciable amounts of detectable binding to nonspecific nucleic acids.
  • High stringency conditions can be used to achieve selective hybridization conditions as known in the art and discussed herein.
  • the nucleic acid sequence homology between the polynucleotides, oligonucleotides, and fragments of the disclosure and a nucleic acid sequence of interest will be at least 80%, and more typically with increasing homologies of at least 85%, 90%, 95%, 99%, and 100%.
  • Two amino acid sequences are homologous if there is a partial or complete identity between their sequences. For example, 85% homology means that 85% of the amino acids are identical when the two sequences are aligned for maximum matching. Gaps (in either of the two sequences being matched) are allowed in maximizing matching gap lengths of 5 or less are preferred with 2 or less being more preferred.
  • two protein sequences or polypeptide sequences derived from them of at least 30 amino acids in length
  • the two sequences or parts thereof are more preferably homologous if their amino acids are greater than or equal to 50% identical when optimally aligned using the ALIGN program.
  • the term “corresponds to” is used herein to mean that a polynucleotide sequence is homologous (i.e., is identical, not strictly evolutionarily related) to all or a portion of a reference polynucleotide sequence, or that a polypeptide sequence is identical to a reference polypeptide sequence.
  • the term “complementary to” is used herein to mean that the complementary sequence is homologous to all or a portion of a reference polynucleotide sequence.
  • the nucleotide sequence “TATAC” corresponds to a reference sequence “TATAC” and is complementary to a reference sequence “GTATA”.
  • reference sequence is a defined sequence used as a basis for a sequence comparison a reference sequence may be a subset of a larger sequence, for example, as a segment of a full-length cDNA or gene sequence given in a sequence listing or may comprise a complete cDNA or gene sequence. Generally, a reference sequence is at least 18 nucleotides or 6 amino acids in length, frequently at least 24 nucleotides or 8 amino acids in length, and often at least 48 nucleotides or 16 amino acids in length.
  • two polynucleotides or amino acid sequences may each (1) comprise a sequence (i.e., a portion of the complete polynucleotide or amino acid sequence) that is similar between the two molecules, and (2) may further comprise a sequence that is divergent between the two polynucleotides or amino acid sequences
  • sequence comparisons between two (or more) molecules are typically performed by comparing sequences of the two molecules over a “comparison window” to identify and compare local regions of sequence similarity.
  • a “comparison window”, as used herein, refers to a conceptual segment of at least 18 contiguous nucleotide positions or 6 amino acids wherein a polynucleotide sequence or amino acid sequence may be compared to a reference sequence of at least 18 contiguous nucleotides or 6 amino acid sequences and wherein the portion of the polynucleotide sequence in the comparison window may comprise additions, deletions, substitutions, and the like (i.e., gaps) of 20 percent or less as compared to the reference sequence (which does not comprise additions or deletions) for optimal alignment of the two sequences.
  • Optimal alignment of sequences for aligning a comparison window may be conducted by the local homology algorithm of Smith and Waterman Adv. Appl. Math.
  • sequence identity means that two polynucleotide or amino acid sequences are identical (i.e., on a nucleotide-by-nucleotide or residue-by-residue basis) over the comparison window.
  • percentage of sequence identity is calculated by comparing two optimally aligned sequences over the window of comparison, determining the number of positions at which the identical nucleic acid base (e.g., A, T, C, G, U or I) or residue occurs in both sequences to yield the number of matched positions, dividing the number of matched positions by the total number of positions in the comparison window (i.e., the window size), and multiplying the result by 100 to yield the percentage of sequence identity.
  • substantially identical denotes a characteristic of a polynucleotide or amino acid sequence, wherein the polynucleotide or amino acid comprises a sequence that has at least 85 percent sequence identity, for example, at least 90 to 95 percent sequence identity, more usually at least 99 percent sequence identity as compared to a reference sequence over a comparison window of at least 18 nucleotide (6 amino acid) positions, frequently over a window of at least 24-48 nucleotide (8-16 amino acid) positions, wherein the percentage of sequence identity is calculated by comparing the reference sequence to the sequence which may include deletions or additions which total 20 percent or less of the reference sequence over the comparison window.
  • the reference sequence may be a subset of a larger sequence.
  • Examples of unconventional amino acids include: 4 hydroxyproline, ⁇ -carboxyglutamate, ⁇ -N,N,N-trimethyllysine, ⁇ -N-acetyllysine, O-phosphoserine, N-acetylserine, N-formylmethionine, 3-methylhistidine, 5-hydroxylysine, ⁇ -N-methylarginine, and other similar amino acids and imino acids (e.g., 4-hydroxyproline).
  • the left-hand direction is the amino terminal direction and the right-hand direction is the carboxy-terminal direction, in accordance with standard usage and convention.
  • the left-hand end of single-stranded polynucleotide sequences is the 5′ end the left-hand direction of double-stranded polynucleotide sequences is referred to as the 5′ direction.
  • the direction of 5′ to 3′ addition of nascent RNA transcripts is referred to as the transcription direction sequence regions on the DNA strand having the same sequence as the RNA and which are 5′ to the 5′ end of the RNA transcript are referred to as “upstream sequences”, sequence regions on the DNA strand having the same sequence as the RNA and which are 3′ to the 3′ end of the RNA transcript are referred to as “downstream sequences”.
  • substantially identical means that two peptide sequences, when optimally aligned, such as by the programs GAP or BESTFIT using default gap weights, share at least 80 percent sequence identity, for example, at least 90 percent sequence identity, at least 95 percent sequence identity, or at least 99 percent sequence identity.
  • residue positions which are not identical differ by conservative amino acid substitutions.
  • Conservative amino acid substitutions refer to the interchangeability of residues having similar side chains.
  • a group of amino acids having aliphatic side chains is glycine, alanine, valine, leucine, and isoleucine; a group of amino acids having aliphatic-hydroxyl side chains is serine and threonine; a group of amino acids having amide-containing side chains is asparagine and glutamine; a group of amino acids having aromatic side chains is phenylalanine, tyrosine, and tryptophan; a group of amino acids having basic side chains is lysine, arginine, and histidine; and a group of amino acids having sulfur-containing side chains is cysteine and methionine.
  • Suitable conservative amino acids substitution groups are: valine-leucine-isoleucine, phenylalanine-tyrosine, lysine-arginine, alanine valine, glutamic-aspartic, and asparagine-glutamine.
  • amino acid sequences of antibodies or immunoglobulin molecules are contemplated as being encompassed by the present disclosure, providing that the variations in the amino acid sequence maintain at least 75%, for example, at least 80%, 90%, 95%, or 99%.
  • conservative amino acid replacements are contemplated. Conservative replacements are those that take place within a family of amino acids that are related in their side chains.
  • amino acids are generally divided into families: (1) acidic amino acids are aspartate, glutamate; (2) basic amino acids are lysine, arginine, histidine; (3) non-polar amino acids are alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan, and (4) uncharged polar amino acids are glycine, asparagine, glutamine, cysteine, serine, threonine, tyrosine.
  • the hydrophilic amino acids include arginine, asparagine, aspartate, glutamine, glutamate, histidine, lysine, serine, and threonine.
  • the hydrophobic amino acids include alanine, cysteine, isoleucine, leucine, methionine, phenylalanine, proline, tryptophan, tyrosine and valine.
  • Other families of amino acids include (i) serine and threonine, which are the aliphatic-hydroxy family; (ii) asparagine and glutamine, which are the amide containing family; (iii) alanine, valine, leucine and isoleucine, which are the aliphatic family; and (iv) phenylalanine, tryptophan, and tyrosine, which are the aromatic family.
  • Suitable amino- and carboxy-termini of fragments or analogs occur near boundaries of functional domains.
  • Structural and functional domains can be identified by comparison of the nucleotide and/or amino acid sequence data to public or proprietary sequence databases.
  • computerized comparison methods are used to identify sequence motifs or predicted protein conformation domains that occur in other proteins of known structure and/or function. Methods to identify protein sequences that fold into a known three-dimensional structure are known. Bowie et al. Science 253:164 (1991).
  • Suitable amino acid substitutions are those which: (1) reduce susceptibility to proteolysis, (2) reduce susceptibility to oxidation, (3) alter binding affinity for forming protein complexes, (4) alter binding affinities, and (4) confer or modify other physicochemical or functional properties of such analogs.
  • Analogs can include various muteins of a sequence other than the naturally-occurring peptide sequence. For example, single or multiple amino acid substitutions (for example, conservative amino acid substitutions) may be made in the naturally-occurring sequence (for example, in the portion of the polypeptide outside the domain(s) forming intermolecular contacts.
  • a conservative amino acid substitution should not substantially change the structural characteristics of the parent sequence (e.g., a replacement amino acid should not tend to break a helix that occurs in the parent sequence, or disrupt other types of secondary structure that characterizes the parent sequence).
  • Examples of art-recognized polypeptide secondary and tertiary structures are described in Proteins, Structures and Molecular Principles (Creighton, Ed., W. H. Freeman and Company, New York (1984)); Introduction to Protein Structure (C. Branden and J. Tooze, eds., Garland Publishing, New York, N.Y. (1991)); and Thornton et al. Nature 354:105 (1991).
  • polypeptide fragment refers to a polypeptide that has an amino terminal and/or carboxy-terminal deletion, but where the remaining amino acid sequence is identical to the corresponding positions in the naturally-occurring sequence deduced, for example, from a full length cDNA sequence. Fragments typically are at least 5, 6, 8 or 10 amino acids long, for example, at least 14 amino acids long, at least 20 amino acids long, at least 50 amino acids long, or at least 70 amino acids long.
  • analog refers to polypeptides which are comprised of a segment of at least 25 amino acids that has substantial identity to a portion of a deduced amino acid sequence and which has specific binding to CD47, under suitable binding conditions.
  • polypeptide analogs comprise a conservative amino acid substitution (or addition or deletion) with respect to the naturally-occurring sequence.
  • Analogs typically are at least 20 amino acids long, for example, at least 50 amino acids long or longer, and can often be as long as a full-length naturally-occurring polypeptide.
  • Peptide analogs are commonly used in the pharmaceutical industry as non-peptide drugs with properties analogous to those of the template peptide. These types of non-peptide compound are termed “peptide mimetics” or “peptidomimetics”. Fauchere, J. Adv. Drug Res. 15:29 (1986), Veber and Freidinger TINS p.392 (1985); and Evans et al. J. Med. Chem. 30:1229 (1987). Such compounds are often developed with the aid of computerized molecular modeling. Peptide mimetics that are structurally similar to therapeutically useful peptides may be used to produce an equivalent therapeutic or prophylactic effect.
  • peptidomimetics are structurally similar to a paradigm polypeptide (i.e., a polypeptide that has a biochemical property or pharmacological activity), such as human antibody, but have one or more peptide linkages optionally replaced by a linkage selected from the group consisting of: —CH 2 NH—, —CH 2 S—, —CH 2 —CH 2 —, —CH ⁇ CH—(cis and trans), —COCH 2 —, CH(OH)CH 2 —, and —CH 2 SO—, by methods well known in the art.
  • a paradigm polypeptide i.e., a polypeptide that has a biochemical property or pharmacological activity
  • linkages optionally replaced by a linkage selected from the group consisting of: —CH 2 NH—, —CH 2 S—, —CH 2 —CH 2 —, —CH ⁇ CH—(cis and trans), —COCH 2 —, CH(OH)CH 2 —, and —
  • Systematic substitution of one or more amino acids of a consensus sequence with a D-amino acid of the same type may be used to generate more stable peptides.
  • constrained peptides comprising a consensus sequence or a substantially identical consensus sequence variation may be generated by methods known in the art (Rizo and Gierasch Ann. Rev. Biochem. 61:387 (1992)); for example, by adding internal cysteine residues capable of forming intramolecular disulfide bridges which cyclize the peptide.
  • agent is used herein to denote a chemical compound, a mixture of chemical compounds, a biological macromolecule, and/or an extract made from biological materials.
  • label refers to incorporation of a detectable marker, e.g., by incorporation of a radiolabeled amino acid or attachment to a polypeptide of biotinyl moieties that can be detected by marked avidin (e.g., streptavidin containing a fluorescent marker or enzymatic activity that can be detected by optical or calorimetric methods). In certain situations, the label or marker can also be therapeutic. Various methods of labeling polypeptides and glycoproteins are known in the art and may be used.
  • labels for polypeptides include, but are not limited to, the following: radioisotopes or radionuclides (e.g., 3 H, 14 C, 15 N, 35 S, 90 Y, 99 Tc, 111 In, 125 I, 131 I), fluorescent labels (e.g., FITC, rhodamine, lanthanide phosphors), enzymatic labels (e.g., horseradish peroxidase, ⁇ -galactosidase, luciferase, alkaline phosphatase), chemiluminescent, biotinyl groups, predetermined polypeptide epitopes recognized by a secondary reporter (e.g., leucine zipper pair sequences, binding sites for secondary antibodies, metal binding domains, epitope tags).
  • radioisotopes or radionuclides e.g., 3 H, 14 C, 15 N, 35 S, 90 Y, 99 Tc, 111 In, 125 I, 131 I
  • labels are attached by spacer arms of various lengths to reduce potential steric hindrance.
  • pharmaceutical agent or drug refers to a chemical compound or composition capable of inducing a desired therapeutic effect when properly administered to a patient.
  • anti-plastic agent is used herein to refer to agents that have the functional property of inhibiting a development or progression of a neoplasm in a human, particularly a malignant (cancerous) lesion, such as a carcinoma, sarcoma, lymphoma, or leukemia. Inhibition of metastasis is frequently a property of antineoplastic agents.
  • the terms “treat,” treating,” “treatment,” and the like refer to reducing and/or ameliorating a disorder and/or symptoms associated therewith.
  • “alleviate” and/or “alleviating” is meant decrease, suppress, attenuate, diminish, arrest, and/or stabilize the development or progression of a disease such as, for example, a cancer. It will be appreciated that, although not precluded, treating a disorder or condition does not require that the disorder, condition or symptoms associated therewith be completely eliminated.
  • substantially pure means an object species is the predominant species present (i.e., on a molar basis it is more abundant than any other individual species in the composition), and in some embodiments, a substantially purified fraction is a composition wherein the object species comprises at least about 50 percent (on a molar basis) of all macromolecular species present.
  • a substantially pure composition will comprise more than about 80 percent of all macromolecular species present in the composition, for example, more than about 85%, 90%, 95%, and 99%.
  • the object species is purified to essential homogeneity (contaminant species cannot be detected in the composition by conventional detection methods) wherein the composition consists essentially of a single macromolecular species.
  • an effective amount is meant the amount required to ameliorate the symptoms of a disease relative to an untreated patient.
  • the effective amount of active compound(s) used to practice the present invention for therapeutic treatment of a disease varies depending upon the manner of administration, the age, body weight, and general health of the subject. Ultimately, the attending physician or veterinarian will decide the appropriate amount and dosage regimen. Such amount is referred to as an “effective” amount.
  • subject is meant a mammal, including, but not limited to, a human or non-human mammal, such as a bovine, equine, canine, rodent, ovine, primate, camelid, or feline.
  • a human or non-human mammal such as a bovine, equine, canine, rodent, ovine, primate, camelid, or feline.
  • administering refers to any mode of transferring, delivering, introducing, or transporting a therapeutic agent to a subject in need of treatment with such an agent.
  • modes include, but are not limited to, oral, topical, intravenous, intraperitoneal, intramuscular, intradermal, intranasal, and subcutaneous administration.
  • fragment is meant a portion of a polypeptide or nucleic acid molecule. This portion contains, for example, at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, or 90% of the entire length of the reference nucleic acid molecule or polypeptide.
  • a fragment may contain 10, 20, 30, 40, 50, 60, 70, 80, 90, or 100, 200, 300, 400, 500, 600, 700, 800, 900, or 1000 nucleotides or amino acids.
  • Ranges provided herein are understood to be shorthand for all of the values within the range.
  • a range of 1 to 50 is understood to include any number, combination of numbers, or sub-range from the group consisting of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, or 50.
  • the term “about” is understood as within a range of normal tolerance in the art, for example, within 2 standard deviations of the mean. About can be understood as within 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, 1%, 0.5%, 0.1%, 0.05%, or 0.01% of the stated value. Unless otherwise clear from the context, all numerical values provided herein are modified by the term “about.”
  • OX40 is a member of the TNF receptor superfamily that is predominantly expressed on activated T-cells and serves as a co-stimulatory molecule. OX40 engagement has been shown to induce down regulation of CTLA-4. OX40 blocking agents are capable of dampening immune response, while agonists of OX40 enhance immune responses. OX40 agonists have potential to enhance anti-tumor immunity. Crystallographic studies reveal that the OX40 ligand (OX40L) exists as a trimer. Furthermore, murine studies comparing the anti-tumor activity of an OX40 agonist antibody utilizing Fc ⁇ R expressing and deficient mice, demonstrated the need for Fc ⁇ R engagement, suggesting a need for antibody crosslinking. OX40 signaling has been suggested to dampen the suppressive capacity of regulatory T-cells and co-stimulate effector T-cells. OX40 Agonism has been shown to be important for driving differentiation toward and protecting memory T-cells.
  • the fusion proteins are multispecific containing at least a first binding domain, e.g., a TBD, and a second binding domain directed toward Program Death Ligand 1 (PD-L1).
  • a first binding domain e.g., a TBD
  • a second binding domain directed toward Program Death Ligand 1 (PD-L1).
  • the binding to PD-L1 is capable of providing the additional crosslinking function and TNFRSF activation is achieved with only one or two TBDs.
  • the TNFRSF signaling is enhanced and focused by the presence of a PD-L1 expressing cell.
  • PDL1 is a 40 kDa type I transmembrane protein that forms a complex with its receptor programmed cell death protein 1 (PD1), also known as CD279. Engagement of PDL1 with its receptor PD1 on T cells delivers a signal that inhibits TCR-mediated activation of IL-2 production and T cell proliferation. Aberrant expression and/or activity of PDL1 and PDL1-related signaling has been implicated in the pathogenesis of many diseases and disorders, such as cancer, inflammation, and autoimmunity.
  • PD1 programmed cell death protein 1
  • the PD-L1 binding portion is single domain antibody. In some embodiments, the PD-L1 binding portion of the fusion blocks or dampens the interaction of PD-L1 and PD-1. Exemplary PD-L1-targeting single domain sequences are shown below:
  • the PD-L1 binding portion is derived from the extracellular domain of PD-1 containing at least the IgV domain as shown below:
  • the PDL1 binding domain comprises or is derived from a known anti-PDL1 antibody sequence or antigen-binding fragment thereof. In some embodiments, the PDL1 binding domain comprises or is derived from an antibody sequence disclosed in PCT Publication No. WO 2016/149201, the contents of which are hereby incorporated by reference in their entirety.
  • the PDL1 binding domain comprises or is derived from an antibody sequence or antigen-binding fragment thereof that includes a combination of a variable heavy chain (VH) sequence and a variable light chain (VL) sequence selected from the group consisting of:
  • VH variable heavy chain
  • VL variable light chain
  • EIVLTQSPATLSLSPGERATLSCRASQSVSSYLVWYQQKPGQAPRLLIY DASNRATGIPARFSGSGSGTDFTLTISSLEPEDFAVYYCQQRSNWPRTF GQGTKVEIK SEQ ID NO: 84
  • EIVLTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIY DASNRATGIPARFSGSGSGTDFTLTISSLEPEDFAVYYCQQRSNWPTFG QGTKVEIK (SEQ ID NO: 85) DIQMTQSPSSLSASVGDRVTITCRASQGISSWLAWYQQKPEKAPKSLIY AASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYNSYPYTF GQGTKLEIK (SEQ ID NO: 86) EIVLTQSPGTLSLSPGERATLSCRASQSVSSSYLAWYQQKPG
  • the PDL1 binding domain comprises or is derived from an antibody sequence or antigen-binding fragment thereof that includes a combination of a VH sequence and a VL sequence selected from the group consisting of:
  • the PDL1 binding domain comprises or is derived from an antibody sequence or antigen-binding fragment thereof that includes a combination of a VH sequence and a VL sequence selected from the group consisting of:
  • the PDL1 binding domain comprises or is derived from an antibody sequence or antigen-binding fragment thereof that includes a combination of a VH sequence and a VL sequence selected from the group consisting of:
  • the PDL1 binding domain comprises or is derived from an antibody sequence or antigen-binding fragment thereof that includes a combination of a VH sequence and a VL sequence selected from the group consisting of:
  • the PDL1 binding domain comprises or is derived from an antibody sequence or antigen-binding fragment thereof that includes a combination of a VH sequence and a VL sequence selected from the group consisting of:
  • the PDL1 binding domain comprises or is derived from an antibody sequence or antigen-binding fragment thereof that includes a combination of a VH sequence and a VL sequence selected from the group consisting of:
  • the PDL1 binding domain comprises or is derived from an antibody sequence or antigen-binding fragment thereof that includes a combination of a VH sequence and a VL sequence selected from the group consisting of:
  • SEQ ID NO: 180 EVQLVQSGPELKKPGASVKMSCKASGYTFTSYVMHWVKQAPGQRLEWIGY VNPFNDGTKYNEMFKGRATLTSDKSTSTAYMELSSLRSEDSAVYYCARQA WGYPWGQGTLVTVSS (SEQ ID NO: 181) EVQLVQSGAEVKKPGASVKMSCKASGYTFTSYVMHWVKQAPGQRLEWIGY VNPFNDGTKYNEMFKGRATLTSDKSTSTAYMELSSLRSEDTAVYYCARQA WGYPWGQGTLVTVSS (SEQ ID NO: 182) EVQLVQSGAEVKKPGASVKMSCKASGYTFTSYVMHWVRQAPGQRLEWIGY VNPFNDGTKYNEMFKGRATLTSDKSTSTAYMELSSLRSEDTAVYYCARQA WGYPWGQGTLVTVSS (SEQ ID NO: 183) EVQLVQSGAEVKKPGASVKVSC
  • the PDL1 binding domain comprises or is derived from an antibody sequence or antigen-binding fragment thereof that includes a combination of a VH sequence and a VL sequence selected from the group consisting of:
  • the PDL1 binding domain comprises or is derived from an antibody sequence or antigen-binding fragment thereof that includes a combination of a heavy chain (HC) and a light chain sequence (LC) selected from the group consisting of:
  • the PDL1 binding domain comprises or is derived from an antibody sequence or antigen-binding fragment thereof that includes a combination of a VH sequence and a VL sequence selected from the group consisting of:
  • the PDL1 binding domain comprises or is derived from an antibody sequence or antigen-binding fragment thereof that includes a combination of a VH sequence and a VL sequence selected from the group consisting of:
  • the PDL1 binding domain comprises or is derived from an antibody sequence or antigen-binding fragment thereof that includes a combination of a VH sequence and a VL sequence selected from the group consisting of:
  • the PDL1 binding domain comprises or is derived from an antibody sequence or antigen-binding fragment thereof that includes a combination of a VH sequence and a VL sequence selected from the group consisting of:
  • SEQ ID NO: 306 SYELMQPPSVSVAPGKTATIACGGENIGRKTVHWYQQKPGQAPVLVIYYD SDRPSGIPERFSGSNSGNTATLTISRVEAGDEADYYCQVWDSSSDHRIFG GGTKLTVL (SEQ ID NO: 307) AIRMTQSPSSLSASVGDRVTITCRASQSISSYLNWYQQKPGKAPKLLIYT TSSLKSGVPSRFSGSGSGTDFTLTISRLQPEDFATYYCQQSYSSTWTFGR GTKVEIK (SEQ ID NO: 308) QSVLTQPPSVSAAPGQKVTISCSGNNSNIANNYVSWYQQLPGTAPKLLIY DNNYRPSGIPDRFSGSKSGTSATLDITGLQTGDEADYYCGVWDGSLTTGV FGGGTKLTVL (SEQ ID NO: 309) LPVLTQPASVSGSPGQSITISCTGTTSDIGGYDYVSWY
  • the PDL1 binding domain comprises or is derived from an antibody sequence or antigen-binding fragment thereof that includes a combination of a VH sequence and a VL sequence selected from the group consisting of:
  • the PDL1 binding domain comprises or is derived from an antibody sequence or antigen-binding fragment thereof that includes a combination of a VH sequence and a VL sequence selected from the group consisting of:
  • the PDL1 binding domain comprises or is derived from an antibody sequence or antigen-binding fragment thereof that includes a single chain FIT (scFv) sequence selected from the group consisting of:
  • the fusion proteins are bispecific molecules that include a TBD that binds OX40 and a binding domain directed toward PDL1.
  • the binding to PDL1 is capable of providing the additional crosslinking function and TNFRSF activation can be achieved with only one or two anti-OX40 TBDs.
  • the TNFRSF signaling is enhanced and focused by the presence of a PDL1 expressing cell.
  • Tetravalent hz1D10v1 IgG1-wt (SEQ ID NO: 387) EVQLLESGGGEVQPGGSLRLSCAASGFTFSDAFMYWVRQAPGKGLEWVS SISNRGLKTAYAESVKGRFTISRDNAKNTLYLQMSSLRAEDTAVYYCSR DVDGDFRGQGTLVTVKPGGSGGSEVQLLESGGGEVQPGGSLRLSCAASG FTFSDAFMYWVRQAPGKGLEWVSSISNRGLKTAYAESVKGRFTISRDNA KNTLYLQMSSLRAEDTAVYYCSRDVDGDFRGQGTLVTVKPGGGGDKTHT CPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVK FNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKV SNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTC
  • the fusion proteins are multispecific containing a TBD and a binding domain directed toward Folate Receptor Alpha (FR ⁇ ).
  • FR ⁇ Folate Receptor Alpha
  • the binding to FR ⁇ is capable of providing the additional crosslinking function and TNFRSF activation can be achieved with only one or two TBDs.
  • the TNFRSF signaling is enhanced and focused by the presence of a FR ⁇ expressing cell.
  • the fusion proteins contain a TBD fused to a tumor, bacterial or viral antigen (vaccine sequence).
  • the binding to the TBD facilitates enhanced immunogenicity of the vaccine sequence thereby promoting acquired immunity to a tumor, bacteria or virus that expresses the vaccine sequence.
  • the TBD and the vaccine may be non-fused and introduced separately.
  • the vaccine may be nucleic acid sequence, protein sequence or whole cells such as tumor cell, bacterial cells or virus.
  • Vaccines may be monovalent (also called univalent) or multivalent (also called polyvalent).
  • a monovalent vaccine is designed to immunize against a single antigen or single microorganism or cancer type.
  • a multivalent or polyvalent vaccine is designed to immunize against two or more strains of the same microorganism or cancer type, or against two or more distinct microorganisms or cancer types.
  • the OX40-targeting single domain antibodies referred to herein as 1A06 (SEQ ID NO: 16), 2B07, 2C09 (SEQ ID NO: 19), 1D10 (SEQ ID NO: 22), 2E4 (SEQ ID NO: 18), 2H06 (SEQ ID NO: 17), 3E11 (SEQ ID NO: 23), 3G9 (SEQ ID NO: 24), and G3 (SEQ ID NO: 25) bind cell surface OX40 expressed on CHO cells ( FIGS. 2A-2B ). Binding was assessed by flow cytometry using OX40 expressing CHO cells and data is presented as median fluorescence intensity.
  • the OX40-targeting sdAbs referred to herein as 1D10, G3, and 3E11 were also evaluated for their ability to bind cynomolgus OX40 expressed on CHO cells ( FIG. 4 ). Binding was assessed by flow cytometry using cynoOX40 expressing CHO cells and data is presented as median fluorescence intensity.
  • FIGS. 12A and 12B Various humanized versions of OX40-targeting sdAbs coupled to an Fc region were also evaluated for their ability to bind human OX40 and cynomolgus OX40 ( FIGS. 12A and 12B ). Binding was assessed by flow cytometry using OX40 expressing CHO cells and data is presented as median fluorescence intensity.
  • the OX40-targeting single domain antibodies referred to herein as 1D10 (SEQ ID NO: 22), 2E4 (SEQ ID NO: 18), G3 (SEQ ID NO: 25), 3E11 (SEQ ID NO: 23), and H11 block the interaction between OX40 and OX40L. As shown in FIG. 3 , 2E4 blocks the interaction between OX40 and OX40L, while the other single domain antibodies do not.
  • a single domain antibody that binds GITR was included as a negative control. Blocking was assessed by flow cytometry using a OX40L-citrine fusion protein and data is presented as median fluorescence intensity.
  • binding domains such as, for example, single domain antibodies (sdAbs)
  • sdAbs single domain antibodies
  • multiple OX40-targeting VHHs are operably linked to an Fc region polypeptide to produce multivalent OX40-targeting molecules.
  • FIG. 5A is schematic depicting the format of various embodiments of multivalent OX40 binding fusion proteins and the estimated molecular weights for each.
  • FIG. 5B is a photograph of a Coomassie blue stain SDS-PAGE gel of multivalent OX40 binding fusion proteins under reducing and non-reducing conditions.
  • FIG. 6 depicts the comparison between tetravalent and bivalent binding of OX40 using the fusion proteins of the present disclosure.
  • OX40 signaling was monitored using an NF-kB reporter 293 cell line expressing OX40.
  • Fusion proteins incorporating 1D10 binding domain (SEQ ID NO: 22) as the TBD were used in these assays.
  • FIG. 7A depicts the comparison between tetravalent and hexavalent binding of OX40 using the fusion proteins of the present disclosure.
  • FIG. 7B depicts the comparison between hexavalent binding of OX40 using a fusion protein of the present disclosure and a known hexameric OX40L-fusion protein, which is described in U.S. Pat. No. 7,959,925).
  • the multivalent OX40 binding fusion proteins of the present disclosure displayed equivalent or enhanced OX40 agonistic activity compared to the hexameric OX40L fusion protein.
  • OX40 signaling was monitored using a NF-kB reporter 293 cell line expressing OX40. Fusion proteins incorporating 1D10 as the TBD were used in these assays.
  • FIGS. 8A and 8B are a series of graphs depicting the elution profile from a size exclusion chromatography (SEC) column (Superdex 200) for tetravalent ( FIG. 8A ) and hexavalent ( FIG. 8B ) 1D10. Calculated molecular weights based on the retention volume (standard curve) are also shown.
  • SEC size exclusion chromatography
  • FIG. 9 is a graph demonstrating OX40 signaling is mediated by various multivalent formats of the fusion proteins of the present disclosure, including hexavalent with three tandem OX40 VHHs linked to an Fc region, tetravalent with two tandem OX40 VHHs linked to an Fc region and tetravalent with an N-terminal and C-terminal OX40 VHH separated by an Fc region.
  • OX40 signaling was monitored using an NF-kB reporter 293 cell line expressing OX40. Fusion proteins incorporating 1D10 as the TBD were used in for these assays.
  • FIGS. 14A and 14B are a pair of graphs demonstrating OX40 signaling is mediated by various multivalent formats of the fusion proteins of the present disclosure, including hexavalent with three tandem OX40 VHHs linked to an Fc region, tetravalent with two tandem OX40 VHHs linked to an Fc region and tetravalent with an N-terminal and C-terminal OX40 VHH separated by an Fc region.
  • OX40 signaling was monitored using an NF-kB reporter 293 cell line expressing OX40. Fusion proteins incorporating hzG3v9 as the TBD were used in the tetravalent and hexavalent molecules for these assays.
  • FIGS. 10A, 10B, and 10C depict PDL1-dependent OX40 agonism mediated by bispecific PDL1-OX40 targeting fusion proteins of the present disclosure.
  • FIGS. 10 A and B are conceptual schematics wherein the bispecific fusion protein have minimal OX40 agonistic properties ( FIG. 10A ) unless bound by a PDL1 expressing cell ( FIG. 10B ).
  • FIG. 10C is graph demonstrating the ability of a PDL1-positive cell (here PDL1 transfected CHO cells) to mediate OX40 signaling and the inability of PDL1-negative cell (here untransfected CHO cells) to mediate OX40 signaling.
  • OX40 signaling was monitored using a NF-kB reporter 293 cell line expressing OX40. Numerous distinct bispecific fusion proteins are shown in this figure, each containing a distinct OX40 binding VHH (e.g., G3, 2E4, 3G9, 1D10) and the same PDL1 VHH, 28A10.
  • VHH e.g., G3, 2E4, 3G9, 1D10
  • FIG. 11 depicts FR ⁇ -dependent OX40 agonists signaling mediated by bispecific FR ⁇ -OX40 targeting fusion proteins of the present disclosure.
  • OX40 signaling was monitored using a NF-kB reporter 293 cell line expressing OX40.
  • Numerous distinct bispecific fusion proteins are shown in this figure, each containing a distinct FR ⁇ binding VHH (e.g., 1G10, 1A3, 57, 5) and the same OX40 VHH, 1D10.
  • FIGS. 13A and 13B are a pair of graphs depicting whether various humanized OX40 single domain antibodies bind to various TNFRSF members.
  • Various humanized sdAbs of the disclosure as the TBD were used in the tetravalent and hexavalent molecules for these assays.

Landscapes

  • Health & Medical Sciences (AREA)
  • Immunology (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Biochemistry (AREA)
  • Biophysics (AREA)
  • Genetics & Genomics (AREA)
  • Molecular Biology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Veterinary Medicine (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Rheumatology (AREA)
  • Pain & Pain Management (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
US15/404,167 2016-01-11 2017-01-11 Multivalent and multispecific ox40-binding fusion proteins Abandoned US20170198051A1 (en)

Priority Applications (3)

Application Number Priority Date Filing Date Title
US15/404,167 US20170198051A1 (en) 2016-01-11 2017-01-11 Multivalent and multispecific ox40-binding fusion proteins
US16/295,332 US11117972B2 (en) 2016-01-11 2019-03-07 Multivalent and multispecific OX40-binding fusion proteins
US17/398,851 US12227584B2 (en) 2016-01-11 2021-08-10 Multivalent and multispecific OX40-binding fusion proteins

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201662277027P 2016-01-11 2016-01-11
US15/404,167 US20170198051A1 (en) 2016-01-11 2017-01-11 Multivalent and multispecific ox40-binding fusion proteins

Related Child Applications (1)

Application Number Title Priority Date Filing Date
US16/295,332 Division US11117972B2 (en) 2016-01-11 2019-03-07 Multivalent and multispecific OX40-binding fusion proteins

Publications (1)

Publication Number Publication Date
US20170198051A1 true US20170198051A1 (en) 2017-07-13

Family

ID=59275443

Family Applications (3)

Application Number Title Priority Date Filing Date
US15/404,167 Abandoned US20170198051A1 (en) 2016-01-11 2017-01-11 Multivalent and multispecific ox40-binding fusion proteins
US16/295,332 Active 2037-05-04 US11117972B2 (en) 2016-01-11 2019-03-07 Multivalent and multispecific OX40-binding fusion proteins
US17/398,851 Active 2038-12-27 US12227584B2 (en) 2016-01-11 2021-08-10 Multivalent and multispecific OX40-binding fusion proteins

Family Applications After (2)

Application Number Title Priority Date Filing Date
US16/295,332 Active 2037-05-04 US11117972B2 (en) 2016-01-11 2019-03-07 Multivalent and multispecific OX40-binding fusion proteins
US17/398,851 Active 2038-12-27 US12227584B2 (en) 2016-01-11 2021-08-10 Multivalent and multispecific OX40-binding fusion proteins

Country Status (13)

Country Link
US (3) US20170198051A1 (enExample)
EP (1) EP3402507A4 (enExample)
JP (3) JP7328761B2 (enExample)
KR (1) KR20180098671A (enExample)
CN (1) CN108883153A (enExample)
AU (2) AU2017207318B2 (enExample)
BR (1) BR112018013911A2 (enExample)
CA (1) CA3009075A1 (enExample)
IL (2) IL298686A (enExample)
MX (2) MX2018008310A (enExample)
RU (1) RU2022106508A (enExample)
SG (1) SG11201805422WA (enExample)
WO (1) WO2017123673A2 (enExample)

Cited By (14)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20170281765A1 (en) * 2012-05-31 2017-10-05 Sorrento Therapeutics, Inc. Antigen binding proteins that bind pd-l1
US10336824B2 (en) 2015-03-13 2019-07-02 Cytomx Therapeutics, Inc. Anti-PDL1 antibodies, activatable anti-PDL1 antibodies, and methods of thereof
WO2019133817A1 (en) * 2017-12-29 2019-07-04 Her Jeng Horng Monospecific and bispecific proteins with immune checkpoint regulation for cancer therapy
WO2020102647A1 (en) * 2018-11-15 2020-05-22 Invenra Inc. Multivalent receptor-clustering agonist antibody constructs and antigen binding proteins
WO2021084104A1 (en) * 2019-10-30 2021-05-06 Bioinvent International Ab Tetravalent antibody molecules
US11117972B2 (en) * 2016-01-11 2021-09-14 Inhibrx, Inc. Multivalent and multispecific OX40-binding fusion proteins
US11168144B2 (en) 2017-06-01 2021-11-09 Cytomx Therapeutics, Inc. Activatable anti-PDL1 antibodies, and methods of use thereof
US20230303664A1 (en) * 2020-07-29 2023-09-28 MAX-PLANCK-Gesellschaft zur Förderung der Wissenschaften e.V. Therapeutic and diagnostic vhh antibodies against sars-cov-2 and methods for their enhancement
EP4077374A4 (en) * 2019-12-20 2023-12-27 Kisoji Biotechnology Inc. POLYPEPTIDES, PROTEIN COMPLEXES AND ASSOCIATED PRODUCTION PROCESS
US11866507B2 (en) 2017-04-11 2024-01-09 Inhibrx, Inc. Multispecific polypeptide constructs having constrained CD3 binding and methods of using the same
WO2024006831A3 (en) * 2022-06-28 2024-05-23 Beijing Starmab Biomed Technology Ltd Monospecific and multi-specific antibodies
US12195533B2 (en) 2018-07-24 2025-01-14 Inhibrx Biosciences, Inc. Multispecific polypeptide constructs containing a constrained CD3 binding domain and a receptor binding region and methods of using the same
US12331132B2 (en) 2018-04-11 2025-06-17 Inhibrx Biosciences, Inc. Multispecific polypeptide constructs having constrained CD3 binding and related methods and uses
US12331320B2 (en) 2018-10-10 2025-06-17 The Research Foundation For The State University Of New York Genome edited cancer cell vaccines

Families Citing this family (21)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP3487533A4 (en) * 2016-07-20 2020-03-25 IGM Biosciences, Inc. MULTIMERE OX40-BINDING MOLECULES AND USES THEREOF
EP3494139B1 (en) 2016-08-05 2022-01-12 F. Hoffmann-La Roche AG Multivalent and multiepitopic anitibodies having agonistic activity and methods of use
EP3515951B1 (en) * 2016-09-23 2024-02-28 Merus N.V. Binding molecules that modulate a biological activity expressed by a cell
EA201991207A1 (ru) 2016-12-19 2019-12-30 Гленмарк Фармасьютикалс С.А. Новые агонисты tnfr и их применение
TWI842672B (zh) 2017-04-13 2024-05-21 美商艾吉納斯公司 抗cd137抗體及其使用方法
CN110305210B (zh) * 2018-03-27 2023-02-28 信达生物制药(苏州)有限公司 新型抗体分子、其制备方法及其用途
TW202019968A (zh) * 2018-08-13 2020-06-01 美商英伊布里克斯公司 Ox40結合多肽及其用途
CN113166263A (zh) 2018-10-11 2021-07-23 印希比股份有限公司 Dll3单域抗体及其治疗性组合物
CN120623346A (zh) 2018-10-11 2025-09-12 因荷布瑞克斯生物科学公司 Pd-1单结构域抗体及其治疗组合物
US20230124851A1 (en) 2018-10-11 2023-04-20 Inhibrx, lnc. B7h3 single domain antibodies and therapeutic compositions thereof
US20210340273A1 (en) 2018-10-11 2021-11-04 Inhlbrx, inc. 5t4 single domain antibodies and therapeutic compositions thereof
WO2020102233A1 (en) * 2018-11-13 2020-05-22 Jn Biosciences Llc Bispecific antibodies for activation of immune cells
CN113490686B (zh) * 2019-01-07 2025-02-18 拜科托莱夫股份有限公司 病原体结合蛋白
TWI793395B (zh) * 2019-01-25 2023-02-21 大陸商信達生物製藥(蘇州)有限公司 結合pd-l1和ox40的雙特異性抗體
WO2021073611A1 (zh) * 2019-10-17 2021-04-22 江苏康宁杰瑞生物制药有限公司 Ox40/pd-l1双特异性抗体
TWI802923B (zh) * 2020-06-30 2023-05-21 大陸商和鉑醫藥(上海)有限責任公司 標靶ox40的抗體及其製備方法和應用
EP3940931A1 (de) 2020-07-14 2022-01-19 Siemens Aktiengesellschaft Verfahren zur herstellung eines rotors einer asynchronmaschine
WO2022243341A1 (en) * 2021-05-18 2022-11-24 Pieris Pharmaceuticals Gmbh Lipocalin muteins with binding affinity for ox40
TW202334203A (zh) * 2021-11-19 2023-09-01 德商皮里斯製藥有限公司 新穎的ox40及pd-l1特異性融合蛋白
JP2025501522A (ja) * 2021-12-17 2025-01-22 シャンハイ・ヘンリウス・バイオテック・インコーポレイテッド 抗ox40抗体及び使用方法
CN118515763B (zh) * 2024-07-23 2024-11-01 北京百普赛斯生物科技股份有限公司 Il-6的抗体、检测试剂盒及其应用

Family Cites Families (39)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5151510A (en) 1990-04-20 1992-09-29 Applied Biosystems, Inc. Method of synethesizing sulfurized oligonucleotide analogs
GB9112536D0 (en) 1991-06-11 1991-07-31 Celltech Ltd Chemical compounds
US20090087878A9 (en) * 1999-05-06 2009-04-02 La Rosa Thomas J Nucleic acid molecules associated with plants
US20110131679A2 (en) * 2000-04-19 2011-06-02 Thomas La Rosa Rice Nucleic Acid Molecules and Other Molecules Associated with Plants and Uses Thereof for Plant Improvement
ES2326964T3 (es) * 2001-10-25 2009-10-22 Genentech, Inc. Composiciones de glicoproteina.
US20040029129A1 (en) * 2001-10-25 2004-02-12 Liangsu Wang Identification of essential genes in microorganisms
NZ540196A (en) 2002-11-08 2008-09-26 Ablynx Nv Camelidae antibodies against imminoglobulin E and use thereof for the treatment of allergic disorders
DK1644412T4 (en) 2003-07-01 2018-11-12 Ucb Biopharma Sprl MODIFIED ANTIBODY-FAB FRAGMENTS
GB0315450D0 (en) 2003-07-01 2003-08-06 Celltech R&D Ltd Biological products
GB0315457D0 (en) 2003-07-01 2003-08-06 Celltech R&D Ltd Biological products
GB0411186D0 (en) 2004-05-19 2004-06-23 Celltech R&D Ltd Biological products
CA2606809C (en) * 2005-05-06 2016-01-05 Providence Health System Trimeric ox40-immunoglobulin fusion protein and methods of use
EP2500352A1 (en) 2005-08-19 2012-09-19 Abbott Laboratories Dual variable domain immunoglobulin and uses thereof
JP5093097B2 (ja) 2006-03-03 2012-12-05 小野薬品工業株式会社 細胞表面機能分子の細胞外領域多量体
US20130332133A1 (en) * 2006-05-11 2013-12-12 Ramot At Tel Aviv University Ltd. Classification of Protein Sequences and Uses of Classified Proteins
CA2700714C (en) 2007-09-26 2018-09-11 Ucb Pharma S.A. Dual specificity antibody fusions
HRP20170908T1 (hr) 2008-12-09 2017-09-22 F. Hoffmann - La Roche Ag Protutijela anti-pd-l1 i njihova uporaba za poboljšanje funkcije t-stanice
WO2010089411A2 (en) 2009-02-09 2010-08-12 Universite De La Mediterranee Pd-1 antibodies and pd-l1 antibodies and uses thereof
US8614295B2 (en) 2009-02-17 2013-12-24 Ucb Pharma S.A. Antibody molecules having specificity for human OX40
US8962807B2 (en) * 2009-12-14 2015-02-24 Ablynx N.V. Single variable domain antibodies against OX40L, constructs and therapeutic use
WO2011119484A1 (en) * 2010-03-23 2011-09-29 Iogenetics, Llc Bioinformatic processes for determination of peptide binding
PL2606064T3 (pl) 2010-08-16 2015-07-31 Novimmune Sa Sposoby wytwarzania wieloswoistych i wielowartościowych przeciwciał
BR112013004581A2 (pt) * 2010-08-26 2017-06-27 Abbvie Inc imunoglobulinas de domínio variável dual e seus usos
EA036047B1 (ru) * 2011-07-11 2020-09-18 Икнос Сайенсиз Са Антитела, которые связываются с ox40, и их применение
IL311502A (en) * 2012-02-27 2024-05-01 Ablynx Nv Cx3cr1-binding polypeptides
CA2871934C (en) 2012-04-30 2023-06-13 Medimmune, Llc Molecules with reduced effector function and extended half-lives, compositions, and uses thereof
IN2015DN01361A (enExample) * 2012-08-02 2015-07-03 Jn Biosciences Llc
WO2014028776A1 (en) 2012-08-15 2014-02-20 Zyngenia, Inc. Monovalent and multivalent multispecific complexes and uses thereof
AR093984A1 (es) * 2012-12-21 2015-07-01 Merck Sharp & Dohme Anticuerpos que se unen a ligando 1 de muerte programada (pd-l1) humano
US10533054B2 (en) 2013-01-31 2020-01-14 Thomas Jefferson University Agonist fusion protein for CD40 and OX40 and methods of stimulating the immune system
HK1217958A1 (zh) * 2013-03-15 2017-01-27 默克专利有限公司 四价双特异性抗体
UA119319C2 (uk) 2013-03-18 2019-06-10 Біосерокс Продактс Б.В. Гуманізоване антитіло до cd134 (ox40) і його застосування
WO2014209804A1 (en) 2013-06-24 2014-12-31 Biomed Valley Discoveries, Inc. Bispecific antibodies
BR112016013963A2 (pt) * 2013-12-17 2017-10-10 Genentech Inc terapia de combinação compreendendo agonistas de ligação de ox40 e antagonistas de ligação do eixo de pd-1
KR20170096112A (ko) * 2014-11-17 2017-08-23 제넨테크, 인크. Ox40 결합 효능제 및 pd-1 축 결합 길항제를 포함하는 조합 요법
JP7001474B2 (ja) 2015-01-21 2022-01-19 インヒブルクス,インコーポレイティド 非免疫原性単一ドメイン抗体
CA2978942A1 (en) 2015-03-13 2016-09-22 Cytomx Therapeutics, Inc. Anti-pdl1 antibodies, activatable anti-pdl1 antibodies, and methods of use thereof
JP7328761B2 (ja) 2016-01-11 2023-08-17 インヒブルクス インコーポレイテッド 多価多重特異性ox40結合融合タンパク質
EA201991207A1 (ru) * 2016-12-19 2019-12-30 Гленмарк Фармасьютикалс С.А. Новые агонисты tnfr и их применение

Cited By (21)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20170281765A1 (en) * 2012-05-31 2017-10-05 Sorrento Therapeutics, Inc. Antigen binding proteins that bind pd-l1
US10058609B2 (en) * 2012-05-31 2018-08-28 Sorrento Therapeutics, Inc. Antigen binding proteins that bind PD-L1
US11878058B2 (en) 2012-05-31 2024-01-23 Sorrento Therapeutics, Inc. Antigen binding proteins that bind PD-L1
US11027012B2 (en) 2012-05-31 2021-06-08 Sorrento Therapeutics, Inc. Antigen binding proteins that bind PD-L1
US10669339B2 (en) 2015-03-13 2020-06-02 Cytomx Therapeutics, Inc. Anti-PDL1 antibodies, activatable anti-PDL1 antibodies, and methods of use thereof
US11174316B2 (en) 2015-03-13 2021-11-16 Cytomx Therapeutics, Inc. Anti-PDL1 antibodies, activatable anti-PDL1 antibodies, and methods of use thereof
US10336824B2 (en) 2015-03-13 2019-07-02 Cytomx Therapeutics, Inc. Anti-PDL1 antibodies, activatable anti-PDL1 antibodies, and methods of thereof
US11117972B2 (en) * 2016-01-11 2021-09-14 Inhibrx, Inc. Multivalent and multispecific OX40-binding fusion proteins
US11866507B2 (en) 2017-04-11 2024-01-09 Inhibrx, Inc. Multispecific polypeptide constructs having constrained CD3 binding and methods of using the same
US11168144B2 (en) 2017-06-01 2021-11-09 Cytomx Therapeutics, Inc. Activatable anti-PDL1 antibodies, and methods of use thereof
WO2019133817A1 (en) * 2017-12-29 2019-07-04 Her Jeng Horng Monospecific and bispecific proteins with immune checkpoint regulation for cancer therapy
US11643470B2 (en) 2017-12-29 2023-05-09 Ap Biosciences, Inc. PD-L1 and OX40 binding proteins for cancer Regulation
US12304961B2 (en) 2017-12-29 2025-05-20 Ap Biosciences, Inc. PD-L1 and OX40 binding proteins for cancer regulation
US12331132B2 (en) 2018-04-11 2025-06-17 Inhibrx Biosciences, Inc. Multispecific polypeptide constructs having constrained CD3 binding and related methods and uses
US12195533B2 (en) 2018-07-24 2025-01-14 Inhibrx Biosciences, Inc. Multispecific polypeptide constructs containing a constrained CD3 binding domain and a receptor binding region and methods of using the same
US12331320B2 (en) 2018-10-10 2025-06-17 The Research Foundation For The State University Of New York Genome edited cancer cell vaccines
WO2020102647A1 (en) * 2018-11-15 2020-05-22 Invenra Inc. Multivalent receptor-clustering agonist antibody constructs and antigen binding proteins
WO2021084104A1 (en) * 2019-10-30 2021-05-06 Bioinvent International Ab Tetravalent antibody molecules
EP4077374A4 (en) * 2019-12-20 2023-12-27 Kisoji Biotechnology Inc. POLYPEPTIDES, PROTEIN COMPLEXES AND ASSOCIATED PRODUCTION PROCESS
US20230303664A1 (en) * 2020-07-29 2023-09-28 MAX-PLANCK-Gesellschaft zur Förderung der Wissenschaften e.V. Therapeutic and diagnostic vhh antibodies against sars-cov-2 and methods for their enhancement
WO2024006831A3 (en) * 2022-06-28 2024-05-23 Beijing Starmab Biomed Technology Ltd Monospecific and multi-specific antibodies

Also Published As

Publication number Publication date
WO2017123673A3 (en) 2017-08-24
JP2019504062A (ja) 2019-02-14
US20190263916A1 (en) 2019-08-29
AU2017207318A1 (en) 2018-07-12
JP2025081649A (ja) 2025-05-27
WO2017123673A2 (en) 2017-07-20
US20220106397A1 (en) 2022-04-07
EP3402507A4 (en) 2019-08-07
JP2022185021A (ja) 2022-12-13
US11117972B2 (en) 2021-09-14
EP3402507A2 (en) 2018-11-21
MX2018008310A (es) 2019-01-28
IL260531B1 (en) 2023-01-01
KR20180098671A (ko) 2018-09-04
US12227584B2 (en) 2025-02-18
JP7328761B2 (ja) 2023-08-17
AU2024200551A1 (en) 2024-02-22
NZ743731A (en) 2025-06-27
IL298686A (en) 2023-01-01
IL260531B2 (en) 2023-05-01
MX2024004017A (es) 2024-05-08
BR112018013911A2 (pt) 2018-12-18
CN108883153A (zh) 2018-11-23
AU2017207318B2 (en) 2023-12-07
CA3009075A1 (en) 2017-07-20
SG11201805422WA (en) 2018-07-30
IL260531A (enExample) 2018-08-30
RU2018128629A (ru) 2020-02-13
RU2022106508A (ru) 2022-04-05
RU2018128629A3 (enExample) 2020-06-16

Similar Documents

Publication Publication Date Title
US12227584B2 (en) Multivalent and multispecific OX40-binding fusion proteins
US12187804B2 (en) Multivalent and multispecific 41BB-binding proteins
US20220112288A1 (en) Bioengineered t cell mediated immunity, materials and other methods for modulating cluster of differentiation iv &/or viii
US10344078B2 (en) Type III secretion system targeting molecules
RU2773052C2 (ru) Поливалентные и полиспецифические ох40-связывающие слитые белки
RU2789648C2 (ru) Мультивалентные и мультиспецифические 41bb-связывающие слитые белки

Legal Events

Date Code Title Description
AS Assignment

Owner name: INHIBRX LP, CALIFORNIA

Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:ECKELMAN, BRENDAN P.;TIMMER, JOHN C.;HATA, CHELSIE;AND OTHERS;REEL/FRAME:043582/0908

Effective date: 20170814

AS Assignment

Owner name: INHIBRX, INC., CALIFORNIA

Free format text: MERGER AND CHANGE OF NAME;ASSIGNORS:INHIBRX LP;TENIUM THERAPEUTICS, INC.;REEL/FRAME:046215/0084

Effective date: 20180430

STCB Information on status: application discontinuation

Free format text: ABANDONED -- FAILURE TO RESPOND TO AN OFFICE ACTION

AS Assignment

Owner name: INHIBRX, INC., CALIFORNIA

Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNOR:RASCON, LUCAS;REEL/FRAME:050265/0685

Effective date: 20190827

AS Assignment

Owner name: INHIBRX BIOSCIENCES, INC., CALIFORNIA

Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNOR:INHIBRX, INC.;REEL/FRAME:067679/0635

Effective date: 20240528

Owner name: INHIBRX BIOSCIENCES, INC., CALIFORNIA

Free format text: ASSIGNMENT OF ASSIGNOR'S INTEREST;ASSIGNOR:INHIBRX, INC.;REEL/FRAME:067679/0635

Effective date: 20240528