US20140329889A1 - Cyclic di-nucleotide induction of type i interferon - Google Patents

Cyclic di-nucleotide induction of type i interferon Download PDF

Info

Publication number
US20140329889A1
US20140329889A1 US14/268,967 US201414268967A US2014329889A1 US 20140329889 A1 US20140329889 A1 US 20140329889A1 US 201414268967 A US201414268967 A US 201414268967A US 2014329889 A1 US2014329889 A1 US 2014329889A1
Authority
US
United States
Prior art keywords
cyclic
nucleotide
cells
sting
cell
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Abandoned
Application number
US14/268,967
Inventor
Russell E. Vance
Ming C. Hammond
Dara Burdette
Ellie J. Diner
Stephen C. Wilson
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
University of California San Diego UCSD
Original Assignee
University of California San Diego UCSD
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by University of California San Diego UCSD filed Critical University of California San Diego UCSD
Priority to US14/268,967 priority Critical patent/US20140329889A1/en
Assigned to THE REGENTS OF THE UNIVERSITY OF CALIFORNIA reassignment THE REGENTS OF THE UNIVERSITY OF CALIFORNIA ASSIGNMENT OF ASSIGNORS INTEREST (SEE DOCUMENT FOR DETAILS). Assignors: DINER, Elie J., HAMMOND, Ming C., VANCE, RUSSELL E., BURDETTE, Dara, WILSON, STEPHEN C.
Publication of US20140329889A1 publication Critical patent/US20140329889A1/en
Assigned to NATIONAL INSTITUTES OF HEALTH (NIH), U.S. DEPT. OF HEALTH AND HUMAN SERVICES (DHHS), U.S. GOVERNMENT reassignment NATIONAL INSTITUTES OF HEALTH (NIH), U.S. DEPT. OF HEALTH AND HUMAN SERVICES (DHHS), U.S. GOVERNMENT CONFIRMATORY LICENSE (SEE DOCUMENT FOR DETAILS). Assignors: UNIVERSITY OF CALIFORNIA BERKELEY
Priority to US16/279,950 priority patent/US20190292216A1/en
Priority to US17/464,494 priority patent/US11873319B2/en
Abandoned legal-status Critical Current

Links

Images

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07HSUGARS; DERIVATIVES THEREOF; NUCLEOSIDES; NUCLEOTIDES; NUCLEIC ACIDS
    • C07H21/00Compounds containing two or more mononucleotide units having separate phosphate or polyphosphate groups linked by saccharide radicals of nucleoside groups, e.g. nucleic acids
    • C07H21/02Compounds containing two or more mononucleotide units having separate phosphate or polyphosphate groups linked by saccharide radicals of nucleoside groups, e.g. nucleic acids with ribosyl as saccharide radical
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/70Carbohydrates; Sugars; Derivatives thereof
    • A61K31/7084Compounds having two nucleosides or nucleotides, e.g. nicotinamide-adenine dinucleotide, flavine-adenine dinucleotide
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12Antivirals
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • A61P35/04Antineoplastic agents specific for metastasis
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • A61P37/04Immunostimulants

Definitions

  • Interferons are proteins having a variety of biological activities, some of which are antiviral, immunomodulating and antiproliferative. They are relatively small, species-specific, single chain polypeptides, produced by mammalian cells in response to exposure to a variety of inducers such as viruses, polypeptides, mitogens and the like. Interferons protect animal tissues and cells against viral attack and are an important host defense mechanism. In most cases, interferons provide better protection to tissues and cells of the kind from which they have been produced than to other types of tissues and cells, indicating that human-derived interferon could be more efficacious in treating human diseases than interferons from other species.
  • Interferons may be classified as Type-I, Type-II and Type-Ill interferons.
  • Mammalian Type-I interferons include IFN- ⁇ (alpha), IFN- ⁇ (beta), IFN- ⁇ (kappa), IFN- ⁇ (delta), IFN- ⁇ (epsilon), IFN- ⁇ (tau), IFN- ⁇ (omega), and IFN- ⁇ (zeta, also known as limitin).
  • Agents that induce interferon production find use as vaccine adjuvants and in formulations that initiate effector and memory T-cell responses.
  • Effective adjuvants enhance specific immune responses to antigens while minimizing toxic side effects, reducing the dose and dosage of vaccinations, and broadening the immune response.
  • effective adjuvants may be coformulated with antigens derived from intracellular pathogens and cancer cells to activate an effective cellular and humoral immune response to treat intracellular pathogens and reduce tumor burden.
  • the immunomodulatory activity of interferon proteins, and the signaling pathways that regulate interferon production are drawing interest as a target for designing new adjuvants.
  • Interferons have potential in the treatment of a large number of human cancers since these molecules have anti-cancer activity that acts at multiple levels.
  • interferon proteins can directly inhibit the proliferation of human tumor cells.
  • the anti-proliferative activity is also synergistic with a variety of approved chemotherapeutic agents such as cisplatin, 5FU and paclitaxel.
  • the immunomodulatory activity of interferon proteins can lead to the induction of an anti-tumor immune response. This response includes activation of NK cells, stimulation of macrophage activity and induction of MHC class I surface expression, leading to the induction of anti-tumor cytotoxic T lymphocyte activity.
  • interferons play a role in cross-presentation of antigens in the immune system.
  • IFN- ⁇ protein may have anti-angiogenic activity.
  • Angiogenesis new blood vessel formation, is critical for the growth of solid tumors.
  • IFN- ⁇ may inhibit angiogenesis by inhibiting the expression of pro-angiogenic factors such as bFGF and VEGF.
  • interferon proteins may inhibit tumor invasiveness by modulating the expression of enzymes, such as collagenase and elastase, which are important in tissue remodeling.
  • Interferons also appear to have antiviral activities that are based on two different mechanisms. For instance, type I interferon proteins ( ⁇ and ⁇ ) can directly inhibit the replication of human hepatitis B virus (“HBV”) and hepatitis C virus (“HCV”), but can also stimulate an immune response that attacks cells infected with these viruses.
  • HBV human hepatitis B virus
  • HCV hepatitis C virus
  • compositions are provided for increasing the production of a type I interferon (IFN) in a cell. Aspects of the methods include increasing the level of a 2′-5′ phosphodiester linkage comprising cyclic-di-nucleotide in a cell in a manner sufficient to increase production of the type I interferon (IFN) by the cell. Also provided are compositions and kits for practicing the subject methods.
  • a method for increasing the production of a type I interferon (IFN) in a cell by increasing the level of a 2′-5′ phosphodiester linkage containing cyclic-di-nucleotide in the cell in a manner sufficient to increase production of the type I interferon (IFN) by the cell.
  • IFN type I interferon
  • the method includes the step of contacting the cell with the cyclic-di-nucleotide.
  • the cyclic-di-nucleotide has two 2′-5′ phosphodiester linkages. In other embodiments, the cyclic-di-nucleotide has a 2′-5′ phosphodiester linkage and a 3′-5′ phosphodiester linkage.
  • the cyclic-di-nucleotide comprises a guanosine nucleoside. In some embodiments, the cyclic-di-nucleotide contains two guanosine nucleosides. In certain embodiments, the cyclic-di-nucleotide comprises an adenosine nucleoside. In some embodiments, the cyclic-di-nucleotide contains two adenosine nucleosides. In other embodiments, the cyclic-di-nucleotide comprises an adenosine nucleoside and a guanosine nucleoside.
  • the cyclic-di-nucleotide has the following formula:
  • the cyclic-di-nucleotide has the following formula:
  • the level of the cyclic-di-nucleotide is increased by increasing the activity of a cGAMP synthase (cGAS) in the cell.
  • cGAS cGAMP synthase
  • the activity of the cGAS is increased by enhancing expression of a nucleic acid encoding cGAS.
  • the activity of the cGAS is increased by introducing a nucleic acid encoding the cGAS into the cell.
  • the method is for increasing the production of interferon (IFN) alpha.
  • IFN interferon alpha.
  • the IFN is interferon beta.
  • the method is for increasing the production of a type I interferon (IFN) in a mammalian cell.
  • mammalian cell is a human cell.
  • the cell is in vitro. In other embodiments, the cell is in vivo.
  • a method for increasing the production of a type I interferon (IFN) in a subject includes the step of administering to the subject an amount of a 2′-5′ phosphodiester linkage comprising cyclic-di-nucleotide active agent effective to increase the production of the type I interferon in the subject.
  • the active agent can include, but is not limited to, any of the 2′-5′ phosphodiester linkage containing cyclic-di-nucleotides described herein.
  • the cyclic-di-nucleotide has two 2′-5′ phosphodiester linkages.
  • the cyclic-di-nucleotide has a 2′-5′ phosphodiester linkage and a 3′-5′ phosphodiester linkage.
  • the cyclic-di-nucleotide contains a guanosine nucleoside. In certain embodiments, the cyclic-di-nucleotide contains two guanosine nucleosides. In some embodiments, the cyclic-di-nucleotide contains an adenosine nucleoside. In specific embodiments, the cyclic-di-nucleotide contains two adenosine nucleosides. In other embodiments, the cyclic-di-nucleotide contains an adenosine and a guanosine nucleoside. In some embodiments, the cyclic-di-nucleotide has the following formula:
  • the cyclic-di-nucleotide has the following formula:
  • the 2′-5′ phosphodiester linkage comprising cyclic-di-nucleotide active agent includes an agent that increases cellular activity of a cGAMP synthase (cGAS).
  • the agent comprises a nucleic acid encoding the cGAS.
  • the method is for increasing the production of interferon (IFN) alpha in a subject. In other embodiments, the method is for increasing the production of interferon beta in a subject.
  • IFN interferon
  • the subject has a viral infection. In certain embodiments, the subject has a bacterial infection. In other embodiments, the subject has a neoplastic disease. In certain embodiments, the subject is mammal. In some embodiments, the mammal is a human.
  • a method for increasing a stimulator of interferon genes (STING) mediated response in a subject includes the step of administering to the subject an amount of a STING active agent effective to increase a STING mediated response in the subject.
  • the STING mediated response is non-responsive to a cyclic-di-nucleotide having two 3′-5′ phosphodiester bonds.
  • the STING active agent can include, but is not limited to, any of the 2′-5′ phosphodiester linkage containing cyclic-di-nucleotides described herein.
  • the cyclic-di-nucleotide has two 2′-5′ phosphodiester linkages.
  • the cyclic-di-nucleotide has a 2′-5′ phosphodiester linkage and a 3′-5′ phosphodiester linkage.
  • the cyclic-di-nucleotide contains a guanosine nucleoside. In certain embodiments, the cyclic-di-nucleotide contains two guanosine nucleosides. In some embodiments, the cyclic-di-nucleotide contains an adenosine nucleoside. In specific embodiments, the cyclic-di-nucleotide contains two adenosine nucleosides. In other embodiments, the cyclic-di-nucleotide contains an adenosine and a guanosine nucleoside. In some embodiments, the cyclic-di-nucleotide has the following formula:
  • the cyclic-di-nucleotide has the following formula:
  • the STING active agent includes an agent that increases cellular activity of a cGAMP synthase (cGAS).
  • the agent comprises a nucleic acid encoding the cGAS.
  • the STING active agent includes an agent that increases cellular activity of STING.
  • the agent comprises a nucleic acid encoding the STING.
  • the subject has a viral infection. In certain embodiments, the subject has a bacterial infection. In other embodiments, the subject has a neoplastic disease. In certain embodiments, the subject is mammal. In some embodiments, the mammal is a human.
  • a cyclic-di-nucleotide comprising a 2′-5′ phosphodiester linkage.
  • Such cyclic-di-nucleotides are useful, for example, in practicing the subject methods, including, but not limited to, methods for increasing the production of a type I interferon in a cell or a subject.
  • the cyclic-di-nucleotide has two 2′-5′ phosphodiester linkages. In other embodiments, the cyclic-di-nucleotide has a 2′-5′ phosphodiester linkage and a 3′-5′ phosphodiester linkage.
  • the cyclic-di-nucleotide contains a guanosine nucleoside. In some embodiments, the cyclic-di-nucleotide contains two guanosine nucleosides. In certain embodiments, the cyclic-di-nucleotide contains an adenosine nucleoside. In some embodiments, the cyclic-di-nucleotide contains two adenosine nucleosides. In other embodiments, the cyclic-di-nucleotide contains an adenosine and a guanosine nucleoside.
  • the cyclic-di-nucleotide has the following formula:
  • the cyclic-di-nucleotide has the following formula:
  • composition containing a 2′-5′ phosphodiester linkage containing cyclic-di-nucleotiden and a pharmaceutically acceptable carrier.
  • the cyclic-di-nucleotide has two 2′-5′ phosphodiester linkages. In other embodiments, the cyclic-di-nucleotide has a 2′-5′ phosphodiester linkage and a 3′-5′ phosphodiester linkage. In certain embodiments of the composition, the cyclic-di-nucleotide contains a guanosine nucleoside. In some embodiments, the cyclic-di-nucleotide contains two guanosine nucleosides. In certain embodiments, the cyclic-di-nucleotide contains an adenosine nucleoside.
  • the cyclic-di-nucleotide contains two adenosine nucleosides. In other embodiments, the cyclic-di-nucleotide contains an adenosine and a guanosine nucleoside.
  • the cyclic-di-nucleotide has the following formula:
  • the cyclic-di-nucleotide has the following formula:
  • FIGS. 1A-1F show the variable responsiveness of human STING variants to cyclic-di-nucleotides maps to arginine 232.
  • THP-1 cells were transduced with vectors encoding an shRNA targeting STING or a control shRNA. Cells were then stimulated with cyclic-di-GMP (cdG), dsDNA, cyclic-di-AMP (cdA), poly-inosine:cytosine (pI:C), or Sendai Virus, and induction of human interferon- ⁇ mRNA was assessed by quantitative reverse transcriptase PCR.
  • B Western blotting confirmed that knockdown of STING was effective.
  • HEK293T cells were transfected with the indicated amounts of various mouse (m) or human (h) STING expression plasmid and then stimulated 6 h later by transfection with synthetic cdG (5 ⁇ M). GT denotes the null 1199N allele of Sting from Goldenticket (Gt) mice. STING activation was assessed by use of a co-transfected IFN-luciferase reporter construct.
  • (D) Gt (STING-null) macrophages were transduced with retroviral vectors encoding the indicated STING alleles and were then stimulated 48 h later by transfection with cdG (5 ⁇ M) or dsDNA 70-mer oligonucleotide (0.5 ⁇ g/mL). IFN induction was measured by qRT-PCR. ND, not detected.
  • FIG. 2 shows the sequence alignment of hSTING variants.
  • hSTING was cloned from THP-1 cells compared to the reference STING allele (NCBI NP — 938023.1).
  • FIG. 3 shows that R232 of human STING is required for responsiveness to c-di-GMP, but not for binding of c-di-GMP.
  • A 293T cells were transfected with the indicated alleles of mouse (m)STING or human (h)STING and were then stimulated with c-di-GMP (cdG). STING activity was detected by the induction of a co-transfected IFN-luciferase reporter construct and expressed as fold-induction over luciferase activity of unstimulated cells.
  • Lysates of transfected 293T cells were UV crosslinked in the presence of ⁇ 32P-c-di-GMP, resolved by SDS-PAGE, and then analyzed by autoradiography. Lysates were also western blotted for STING and ACTIN as expression controls in parallel.
  • FIG. 4 shows that G230A and H232R are both required for optimal responsiveness to c-di-nucleotides but are not required for binding to c-di-nucleotides.
  • A, B 293T cells were transfected with the indicated alleles of mouse (m)STING or human (h)STING and were then stimulated with c-di-GMP (cdG). STING activity was detected by the induction of a cotransfected IFN-luciferase reporter construct.
  • FIG. 5 shows that STING variants are responsive to cGAS.
  • A HEK293T cells were transfected with the indicated STING alleles and with human and mouse cGAS (wt and GS>AA mutants) as indicated. STING activation was assessed by a co-transfected IFN-luciferase reporter construct.
  • B HEK293T cells were transfected with the indicated STING alleles and with a mammalian expression vector encoding a cGAMP synthase (DncV) from V. cholerae . STING activation was assessed as in A.
  • DncV mammalian expression vector encoding a cGAMP synthase
  • FIG. 6 shows that cGAS produces a non-canonical cyclic dinucleotide containing a 2′-5′ phosphodiester linkage.
  • WspR, DncV and cGAS were mixed with ⁇ 32 P-GTP or ⁇ 32 P-ATP and the indicated unlabeled nucleotides. Reactions were mixed with TLC running buffer and nucleic acid species were resolved on a PEI-Cellulose TLC plate.
  • FIGS. 7A-7D provide additional NMR analysis of the cGAS product. All data acquisition was performed in D2O and at 50° C.
  • A, B Multiplicity-edited 1H-13C HSQC experiment in a 900 MHz field. Positive phased signals corresponding to methine and methyl protons are shown in green, negative phased signals corresponding to methylene protons are shown in blue.
  • C 1 H- 1 H COSY experiment in a 600 MHz field.
  • D 1 H- 1 H NOESY experiment in a 900 MHz field.
  • compositions are provided for increasing the production of a type I interferon (IFN) in a cell. Aspects of the methods include increasing the level of a 2′-5′ phosphodiester linkage comprising cyclic-di-nucleotide in a cell in a manner sufficient to increase production of the type I interferon (IFN) by the cell. Also provided are compositions and kits for practicing embodiments of the subject methods.
  • methods of increasing the production of a type I interferon (IFN) in a cell e.g., in vitro or in vivo are provided.
  • IFN type I interferon
  • the subject methods increase type-I interferon production in a cell, as compared to a control.
  • the magnitude of the increase may vary, and in some instances is 2-fold or greater, such as 5-fold or greater, including 10-fold or greater, as compared to a suitable control.
  • the methods are methods of increasing type-I interferon production in a cell, e.g., by a magnitude of 2-fold or greater, such as 5-fold or greater, including 10-fold or greater, as compared to a suitable control.
  • Interferon production can be measured using any suitable method, including, but not limited to, vesicular stomatitis virus (VSV) challenge bioassay, enzyme-linked immunosorbent assay (ELISA) replicon based bioassays or by using a reporter gene (e.g., luciferase) cloned under regulation of a Type I interferon signaling pathway.
  • VSV vesicular stomatitis virus
  • ELISA enzyme-linked immunosorbent assay
  • the methods may be used to increase the production of any type I interferon including, but not limited to: IFN- ⁇ (alpha), IFN- ⁇ (beta), IFN- ⁇ (kappa), IFN- ⁇ (delta), IFN- ⁇ (epsilon), IFN- ⁇ (tau), IFN- ⁇ (omega), and IFN- ⁇ (zeta, also known as limitin).
  • IFN- ⁇ alpha
  • IFN- ⁇ beta
  • IFN- ⁇ kappa
  • IFN- ⁇ delta
  • IFN- ⁇ epsilon
  • IFN- ⁇ tau
  • IFN- ⁇ miga
  • IFN- ⁇ zeta, also known as limitin
  • the method is for increasing the production of IFN- ⁇ .
  • aspects of the methods include increasing the level of a 2′-5′ phosphodiester linkage comprising cyclic-di-nucleotide in a cell in a manner sufficient to increase production of the type I interferon by the cell.
  • increasing the level of a 2′-5′ phosphodiester linkage comprising cyclic-di-nucleotide is meant that the subject methods increase the amount of a 2′-5′ phosphodiester linkage comprising cyclic-di-nucleotide as compared to a control.
  • 2′-5′ phosphodiester linkage comprising cyclic-di-nucleotides can increase the levels of type I interferon production.
  • the magnitude of the increase may vary, and in some instances is 2-fold or greater, such as 5-fold or greater, including 10-fold or greater, 15-fold greater, 20-fold greater, 25-fold greater, 30-fold greater, 35-fold greater, 40-fold greater, 45-fold greater, 50-fold greater, or 100 fold greater, as compared to a suitable control.
  • the method includes providing a target cell with a cyclic-di-nucleotide active agent that increases 2′-5′ phosphodiester linkage comprising cyclic-di-nucleotide levels in the target cell.
  • Cyclic-di-nucleotide active agents may vary, and include, but are not limited to: small molecules, nucleic acid, protein, and peptide agents.
  • the cyclic-di-nucleotide active agent increases IFN- ⁇ (alpha), IFN- ⁇ (beta), IFN- ⁇ (kappa), IFN- ⁇ (delta), IFN- ⁇ (epsilon), IFN- ⁇ (tau), IFN- ⁇ (omega), and/or IFN- ⁇ (zeta, also known as limitin) in a cell or subject as compared to a control that has not been contacted with the cyclic-di-nucleotide active agent.
  • the increase is from 1.5-fold increase to 50-fold increase or more, including 2-fold increase to 45-fold increase, 5-fold increase to 40-fold increase, 10-fold increase to 35-fold increase, 15-fold increase to 30-fold increase, 20-fold increase to 30-fold increase, and the like.
  • the cyclic-di-nucleotide active agent is a 2′-5′ phosphodiester linkage containing cyclic-di-nucleotide or a functional analogue thereof.
  • 2′-5′ phosphodiester linkage containing cyclic-di-nucleotide include, but are not limited to, those 2′-5′ phosphodiester linkage containing cyclic-di-nucleotides described herein.
  • cyclic-di-nucleotide refers to a compound containing two nucleosides (i.e., a first and second nucleoside), wherein the 2′ or 3′ carbon of each nucleoside is linked to the 5′ carbon of the other nucleoside by a phosphodiester bond. Therefore, a 2′-5′ phosphodiester linkage containing cyclic-di-nucleotide refers to a cyclic-di-nucleotide, wherein the 2′ carbon of at least the first or second nucleosides is linked to the 5′ carbon of the other nucleoside. 2′-5′ phosphodiester linkage containing cyclic-di-nucleotide are discussed in greater detail below.
  • Functional analogues of 2′-5′ phosphodiester linkage containing cyclic-di-nucleotides are those compounds that exhibit similar functional activity (e.g., increasing the production of a type I IFN) and may have a similar structure to a 2′-5′ phosphodiester linkage containing cyclic-di-nucleotide.
  • the functional analogue is a small molecule agent.
  • Naturally occurring or synthetic small molecule compounds of interest include numerous chemical classes, such organic molecules, including small organic compounds having a molecular weight of more than 50 and less than about 2,500 daltons.
  • Candidate agents comprise functional groups necessary for structural interaction with proteins, particularly hydrogen bonding, and typically include at least an amine, carbonyl, hydroxyl or carboxyl group, preferably at least two of the functional chemical groups.
  • the candidate agents may comprise cyclical carbon or heterocyclic structures and/or aromatic or polyaromatic structures substituted with one or more of the above functional groups.
  • Candidate agents are also found among biomolecules including peptides, saccharides, fatty acids, steroids, purines, pyrimidines, derivatives, structural analogs or combinations thereof. Such molecules may be identified, among other ways, by employing suitable screening protocols.
  • the cyclic-di-nucleotide active agent is an agent that increases the cellular activity of a cyclic GMP-AMP synthase (cGAS).
  • cGAS cyclic GMP-AMP synthase
  • increasing the levels cGMP synthase (cGAS) can increase the production and/or activity of cyclic-di-nucleotide in a cell.
  • a target cell may be contacted with an agent that increases cGMP synthase production and/or cellular activity in a manner sufficient to increase the production of Type I interferon in the cell.
  • the cyclic-di-nucleotide active agent is a nucleic acid encoding a cGAS.
  • Nucleic acids encoding various cGAS enzymes include, but are not limited to, those described in: Sun et al. Science 339(6121):786-91 and those deposited in GENBANK and assigned deposit numbers: NM — 138441.2 and NP — 612450.2 (human); NM — 173386.4 and NP — 775562.2 ( mus musculus ).
  • nucleic acid encoding cGAS has the following sequence:
  • the nucleic acid encoding cGAS is a nucleic acid with 40% to 99%, 45% to 99%, 50% to 99%, 55% to 99%, 60% to 99%, 65% to 99%, 70% to 99%, 75% to 99%, 80% to 99%, 85% to 99%, 90% to 99% or, 95% to 99% sequence identity with a wild type cGAS nucleic acid sequence.
  • the nucleic acid encoding cGAS is a nucleic acid with 40% to 50%, 50% to 60%, 60% to 70%, 70% to 80%, 80% to 90%, or 90 to 99% sequence identity with a wild type cGAS nucleic acid sequence.
  • the nucleic acid encoding cGAS is a nucleic acid with 40% or more, 45% or more, 50% or more, 55% or more, 60% or more, 70% or more, 75% or more, 80% or more, 85% or more, 90% or more, 95% or more or 99% or more sequence identity with a wild type cGAS nucleic acid sequence.
  • the cyclic-di-nucleotide active agent is a vector containing a nucleic acid encoding cGAS.
  • Vectors may be provided directly to the subject cells.
  • the cells are contacted with vectors having the nucleic acid encoding the cyclic-di-nucleotide active agent(s) (e.g., a nucleic acid encoding cGAS) such that the vectors are taken up by the cells.
  • Methods for contacting cells with nucleic acid vectors that are plasmids such as electroporation, calcium chloride transfection, and lipofection, are well known in the art.
  • the cells are contacted with viral particles comprising the nucleic acid encoding the cyclic-di-nucleotide agent(s).
  • Retroviruses for example, lentiviruses, are particularly suitable to the method of the invention. Commonly used retroviral vectors are “defective”, i.e., unable to produce viral proteins required for productive infection. Rather, replication of the vector requires growth in a packaging cell line. To generate viral particles comprising nucleic acids of interest, the retroviral nucleic acids comprising the nucleic acid are packaged into viral capsids by a packaging cell line.
  • Different packaging cell lines provide a different envelope protein (ecotropic, amphotropic or xenotropic) to be incorporated into the capsid, this envelope protein determining the specificity of the viral particle for the cells (ecotropic for murine and rat; amphotropic for most mammalian cell types including human, dog and mouse; and xenotropic for most mammalian cell types except murine cells).
  • the appropriate packaging cell line may be used to ensure that the cells are targeted by the packaged viral particles.
  • Vectors used for providing the nucleic acids encoding the cyclic-di-nucleotide activity active agent(s) to the subject cells may include suitable promoters for driving the expression, that is, transcriptional activation, of the nucleic acid of interest.
  • the nucleic acid of interest will be operably linked to a promoter.
  • This may include ubiquitously acting promoters, for example, the CMV- ⁇ -actin promoter, or inducible promoters, such as promoters that are active in particular cell populations or that respond to the presence of drugs such as tetracycline.
  • transcriptional activation it is intended that transcription will be increased above basal levels in the target cell by 10 fold or more, by 100 fold or more, by 1000 fold or more.
  • vectors used for providing cyclic-di-nucleotide active agent(s) to the subject cells may include nucleic acid sequences that encode for selectable markers in the target cells, so as to identify cells that have taken up the cyclic-di-nucleotide activity active agent(s).
  • Cyclic-di-nucleotide active agent(s) may also be provided to cells as polypeptides.
  • the cyclic-di-nucleotide active agent is a cGAS polypeptide.
  • Amino acid sequences of various cGAS enzymes include, but are not limited to, those described in: Sun et al. Science 339(6121):786-91 and those deposited in GENBANK and assigned deposit numbers: NM — 138441.2 and NP — 612450.2 (human); NM — 173386.4 and NP — 775562.2 ( mus musculus ).
  • the cGAS polypeptide has the following sequence:
  • the cGAS polypeptide is a polypeptide that has 40% to 99%, 45% to 99%, 50% to 99%, 55% to 99%, 60% to 99%, 65% to 99%, 70% to 99%, 75% to 99%, 80% to 99%, 85% to 99%, 90% to 99% or, 95% to 99% sequence identity with a wild type cGAS amino acid sequence.
  • the cGAS polypeptide is a polypeptide that has 40% to 50%, 50% to 60%, 60% to 70%, 70% to 80%, 80% to 90%, or 90 to 99% sequence identity with a wild type cGAS amino acid sequence.
  • the cGAS polypeptide is a polypeptide that has 40% or more, 45% or more, 50% or more, 55% or more, 60% or more, 70% or more, 75% or more, 80% or more, 85% or more, 90% or more, 95% or more or 99% or more sequence identity with a wild type cGAS amino acid sequence.
  • Such polypeptides may optionally be fused to a polypeptide domain that increases solubility of the product.
  • the domain may be linked to the polypeptide through a defined protease cleavage site, e.g., a TEV sequence, which is cleaved by TEV protease.
  • the linker may also include one or more flexible sequences, e.g., from 1 to 10 glycine residues.
  • the cleavage of the fusion protein is performed in a buffer that maintains solubility of the product, e.g., in the presence of from 0.5 to 2 M urea, in the presence of polypeptides and/or polynucleotides that increase solubility, and the like.
  • Domains of interest include endosomolytic domains, e.g., influenza HA domain; and other polypeptides that aid in production, e.g., IF2 domain, GST domain, GRPE domain, and the like.
  • the polypeptide may be formulated for improved stability.
  • the peptides may be PEGylated, where the polyethyleneoxy group provides for enhanced lifetime in the blood stream.
  • the cyclic-di-nucleotide active agent(s) may be fused to a polypeptide permeant domain to promote uptake by the cell.
  • a permeant domains are known in the art and may be used in the non-integrating polypeptides of the present invention, including peptides, peptidomimetics, and non-peptide carriers.
  • a permeant peptide may be derived from the third alpha helix of Drosophila melanogaster transcription factor Antennapaedia, referred to as penetratin, which comprises the amino acid sequence RQIKIWFQNRRMKWKK (SEQ ID NO:03).
  • the permeant peptide comprises the HIV-1 tat basic region amino acid sequence, which may include, for example, amino acids 49-57 of naturally-occurring tat protein.
  • Other permeant domains include poly-arginine motifs, for example, the region of amino acids 34-56 of HIV-1 rev protein, nona-arginine, octa-arginine, and the like.
  • the nona-arginine (R9) sequence is one of the more efficient PTDs that have been characterized (Wender et al. 2000; Uemura et al. 2002).
  • the site at which the fusion is made may be selected in order to optimize the biological activity, secretion or binding characteristics of the polypeptide. The optimal site will be determined by routine experimentation.
  • an effective amount of the active agent i.e., a cyclic-di-nucleotide active agent (such as described above) is provided in the target cell or cells.
  • effective amount or “efficacious amount” means the amount of the active agent that, when contacted with the cell, e.g., by being introduced into the cell in vitro, by being administered to a subject, etc., is sufficient to result in increased levels of a cyclic-di-nucleotide in the cell.
  • the “effective amount” will vary depending on cell and/or the organism and/or compound and or the nature of the desired outcome and/or the disease and its severity and the age, weight, etc., of the subject to be treated.
  • the effective amount of the active agent is provided in the cell by contacting the cell with the active agent.
  • Contact of the cell with the active agent may occur using any convenient protocol.
  • the protocol may provide for in vitro or in vivo contact of the active agent with the target cell, depending on the location of the target cell.
  • the target cell is an isolated cell, e.g., a cell in vitro (i.e., in culture), or a cell ex vivo (“ex vivo” being cells or organs are modified outside of the body, where such cells or organs are typically returned to a living body)
  • the active agent may be introduced directly into the cell under cell culture conditions permissive of viability of the target cell.
  • Such techniques include, but are not necessarily limited to: viral infection, transfection, conjugation, protoplast fusion, electroporation, particle gun technology, calcium phosphate precipitation, direct microinjection, viral vector delivery, and the like.
  • the choice of method is generally dependent on the type of cell being contacted and the nature of the active agent, and the circumstances under which the transformation is taking place (e.g., in vitro, ex vivo, or in vivo).
  • a general discussion of these methods can be found in Ausubel, et al, Short Protocols in Molecular Biology, 3rd ed., Wiley & Sons, 1995.
  • the active agent may be administered to the organism or subject in a manner such that the agent is able to contact the target cell(s), e.g., via an in vivo protocol.
  • in vivo it is meant in the target construct is administered to a living body of an animal.
  • the cyclic-di-nucleotide active agent is employed to modulate c-di-AMP activity in mitotic or post-mitotic cells in vitro or ex vivo, i.e., to produce modified cells that can be reintroduced into an individual.
  • Mitotic and post-mitotic cells of interest in these embodiments include any eukaryotic cell, e.g., pluripotent stem cells, for example, ES cells, iPS cells, and embryonic germ cells; somatic cells, for example, hematopoietic cells, fibroblasts, neurons, muscle cells, bone cells, vascular endothelial cells, gut cells, and the like, and their lineage-restricted progenitors and precursors; and neoplastic, or cancer, cells, i.e., cells demonstrating one or more properties associated with cancer cells, e.g., hyperproliferation, contact inhibition, the ability to invade other tissue, etc.
  • the eukaryotic cells are cancer cells.
  • the eukaryotic cells are hematopoietic cells, e.g., macrophages, NK cells, etc.
  • Cells may be from any mammalian species, e.g., murine, rodent, canine, feline, equine, bovine, ovine, primate, human, etc.
  • Cells may be from established cell lines or they may be primary cells, where “primary cells”, “primary cell lines”, and “primary cultures” are used interchangeably herein to refer to cells and cells cultures that have been derived from a subject and allowed to grow in vitro for a limited number of passages, i.e., splittings, of the culture.
  • primary cultures are cultures that may have been passaged 0 times, 1 time, 2 times, 4 times, 5 times, 10 times, or 15 times, but not enough times go through the crisis stage.
  • the primary cell lines of the present invention are maintained for fewer than 10 passages in vitro.
  • the cells may be harvested from an individual by any convenient method.
  • blood cells e.g., leukocytes, e.g., macrophages
  • leukocytes e.g., macrophages
  • cells from tissues such as skin, muscle, bone marrow, spleen, liver, pancreas, lung, intestine, stomach, etc.
  • An appropriate solution may be used for dispersion or suspension of the harvested cells.
  • Such solution will generally be a balanced salt solution, e.g., normal saline, PBS, Hank's balanced salt solution, etc., conveniently supplemented with fetal calf serum or other naturally occurring factors, in conjunction with an acceptable buffer at low concentration, generally from 5-25 mM.
  • Convenient buffers include HEPES, phosphate buffers, lactate buffers, etc.
  • the cells may be used immediately, or they may be stored, frozen, for long periods of time, being thawed and capable of being reused.
  • the cells may be frozen in 10% DMSO, 50% serum, 40% buffered medium, or some other such solution as is commonly used in the art to preserve cells at such freezing temperatures, and thawed in a manner as commonly known in the art for thawing frozen cultured cells.
  • the cyclic-di-nucleotide active agent(s) may be produced by eukaryotic cells or by prokaryotic cells, it may be further processed by unfolding, e.g., heat denaturation, DTT reduction, etc. and may be further refolded, using methods known in the art.
  • Modifications of interest that do not alter primary sequence include chemical derivatization of polypeptides, e.g., acylation, acetylation, carboxylation, amidation, etc. Also included are modifications of glycosylation, e.g., those made by modifying the glycosylation patterns of a polypeptide during its synthesis and processing or in further processing steps; e.g., by exposing the polypeptide to enzymes which affect glycosylation, such as mammalian glycosylating or deglycosylating enzymes. Also embraced are sequences that have phosphorylated amino acid residues, e.g., phosphotyrosine, phosphoserine, or phosphothreonine.
  • cyclic-di-nucleotide active agent polypeptides e.g., cGAS polypeptides
  • cGAS polypeptides cyclic-di-nucleotide active agent polypeptides
  • Analogs of such polypeptides include those containing residues other than naturally occurring L-amino acids, e.g., D-amino acids or non-naturally occurring synthetic amino acids. D-amino acids may be substituted for some or all of the amino acid residues.
  • the cyclic-di-nucleotide active agent (s) may be prepared by in vitro synthesis, using any suitable method.
  • Various commercial synthetic apparatuses are available, for example, automated synthesizers by Applied Biosystems, Inc., Beckman, etc. By using synthesizers, naturally occurring amino acids may be substituted with unnatural amino acids. The particular sequence and the manner of preparation will be determined by convenience, economics, purity required, and the like.
  • cysteines can be used to make thioethers, histidines for linking to a metal ion complex, carboxyl groups for forming amides or esters, amino groups for forming amides, and the like.
  • the cyclic-di-nucleotide active agent(s) may also be isolated and purified in accordance with conventional methods of recombinant synthesis.
  • a lysate may be prepared of the expression host and the lysate purified using HPLC, exclusion chromatography, gel electrophoresis, affinity chromatography, or other purification technique.
  • the compositions which are used will include 20% or more by weight of the desired product, such as 75% or more by weight of the desired product, including 95% or more by weight of the desired product, and for therapeutic purposes, may be 99.5% or more by weight, in relation to contaminants related to the method of preparation of the product and its purification (where the percentages may be based upon total protein).
  • the cyclic-di-nucleotide active agent(s) be they small molecules (e.g., 2′-5′ phosphodiester linkage containing cyclic-di-nucleotides) polypeptides or nucleic acids that encode cyclic-di-nucleotide active agent polypeptides (e.g., cGAS)—may be provided to the cells for a sufficient period of time, e.g., from 30 minutes to 24 hours, e.g., 1 hour, 1.5 hours, 2 hours, 2.5 hours, 3 hours, 3.5 hours 4 hours, 5 hours, 6 hours, 7 hours, 8 hours, 12 hours, 16 hours, 18 hours, 20 hours, or any other period from 30 minutes to 24 hours, which may be repeated with a frequency of every day to every 4 days, e.g., every 1.5 days, every 2 days, every 3 days, or any other frequency from about every day to about every four
  • the agent(s) may be provided to the subject cells one or more times, e.g., one time, twice, three times, or more than three times, and the cells allowed to incubate with the agent(s) for some amount of time following each contacting event e.g., 16-24 hours, after which time the media is replaced with fresh media and the cells are cultured further.
  • two or more, three or more, four or more, five or more, six or more, seven or more, eight or more, nine or more, or ten or more different cyclic-di-nucleotide active agents are provided to a cell in a manner sufficient to increase production of a type I interferon by the cell.
  • the active agents include two or more different 2′-5′ phosphodiester linkage comprising cyclic-di-nucleotides.
  • the active agents include a 2′-5′ phosphodiester linkage containing cyclic-di-nucleotide and a nucleic acid encoding cGAS or a cGAS polypeptide.
  • the cyclic-di-nucleotide active agent(s) may be provided simultaneously, e.g., as two cyclic-di-nucleotides delivered simultaneously or a cyclic-di-nucleotide and a vector containing a nucleic acid encoding cGAS delivered simultaneously. Alternatively, they may be provided consecutively, e.g., the first cyclic-di-nucleotide active agent being provided first, followed by the cyclic-di-nucleotide active agent, etc. or vice versa.
  • An effective amount of cyclic-di-nucleotide active agent(s) are provided to the cells to result in a change in cyclic-di-nucleotide levels.
  • An effective amount of cyclic-di-nucleotide active agent is the amount to result in a 2-fold increase or more in the amount of cyclic-di-nucleotide production observed relative to a negative control, e.g., a cell contacted with an empty vector or irrelevant polypeptide.
  • an effective amount or dose of a cyclic-di-nucleotide active agent will result in a 2-fold increase, a 3-fold increase, a 4-fold increase or more in the amount of cyclic-di-nucleotide observed, in some instances a 5-fold increase, a 6-fold increase or more, sometimes a 7-fold or 8-fold increase or more in the amount of activity observed, e.g., an increase of 10-fold, 50-fold, or 100-fold or more, in some instances, an increase of 200-fold, 500-fold, 700-fold, or 1000-fold or more, in the amount of activity observed.
  • the amount of activity may be measured by any suitable method.
  • the amount of interferon produced by the cell may be assessed after contact with the cyclic-di-nucleotide active agent(s), e.g., 2 hours, 4 hours, 8 hours, 12 hours, 24 hours, 36 hours, 48 hours, 72 hours or more after contact with the cyclic-di-nucleotide active agent(s).
  • cyclic-di-nucleotide active agent(s) may occur in any culture media and under any culture conditions that promote the survival of the cells.
  • cells may be suspended in any appropriate nutrient medium that is convenient, such as Iscove's modified DMEM or RPMI 1640, supplemented with fetal calf serum or heat inactivated goat serum (about 5-10%), L-glutamine, a thiol, particularly 2-mercaptoethanol, and antibiotics, e.g., penicillin and streptomycin.
  • the culture may contain growth factors to which the cells are responsive. Growth factors, as defined herein, are molecules capable of promoting survival, growth and/or differentiation of cells, either in culture or in the intact tissue, through specific effects on a transmembrane receptor. Growth factors include polypeptides and non-polypeptide factors.
  • a cell may be modified ex vivo to have an increase in cyclic-di-nucleotide levels.
  • it may be desirous to select for the modified cell, e.g., to create an enriched population of modified cells.
  • Any convenient modification to the cells that marks the cells as modified with a cyclic-di-nucleotide active agent may be used.
  • a selectable marker may be inserted into the genome of the cell, so that the population of cells may be enriched for those comprising the genetic modification by separating the genetically marked cells from the remaining population. Separation may be by any convenient separation technique appropriate for the selectable marker used.
  • cells may be separated by fluorescence activated cell sorting
  • fluorescence activated cell sorting if a fluorescent marker has been inserted, cells may be separated from the heterogeneous population by affinity separation techniques, e.g., magnetic separation, affinity chromatography, “panning” with an affinity reagent attached to a solid matrix, or other convenient technique.
  • Techniques providing accurate separation include fluorescence activated cell sorters, which can have varying degrees of sophistication, such as multiple color channels, low angle and obtuse light scattering detecting channels, impedance channels, etc.
  • the cells may be selected against dead cells by employing dyes associated with dead cells (e.g., propidium iodide). Any technique may be employed which is not unduly detrimental to the viability of the genetically modified cells.
  • Cell compositions that are highly enriched for cells comprising cyclic-di-nucleotide active agent(s) are achieved in this manner.
  • “highly enriched” it is meant that the genetically modified cells will be 70% or more, 75% or more, 80% or more, 85% or more, 90% or more of the cell composition, for example, about 95% or more, or 98% or more of the cell composition.
  • the composition may be a substantially pure composition of cells comprising cyclic-di-nucleotide active agent(s).
  • Cells comprising cyclic-di-nucleotide active agent(s) produced by the methods described herein may be used immediately.
  • the cells may be frozen at liquid nitrogen temperatures and stored for long periods of time, being thawed and capable of being reused.
  • the cells may be frozen in 10% DMSO, 50% serum, 40% buffered medium, or some other such solution as is commonly used in the art to preserve cells at such freezing temperatures, and thawed in a manner as commonly known in the art for thawing frozen cultured cells.
  • the cells comprising cyclic-di-nucleotide active agent(s) may be cultured in vitro under various culture conditions.
  • the cells may be expanded in culture, i.e., grown under conditions that promote their proliferation.
  • Culture medium may be liquid or semi-solid, e.g., containing agar, methylcellulose, etc.
  • the cell population may be suspended in an appropriate nutrient medium, such as Iscove's modified DMEM or RPMI 1640, normally supplemented with fetal calf serum (about 5-10%), L-glutamine, a thiol, particularly 2-mercaptoethanol, and antibiotics, e.g., penicillin and streptomycin.
  • the culture may contain growth factors to which the regulatory T cells are responsive. Growth factors, as defined herein, are molecules capable of promoting survival, growth and/or differentiation of cells, either in culture or in the intact tissue, through specific effects on a transmembrane receptor. Growth factors include polypeptides and non-polypeptid
  • Cells that have been modified with cyclic-di-nucleotide active agent(s) may be transplanted to a subject to treat a disease or as an antiviral, antipathogenic, or anticancer therapeutic or for biological research.
  • the subject may be a neonate, a juvenile, or an adult.
  • Mammalian species that may be treated with the present methods include canines and felines; equines; bovines; ovines; etc. and primates, particularly humans. Animal models, particularly small mammals, e.g., murine, lagomorpha, etc., may be used for experimental investigations.
  • Cells may be provided to the subject alone or with a suitable substrate or matrix, e.g., to support their growth and/or organization in the tissue to which they are being transplanted.
  • at least 1 ⁇ 10 3 cells will be administered, for example 5 ⁇ 10 3 cells, 1 ⁇ 10 4 cells, 5 ⁇ 10 4 cells, 1 ⁇ 10 5 cells, 1 ⁇ 10 6 cells or more.
  • the cells may be introduced to the subject via any of the following routes: parenteral, subcutaneous, intravenous, intracranial, intraspinal, intraocular, or into spinal fluid.
  • the cells may be introduced by injection, catheter, or the like.
  • Examples of methods for local delivery include, e.g., through an Ommaya reservoir, e.g., for intrathecal delivery (see, e.g., U.S. Pat. Nos. 5,222,982 and 5,385,582, incorporated herein by reference); by bolus injection, e.g., by a syringe, e.g., into a joint; by continuous infusion, e.g., by cannulation, e.g., with convection (see e.g., US Application No. 20070254842, incorporated here by reference); or by implanting a device upon which the cells have been reversibly affixed (see e.g., US Application Nos. 20080081064 and 20090196903, incorporated herein by reference).
  • the cyclic-di-nucleotide active agent(s) are employed to increase the production of type I interferon in vivo.
  • the cyclic-di-nucleotide active agent(s) are administered directly to the individual.
  • the cyclic-di-nucleotide active agent administered to the subject contains a 2′-5′ phosphodiester linkage containing cyclic-di-nucleotide.
  • Cyclic-di-nucleotide active agent(s) may be administered by any suitable methods for the administration of peptides, small molecules and nucleic acids to a subject.
  • the cyclic-di-nucleotide active agent(s) can be incorporated into a variety of formulations. More particularly, the cyclic-di-nucleotide active agent(s) of the present invention can be formulated into pharmaceutical compositions by combination with appropriate pharmaceutically acceptable carriers or diluents. Pharmaceutical compositions that can be used in practicing the subject methods are described below.
  • an effective amount of the cyclic-di-nucleotide active agent is administered to the subject.
  • an “effective amount” or a “therapeutically effective amount” of the cyclic-di-nucleotide active agent it is meant an amount that is required to reduce the severity, the duration and/or the symptoms of the disease.
  • the effective amount of a pharmaceutical composition containing a cyclic-di-nucleotide active agent, as provided herein is between 0.025 mg/kg and 1000 mg/kg body weight of a human subject.
  • the pharmaceutical composition is administered to a human subject at an amount of 1000 mg/kg body weight or less, 950 mg/kg body weight or less, 900 mg/kg body weight or less, 850 mg/kg body weight or less, 800 mg/kg body weight or less, 750 mg/kg body weight or less, 700 mg/kg body weight or less, 650 mg/kg body weight or less, 600 mg/kg body weight or less, 550 mg/kg body weight or less, 500 mg/kg body weight or less, 450 mg/kg body weight or less, 400 mg/kg body weight or less, 350 mg/kg body weight or less, 300 mg/kg body weight or less, 250 mg/kg body weight or less, 200 mg/kg body weight or less, 150 mg/kg body weight or less, 100 mg/kg body weight or less, 95 mg/kg body weight or less, 90 mg/kg body weight or less, 85 mg/kg body weight or less, 80 mg/kg body weight or less, 75 mg/kg body weight or less, 70 mg/kg body weight or less, or 65 mg/
  • a method for increasing a stimulator of interferon genes (STING) mediated response in a subject e.g., a STING mediated immune response.
  • the method includes the step of administering to the subject an amount of a STING active agent effective to increase a STING mediated response in the subject.
  • STING mediated response refers to any response that is mediated by STING, including, but not limited to, immune responses to bacterial pathogens, viral pathogens, and eukaryotic pathogens. See, e.g., Ishikawa et al. Immunity 29: 538-550 (2008); Ishikawa et al.
  • STING also functions in certain autoimmune diseases initiated by inappropriate recognition of self DNA (see, e.g., Gall et al. Immunity 36: 120-131 (2012), as well as for the induction of adaptive immunity in response to DNA vaccines (see, e.g., Ishikawa et al. Nature 461: 788-792 (2009).
  • increasing a STING mediated response in a subject is meant an increase in a STING mediated response in a subject as compared to a control subject (e.g., a subject who is not administered a STING active agent).
  • the method is for increasing a stimulator of interferon genes (STING) mediated response in a subject, wherein the STING mediated response is non-responsive to a cyclic-di-nucleotide having two 3′-5′ phosphodiester bonds (i.e., a canonical cyclic dinucleotide).
  • STING stimulator of interferon genes
  • the STING active agent is a cyclic-di-nucleotide active agent described herein (e.g., cyclic-di-nucleotide, nucleic acid encoding cGAS).
  • the STING active agent is a nucleic acid encoding STING or a STING polypeptide.
  • Nucleic acids encoding various STINGs include, but are not limited to, those described in: Nitta et al. Hepatology 57(1): 46-58 (2013) and Jin et al. J. Immunol. 190(6): 2835-2843 (2013) and those deposited in GENBANK and assigned deposit numbers: NM — 198282.2 and NP — 938023.1 (human); NM — 028261.1 and NP — 082537.1 ( mus musculus ); and NM — 057386.4 and NP — 476734.1 ( Drosophila melanogaster ).
  • the nucleic acid encoding STING has the following sequence:
  • the nucleic acid encoding STING is a nucleic acid with 40% to 99%, 45% to 99%, 50% to 99%, 55% to 99%, 60% to 99%, 65% to 99%, 70% to 99%, 75% to 99%, 80% to 99%, 85% to 99%, 90% to 99% or, 95% to 99% sequence identity with a wild type STING nucleic acid sequence.
  • the nucleic acid encoding STING is a nucleic acid with 40% to 50%, 50% to 60%, 60% to 70%, 70% to 80%, 80% to 90%, or 90 to 99% sequence identity with a wild type STING nucleic acid sequence.
  • the nucleic acid encoding STING is a nucleic acid with 40% or more, 45% or more, 50% or more, 55% or more, 60% or more, 70% or more, 75% or more, 80% or more, 85% or more, 90% or more, 95% or more or 99% or more sequence identity with a wild type STING nucleic acid sequence.
  • Amino acid sequences of STING include, but are not limited to, those described in: Nitta et al. Hepatology 57(1): 46-58 (2013) and Jin et al. J. Immunol. 190(6): 2835-2843 (2013) and those deposited in GENBANK and assigned deposit numbers: NM — 198282.2 and NP — 938023.1 (human); NM — 028261.1 and NP — 082537.1 ( mus musculus ); and NM — 057386.4 and NP — 476734.1 ( Drosophila melanogaster ).
  • the STING polypeptide has the following sequence:
  • the STING polypeptide has the following sequence:
  • the STING polypeptide is a polypeptide that has 40% to 99%, 45% to 99%, 50% to 99%, 55% to 99%, 60% to 99%, 65% to 99%, 70% to 99%, 75% to 99%, 80% to 99%, 85% to 99%, 90% to 99% or, 95% to 99% sequence identity with a wild type STING amino acid sequence.
  • the cGAS polypeptide is a polypeptide that has 40% to 50%, 50% to 60%, 60% to 70%, 70% to 80%, 80% to 90%, or 90 to 99% sequence identity with a wild type STING amino acid sequence.
  • the STING polypeptide is a polypeptide that has 40% or more, 45% or more, 50% or more, 55% or more, 60% or more, 70% or more, 75% or more, 80% or more, 85% or more, 90% or more, 95% or more or 99% or more sequence identity with a wild type STING amino acid sequence.
  • the methods and compositions provided herein find use in a variety of applications, where such applications include increasing type I interferon (e.g., interferon- ⁇ ) in a subject is desired.
  • the methods and compositions provided herein find use in a variety of applications, where such applications include increasing STING mediated response in a subject is desired.
  • Specific applications of interest include those in which a subject is treated for a disease condition that would benefit from an increase in type I interferon by providing the subject with a therapeutically effective amount of a cyclic-di-nucleotide active agent.
  • the methods and compositions provided herein can be used to produce an ‘adjuvant’ effect in a vaccine to prevent an infection or other disease, wherein the active agent stimulates immunological memory to protect against future disease or infection.
  • subjects suitable for treatment with a method described herein include individuals having an immunological or inflammatory disease or disorder including, but not limited to a cancer, an autoimmune disease or disorder, an allergic reaction, a chronic infectious disease and an immunodeficiency disease or disorder.
  • subjects suitable for treatment with a method of the present invention include individuals having a cellular proliferative disease, such as a neoplastic disease (e.g., cancer).
  • a cellular proliferative disease such as a neoplastic disease (e.g., cancer).
  • Cellular proliferative disease is characterized by the undesired propagation of cells, including, but not limited to, neoplastic disease conditions, e.g., cancer.
  • Examples of cellular proliferative disease include, but not limited to, abnormal stimulation of endothelial cells (e.g., atherosclerosis), solid tumors and tumor metastasis, benign tumors, for example, hemangiomas, acoustic neuromas, neurofibromas, trachomas, and pyogenic granulomas, vascular malfunctions, abnormal wound healing, inflammatory and immune disorders, Bechet's disease, gout or gouty arthritis, abnormal angiogenesis accompanying, for example, rheumatoid arthritis, psoriasis, diabetic retinopathy, other ocular angiogenic diseases such as retinopathy of prematurity (retrolental fibroplastic), macular degeneration, corneal graft rejection, neurovascular glaucoma and Oster Webber syndrome, psoriasis, restenosis, fungal, parasitic and viral infections such cytomegaloviral infections.
  • Subjects to be treated according to the methods of the invention include any individual
  • subjects suitable for treatment with a subject method include individuals who have been clinically diagnosed as infected with a virus.
  • the virus is a hepatitis virus (e.g., HAV, HBV, HCV, delta, etc.), particularly HCV, are suitable for treatment with the methods of the instant invention.
  • Individuals who are infected with HCV are identified as having HCV RNA in their blood, and/or having anti-HCV antibody in their serum.
  • Such individuals include na ⁇ ve individuals (e.g., individuals not previously treated for HCV, particularly those who have not previously received IFN- ⁇ -based or ribavirin-based therapy) and individuals who have failed prior treatment for HCV.
  • subjects suitable for treatment with a method provided herein include an individual with a neurodegenerative disease or disorder, including, but not limited to, Parkinson's disease, Alzheimer's disease, Huntington's disease, and Amyotrophic lateral sclerosis (ALS).
  • a neurodegenerative disease or disorder including, but not limited to, Parkinson's disease, Alzheimer's disease, Huntington's disease, and Amyotrophic lateral sclerosis (ALS).
  • subjects suitable for treatment with a method of the present invention include individuals having multiple sclerosis.
  • Multiple sclerosis refers to an autoimmune neurodegenerative disease, which is marked by inflammation within the central nervous system with lymphocyte attack against myelin produced by oligodendrocytes, plaque formation and demyelization with destruction of the myelin sheath of axons in the brain and spinal cord, leading to significant neurological disability over time.
  • an otherwise healthy person presents with the acute or sub acute onset of neurological symptomatology (attack) manifested by unilateral loss of vision, vertigo, ataxia, dyscoordination, gait difficulties, sensory impairment characterized by paresthesia, dysesthesia, sensory loss, urinary disturbances until incontinence, diplopia, dysarthria or various degrees of motor weakness until paralysis.
  • the symptoms may be painless, remain for several days to a few weeks, and then partially or completely resolve.
  • a second attack will occur. During this period after the first attack, the patient is defined to suffer from probable MS. Probable MS patients may remain undiagnosed for years.
  • the second attack occurs the diagnosis of clinically definite MS (CDMS) is made (Poser criteria 1983; C. M. Poser et al., Ann. Neurol. 1983; 13, 227).
  • subject and patient mean a member or members of any mammalian or non-mammalian species that may have a need for the pharmaceutical methods, compositions and treatments described herein.
  • Subjects and patients thus include, without limitation, primate (including humans), canine, feline, ungulate (e.g., equine, bovine, swine (e.g., pig)), avian, and other subjects.
  • primate including humans
  • canine feline
  • ungulate e.g., equine, bovine, swine (e.g., pig)
  • avian avian
  • Humans and non-human animals having commercial importance are of particular interest.
  • “Mammal” means a member or members of any mammalian species, and includes, by way of example, canines; felines; equines; bovines; ovines; rodentia, etc. and primates, particularly humans.
  • Non-human animal models, particularly mammals, e.g., primate, murine, lagomorpha, etc. may be used for experimental investigations.
  • Treating” or “treatment” of a condition or disease includes: (1) preventing at least one symptom of the conditions, i.e., causing a clinical symptom to not significantly develop in a mammal that may be exposed to or predisposed to the disease but does not yet experience or display symptoms of the disease, (2) inhibiting the disease, i.e., arresting or reducing the development of the disease or its symptoms, or (3) relieving the disease, i.e., causing regression of the disease or its clinical symptoms.
  • the term “treating” is thus used to refer to both prevention of disease, and treatment of pre-existing conditions.
  • the prevention of cellular proliferation can be accomplished by administration of the subject compounds prior to development of overt disease, e.g., to prevent the regrowth of tumors, prevent metastatic growth, etc.
  • the compounds are used to treat ongoing disease, by stabilizing or improving the clinical symptoms of the patient.
  • the cyclic-di-nucleotide active agent described herein may be administered in combination with other pharmaceutically active agents, including other agents that treat the underlying condition or a symptom of the condition.
  • “In combination with” as used herein refers to uses where, for example, the first compound is administered during the entire course of administration of the second compound; where the first compound is administered for a period of time that is overlapping with the administration of the second compound, e.g., where administration of the first compound begins before the administration of the second compound and the administration of the first compound ends before the administration of the second compound ends; where the administration of the second compound begins before the administration of the first compound and the administration of the second compound ends before the administration of the first compound ends; where the administration of the first compound begins before administration of the second compound begins and the administration of the second compound ends before the administration of the first compound ends; where the administration of the second compound begins before administration of the first compound begins and the administration of the first compound ends before the administration of the second compound ends.
  • “in combination” can also refer to regimen involving administration of two or more compounds. “In combination with” as used herein also refers to administration of two or more compounds that may be administered in the same or different formulations, by the same of different routes, and in the same or different dosage form type.
  • agents for use in combination therapy of neoplastic disease include, but are not limited to, thalidomide, marimastat, COL-3, BMS-275291, squalamine, 2-ME, SU6668, neovastat, Medi-522, EMD121974, CAI, celecoxib, interleukin-12, IM862, TNP470, avastin, gleevec, herceptin, and mixtures thereof.
  • chemotherapeutic agents for use in combination therapy include, but are not limited to, daunorubicin, daunomycin, dactinomycin, doxorubicin, epirubicin, idarubicin, esorubicin, bleomycin, mafosfamide, ifosfamide, cytosine arabinoside, bis-chloroethylnitrosurea, busulfan, mitomycin C, actinomycin D, mithramycin, prednisone, hydroxyprogesterone, testosterone, tamoxifen, dacarbazine, procarbazine, hexamethylmelamine, pentamethylmelamine, mitoxantrone, amsacrine, chlorambucil, methylcyclohexylnitrosurea, nitrogen mustards, melphalan, cyclophosphamide, 6-mercaptopurine, 6-thioguanine, cytarabine, 5-azacytidine
  • antiviral agents can also be delivered in the treatment methods of the invention.
  • compounds that inhibit inosine monophosphate dehydrogenase may have the potential to exert direct anti viral activity, and such compounds can be administered in combination with the mutant Listeria , as described herein.
  • Drugs that are effective inhibitors of hepatitis C NS3 protease may be administered in combination with the mutant Listeria , as described herein.
  • Hepatitis C NS3 protease inhibitors inhibit viral replication.
  • Other agents such as inhibitors of HCV NS3 helicase are also attractive drugs for combinational therapy, and are contemplated for use in combination therapies described herein.
  • Ribozymes such as HeptazymeTM and phosphorothioate oligonucleotides which are complementary to HCV protein sequences and which inhibit the expression of viral core proteins are also suitable for use in combination therapies described herein.
  • agents for use in combination therapy of multiple sclerosis include, but are not limited to; glatiramer; corticosteroids; muscle relaxants, such as Tizanidine (Zanaflex) and baclofen (Lioresal); medications to reduce fatigue, such as amantadine (Symmetrel) or modafinil (Provigil); and other medications that may also be used for depression, pain and bladder or bowel control problems that can be associated with MS.
  • combination therapy compounds may be administered by the same route of administration (e.g., intrapulmonary, oral, enteral, etc.) that the cyclic-di-nucleotide active agents are administered.
  • the compounds for use in combination therapy with the cyclic-di-nucleotide active agent may be administered by a different route of administration.
  • the cyclic di-nucleotide active agent functions as an adjuvant when administered together with a drug or vaccine to treat or prevent a disease or condition, including, but not limited to, those diseases and conditions provided herein.
  • the cyclic di-nucleotide active agents are administered together with a vaccine.
  • Such active agents that are administered with a vaccine can function as an adjuvant to enhance the immune response elicited by the vaccine, including stimulating immunological memory to protect against future diseases and/or infections.
  • the cyclic di-nucleotide or STING active agents administered as an adjuvant for a vaccine can enhance the effectiveness of the vaccine by, e.g., increasing the immunogenicity of weaker antigens, reducing the amount of antigen required to elicit a immune response, reducing the frequency of immunization necessary to maintain protective immunity, enhance the efficacy of vaccines in immunocompromised or other individuals with reduced immune responses, and/or increase immunity at a target tissue, such as mucosal immunity.
  • the cyclic di-nucleotide active agents when co-administered with one or more antigens, can induce a particular cytokine profile to promote cellular and humoral immunity against the antigen and increase the effectiveness of vaccination.
  • Antigens used to prepare vaccines may be derived from a variety of microorganisms such as viruses, bacteria and parasites that contain substances that are not normally present in the body, as well as tumor cells. These substances can be used as antigens to produce an immune response to destroy both the antigen and cells containing the antigen, such as a bacterial cell or cancer cell.
  • isolated or crude antigens of microbial pathogens can be used in vaccines to treat infectious disease; isolated or crude tumor cell antigens can be used in vaccines to treat cancer; isolated or crude antigens known to be associated with a pathologically aberrant cell can be used to treat a variety of diseases in which it is beneficial to target particular cells for destruction.
  • Microorganisms that may be a source of antigen include clinically relevant microorganisms, such as bacteria, including pathogenic bacteria; viruses (e.g., Influenza, Measles, Coronavirus); parasites (e.g., Trypanosome, Plasmodium, Leishmania ); fungi (e.g., Aspergillus, Candida, Coccidioides, Cryptococcus ); and the like.
  • viruses e.g., Influenza, Measles, Coronavirus
  • parasites e.g., Trypanosome, Plasmodium, Leishmania
  • fungi e.g., Aspergillus, Candida, Coccidioides, Cryptococcus
  • fungi e.g., Aspergillus, Candida, Coccidioides, Cryptococcus
  • the antigen may be from bacteria, particularly pathogenic bacteria, such as the causative agent of anthrax ( Bacillus anthracis ), plague ( Yersinia pestis ), tuberculosis ( Mycobacterium tuberculosis ), salmonellosis ( Salmonella enterica ), stomach cancer ( Helicobacter pylori ), sexually transmitted diseases ( Chlamydia trachomatis or Neisseria gonorrhea ), and the like.
  • pathogenic bacteria such as the causative agent of anthrax ( Bacillus anthracis ), plague ( Yersinia pestis ), tuberculosis ( Mycobacterium tuberculosis ), salmonellosis ( Salmonella enterica ), stomach cancer ( Helicobacter pylori ), sexually transmitted diseases ( Chlamydia trachomatis or Neisseria gonorrhea ), and the like.
  • Other representative examples include antigens from certain viruses, such as influenza virus(
  • Fungi of interest include, but are not limited to Candida albicans or Aspergillus spp., and parasites of interest include the causative agents of trypanosomiasis, leishmania , pneumonic plague, and lyme disease (Borrellia burgdorferi).
  • a pathologically aberrant cell to be used in a vaccine can be obtained from any source such as one or more individuals having a pathological condition or ex vivo or in vitro cultured cells obtained from one or more such individuals, including a specific individual to be treated with the resulting vaccine.
  • a vaccine formulation for use with an adjuvant containing cyclic di-nucleotide active agents may include, e.g., attenuated and inactivated viral and bacterial pathogens from infected patients or propagated cultures, purified macromolecules, polysaccharides, toxoids, recombinant antigens, organisms containing a foreign gene from a pathogen, synthetic peptides, polynucleic acids, antibodies and tumor cells.
  • Recombinant antigens may be obtained, for example, by isolating and cloning a gene encoding any immunogenic polypeptide, in, e.g., bacterial, yeast, insect, reptile or mammalian cells using recombinant methods well known in the art and described, for example in Sambrook et al., Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory, New York (1992) and in Ansubel et al., Current Protocols in Molecular Biology, John Wiley and Sons, Baltimore, Md. (1998).
  • a number of genes encoding surface antigens from viral, bacterial and protozoan pathogens have been successfully cloned, expressed and used as antigens for vaccine development.
  • the major surface antigen of hepatitis B virus, HbsAg, the b subunit of choleratoxin, the enterotoxin of E. coli , the circumsporozoite protein of the malaria parasite, and a glycoprotein membrane antigen from Epstein-Barr virus, as well as tumor cell antigens have been expressed in various well known vector/host systems, purified and used in vaccines.
  • a vaccine formulation containing cyclic di-nucleotide or STING active agents may advantageously contain other vaccine adjuvants and carriers.
  • These carriers and adjuvants include, but are not limited to, ion exchange resins, alumina, aluminum stearate, lecithin, serum proteins, such as human serum albumin, buffer substances such as phosphates, glycine, sorbic acid, potassium sorbate, partial glyceride mixtures of saturated vegetable fatty acids, phosphate buffered saline solution, water, emulsions (e.g.
  • salts or electrolytes such as protamine sulfate, disodium hydrogen phosphate, potassium hydrogen phosphate, sodium chloride, zinc salts, colloidal silica, magnesium trisilicate, polyvinyl pyrrolidone, cellulose-based substances and polyethylene glycol.
  • any convenient method for determining if a vaccine compound or formulation induces an innate, humoral, cell-mediated, or any combination of these types of immune response may be employed.
  • the ability of a vaccine compound or formulation to induce an innate immune response through STING can be determined using methods described herein as well as other methods. Such methods for detecting an innate immune response can be generally performed within hours of vaccine administration.
  • the ability of a vaccine compound or formulation to induce a humoral response can be determined by measuring the titer of antigen-specific antibodies in an animal primed with the vaccine and boosted with the antigen, or determining the presence of antibodies cross-reactive with an antigen by ELISA, Western blotting or other well-known methods.
  • Cellular immune responses can be determined, for example, by measuring cytotoxic T cell response to antigen using a variety of methods, such as, e.g., FACS sorting, and other methods well known in the art. Methods of detecting humoral and cellular immune responses can be generally performed days or weeks after vaccine administration.
  • cyclic-di-nucleotide refers to a compound containing two nucleosides (i.e., a first and second nucleoside), wherein the 2′ or 3′ carbon of each nucleoside is linked to the 5′ carbon of the other nucleoside by a phosphodiester bond.
  • a 2′-5′ phosphodiester linkage containing cyclic-di-nucleotide refers to a cyclic-di-nucleotide, wherein the 2′ carbon of at least one of the nucleosides is linked to the 5′ carbon of the other nucleoside.
  • 2′-5′ phosphodiester linkage containing cyclic-di-nucleotides can be used in practicing the methods described herein for increasing production of a type I interferon in a cell or subject.
  • a “cyclic-di-nucleotide” also includes all of the stereoisomeric forms of the cyclic-di-nucleotides described herein.
  • nucleoside refers to a composition containing a nitrogenous base covalently attached to a sugar (e.g., ribose or deoxyribose) or an analog thereof.
  • a sugar e.g., ribose or deoxyribose
  • nucleosides include, but are not limited to cytidine, uridine, adenosine, guanosine, thymidine and inosine.
  • the nucleoside contains a deoxyribose sugar.
  • Analogs of nucleosides include, but are not limited to dexoyadenosine analogues (e.g., Didanosine and Vidarabine); deoxycytidine analogues (e.g., Cytarabine, Ematricitabine, Lamivudine, and Zalcitabine); deoxyguanosine analogues (Abacavir and Entecavir); (deoxy-) thymidine analogues (e.g., Stavudine, Telbivudine, and Zidovudine); and deoxyuridine alaogues (e.g., Idoxuridine and Trifluridine).
  • dexoyadenosine analogues e.g., Didanosine and Vidarabine
  • deoxycytidine analogues e.g., Cytarabine, Ematricitabine, Lamivudine, and Zalcitabine
  • deoxyguanosine analogues
  • cyclic-di-nucleotides can increase type-I IFN production in a cell.
  • cyclic-di-nucleotides increase type-I IFN production through a mechanism that involves stimulator of interferon genes (STING).
  • Cyclic-di-nucleotides include those specifically described herein as well as isoforms (e.g., tautomers) of those specifically described herein that can be used in practicing the subject methods. Cyclic-di-nucleotides can be obtained using any suitable method. For example, cyclic-di-nucleotides may be made by chemical synthesis using nucleoside derivatives as starting material. Cyclic-di-nucleotides can also be produced by in vitro synthesis, using recombinant purified cGAMP synthase (cGAS), as described in the Experimental Section below. Moreover, the structures of such cyclic-di-nucleotides can be confirmed using NMR analysis.
  • cGAMP synthase recombinant purified cGAMP synthase
  • Cyclic-di-nucleotides provided herein can be described by the following nomenclature: cyclic[X 1 (A-5′)pX 2 (B-5′)p], wherein X 1 and X 2 are the first and second nucleoside, A is the carbon of the first nucleoside (e.g., 2′ or 3′ position) that is linked to the 5′ carbon of the second nucleoside via a phosphodiester bond and B is the carbon of the second nucleoside (e.g., 2′ or 3′ position) that is linked to the 5′ carbon of the first nucleoside by a phosphodiester bond.
  • cyclic[G(2′-5′)pA(3′-5′)p] has the following formula:
  • the cyclic-di-nucleotide contains a 2′-5′ phosphodiester bond.
  • the cyclic-di-nucleotide further contains a 3′-5′ phosphodiester bond (e.g., cyclic[X 1 (2′-5′)pX 2 (3′-5′)p] or cyclic[X 1 (3′-5′)pX 2 (2′-5′)p]).
  • the cyclic-di-nucleotide contains two 2′-5′ phosphodiester bonds (cyclic[X 1 (2′-5′)pX 2 (2′-5′)p]).
  • the cyclic-di-nucleotide is:
  • the cyclic-di-nucleotide is:
  • the cyclic-di-nucleotide has the following formula:
  • X and Y can be any organic molecule including a nitrogenous base.
  • a “nitrogenous base” refers to nitrogen-containing molecules having the chemical properties of a base including, but not limited to, pyrimidine derivatives (e.g., cytosine, thymine, and uracil) and purine derivatives (e.g., adenine and guanine), as well as substituted pyrimidine and purine derivatives, pyrimidine and purine analogs, and their tautomers.
  • X and Y are each one of the following:
  • the cyclic-di-nucleotide has the following formula (cyclic[G(2′5′)pA(3′5′)p]):
  • the cyclic-di-nucleotide has the following formula (cyclic[G(3′5′)pA(2′5′)p]):
  • the cyclic-di-nucleotide has the following formula cyclic[G(2′5′)pA(2′5′)p]:
  • the cyclic-di-nucleotide has the following formula cyclic[A(2′5′)pA(3′5′)p]:
  • the cyclic-di-nucleotide has the following formula cyclic[G(2′5′)pG(3′5′)p]:
  • the cyclic-di-nucleotide has the following formula cyclic[A(2′5′)pA(2′5′)p]:
  • the cyclic-di-nucleotide has the following formula cyclic[G(2′5′)pG(2′5′)p]:
  • the cyclic-di-nucleotide has one of the following formulas:
  • R is any amino acid side chain.
  • a pharmaceutical composition that contains any of the cyclic-di-nucleotide active agents provided herein and a pharmaceutically acceptable carrier.
  • the cyclic-di-nucleotide active agent is one or more cyclic-di-nucleotides.
  • carrier refers to a diluent, adjuvant, excipient, or vehicle with which the mitochondrial transport protein inhibitor is administered.
  • Such pharmaceutical carriers can be, for example, sterile liquids, such as saline solutions in water and oils, including those of petroleum, animal, vegetable or synthetic origin, such as peanut oil, soybean oil, mineral oil, sesame oil and the like.
  • a saline solution is a preferred carrier when the pharmaceutical composition is administered intravenously.
  • Saline solutions and aqueous dextrose and glycerol solutions can also be employed as liquid carriers, particularly for injectable solutions.
  • suitable pharmaceutical excipients include starch, glucose, lactose, sucrose, gelatin, malt, rice, flour, chalk, silica gel, sodium stearate, glycerol monostearate, talc, sodium chloride, dried skim milk, glycerol, propylene glycol, water, ethanol and the like.
  • the composition if desired, can also contain minor amounts of wetting or emulsifying agents, or pH buffering agents. These compositions can take the form of solutions, suspensions, emulsion, tablets, pills, capsules, powders, sustained-release formulations and the like.
  • composition can be formulated as a suppository, with traditional binders and carriers such as triglycerides.
  • the inhibitors can be formulated as neutral or salt forms.
  • Pharmaceutically acceptable salts include those formed with free amino groups such as those derived from hydrochloric, phosphoric, acetic, oxalic, tartaric acids, etc., and those formed with free carboxyl groups such as those derived from sodium, potassium, ammonium, calcium, ferric hydroxides, isopropylamine, triethylamine, 2-ethylamino ethanol, histidine, procaine, etc. Examples of suitable pharmaceutical carriers are described in “Remington's Pharmaceutical Sciences” by E. W. Martin, hereby incorporated by reference herein in its entirety.
  • compositions will contain a therapeutically effective amount of the mitochondrial transport protein (e.g., a Miro protein, a TRAK protein, or Khc) inhibitor, preferably in purified form, together with a suitable amount of carrier so as to provide the form for proper administration to the patient.
  • the mitochondrial transport protein e.g., a Miro protein, a TRAK protein, or Khc
  • the formulation should suit the mode of administration.
  • the pharmaceutical composition can also include any of a variety of stabilizing agents, such as an antioxidant for example.
  • the pharmaceutical composition includes a polypeptide
  • the polypeptide can be complexed with various well-known compounds that enhance the in vivo stability of the polypeptide, or otherwise enhance its pharmacological properties (e.g., increase the half-life of the polypeptide, reduce its toxicity, enhance solubility or uptake). Examples of such modifications or complexing agents include sulfate, gluconate, citrate and phosphate.
  • the polypeptides of a composition can also be complexed with molecules that enhance their in vivo attributes. Such molecules include, for example, carbohydrates, polyamines, amino acids, other peptides, ions (e.g., sodium, potassium, calcium, magnesium, manganese), and lipids.
  • compositions intended for in vivo use may be sterile. To the extent that a given compound must be synthesized prior to use, the resulting product is typically substantially free of any potentially toxic agents, particularly any endotoxins, which may be present during the synthesis or purification process.
  • compositions for parental administration are also sterile, substantially isotonic and made under GMP conditions.
  • the pharmaceutical composition can be formulated for intravenous, oral, via implant, transmucosal, transdermal, intramuscular, intrathecal, or subcutaneous administration. In some embodiments, the pharmaceutical composition is formulated for intravenous administration. In other embodiments, the pharmaceutical composition is formulated for subcutaneous administration.
  • the following delivery systems, which employ a number of routinely used pharmaceutical carriers, are only representative of the many embodiments envisioned for administering the instant compositions.
  • Injectable drug delivery systems include solutions, suspensions, gels, microspheres and polymeric injectables, and can comprise excipients such as solubility-altering agents (e.g., ethanol, propylene glycol and sucrose) and polymers (e.g., polycaprylactones and PLGAs).
  • Implantable systems include rods and discs, and can contain excipients such as PLGA and polycaprylactone. Osteopontin or nucleic acids of the invention can also be administered attached to particles using a gene gun.
  • Oral delivery systems include tablets and capsules. These can contain excipients such as binders (e.g., hydroxypropylmethylcellulose, polyvinyl pyrilodone, other cellulosic materials and starch), diluents (e.g., lactose and other sugars, starch, dicalcium phosphate and cellulosic materials), disintegrating agents (e.g., starch polymers and cellulosic materials) and lubricating agents (e.g., stearates and talc).
  • excipients such as binders (e.g., hydroxypropylmethylcellulose, polyvinyl pyrilodone, other cellulosic materials and starch), diluents (e.g., lactose and other sugars, starch, dicalcium phosphate and cellulosic materials), disintegrating agents (e.g., starch polymers and cellulosic materials) and lubricating agents (e.
  • Transmucosal delivery systems include patches, tablets, suppositories, pessaries, gels and creams, and can contain excipients such as solubilizers and enhancers (e.g., propylene glycol, bile salts and amino acids), and other vehicles (e.g., polyethylene glycol, fatty acid esters and derivatives, and hydrophilic polymers such as hydroxypropylmethylcellulose and hyaluronic acid).
  • solubilizers and enhancers e.g., propylene glycol, bile salts and amino acids
  • other vehicles e.g., polyethylene glycol, fatty acid esters and derivatives, and hydrophilic polymers such as hydroxypropylmethylcellulose and hyaluronic acid.
  • Dermal delivery systems include, for example, aqueous and nonaqueous gels, creams, multiple emulsions, microemulsions, liposomes, ointments, aqueous and nonaqueous solutions, lotions, aerosols, hydrocarbon bases and powders, and can contain excipients such as solubilizers, permeation enhancers (e.g., fatty acids, fatty acid esters, fatty alcohols and amino acids), and hydrophilic polymers (e.g., polycarbophil and polyvinylpyrolidone).
  • the pharmaceutically acceptable carrier is a liposome or a transdermal enhancer.
  • the pharmaceutical composition containing the cyclic-di-nucleotide active agent is formulated to cross the blood brain barrier (BBB).
  • BBB blood brain barrier
  • One strategy for drug delivery through the blood brain barrier (BBB) entails disruption of the BBB, either by osmotic means such as mannitol or leukotrienes, or biochemically by the use of vasoactive substances such as bradykinin.
  • a BBB disrupting agent can be co-administered with the therapeutic compositions when the compositions are administered by intravascular injection.
  • ND pharmaceutical composition behind the BBB may be by local delivery, for example by intrathecal delivery, e.g., through an Ommaya reservoir (see, e.g., U.S. Pat. Nos.
  • the pharmaceutical composition containing the cyclic-di-nucleotide or STING active agents is formulated in a delivery vehicle, e.g., to enhance cytosolic transport. Any convenient protocol may be employed to facilitate delivery of the cyclic-di-nucleotide active agent across the plasma membrane of a cell and into the cytosol.
  • the cyclic-di-nucleotide or STING active agents and an antigen effective for use in a vaccine may be formulated together to be delivered by the same delivery vehicle in the pharmaceutical composition.
  • the cyclic-di-nucleotide or STING active agents may be encapsulated in a delivery vehicle comprising liposomes in the pharmaceutical composition.
  • a delivery vehicle comprising liposomes in the pharmaceutical composition.
  • Methods of using liposomes for drug delivery and other therapeutic uses are known in the art. See, e.g., U.S. Pat. No. 8,329,213, U.S. Pat. No. 6,465,008, U.S. Pat. No. 5,013,556, US Application No. 20070110798, and Andrews et al., Mol Pharm 2012 9:1118, which are incorporated herein by reference.
  • Liposomes may be modified to render their surface more hydrophilic by adding polyethylene glycol (“pegylated”) to the bilayer, which increases their circulation time in the bloodstream. These are known as “stealth” liposomes and are especially useful as carriers for hydrophilic (water soluble) molecules, such as the cyclic-di-nucleot
  • nano- or microparticles made from biodegradable materials such as poly(lactic acid), poly( ⁇ -glutamic acid), poly(glycolic acid), polylactic-co-glycolic acid.
  • Polyethylenimine, or alginate microparticles, and cationic microparticles, including dedrimers, such as cyclodextrins may be employed as delivery vehicles for cyclic-di-nucleotide or STING active agents to promote cellular uptake. See, e.g., U.S. Pat. No. 8,187,571, Krishnamachari et al., Adv Drug Deliv Rev 2009 61:205, Garzon et al., 2005 Vaccine 23:1384, incorporated herein by reference.
  • photochemical internalization may be employed to enhance cytosolic uptake of cyclic-di-nucleotide or STING active agents.
  • the cyclic-di-nucleotide or STING active agents may be co-adiminstered with a photosensitizing agent. Then, exposure of the target cells to light of a specific wavelength triggers internalization of the cyclic-di-nucleotide or STING active agents.
  • the delivery vehicle for delivering the cyclic-di-nucleotide or STING active agents can also be targeting delivery vehicles, e.g., a liposome containing one or more targeting moieties or biodistribution modifiers on the surface of the liposome.
  • a targeting moiety can be any agent that is capable of specifically binding or interacting with a desired target.
  • the specific binding agent can be any molecule that specifically binds to a protein, peptide, biomacromolecule, cell, tissue, etc. that is being targeted (e.g., a protein peptide, biomacromolecule, cell, tissue, etc. wherein the cyclic-di-nucleotide or STING active agent exerts its desired effect).
  • the specific binding agent can be, but is not limited to, an antibody against an epitope of a peptidic analyte, or any recognition molecule, such as a member of a specific binding pair.
  • suitable specific binding pairs include, but are not limited to: a member of a receptor/ligand pair; a ligand-binding portion of a receptor; a member of an antibody/antigen pair; an antigen-binding fragment of an antibody; a hapten; a member of a lectin/carbohydrate pair; a member of an enzyme/substrate pair; biotin/avidin; biotin/streptavidin; digoxin/antidigoxin; a member of a peptide aptamer binding pair; and the like.
  • the specific binding moiety includes an antibody.
  • An antibody as defined here may include fragments of antibodies which retain specific binding to antigen, including, but not limited to, Fab, Fv, scFv, and Fd fragments, chimeric antibodies, humanized antibodies, single-chain antibodies, and fusion proteins comprising an antigen-binding portion of an antibody and a non-antibody protein.
  • the antibodies may also include Fab′, Fv, F(ab′) 2 , and or other antibody fragments that retain specific binding to antigen.
  • the targeting moiety is a binding agent that specifically interacts with a molecule expressed on a tumor cell or an immune cell (e.g., CD4, CD8, CD69, CD62L, and the like), such that the targeting delivery vehicle containing the cyclic-di-nucleotide or STING active agents is delivered to the site of a tumor or to specific immune cells.
  • a molecule expressed on a tumor cell or an immune cell e.g., CD4, CD8, CD69, CD62L, and the like
  • any combinations of the above listed delivery vehicles may be used advantageously to enhance delivery of the cyclic-di-nucleotide or STING active agents to the target cells.
  • Components of the pharmaceutical composition can be supplied either separately or mixed together in unit dosage form, for example, as a dry lyophilized powder or water free concentrate. Where the composition is to be administered by infusion, it can be dispensed with an infusion bottle containing sterile pharmaceutical grade water or saline. Where the composition is administered by injection, an ample of sterile water for injection or saline can be provided so that the ingredients may be mixed prior to administration.
  • the pharmaceutical composition is supplied as a dry sterilized lyophilized powder that is capable of being reconstituted to the appropriate concentration for administration to a subject.
  • the pharmaceutical composition is supplied as a water free concentrate.
  • the pharmaceutical composition is supplied as a dry sterile lyophilized powder at a unit dosage of at least 0.5 mg, at least 1 mg, at least 2 mg, at least 3 mg, at least 5 mg, at least 10 mg, at least 15 mg, at least 25 mg, at least 30 mg, at least 35 mg, at least 45 mg, at least 50 mg, at least 60 mg, or at least 75 mg.
  • Solutions, suspensions and powders for reconstitutable delivery systems include vehicles such as suspending agents (e.g., gums, xanthans, cellulosics and sugars), humectants (e.g., sorbitol), solubilizers (e.g., ethanol, water, PEG and propylene glycol), surfactants (e.g., sodium lauryl sulfate, Spans, Tweens, and cetyl pyridine), preservatives and antioxidants (e.g., parabens, vitamins E and C, and ascorbic acid), anti-caking agents, coating agents, and chelating agents (e.g., EDTA).
  • suspending agents e.g., gums, xanthans, cellulosics and sugars
  • humectants e.g., sorbitol
  • solubilizers e.g., ethanol, water, PEG and propylene glycol
  • the pharmaceutical composition is formulated as a salt form.
  • Pharmaceutically acceptable salts include those formed with anions such as those derived from hydrochloric, phosphoric, acetic, oxalic, tartaric acids, etc., and those formed with cations such as those derived from sodium, potassium, ammonium, calcium, ferric hydroxides, isopropylamine, triethylamine, 2-ethylamino ethanol, histidine, procaine, etc.
  • the pharmaceutical composition contains a prodrug derivative of any of the cyclic-di-nucleotide or STING active agents provided herein.
  • Such prodrugs can be subsequently converted to an active form of the cyclic-di-nucleotide or STING active agent in the body of the subject administered the pharmaceutical composition.
  • Kits with unit doses of the subject cyclic-di-nucleotide active agents e.g., one or more cyclic-di-nucleotides, e.g., in oral or injectable doses, are provided.
  • the one or more components are present in the same or different containers, as may be convenient or desirable.
  • the instructions may be provided in a variety of different formats.
  • the instructions may include complete protocols for practicing the subject methods or means for obtaining the same (e.g., a website URL directing the user to a webpage which provides the instructions), where these instructions may be printed on a substrate, where substrate may be one or more of: a package insert, the packaging, reagent containers and the like.
  • TLRs Toll-like receptors
  • RLRs RIG-1-like receptors
  • ds DNA The cytosolic presence of foreign double-stranded (ds) DNA triggers a potent antiviral response dominated by the production of type I interferons (IFNs) (Ishii et al., Nat. Immunol. (2006) 7: 40; Stetson et al., Immunity (2006) 24: 93).
  • IFNs type I interferons
  • the molecular mechanism linking dsDNA to interferon production has not been well characterized (Burdette & Vance, Nat. Immunol. (2013) 14: 19).
  • STING A host protein, STING, was identified and shown to be required for the IFN response to cytosolic dsDNA (Ishikawa & Barber, Nature (2008) 455: 674; Ishikawa et al., Nature (2009) 461: 788; Sun et al., Proc Natl Acad Sci USA (2009) 106: 8653; and Zhong et al., Immunity (2008) 29: 538). STING was also shown to be required for the interferon response to bacterially-derived second messengers called cyclic-di-nucleotides (CDNs)(Jin et al., J Immunol (2011) 187: 2595; and Sauer et al., Infect Immun (2011) 79: 688).
  • CDNs cyclic-di-nucleotides
  • CDNs are secreted or released into the cytosol by certain bacterial pathogens (Woodward et al., Science (2010) 328: 1703) and bind directly to STING (Burdette et al., Nature (2011) 478: 515).
  • a mutant (R231A) allele of mouse STING was identified that abolished responsiveness to CDNs but did not appreciably affect the interferon response to cytosolic DNA (Id).
  • Id interferon response to cytosolic DNA
  • 293T cells expressing wild-type mouse STING are responsive to CDNs but not to dsDNA.
  • the IFN responses to cytosolic CDNs and dsDNA both require STING, the responses to these chemically distinct ligands can be genetically uncoupled.
  • hSTING REF and hSTING THP-1 differ at four amino acid positions.
  • hSTING REF encodes a histidine (H) at amino acid position 232
  • hSTING THP-1 encodes an arginine (R) at this position, which corresponds to R231 in mSTING that is critical for responsiveness to CDNs. Therefore, the functionality of individual hSTING alleles were tested by expressing these alleles in 293T cells that lack endogenous STING (Burdette et al.).
  • 293T cells are not responsive to stimulation by dsDNA, presumably due to lack of expression of cGAS (Sun et al.) or perhaps other DNA sensors. Therefore, to test whether the hSTING variants could respond to DNA stimulation, STING-null (‘goldenticket’)(Sauer et al.), but (cGAS + ) macrophages were transduced with hSTING expression vectors. Interestingly, even the hSTING REF variant that is non-responsive to CDNs conferred responsiveness to dsDNA ( FIG. 1D ).
  • hSTING REF therefore phenocopies the R231A mutant of mouse STING, previously described that uncouples responsiveness to CDNs and dsDNA (Burdette et al.). Like the mSTING R231A variant, hSTING REF still bound to CDNs ( FIG. 1E ) (Huang et al., Ouyang et al., and Yin et al.), indicating that this allele is compromised at a step downstream of CDN binding.
  • mSTING R231A was also non-responsive to chemically synthesized cGAMP ( FIG. 1F ) (Kellenberger, et al., J Am Chem. Soc. (2013). 135:4906). This raised the question of whether R231A/R232H variants of STING would be responsive to the cGAS enzyme that is believed to activate STING via production of cGAMP. It was found that human or mouse cGAS expression was sufficient to robustly activate hSTING REF and mSTING R231A variants, even at very low levels of cGAS expression ( FIG. 5A ). Several explanations were considered for this result.
  • DncV produced some c-di-AMP if provided only ATP, and some c-di-GMP if provided only GTP, but preferred to make cGAMP when provided both ATP and GTP (Davies, et al., Cell (2012)149: 358). ( FIG. 6A ).
  • cGAS required both ATP and GTP substrates and the resulting product migratessignificantly differently than any of the canonical CDNs produced by DncV,
  • cGAS and DncV products were analyzed by specific nuclease digestion.
  • the cGAS product was partially cleaved by nuclease P1, which selectively digests 3′-5′ phosphodiester linkages, suggesting that the cGAS product contains at least one 3′-5′ phosphodiester linkage ( FIG. 6B ).
  • nuclease P1 digestion was incomplete as it did not lead to generation of GMP, in contrast to treatment of the cGAS product with snake venom phosphodiesterase, which cleaved both 2′-5′ and 3′-5′ phosphodiester linkages ( FIG. 3B ). This suggests that the cGAS product contains a 2′-5′ phosphodiester linkage.
  • CDNs have been proposed to be useful as vaccine adjuvants or immunotherapeutics (Chen, et al., Vaccine (2010) 28:3080).
  • a synthetic STING activator, DMXAA has been tested in human clinical trials as a novel chemotherapeutic agent.
  • DMXAA was not found to be efficacious in humans, likely because it is unable to stimulate hSTING (Conlon et al.).
  • our results are significant as they indicate that non-canonical 2′-5′ linked CDNs function as potent pan-agonists of diverse STING variants, including those variants that are only poorly responsive to canonical CDNs or DMXAA.
  • THP-1 cells were grown in RPMI 1640 supplemented with 10% FBS, penicillin-streptomycin and L-glutamine.
  • HEK293T cells were grown in DMEM supplemented with 10% FBS, penicillin-streptomycin and L-glutamine.
  • Gp2 retroviral packaging cell lines were maintained in DMEM supplemented with 10% FBS, penicillin-streptomycin and L-glutamine. Animal protocols were approved by the University of California, Berkeley Animal Care and Use Committee.
  • Knockdown of human STING (clone ID NM — 198282.1-90151c1) was achieved using pLKO.1 (The RNAi Consortium).
  • the sequence for knockdown of human STING is 5′-GCA GAG CTA TTT CCT TCC ACA (SEQ ID NO:07) which correspond to 5′-CCG GGC AGA GCT ATT TCC TTC CAC ACT CGA GTG TGG AAG GAA ATA GCT CTG CTT TTT G (SEQ ID NO:08) forward oligo and 5′-AAT TCA AAA
  • AGC AGA GCT ATT TCC TTC CAC ACT CGA GTG TGG AAG GAA ATA GCT CTG C (SEQ ID NO:09) reverse oligo.
  • Oligos were annealed and cloned into Agel and EcoRI digested pLKO.1 (Addgene) and retrovirally transduced into THP-1 cells in parallel with scramble shRNA control constructs. Stable cell lines were selected with puromycin. THP-1 cells were differentiated with 1 ⁇ g/mL PMA for 24 hours. Cells were allowed to rest for 24 hours and then restimulated for 6 hours with the indicated ligands. IFN induction was measured by qRT-PCR as described below.
  • Bone marrow macrophages and HEK293T cells were stimulated using Lipofectamine 2000 (Invitrogen). Unless otherwise specified, cyclic-di-GMP, cyclic-di-AMP, polyl:C and Vaccinia Virus 70 mer DNA was prepared as described previously (Burdette et al.) and used at similar concentrations. Sendai virus was purchased from Charles River Laboratories. cGAMP was synthesized as previously described (Kellenberger et al).
  • the THP-1 STING allele was amplified from cDNA using 5′ hSTING HindIII(5′-ATCGAA GCT TCC ACC ATG CCC CAC TCC AGC CTG) (SEQ ID NO:10) and 3′ hSTING NotI (5′-ATC GGC GGC CGC TCA GGC ATA GTC AGG CAC GTC ATA AGG ATA AGA GAA ATC CGT GCG GAG AG) (SEQ ID NO:11). Resulting PCR product was cloned into pCDNA3 using HindIII/NotI digestion.
  • THP-1 STING was amplified and cloned into MSCV2.2 using the 3′ primer listed above and 5′ hSTING XhoI (5′-ATC GCT CGA GCC ACC ATG CCC CAC TCC AGC CTG) (SEQ ID NO:12) and XhoI/NotI digestion.
  • IFN-luciferase, TK-Renilla and mouse STING plasmids were used as previously described (Burdette et al.). Mutations in human STING were introduced using Quikchange Site Directed Mutagenesis Kit (Stratagene).
  • cDNA clones corresponding to mouse and human cGAS were obtained from Open Biosystems and correspond to those described previously (Sun et al., Wu et al.).
  • Mouse cGAS was amplified from cDNA clones with an N-terminal flag tag with forward oligo 5′-mcGAS-KpnI (5′-ATC GGG TAC CCC ACC ATG GAT TAC AAG GAT GAC GAT GAC AAG GAA GAT CCG CGT AGA AGG) (SEQ ID NO:13) and reverse oligo 3′-mcGAS-NotI (5′-ATC GGC GGC CGC TCA AAG CTT GTC AAA AAT TGG) (SEQ ID NO:14).
  • forward oligo 5′-mcGAS-KpnI 5′-ATC GGG TAC CCC ACC ATG GAT TAC AAG GAT GAC GAT GAC AAG GAA GAT CCG CGT AGA AGG
  • reverse oligo 3′-mcGAS-NotI 5′-ATC GGC GGC CGC TCA AAG CTT GTC AAA AAT TGG
  • hcGAS was amplified with forward oligo 5′-hcGAS-flag-KpnI (5′-ATC GGG TAC CCC ACC ATG GAT TAC AAG GAT GAC GAT GAC AAG CAG CCT TGG CAC GGA AAG G) (SEQ ID NO:15) and reverse 3′-hcGAS-NotI (5′ATC GGC GGC CGC TCA AAA TTC ATC AAA AAC TGG AAA C) (SEQ ID NO:16). Both PCR products were cloned into pCDNA3 at KpnI and NotI restriction enzyme sites.
  • DncV was amplified using DncV fwd BamHI (5′-GCA TGG ATC CGC CAC CAT GAC TTG GAA CTT TCA CCA G) (SEQ ID NO:17) and DncV rev NotI (5′-GCA TGC GGC CGC TCA GCC ACT TAC CAT TGT GCT GC) (SEQ ID NO:18) and cloned into pCDNA3 using BamHI and NotI.
  • DncV was amplified using DncV fwd XhoI (5′-GCA TCT CGA GCC ACC ATG ACT TGG AAC TTT CAC CAG) (SEQ ID NO:19) and DncV rev NotI. Resulting DNA was cloned into MSCV 2.2 digested with XhoI/NotI. Constructs for bacterial mcGAS overexpression were constructed as follows.
  • N terminal His6-SUMO tag amplified by PCR using His6 SUMO Nco (5′-TAA TAA GGA GAT ATA CCA TGG GCA GCA GCC) (SEQ ID NO:20) and His6 SUMO Sal (5′-GAA TTC GTC GAC ACC AAT CTG TTC TCT GTG AGC) (SEQ ID NO:21) off of pCDF-Duet2 template (gift from M. Rape lab, UC-Berkeley) and cloned into pET28a using NcoI and SalI to make pET28a-H6SUMO.
  • His6 SUMO Nco 5′-TAA TAA GGA GAT ATA CCA TGG GCA GCA GCC
  • His6 SUMO Sal 5′-GAA TTC GTC GAC ACC AAT CTG TTC TCT GTG AGC
  • mcGAS Full length mcGAS was PCR amplified from the mouse cDNA clone described above using mcGAS fwd Sal (5′-GAT GTC GAC ATG GAA GAT CCG CGT AGA AGG ACG) (SEQ ID NO:22) and mcGAS rev Xho (5′-ATC CTC GAG TCA AAG CTT GTC AAA AAT TGG AAA CC) (SEQ ID NO:23) and cloned into pET28a-H6SUMO using SalI and XhoI to make pET28a-H6SUMO-mcGAS that expresses full length mcGAS fused to an N-terminal His6 SUMO tag.
  • Sal 5′-GAT GTC GAC ATG GAA GAT CCG CGT AGA AGG ACG
  • mcGAS rev Xho 5′-ATC CTC GAG TCA AAG CTT GTC AAA AAT TGG AAA CC
  • WspR construct (pQE-WspR*) was a generous gift from Steve Lory (Harvard). WspR purification and c-di-GMP synthesis reactions were carried out as previously described (Merighi, et al., Mol Microbiol (2007)65: 876). Overexpression strains and plasmids for DncV and mutant DncV were provided by J. Mekalanos. DncV protein was overexpressed and purified as previously described (Davies et al.). Briefly, DncV protein production was induced in mid-log phase for 3 h at 37° C. with 1 mM IPTG. Cells were lysed and DncV protein was purified under denaturing conditions.
  • the cGAS product was purified using reverse-phase HPLC on an Agilent 1260 Infinity HPLC equipped with an Agilent Polaris C18-A column (5 ⁇ m, 250 mm ⁇ 10 mm, 180 ⁇ ). Purification conditions include a 100% to 0% gradient of solvent A over 20 min at 50° C. and a flow rate of 5 mL/min, where solvent A is 100 mM ammonium acetate in water and solvent B is acetonitrile. Purified elution fractions were evaporated multiple times in order to remove excess ammonia. Resonance assignments were made using COSY, 1 H- 13 C HSQC, NOESY, 1 H- 13 C HMBC, and 1H- 31 P HMBC.
  • HEK293T cells were plated in TC-treated 96-well plates at 0.5%°-%106% cells°/0 ml-1. The next day, the cells were transfected with indicated constructs, together with IFN- ⁇ -firefly luciferase and TKRenilla luciferase reporter constructs. Following stimulation for 6% h with the indicated ligands, the cells were lysed in passive lysis buffer (Promega) for 5% min at 25° C.
  • passive lysis buffer Promega
  • the cell lysates were incubated with firefly luciferase substrate (Biosynth) and the Renilla luciferase substrate coelenterazine (Biotium), and luminescence was measured on a SpectraMax L microplate reader (Molecular Devices). The relative lfnb expression was calculated as firefly luminescence relative to Renilla luminescence.
  • reactions were removed and mixed 1:5 with TLC running buffer (1:1.5 (v/v) saturated NH4SO4 and 1.5M KH2PO4, pH 3.6) and spotted on PEIcellulose TLC plate (Sigma). Following solvent migration, the TLC plate was exposed to a phosphorimager screen and imaged using Typhoon scanner. For in vitro product transfection into 293T cells, reactions were scaled up, radiolabeled nucleotide was omitted and the concentration of ATP and GTP was increased to 2 mM.
  • the phosphorous nucleus, P-11 is correlated to the 2′ ribose proton (H-12) of guanosine as well as to the 5′ ribose methylene protons (H-10) and the 4′ ribose proton (H-9) of adenosine.
  • the other phosphorous nucleus (P-22) is correlated to the 3′ ribose proton (H-8) of adenosine as well as to the 5′ ribose methylene protons (H-21) and 4′ ribose proton (H-20) of guanosine.
  • the regiochemistry of the phosphodiester linkages was determined to be cyclic[G(2′-5′)pA(3′-5′)p].
  • the protons corresponding to the adenine nucleobase (H-2, H-5) and guanine nucleobase (H-17) were assigned based upon reference spectra for the individual nucleobases, 1H-13C HMBC, and 1H-13C HSQC NMR ( FIG. 7A and 7B ).
  • the 1H-1H NOESY experiment showed through-space interactions_between the adenine proton H-5 and the 3′ ribose proton (H-8) as well as between the guanine proton H-17 and the 1′ ribose proton (H-18) ( FIG. 7D ).
  • the remaining protons in the corresponding ribose spin systems were identified by 1H-1H COSY ( FIG. 7C ), and multiplicity edited 1H-13C HSQC ( FIGS. 7A and 7B ), which distinguished the 5′ methylene protons in particular (H-10 and H-21).
  • RNA from mammalian cell lines was extracted using Trizol reagent (Invitrogen) or RNeasy Mini Kit (Qiagen). RNA was treated with RQ1 RNase-free DNase (Promega). RNA was reverse transcribed with Superscript III (Invitrogen). Mouse ifnB was quantified relative to mouse rps17 as described previously (Woodward et al). Human ifnB was quantified relative to human S9 as described previously (Wu et al).

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Organic Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Molecular Biology (AREA)
  • Public Health (AREA)
  • Medicinal Chemistry (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Veterinary Medicine (AREA)
  • Biochemistry (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Immunology (AREA)
  • Genetics & Genomics (AREA)
  • Biotechnology (AREA)
  • Epidemiology (AREA)
  • Oncology (AREA)
  • Communicable Diseases (AREA)
  • Virology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)

Abstract

Methods and compositions are provided for increasing the production of a type I interferon (IFN) in a cell. Aspects of the methods include increasing the level of a 2′-5′ phosphodiester linkage comprising cyclic-di-nucleotide in a cell in a manner sufficient to increase production of the type I interferon (IFN) by the cell. Also provided are compositions and kits for practicing the embodiments of the methods.

Description

    CROSS REFERENCE TO RELATED APPLICATIONS
  • Under 35 U.S.C. §119(e), this application claims priority to the filing date of U.S. Provisional Patent Application Ser. No. 61/819,499, filed on May 3, 2013; the disclosure of which applications are incorporated herein by reference.
  • GOVERNMENT RIGHTS
  • This invention was made with government support under grant nos. A1063302, A1075038, A1080749, A1082357, and OD008677 awarded by the National Institutes of Health. The government has certain rights in the invention.
  • INTRODUCTION
  • Interferons (also referred to as “IFN” or “IFNs”) are proteins having a variety of biological activities, some of which are antiviral, immunomodulating and antiproliferative. They are relatively small, species-specific, single chain polypeptides, produced by mammalian cells in response to exposure to a variety of inducers such as viruses, polypeptides, mitogens and the like. Interferons protect animal tissues and cells against viral attack and are an important host defense mechanism. In most cases, interferons provide better protection to tissues and cells of the kind from which they have been produced than to other types of tissues and cells, indicating that human-derived interferon could be more efficacious in treating human diseases than interferons from other species. Interferons may be classified as Type-I, Type-II and Type-Ill interferons. Mammalian Type-I interferons include IFN-α (alpha), IFN-β (beta), IFN-κ (kappa), IFN-δ (delta), IFN-ε (epsilon), IFN-τ (tau), IFN-ω(omega), and IFN-ζ (zeta, also known as limitin).
  • Agents that induce interferon production find use as vaccine adjuvants and in formulations that initiate effector and memory T-cell responses. Effective adjuvants enhance specific immune responses to antigens while minimizing toxic side effects, reducing the dose and dosage of vaccinations, and broadening the immune response. There remains a need for effective adjuvants that may be coformulated with antigens derived from intracellular pathogens and cancer cells to activate an effective cellular and humoral immune response to treat intracellular pathogens and reduce tumor burden. The immunomodulatory activity of interferon proteins, and the signaling pathways that regulate interferon production, are drawing interest as a target for designing new adjuvants.
  • Interferons have potential in the treatment of a large number of human cancers since these molecules have anti-cancer activity that acts at multiple levels. First, interferon proteins can directly inhibit the proliferation of human tumor cells. The anti-proliferative activity is also synergistic with a variety of approved chemotherapeutic agents such as cisplatin, 5FU and paclitaxel. Secondly, the immunomodulatory activity of interferon proteins can lead to the induction of an anti-tumor immune response. This response includes activation of NK cells, stimulation of macrophage activity and induction of MHC class I surface expression, leading to the induction of anti-tumor cytotoxic T lymphocyte activity. In addition, interferons play a role in cross-presentation of antigens in the immune system. Moreover, some studies further indicate that IFN-β protein may have anti-angiogenic activity. Angiogenesis, new blood vessel formation, is critical for the growth of solid tumors. Evidence indicates that IFN-β may inhibit angiogenesis by inhibiting the expression of pro-angiogenic factors such as bFGF and VEGF. Lastly, interferon proteins may inhibit tumor invasiveness by modulating the expression of enzymes, such as collagenase and elastase, which are important in tissue remodeling.
  • Interferons also appear to have antiviral activities that are based on two different mechanisms. For instance, type I interferon proteins (α and β) can directly inhibit the replication of human hepatitis B virus (“HBV”) and hepatitis C virus (“HCV”), but can also stimulate an immune response that attacks cells infected with these viruses.
  • SUMMARY
  • Methods and compositions are provided for increasing the production of a type I interferon (IFN) in a cell. Aspects of the methods include increasing the level of a 2′-5′ phosphodiester linkage comprising cyclic-di-nucleotide in a cell in a manner sufficient to increase production of the type I interferon (IFN) by the cell. Also provided are compositions and kits for practicing the subject methods.
  • In one aspect, provided herein is a method for increasing the production of a type I interferon (IFN) in a cell by increasing the level of a 2′-5′ phosphodiester linkage containing cyclic-di-nucleotide in the cell in a manner sufficient to increase production of the type I interferon (IFN) by the cell.
  • In certain embodiments, the method includes the step of contacting the cell with the cyclic-di-nucleotide. In certain embodiments, the cyclic-di-nucleotide has two 2′-5′ phosphodiester linkages. In other embodiments, the cyclic-di-nucleotide has a 2′-5′ phosphodiester linkage and a 3′-5′ phosphodiester linkage.
  • In certain embodiments, the cyclic-di-nucleotide comprises a guanosine nucleoside. In some embodiments, the cyclic-di-nucleotide contains two guanosine nucleosides. In certain embodiments, the cyclic-di-nucleotide comprises an adenosine nucleoside. In some embodiments, the cyclic-di-nucleotide contains two adenosine nucleosides. In other embodiments, the cyclic-di-nucleotide comprises an adenosine nucleoside and a guanosine nucleoside.
  • In certain embodiments, the cyclic-di-nucleotide has the following formula:
  • Figure US20140329889A1-20141106-C00001
  • wherein X and Y are each:
  • Figure US20140329889A1-20141106-C00002
  • In some embodiments, the cyclic-di-nucleotide has the following formula:
  • Figure US20140329889A1-20141106-C00003
  • In certain embodiments of the method, the level of the cyclic-di-nucleotide is increased by increasing the activity of a cGAMP synthase (cGAS) in the cell. In some embodiments, the activity of the cGAS is increased by enhancing expression of a nucleic acid encoding cGAS. In some embodiments, the activity of the cGAS is increased by introducing a nucleic acid encoding the cGAS into the cell.
  • In certain embodiments, the method is for increasing the production of interferon (IFN) alpha. In other embodiments, the IFN is interferon beta.
  • In certain embodiments, the method is for increasing the production of a type I interferon (IFN) in a mammalian cell. In particular embodiments, mammalian cell is a human cell. In some embodiments, the cell is in vitro. In other embodiments, the cell is in vivo.
  • In another aspect, provided herein is a method for increasing the production of a type I interferon (IFN) in a subject, the method includes the step of administering to the subject an amount of a 2′-5′ phosphodiester linkage comprising cyclic-di-nucleotide active agent effective to increase the production of the type I interferon in the subject.
  • The active agent can include, but is not limited to, any of the 2′-5′ phosphodiester linkage containing cyclic-di-nucleotides described herein. In certain embodiments, the cyclic-di-nucleotide has two 2′-5′ phosphodiester linkages. In other embodiments, the cyclic-di-nucleotide has a 2′-5′ phosphodiester linkage and a 3′-5′ phosphodiester linkage.
  • In some embodiments, the cyclic-di-nucleotide contains a guanosine nucleoside. In certain embodiments, the cyclic-di-nucleotide contains two guanosine nucleosides. In some embodiments, the cyclic-di-nucleotide contains an adenosine nucleoside. In specific embodiments, the cyclic-di-nucleotide contains two adenosine nucleosides. In other embodiments, the cyclic-di-nucleotide contains an adenosine and a guanosine nucleoside. In some embodiments, the cyclic-di-nucleotide has the following formula:
  • Figure US20140329889A1-20141106-C00004
  • wherein X and Y are each:
  • Figure US20140329889A1-20141106-C00005
  • In some embodiments of the subject method, the cyclic-di-nucleotide has the following formula:
  • Figure US20140329889A1-20141106-C00006
  • In certain embodiments, the 2′-5′ phosphodiester linkage comprising cyclic-di-nucleotide active agent includes an agent that increases cellular activity of a cGAMP synthase (cGAS). In specific embodiments, the agent comprises a nucleic acid encoding the cGAS.
  • In certain embodiments, the method is for increasing the production of interferon (IFN) alpha in a subject. In other embodiments, the method is for increasing the production of interferon beta in a subject.
  • In certain embodiments, the subject has a viral infection. In certain embodiments, the subject has a bacterial infection. In other embodiments, the subject has a neoplastic disease. In certain embodiments, the subject is mammal. In some embodiments, the mammal is a human.
  • In another aspect, provided herein is a method for increasing a stimulator of interferon genes (STING) mediated response in a subject, the method includes the step of administering to the subject an amount of a STING active agent effective to increase a STING mediated response in the subject. In certain embodiments, the STING mediated response is non-responsive to a cyclic-di-nucleotide having two 3′-5′ phosphodiester bonds.
  • The STING active agent can include, but is not limited to, any of the 2′-5′ phosphodiester linkage containing cyclic-di-nucleotides described herein. In certain embodiments, the cyclic-di-nucleotide has two 2′-5′ phosphodiester linkages. In other embodiments, the cyclic-di-nucleotide has a 2′-5′ phosphodiester linkage and a 3′-5′ phosphodiester linkage.
  • In some embodiments, the cyclic-di-nucleotide contains a guanosine nucleoside. In certain embodiments, the cyclic-di-nucleotide contains two guanosine nucleosides. In some embodiments, the cyclic-di-nucleotide contains an adenosine nucleoside. In specific embodiments, the cyclic-di-nucleotide contains two adenosine nucleosides. In other embodiments, the cyclic-di-nucleotide contains an adenosine and a guanosine nucleoside. In some embodiments, the cyclic-di-nucleotide has the following formula:
  • Figure US20140329889A1-20141106-C00007
  • wherein X and Y are each:
  • Figure US20140329889A1-20141106-C00008
  • In some embodiments of the subject method, the cyclic-di-nucleotide has the following formula:
  • Figure US20140329889A1-20141106-C00009
  • In certain embodiments, the STING active agent includes an agent that increases cellular activity of a cGAMP synthase (cGAS). In specific embodiments, the agent comprises a nucleic acid encoding the cGAS.
  • In certain embodiments, the STING active agent includes an agent that increases cellular activity of STING. In specific embodiments, the agent comprises a nucleic acid encoding the STING.
  • In certain embodiments, the subject has a viral infection. In certain embodiments, the subject has a bacterial infection. In other embodiments, the subject has a neoplastic disease. In certain embodiments, the subject is mammal. In some embodiments, the mammal is a human.
  • In another aspect, provided herein is a cyclic-di-nucleotide comprising a 2′-5′ phosphodiester linkage. Such cyclic-di-nucleotides are useful, for example, in practicing the subject methods, including, but not limited to, methods for increasing the production of a type I interferon in a cell or a subject.
  • In certain embodiments, the cyclic-di-nucleotide has two 2′-5′ phosphodiester linkages. In other embodiments, the cyclic-di-nucleotide has a 2′-5′ phosphodiester linkage and a 3′-5′ phosphodiester linkage.
  • In certain embodiments, the cyclic-di-nucleotide contains a guanosine nucleoside. In some embodiments, the cyclic-di-nucleotide contains two guanosine nucleosides. In certain embodiments, the cyclic-di-nucleotide contains an adenosine nucleoside. In some embodiments, the cyclic-di-nucleotide contains two adenosine nucleosides. In other embodiments, the cyclic-di-nucleotide contains an adenosine and a guanosine nucleoside.
  • In some embodiments, the cyclic-di-nucleotide has the following formula:
  • Figure US20140329889A1-20141106-C00010
  • wherein X and Y are each:
  • Figure US20140329889A1-20141106-C00011
  • In certain embodiments, the cyclic-di-nucleotide has the following formula:
  • Figure US20140329889A1-20141106-C00012
  • In another aspect, provided herein is a composition containing a 2′-5′ phosphodiester linkage containing cyclic-di-nucleotiden and a pharmaceutically acceptable carrier.
  • In certain embodiments, the cyclic-di-nucleotide has two 2′-5′ phosphodiester linkages. In other embodiments, the cyclic-di-nucleotide has a 2′-5′ phosphodiester linkage and a 3′-5′ phosphodiester linkage. In certain embodiments of the composition, the cyclic-di-nucleotide contains a guanosine nucleoside. In some embodiments, the cyclic-di-nucleotide contains two guanosine nucleosides. In certain embodiments, the cyclic-di-nucleotide contains an adenosine nucleoside. In some embodiments, the cyclic-di-nucleotide contains two adenosine nucleosides. In other embodiments, the cyclic-di-nucleotide contains an adenosine and a guanosine nucleoside.
  • In certain embodiments of the composition, the cyclic-di-nucleotide has the following formula:
  • Figure US20140329889A1-20141106-C00013
  • wherein X and Y are each:
  • Figure US20140329889A1-20141106-C00014
  • In certain embodiments of the composition, the cyclic-di-nucleotide has the following formula:
  • Figure US20140329889A1-20141106-C00015
  • BRIEF DESCRIPTION OF THE FIGURES
  • The invention is best understood from the following detailed description when read in conjunction with the accompanying drawings. It is emphasized that, according to common practice, the various features of the drawings are not to-scale. On the contrary, the dimensions of the various features are arbitrarily expanded or reduced for clarity. Included in the drawings are the following figures:
  • FIGS. 1A-1F show the variable responsiveness of human STING variants to cyclic-di-nucleotides maps to arginine 232. (A) THP-1 cells were transduced with vectors encoding an shRNA targeting STING or a control shRNA. Cells were then stimulated with cyclic-di-GMP (cdG), dsDNA, cyclic-di-AMP (cdA), poly-inosine:cytosine (pI:C), or Sendai Virus, and induction of human interferon-β mRNA was assessed by quantitative reverse transcriptase PCR. (B) Western blotting confirmed that knockdown of STING was effective. (C) HEK293T cells were transfected with the indicated amounts of various mouse (m) or human (h) STING expression plasmid and then stimulated 6 h later by transfection with synthetic cdG (5 μM). GT denotes the null 1199N allele of Sting from Goldenticket (Gt) mice. STING activation was assessed by use of a co-transfected IFN-luciferase reporter construct. (D) Gt (STING-null) macrophages were transduced with retroviral vectors encoding the indicated STING alleles and were then stimulated 48 h later by transfection with cdG (5 μM) or dsDNA 70-mer oligonucleotide (0.5 μg/mL). IFN induction was measured by qRT-PCR. ND, not detected. (E) Binding assay of STING to 32P-c-di-GMP. STING proteins were expressed in HEK293T cells and cell lysates were subjected to UVcrosslinking with 32P-cdG, and resolved by SDS-PAGE. Binding was quantified by autoradiography. Western blots of cell lysates with an anti-STING polyclonal antibody confirmed similar expression of the various STING proteins. (F) Responsiveness of mSTING to cGAMP is affected by mutations of R231. The indicated mutants were tested as in C.
  • FIG. 2 shows the sequence alignment of hSTING variants. hSTING was cloned from THP-1 cells compared to the reference STING allele (NCBI NP938023.1).
  • FIG. 3 shows that R232 of human STING is required for responsiveness to c-di-GMP, but not for binding of c-di-GMP. (A) 293T cells were transfected with the indicated alleles of mouse (m)STING or human (h)STING and were then stimulated with c-di-GMP (cdG). STING activity was detected by the induction of a co-transfected IFN-luciferase reporter construct and expressed as fold-induction over luciferase activity of unstimulated cells. (B) Lysates of transfected 293T cells were UV crosslinked in the presence of α32P-c-di-GMP, resolved by SDS-PAGE, and then analyzed by autoradiography. Lysates were also western blotted for STING and ACTIN as expression controls in parallel.
  • FIG. 4 shows that G230A and H232R are both required for optimal responsiveness to c-di-nucleotides but are not required for binding to c-di-nucleotides. (A, B) 293T cells were transfected with the indicated alleles of mouse (m)STING or human (h)STING and were then stimulated with c-di-GMP (cdG). STING activity was detected by the induction of a cotransfected IFN-luciferase reporter construct.
  • FIG. 5 shows that STING variants are responsive to cGAS. (A) HEK293T cells were transfected with the indicated STING alleles and with human and mouse cGAS (wt and GS>AA mutants) as indicated. STING activation was assessed by a co-transfected IFN-luciferase reporter construct. (B) HEK293T cells were transfected with the indicated STING alleles and with a mammalian expression vector encoding a cGAMP synthase (DncV) from V. cholerae. STING activation was assessed as in A. (C) In vitro enzymatically generated products of rWspR, rDncV and rcGAS were transfected into digitonin permeabilized HEK293T cells expressing the indicated mouse and human STING proteins. Chemically synthesized cyclic-di-GMP (cdG) and cGAMP were included as controls. STING activation was assessed as in A and B.
  • FIG. 6 shows that cGAS produces a non-canonical cyclic dinucleotide containing a 2′-5′ phosphodiester linkage. (A) Purified recombinant WspR, DncV and cGAS were mixed with α32P-GTP or α32P-ATP and the indicated unlabeled nucleotides. Reactions were mixed with TLC running buffer and nucleic acid species were resolved on a PEI-Cellulose TLC plate. (B) WspR, DncV and cGAS products labeled with α32P-GTP were digested with nuclease P1 and Snake Venom Phosphodiesterase and nucleic acid species were resolved on a PEI-Cellulose TLC plate. (C) 1H-31P HMBC of HPLC-purified cGAS product acquired at 600 MHz and 50° C. Critical through-bond correlations for the phosphodiester bonds are indicated. NMR elucidated structure of cGAS product is also shown.
  • FIGS. 7A-7D provide additional NMR analysis of the cGAS product. All data acquisition was performed in D2O and at 50° C. (A, B) Multiplicity-edited 1H-13C HSQC experiment in a 900 MHz field. Positive phased signals corresponding to methine and methyl protons are shown in green, negative phased signals corresponding to methylene protons are shown in blue. (C) 1H-1H COSY experiment in a 600 MHz field. (D) 1H-1H NOESY experiment in a 900 MHz field.
  • DETAILED DESCRIPTION
  • Methods and compositions are provided for increasing the production of a type I interferon (IFN) in a cell. Aspects of the methods include increasing the level of a 2′-5′ phosphodiester linkage comprising cyclic-di-nucleotide in a cell in a manner sufficient to increase production of the type I interferon (IFN) by the cell. Also provided are compositions and kits for practicing embodiments of the subject methods.
  • Before the present invention is described in greater detail, it is to be understood that this invention is not limited to particular embodiments described, as such may, of course, vary. It is also to be understood that the terminology used herein is for the purpose of describing particular embodiments only, and is not intended to be limiting, since the scope of the present invention will be limited only by the appended claims.
  • Where a range of values is provided, it is understood that each intervening value, to the tenth of the unit of the lower limit unless the context clearly dictates otherwise, between the upper and lower limit of that range and any other stated or intervening value in that stated range, is encompassed within the invention. The upper and lower limits of these smaller ranges may independently be included in the smaller ranges and are also encompassed within the invention, subject to any specifically excluded limit in the stated range. Where the stated range includes one or both of the limits, ranges excluding either or both of those included limits are also included in the invention.
  • Certain ranges are presented herein with numerical values being preceded by the term “about.” The term “about” is used herein to provide literal support for the exact number that it precedes, as well as a number that is near to or approximately the number that the term precedes. In determining whether a number is near to or approximately a specifically recited number, the near or approximating recited number may be a number which, in the context in which it is presented, provides the substantial equivalent of the specifically recited number.
  • Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs. Although any methods and materials similar or equivalent to those described herein can also be used in the practice or testing of the present invention, representative illustrative methods and materials are now described.
  • All publications and patents cited in this specification are herein incorporated by reference as if each individual publication or patent were specifically and individually indicated to be incorporated by reference and are incorporated herein by reference to disclose and describe the methods and/or materials in connection with which the publications are cited. The citation of any publication is for its disclosure prior to the filing date and should not be constructed as an admission that the present invention is not entitled to antedate such publication by virtue of prior invention. Further, the dates of publication provided may be different from the actual publication dates which may need to be independently confirmed.
  • It is noted that, as used herein and in the appended claims, the singular forms “a”, “an”, and “the” include plural referents unless the context clearly dictates otherwise. It is further noted that the claims may be drafted to exclude any optional element. As such, this statement is intended to serve as antecedent basis for use of such exclusive terminology as “solely,” “only” and the like in connection with the recitation of claim elements, or use of a “negative” limitation.
  • As will be apparent to those of skill in the art upon reading this disclosure, each of the individual embodiments described and illustrated herein has discrete components and features which may be readily separated from or combined with the features of any of the other several embodiments without departing from the scope or spirit of the present invention. Any recited method can be carried out in the order of events recited or in any other order which is logically possible.
  • Methods
  • As summarized above, methods of increasing the production of a type I interferon (IFN) in a cell, e.g., in vitro or in vivo are provided. By increasing type-I interferon production is meant that the subject methods increase type-I interferon production in a cell, as compared to a control. The magnitude of the increase may vary, and in some instances is 2-fold or greater, such as 5-fold or greater, including 10-fold or greater, as compared to a suitable control. As such, in some instances, the methods are methods of increasing type-I interferon production in a cell, e.g., by a magnitude of 2-fold or greater, such as 5-fold or greater, including 10-fold or greater, as compared to a suitable control. In those embodiments where, prior to practice of the methods, interferon production is not-detectable, the increase may result in detectable amounts of interferon production. Interferon production can be measured using any suitable method, including, but not limited to, vesicular stomatitis virus (VSV) challenge bioassay, enzyme-linked immunosorbent assay (ELISA) replicon based bioassays or by using a reporter gene (e.g., luciferase) cloned under regulation of a Type I interferon signaling pathway. See, e.g., Meager J. Immunol. Methods 261:21-36 (2002); Vrolijk et al. C. J. Virol. Methods 110:201-209 (2003); and Francois et al. Antimicrob Agents Chemother 49(9):3770-3775 (2005).
  • The methods may be used to increase the production of any type I interferon including, but not limited to: IFN-α (alpha), IFN-β (beta), IFN-κ (kappa), IFN-δ (delta), IFN-ε (epsilon), IFN-τ (tau), IFN-ω (omega), and IFN-ζ (zeta, also known as limitin). In some embodiments, the method is for increasing the production of IFN-α. In some embodiments, the method is for increasing IFN-β.
  • Aspects of the methods include increasing the level of a 2′-5′ phosphodiester linkage comprising cyclic-di-nucleotide in a cell in a manner sufficient to increase production of the type I interferon by the cell. By increasing the level of a 2′-5′ phosphodiester linkage comprising cyclic-di-nucleotide is meant that the subject methods increase the amount of a 2′-5′ phosphodiester linkage comprising cyclic-di-nucleotide as compared to a control. As demonstrated in the Experimental Section below, 2′-5′ phosphodiester linkage comprising cyclic-di-nucleotides can increase the levels of type I interferon production. The magnitude of the increase may vary, and in some instances is 2-fold or greater, such as 5-fold or greater, including 10-fold or greater, 15-fold greater, 20-fold greater, 25-fold greater, 30-fold greater, 35-fold greater, 40-fold greater, 45-fold greater, 50-fold greater, or 100 fold greater, as compared to a suitable control.
  • Increasing the level of a 2′-5′ phosphodiester linkage comprising cyclic-di-nucleotide levels can be accomplished using a variety of different approaches. In some instances, the method includes providing a target cell with a cyclic-di-nucleotide active agent that increases 2′-5′ phosphodiester linkage comprising cyclic-di-nucleotide levels in the target cell. Cyclic-di-nucleotide active agents may vary, and include, but are not limited to: small molecules, nucleic acid, protein, and peptide agents.
  • In some embodiments, the cyclic-di-nucleotide active agent increases IFN-α (alpha), IFN-β (beta), IFN-κ (kappa), IFN-δ (delta), IFN-ε (epsilon), IFN-τ (tau), IFN-ω (omega), and/or IFN-ζ (zeta, also known as limitin) in a cell or subject as compared to a control that has not been contacted with the cyclic-di-nucleotide active agent. In such embodiments, the increase is from 1.5-fold increase to 50-fold increase or more, including 2-fold increase to 45-fold increase, 5-fold increase to 40-fold increase, 10-fold increase to 35-fold increase, 15-fold increase to 30-fold increase, 20-fold increase to 30-fold increase, and the like.
  • In some instances, the cyclic-di-nucleotide active agent is a 2′-5′ phosphodiester linkage containing cyclic-di-nucleotide or a functional analogue thereof. 2′-5′ phosphodiester linkage containing cyclic-di-nucleotide include, but are not limited to, those 2′-5′ phosphodiester linkage containing cyclic-di-nucleotides described herein.
  • As used herein “cyclic-di-nucleotide” refers to a compound containing two nucleosides (i.e., a first and second nucleoside), wherein the 2′ or 3′ carbon of each nucleoside is linked to the 5′ carbon of the other nucleoside by a phosphodiester bond. Therefore, a 2′-5′ phosphodiester linkage containing cyclic-di-nucleotide refers to a cyclic-di-nucleotide, wherein the 2′ carbon of at least the first or second nucleosides is linked to the 5′ carbon of the other nucleoside. 2′-5′ phosphodiester linkage containing cyclic-di-nucleotide are discussed in greater detail below.
  • Functional analogues of 2′-5′ phosphodiester linkage containing cyclic-di-nucleotides are those compounds that exhibit similar functional activity (e.g., increasing the production of a type I IFN) and may have a similar structure to a 2′-5′ phosphodiester linkage containing cyclic-di-nucleotide. In some instances, the functional analogue is a small molecule agent. Naturally occurring or synthetic small molecule compounds of interest include numerous chemical classes, such organic molecules, including small organic compounds having a molecular weight of more than 50 and less than about 2,500 daltons. Candidate agents comprise functional groups necessary for structural interaction with proteins, particularly hydrogen bonding, and typically include at least an amine, carbonyl, hydroxyl or carboxyl group, preferably at least two of the functional chemical groups. The candidate agents may comprise cyclical carbon or heterocyclic structures and/or aromatic or polyaromatic structures substituted with one or more of the above functional groups. Candidate agents are also found among biomolecules including peptides, saccharides, fatty acids, steroids, purines, pyrimidines, derivatives, structural analogs or combinations thereof. Such molecules may be identified, among other ways, by employing suitable screening protocols.
  • In some instances, the cyclic-di-nucleotide active agent is an agent that increases the cellular activity of a cyclic GMP-AMP synthase (cGAS). As discussed in the Experimental Section, below, increasing the levels cGMP synthase (cGAS) can increase the production and/or activity of cyclic-di-nucleotide in a cell. As such, a target cell may be contacted with an agent that increases cGMP synthase production and/or cellular activity in a manner sufficient to increase the production of Type I interferon in the cell. In some embodiments, the cyclic-di-nucleotide active agent is a nucleic acid encoding a cGAS. Nucleic acids encoding various cGAS enzymes include, but are not limited to, those described in: Sun et al. Science 339(6121):786-91 and those deposited in GENBANK and assigned deposit numbers: NM138441.2 and NP612450.2 (human); NM173386.4 and NP775562.2 (mus musculus).
  • In certain embodiments, the nucleic acid encoding cGAS has the following sequence:
  • (SEQ ID NO: 01)
    agcctggggttccccttcgggtcgcagactcttgtgtgcccgccagtag
    tgcttggtttccaacagctgctgctggctcttcctcttgcggccttttc
    ctgaaacggattcttctttcggggaacagaaagcgccagccatgcagcc
    ttggcacggaaaggccatgcagagagcttccgaggccggagccactgcc
    cccaaggcttccgcacggaatgccaggggcgccccgatggatcccaccg
    agtctccggctgcccccgaggccgccctgcctaaggcgggaaagttcgg
    ccccgccaggaagtcgggatcccggcagaaaaagagcgccccggacacc
    caggagaggccgcccgtccgcgcaactggggcccgcgccaaaaaggccc
    ctcagcgcgcccaggacacgcagccgtctgacgccaccagcgcccctgg
    ggcagaggggctggagcctcctgcggctcgggagccggctctttccagg
    gctggttcttgccgccagaggggcgcgcgctgctccacgaagccaagac
    ctccgcccgggccctgggacgtgcccagccccggcctgccggtctcggc
    ccccattctcgtacggagggatgcggcgcctggggcctcgaagctccgg
    gcggttttggagaagttgaagctcagccgcgatgatatctccacggcgg
    cggggatggtgaaaggggttgtggaccacctgctgctcagactgaagtg
    cgactccgcgttcagaggcgtcgggctgctgaacaccgggagctactat
    gagcacgtgaagatttctgcacctaatgaatttgatgtcatgtttaaac
    tggaagtccccagaattcaactagaagaatattccaacactcgtgcata
    ttactttgtgaaatttaaaagaaatccgaaagaaaatcctctgagtcag
    tttttagaaggtgaaatattatcagcttctaagatgctgtcaaagttta
    ggaaaatcattaaggaagaaattaacgacattaaagatacagatgtcat
    catgaagaggaaaagaggagggagccctgctgtaacacttcttattagt
    gaaaaaatatctgtggatataaccctggctttggaatcaaaaagtagct
    ggcctgctagcacccaagaaggcctgcgcattcaaaactggctttcagc
    aaaagttaggaagcaactacgactaaagccattttaccttgtacccaag
    catgcaaaggaaggaaatggtttccaagaagaaacatggcggctatcct
    tctctcacatcgaaaaggaaattttgaacaatcatggaaaatctaaaac
    gtgctgtgaaaacaaagaagagaaatgttgcaggaaagattgtttaaaa
    ctaatgaaataccttttagaacagctgaaagaaaggtttaaagacaaaa
    aacatctggataaattctcttcttatcatgtgaaaactgccttctttca
    cgtatgtacccagaaccctcaagacagtcagtgggaccgcaaagacctg
    ggcctctgctttgataactgcgtgacatactttcttcagtgcctcagga
    cagaaaaacttgagaattattttattcctgaattcaatctattctctag
    caacttaattgacaaaagaagtaaggaatttctgacaaagcaaattgaa
    tatgaaagaaacaatgagtttccagtttttgatgaattttgagattgta
    tttttagaaagatctaagaactagagtcaccctaaatcctggagaatac
    aagaaaaatttgaaaaggggccagacgctgtggctcac.
  • In some embodiments, the nucleic acid encoding cGAS is a nucleic acid with 40% to 99%, 45% to 99%, 50% to 99%, 55% to 99%, 60% to 99%, 65% to 99%, 70% to 99%, 75% to 99%, 80% to 99%, 85% to 99%, 90% to 99% or, 95% to 99% sequence identity with a wild type cGAS nucleic acid sequence. In some embodiments, the nucleic acid encoding cGAS is a nucleic acid with 40% to 50%, 50% to 60%, 60% to 70%, 70% to 80%, 80% to 90%, or 90 to 99% sequence identity with a wild type cGAS nucleic acid sequence. In some embodiments, the nucleic acid encoding cGAS is a nucleic acid with 40% or more, 45% or more, 50% or more, 55% or more, 60% or more, 70% or more, 75% or more, 80% or more, 85% or more, 90% or more, 95% or more or 99% or more sequence identity with a wild type cGAS nucleic acid sequence.
  • In some instances, the cyclic-di-nucleotide active agent is a vector containing a nucleic acid encoding cGAS. Vectors may be provided directly to the subject cells. In other words, the cells are contacted with vectors having the nucleic acid encoding the cyclic-di-nucleotide active agent(s) (e.g., a nucleic acid encoding cGAS) such that the vectors are taken up by the cells. Methods for contacting cells with nucleic acid vectors that are plasmids, such as electroporation, calcium chloride transfection, and lipofection, are well known in the art. For viral vector delivery, the cells are contacted with viral particles comprising the nucleic acid encoding the cyclic-di-nucleotide agent(s). Retroviruses, for example, lentiviruses, are particularly suitable to the method of the invention. Commonly used retroviral vectors are “defective”, i.e., unable to produce viral proteins required for productive infection. Rather, replication of the vector requires growth in a packaging cell line. To generate viral particles comprising nucleic acids of interest, the retroviral nucleic acids comprising the nucleic acid are packaged into viral capsids by a packaging cell line. Different packaging cell lines provide a different envelope protein (ecotropic, amphotropic or xenotropic) to be incorporated into the capsid, this envelope protein determining the specificity of the viral particle for the cells (ecotropic for murine and rat; amphotropic for most mammalian cell types including human, dog and mouse; and xenotropic for most mammalian cell types except murine cells). The appropriate packaging cell line may be used to ensure that the cells are targeted by the packaged viral particles. Methods of introducing the retroviral vectors comprising the nucleic acid encoding the reprogramming factors into packaging cell lines and of collecting the viral particles that are generated by the packaging lines are well known in the art.
  • Vectors used for providing the nucleic acids encoding the cyclic-di-nucleotide activity active agent(s) to the subject cells may include suitable promoters for driving the expression, that is, transcriptional activation, of the nucleic acid of interest. In other words, the nucleic acid of interest will be operably linked to a promoter. This may include ubiquitously acting promoters, for example, the CMV-β-actin promoter, or inducible promoters, such as promoters that are active in particular cell populations or that respond to the presence of drugs such as tetracycline. By transcriptional activation, it is intended that transcription will be increased above basal levels in the target cell by 10 fold or more, by 100 fold or more, by 1000 fold or more. In addition, vectors used for providing cyclic-di-nucleotide active agent(s) to the subject cells may include nucleic acid sequences that encode for selectable markers in the target cells, so as to identify cells that have taken up the cyclic-di-nucleotide activity active agent(s).
  • Cyclic-di-nucleotide active agent(s) may also be provided to cells as polypeptides. For example, in some instances the cyclic-di-nucleotide active agent is a cGAS polypeptide. Amino acid sequences of various cGAS enzymes include, but are not limited to, those described in: Sun et al. Science 339(6121):786-91 and those deposited in GENBANK and assigned deposit numbers: NM138441.2 and NP612450.2 (human); NM173386.4 and NP775562.2 (mus musculus).
  • In certain embodiments, the cGAS polypeptide has the following sequence:
  • (SEQ ID NO: 02)
    MQPWHGKAMQRASEAGATAPKASARNARGAPMDPTESPAAPEAALPKAG
    KFGPARKSGSRQKKSAPDTQERPPVRATGARAKKAPQRAQDTQPSDATS
    APGAEGLEPPAAREPALSRAGSCRQRGARCSTKPRPPPGPWDVPSPGLP
    VSAPILVRRDAAPGASKLRAVLEKLKLSRDDISTAAGMVKGVVDHLLLR
    LKCDSAFRGVGLLNTGSYYEHVKISAPNEFDVMFKLEVPRIQLEEYSNT
    RAYYFVKFKRNPKENPLSQFLEGEILSASKMLSKFRKIIKEEINDIKDT
    DVIMKRKRGGSPAVTLLISEKISVDITLALESKSSWPASTQEGLRIQNW
    LSAKVRKQLRLKPFYLVPKHAKEGNGFQEETWRLSFSHIEKEILNNHGK
    SKTCCENKEEKCCRKDCLKLMKYLLEQLKERFKDKKHLDKFSSYHVKTA
    FFHVCTQNPQDSQWDRKDLGLCFDNCVTYFLQCLRTEKLENYFIPEFNL
    FSSNLIDKRSKEFLTKQIEY ERNNEFPVFDEF. 
  • In some embodiments, the cGAS polypeptide is a polypeptide that has 40% to 99%, 45% to 99%, 50% to 99%, 55% to 99%, 60% to 99%, 65% to 99%, 70% to 99%, 75% to 99%, 80% to 99%, 85% to 99%, 90% to 99% or, 95% to 99% sequence identity with a wild type cGAS amino acid sequence. In some embodiments, the cGAS polypeptide is a polypeptide that has 40% to 50%, 50% to 60%, 60% to 70%, 70% to 80%, 80% to 90%, or 90 to 99% sequence identity with a wild type cGAS amino acid sequence. In some embodiments, the cGAS polypeptide is a polypeptide that has 40% or more, 45% or more, 50% or more, 55% or more, 60% or more, 70% or more, 75% or more, 80% or more, 85% or more, 90% or more, 95% or more or 99% or more sequence identity with a wild type cGAS amino acid sequence.
  • Such polypeptides may optionally be fused to a polypeptide domain that increases solubility of the product. The domain may be linked to the polypeptide through a defined protease cleavage site, e.g., a TEV sequence, which is cleaved by TEV protease. The linker may also include one or more flexible sequences, e.g., from 1 to 10 glycine residues. In some embodiments, the cleavage of the fusion protein is performed in a buffer that maintains solubility of the product, e.g., in the presence of from 0.5 to 2 M urea, in the presence of polypeptides and/or polynucleotides that increase solubility, and the like. Domains of interest include endosomolytic domains, e.g., influenza HA domain; and other polypeptides that aid in production, e.g., IF2 domain, GST domain, GRPE domain, and the like. The polypeptide may be formulated for improved stability. For example, the peptides may be PEGylated, where the polyethyleneoxy group provides for enhanced lifetime in the blood stream.
  • Additionally or alternatively, the cyclic-di-nucleotide active agent(s) may be fused to a polypeptide permeant domain to promote uptake by the cell. A number of permeant domains are known in the art and may be used in the non-integrating polypeptides of the present invention, including peptides, peptidomimetics, and non-peptide carriers. For example, a permeant peptide may be derived from the third alpha helix of Drosophila melanogaster transcription factor Antennapaedia, referred to as penetratin, which comprises the amino acid sequence RQIKIWFQNRRMKWKK (SEQ ID NO:03). As another example, the permeant peptide comprises the HIV-1 tat basic region amino acid sequence, which may include, for example, amino acids 49-57 of naturally-occurring tat protein. Other permeant domains include poly-arginine motifs, for example, the region of amino acids 34-56 of HIV-1 rev protein, nona-arginine, octa-arginine, and the like. (See, for example, Futaki et al. Curr Protein Pept Sci. 4(2): 87-96 (2003); and Wender et al. Proc. Natl. Acad. Sci. U.S.A 97(24):13003-8 (2000); published U.S. Patent applications 20030220334; 20030083256; 20030032593; and 20030022831, herein specifically incorporated by reference for the teachings of translocation peptides and peptoids). The nona-arginine (R9) sequence is one of the more efficient PTDs that have been characterized (Wender et al. 2000; Uemura et al. 2002). The site at which the fusion is made may be selected in order to optimize the biological activity, secretion or binding characteristics of the polypeptide. The optimal site will be determined by routine experimentation.
  • In practicing embodiments of the methods provided herein, an effective amount of the active agent, i.e., a cyclic-di-nucleotide active agent (such as described above), is provided in the target cell or cells. As used herein “effective amount” or “efficacious amount” means the amount of the active agent that, when contacted with the cell, e.g., by being introduced into the cell in vitro, by being administered to a subject, etc., is sufficient to result in increased levels of a cyclic-di-nucleotide in the cell. The “effective amount” will vary depending on cell and/or the organism and/or compound and or the nature of the desired outcome and/or the disease and its severity and the age, weight, etc., of the subject to be treated.
  • In some instances, the effective amount of the active agent is provided in the cell by contacting the cell with the active agent. Contact of the cell with the active agent may occur using any convenient protocol. The protocol may provide for in vitro or in vivo contact of the active agent with the target cell, depending on the location of the target cell. For example, where the target cell is an isolated cell, e.g., a cell in vitro (i.e., in culture), or a cell ex vivo (“ex vivo” being cells or organs are modified outside of the body, where such cells or organs are typically returned to a living body), the active agent may be introduced directly into the cell under cell culture conditions permissive of viability of the target cell. Such techniques include, but are not necessarily limited to: viral infection, transfection, conjugation, protoplast fusion, electroporation, particle gun technology, calcium phosphate precipitation, direct microinjection, viral vector delivery, and the like. The choice of method is generally dependent on the type of cell being contacted and the nature of the active agent, and the circumstances under which the transformation is taking place (e.g., in vitro, ex vivo, or in vivo). A general discussion of these methods can be found in Ausubel, et al, Short Protocols in Molecular Biology, 3rd ed., Wiley & Sons, 1995. As another example, where the target cell or cells are part of a multicellular organism, the active agent may be administered to the organism or subject in a manner such that the agent is able to contact the target cell(s), e.g., via an in vivo protocol. By “in vivo,” it is meant in the target construct is administered to a living body of an animal.
  • In some embodiments, the cyclic-di-nucleotide active agent is employed to modulate c-di-AMP activity in mitotic or post-mitotic cells in vitro or ex vivo, i.e., to produce modified cells that can be reintroduced into an individual. Mitotic and post-mitotic cells of interest in these embodiments include any eukaryotic cell, e.g., pluripotent stem cells, for example, ES cells, iPS cells, and embryonic germ cells; somatic cells, for example, hematopoietic cells, fibroblasts, neurons, muscle cells, bone cells, vascular endothelial cells, gut cells, and the like, and their lineage-restricted progenitors and precursors; and neoplastic, or cancer, cells, i.e., cells demonstrating one or more properties associated with cancer cells, e.g., hyperproliferation, contact inhibition, the ability to invade other tissue, etc. In certain embodiments, the eukaryotic cells are cancer cells. In certain embodiments, the eukaryotic cells are hematopoietic cells, e.g., macrophages, NK cells, etc. Cells may be from any mammalian species, e.g., murine, rodent, canine, feline, equine, bovine, ovine, primate, human, etc. Cells may be from established cell lines or they may be primary cells, where “primary cells”, “primary cell lines”, and “primary cultures” are used interchangeably herein to refer to cells and cells cultures that have been derived from a subject and allowed to grow in vitro for a limited number of passages, i.e., splittings, of the culture. For example, primary cultures are cultures that may have been passaged 0 times, 1 time, 2 times, 4 times, 5 times, 10 times, or 15 times, but not enough times go through the crisis stage. Typically, the primary cell lines of the present invention are maintained for fewer than 10 passages in vitro.
  • If the cells are primary cells, they may be harvested from an individual by any convenient method. For example, blood cells, e.g., leukocytes, e.g., macrophages, may be harvested by apheresis, leukocytapheresis, density gradient separation, etc., while cells from tissues such as skin, muscle, bone marrow, spleen, liver, pancreas, lung, intestine, stomach, etc. may be harvested by biopsy. An appropriate solution may be used for dispersion or suspension of the harvested cells. Such solution will generally be a balanced salt solution, e.g., normal saline, PBS, Hank's balanced salt solution, etc., conveniently supplemented with fetal calf serum or other naturally occurring factors, in conjunction with an acceptable buffer at low concentration, generally from 5-25 mM. Convenient buffers include HEPES, phosphate buffers, lactate buffers, etc. The cells may be used immediately, or they may be stored, frozen, for long periods of time, being thawed and capable of being reused. In such cases, the cells may be frozen in 10% DMSO, 50% serum, 40% buffered medium, or some other such solution as is commonly used in the art to preserve cells at such freezing temperatures, and thawed in a manner as commonly known in the art for thawing frozen cultured cells.
  • The cyclic-di-nucleotide active agent(s) may be produced by eukaryotic cells or by prokaryotic cells, it may be further processed by unfolding, e.g., heat denaturation, DTT reduction, etc. and may be further refolded, using methods known in the art.
  • Modifications of interest that do not alter primary sequence include chemical derivatization of polypeptides, e.g., acylation, acetylation, carboxylation, amidation, etc. Also included are modifications of glycosylation, e.g., those made by modifying the glycosylation patterns of a polypeptide during its synthesis and processing or in further processing steps; e.g., by exposing the polypeptide to enzymes which affect glycosylation, such as mammalian glycosylating or deglycosylating enzymes. Also embraced are sequences that have phosphorylated amino acid residues, e.g., phosphotyrosine, phosphoserine, or phosphothreonine.
  • Also included in the subject invention are cyclic-di-nucleotide active agent polypeptides (e.g., cGAS polypeptides) that have been modified using ordinary molecular biological techniques and synthetic chemistry so as to improve their resistance to proteolytic degradation or to optimize solubility properties or to render them more suitable as a therapeutic agent. Analogs of such polypeptides include those containing residues other than naturally occurring L-amino acids, e.g., D-amino acids or non-naturally occurring synthetic amino acids. D-amino acids may be substituted for some or all of the amino acid residues.
  • The cyclic-di-nucleotide active agent (s) may be prepared by in vitro synthesis, using any suitable method. Various commercial synthetic apparatuses are available, for example, automated synthesizers by Applied Biosystems, Inc., Beckman, etc. By using synthesizers, naturally occurring amino acids may be substituted with unnatural amino acids. The particular sequence and the manner of preparation will be determined by convenience, economics, purity required, and the like.
  • If desired, various groups may be introduced into the peptide during synthesis or during expression, which allow for linking to other molecules or to a surface. Thus cysteines can be used to make thioethers, histidines for linking to a metal ion complex, carboxyl groups for forming amides or esters, amino groups for forming amides, and the like.
  • The cyclic-di-nucleotide active agent(s) may also be isolated and purified in accordance with conventional methods of recombinant synthesis. A lysate may be prepared of the expression host and the lysate purified using HPLC, exclusion chromatography, gel electrophoresis, affinity chromatography, or other purification technique. For the most part, the compositions which are used will include 20% or more by weight of the desired product, such as 75% or more by weight of the desired product, including 95% or more by weight of the desired product, and for therapeutic purposes, may be 99.5% or more by weight, in relation to contaminants related to the method of preparation of the product and its purification (where the percentages may be based upon total protein).
  • To modulate cyclic-di-nucleotide activity and/or production, the cyclic-di-nucleotide active agent(s)—be they small molecules (e.g., 2′-5′ phosphodiester linkage containing cyclic-di-nucleotides) polypeptides or nucleic acids that encode cyclic-di-nucleotide active agent polypeptides (e.g., cGAS)—may be provided to the cells for a sufficient period of time, e.g., from 30 minutes to 24 hours, e.g., 1 hour, 1.5 hours, 2 hours, 2.5 hours, 3 hours, 3.5 hours 4 hours, 5 hours, 6 hours, 7 hours, 8 hours, 12 hours, 16 hours, 18 hours, 20 hours, or any other period from 30 minutes to 24 hours, which may be repeated with a frequency of every day to every 4 days, e.g., every 1.5 days, every 2 days, every 3 days, or any other frequency from about every day to about every four days. The agent(s) may be provided to the subject cells one or more times, e.g., one time, twice, three times, or more than three times, and the cells allowed to incubate with the agent(s) for some amount of time following each contacting event e.g., 16-24 hours, after which time the media is replaced with fresh media and the cells are cultured further.
  • In certain embodiments, two or more, three or more, four or more, five or more, six or more, seven or more, eight or more, nine or more, or ten or more different cyclic-di-nucleotide active agents are provided to a cell in a manner sufficient to increase production of a type I interferon by the cell. In some instances, the active agents include two or more different 2′-5′ phosphodiester linkage comprising cyclic-di-nucleotides. In certain embodiments, the active agents include a 2′-5′ phosphodiester linkage containing cyclic-di-nucleotide and a nucleic acid encoding cGAS or a cGAS polypeptide. In instances in which two or more different cyclic-di-nucleotide active agents are provided to the cell, i.e., a cyclic-di-nucleotide active agent cocktail, the cyclic-di-nucleotide active agent(s) may be provided simultaneously, e.g., as two cyclic-di-nucleotides delivered simultaneously or a cyclic-di-nucleotide and a vector containing a nucleic acid encoding cGAS delivered simultaneously. Alternatively, they may be provided consecutively, e.g., the first cyclic-di-nucleotide active agent being provided first, followed by the cyclic-di-nucleotide active agent, etc. or vice versa.
  • An effective amount of cyclic-di-nucleotide active agent(s) are provided to the cells to result in a change in cyclic-di-nucleotide levels. An effective amount of cyclic-di-nucleotide active agent is the amount to result in a 2-fold increase or more in the amount of cyclic-di-nucleotide production observed relative to a negative control, e.g., a cell contacted with an empty vector or irrelevant polypeptide. That is to say, an effective amount or dose of a cyclic-di-nucleotide active agent will result in a 2-fold increase, a 3-fold increase, a 4-fold increase or more in the amount of cyclic-di-nucleotide observed, in some instances a 5-fold increase, a 6-fold increase or more, sometimes a 7-fold or 8-fold increase or more in the amount of activity observed, e.g., an increase of 10-fold, 50-fold, or 100-fold or more, in some instances, an increase of 200-fold, 500-fold, 700-fold, or 1000-fold or more, in the amount of activity observed. The amount of activity may be measured by any suitable method. For example, the amount of interferon produced by the cell may be assessed after contact with the cyclic-di-nucleotide active agent(s), e.g., 2 hours, 4 hours, 8 hours, 12 hours, 24 hours, 36 hours, 48 hours, 72 hours or more after contact with the cyclic-di-nucleotide active agent(s).
  • Contacting the cells with the cyclic-di-nucleotide active agent(s) may occur in any culture media and under any culture conditions that promote the survival of the cells. For example, cells may be suspended in any appropriate nutrient medium that is convenient, such as Iscove's modified DMEM or RPMI 1640, supplemented with fetal calf serum or heat inactivated goat serum (about 5-10%), L-glutamine, a thiol, particularly 2-mercaptoethanol, and antibiotics, e.g., penicillin and streptomycin. The culture may contain growth factors to which the cells are responsive. Growth factors, as defined herein, are molecules capable of promoting survival, growth and/or differentiation of cells, either in culture or in the intact tissue, through specific effects on a transmembrane receptor. Growth factors include polypeptides and non-polypeptide factors.
  • Following the methods described above, a cell may be modified ex vivo to have an increase in cyclic-di-nucleotide levels. In some embodiments, it may be desirous to select for the modified cell, e.g., to create an enriched population of modified cells. Any convenient modification to the cells that marks the cells as modified with a cyclic-di-nucleotide active agent may be used. For example, a selectable marker may be inserted into the genome of the cell, so that the population of cells may be enriched for those comprising the genetic modification by separating the genetically marked cells from the remaining population. Separation may be by any convenient separation technique appropriate for the selectable marker used. For example, if a fluorescent marker has been inserted, cells may be separated by fluorescence activated cell sorting, whereas if a cell surface marker has been inserted, cells may be separated from the heterogeneous population by affinity separation techniques, e.g., magnetic separation, affinity chromatography, “panning” with an affinity reagent attached to a solid matrix, or other convenient technique. Techniques providing accurate separation include fluorescence activated cell sorters, which can have varying degrees of sophistication, such as multiple color channels, low angle and obtuse light scattering detecting channels, impedance channels, etc. The cells may be selected against dead cells by employing dyes associated with dead cells (e.g., propidium iodide). Any technique may be employed which is not unduly detrimental to the viability of the genetically modified cells.
  • Cell compositions that are highly enriched for cells comprising cyclic-di-nucleotide active agent(s) are achieved in this manner. By “highly enriched”, it is meant that the genetically modified cells will be 70% or more, 75% or more, 80% or more, 85% or more, 90% or more of the cell composition, for example, about 95% or more, or 98% or more of the cell composition. In other words, the composition may be a substantially pure composition of cells comprising cyclic-di-nucleotide active agent(s).
  • Cells comprising cyclic-di-nucleotide active agent(s) produced by the methods described herein may be used immediately. Alternatively, the cells may be frozen at liquid nitrogen temperatures and stored for long periods of time, being thawed and capable of being reused. In such cases, the cells may be frozen in 10% DMSO, 50% serum, 40% buffered medium, or some other such solution as is commonly used in the art to preserve cells at such freezing temperatures, and thawed in a manner as commonly known in the art for thawing frozen cultured cells.
  • The cells comprising cyclic-di-nucleotide active agent(s) may be cultured in vitro under various culture conditions. The cells may be expanded in culture, i.e., grown under conditions that promote their proliferation. Culture medium may be liquid or semi-solid, e.g., containing agar, methylcellulose, etc. The cell population may be suspended in an appropriate nutrient medium, such as Iscove's modified DMEM or RPMI 1640, normally supplemented with fetal calf serum (about 5-10%), L-glutamine, a thiol, particularly 2-mercaptoethanol, and antibiotics, e.g., penicillin and streptomycin. The culture may contain growth factors to which the regulatory T cells are responsive. Growth factors, as defined herein, are molecules capable of promoting survival, growth and/or differentiation of cells, either in culture or in the intact tissue, through specific effects on a transmembrane receptor. Growth factors include polypeptides and non-polypeptide factors.
  • Cells that have been modified with cyclic-di-nucleotide active agent(s) may be transplanted to a subject to treat a disease or as an antiviral, antipathogenic, or anticancer therapeutic or for biological research. The subject may be a neonate, a juvenile, or an adult. Of particular interest are mammalian subjects. Mammalian species that may be treated with the present methods include canines and felines; equines; bovines; ovines; etc. and primates, particularly humans. Animal models, particularly small mammals, e.g., murine, lagomorpha, etc., may be used for experimental investigations.
  • Cells may be provided to the subject alone or with a suitable substrate or matrix, e.g., to support their growth and/or organization in the tissue to which they are being transplanted. In some instances, at least 1×103 cells will be administered, for example 5×103 cells, 1×104 cells, 5×104 cells, 1×105 cells, 1×106 cells or more. The cells may be introduced to the subject via any of the following routes: parenteral, subcutaneous, intravenous, intracranial, intraspinal, intraocular, or into spinal fluid. The cells may be introduced by injection, catheter, or the like. Examples of methods for local delivery, that is, delivery to the site of injury, include, e.g., through an Ommaya reservoir, e.g., for intrathecal delivery (see, e.g., U.S. Pat. Nos. 5,222,982 and 5,385,582, incorporated herein by reference); by bolus injection, e.g., by a syringe, e.g., into a joint; by continuous infusion, e.g., by cannulation, e.g., with convection (see e.g., US Application No. 20070254842, incorporated here by reference); or by implanting a device upon which the cells have been reversibly affixed (see e.g., US Application Nos. 20080081064 and 20090196903, incorporated herein by reference).
  • In other aspects of the invention, the cyclic-di-nucleotide active agent(s) are employed to increase the production of type I interferon in vivo. In these in vivo embodiments, the cyclic-di-nucleotide active agent(s) are administered directly to the individual. In some embodiments, the cyclic-di-nucleotide active agent administered to the subject contains a 2′-5′ phosphodiester linkage containing cyclic-di-nucleotide.
  • Cyclic-di-nucleotide active agent(s) may be administered by any suitable methods for the administration of peptides, small molecules and nucleic acids to a subject. The cyclic-di-nucleotide active agent(s) can be incorporated into a variety of formulations. More particularly, the cyclic-di-nucleotide active agent(s) of the present invention can be formulated into pharmaceutical compositions by combination with appropriate pharmaceutically acceptable carriers or diluents. Pharmaceutical compositions that can be used in practicing the subject methods are described below.
  • In such instances, an effective amount of the cyclic-di-nucleotide active agent is administered to the subject. By an “effective amount” or a “therapeutically effective amount” of the cyclic-di-nucleotide active agent it is meant an amount that is required to reduce the severity, the duration and/or the symptoms of the disease. In some embodiments, the effective amount of a pharmaceutical composition containing a cyclic-di-nucleotide active agent, as provided herein, is between 0.025 mg/kg and 1000 mg/kg body weight of a human subject. In certain embodiments, the pharmaceutical composition is administered to a human subject at an amount of 1000 mg/kg body weight or less, 950 mg/kg body weight or less, 900 mg/kg body weight or less, 850 mg/kg body weight or less, 800 mg/kg body weight or less, 750 mg/kg body weight or less, 700 mg/kg body weight or less, 650 mg/kg body weight or less, 600 mg/kg body weight or less, 550 mg/kg body weight or less, 500 mg/kg body weight or less, 450 mg/kg body weight or less, 400 mg/kg body weight or less, 350 mg/kg body weight or less, 300 mg/kg body weight or less, 250 mg/kg body weight or less, 200 mg/kg body weight or less, 150 mg/kg body weight or less, 100 mg/kg body weight or less, 95 mg/kg body weight or less, 90 mg/kg body weight or less, 85 mg/kg body weight or less, 80 mg/kg body weight or less, 75 mg/kg body weight or less, 70 mg/kg body weight or less, or 65 mg/kg body weight or less.
  • In another aspect, provided herein is a method for increasing a stimulator of interferon genes (STING) mediated response in a subject, e.g., a STING mediated immune response. In certain embodiments, the method includes the step of administering to the subject an amount of a STING active agent effective to increase a STING mediated response in the subject. A “STING” mediated response refers to any response that is mediated by STING, including, but not limited to, immune responses to bacterial pathogens, viral pathogens, and eukaryotic pathogens. See, e.g., Ishikawa et al. Immunity 29: 538-550 (2008); Ishikawa et al. Nature 461: 788-792 (2009); and Sharma et al. Immunity 35: 194-207 (2011). STING also functions in certain autoimmune diseases initiated by inappropriate recognition of self DNA (see, e.g., Gall et al. Immunity 36: 120-131 (2012), as well as for the induction of adaptive immunity in response to DNA vaccines (see, e.g., Ishikawa et al. Nature 461: 788-792 (2009). By increasing a STING mediated response in a subject is meant an increase in a STING mediated response in a subject as compared to a control subject (e.g., a subject who is not administered a STING active agent). In certain embodiments, the method is for increasing a stimulator of interferon genes (STING) mediated response in a subject, wherein the STING mediated response is non-responsive to a cyclic-di-nucleotide having two 3′-5′ phosphodiester bonds (i.e., a canonical cyclic dinucleotide).
  • As described in the Experimental Section below, cyclic-di-nucleotides having 2′-5′ phosphodiester bonds have been shown to activate STING signaling. Moreover, such cyclic-di-nucleotides having 2′-5′ phosphodiester bonds have been shown to stimulate alleles of STING that are non-responsive to cyclic-di-nucleotides that have two phosphodiester bonds. As such, in some embodiments, the STING active agent is a cyclic-di-nucleotide active agent described herein (e.g., cyclic-di-nucleotide, nucleic acid encoding cGAS).
  • In other embodiments the STING active agent is a nucleic acid encoding STING or a STING polypeptide. Nucleic acids encoding various STINGs include, but are not limited to, those described in: Nitta et al. Hepatology 57(1): 46-58 (2013) and Jin et al. J. Immunol. 190(6): 2835-2843 (2013) and those deposited in GENBANK and assigned deposit numbers: NM198282.2 and NP938023.1 (human); NM028261.1 and NP082537.1 (mus musculus); and NM057386.4 and NP476734.1 (Drosophila melanogaster).
  • In certain embodiments, the nucleic acid encoding STING has the following sequence:
  • (SEQ ID NO: 04)
    gttcatttttcactcctccctcctaggtcacacttttcagaaaaagaat
    ctgcatcctggaaaccagaagaaaaatatgagacggggaatcatcgtgt
    gatgtgtgtgctgcctttggctgagtgtgtggagtcctgctcaggtgtt
    aggtacagtgtgtttgatcgtggtggcttgaggggaacccgctgttcag
    agctgtgactgcggctgcactcagagaagctgcccttggctgctcgtag
    cgccgggccttctctcctcgtcatcatccagagcagccagtgtccggga
    ggcagaagatgccccactccagcctgcatccatccatcccgtgtcccag
    gggtcacggggcccagaaggcagccttggttctgctgagtgcctgcctg
    gtgaccctttgggggctaggagagccaccagagcacactctccggtacc
    tggtgctccacctagcctccctgcagctgggactgctgttaaacggggt
    ctgcagcctggctgaggagctgcgccacatccactccaggtaccggggc
    agctactggaggactgtgcgggcctgcctgggctgccccctccgccgtg
    gggccctgttgctgctgtccatctatttctactactccctcccaaatgc
    ggtcggcccgcccttcacttggatgcttgccctcctgggcctctcgcag
    gcactgaacatcctcctgggcctcaagggcctggccccagctgagatct
    ctgcagtgtgtgaaaaagggaatttcaacgtggcccatgggctggcatg
    gtcatattacatcggatatctgcggctgatcctgccagagctccaggcc
    cggattcgaacttacaatcagcattacaacaacctgctacggggtgcag
    tgagccagcggctgtatattctcctcccattggactgtggggtgcctga
    taacctgagtatggctgaccccaacattcgcttcctggataaactgccc
    cagcagaccggtgaccatgctggcatcaaggatcgggtttacagcaaca
    gcatctatgagcttctggagaacgggcagcgggcgggcacctgtgtcct
    ggagtacgccacccccttgcagactttgtttgccatgtcacaatacagt
    caagctggctttagccgggaggataggcttgagcaggccaaactcttct
    gccggacacttgaggacatcctggcagatgcccctgagtctcagaacaa
    ctgccgcctcattgcctaccaggaacctgcagatgacagcagcttctcg
    ctgtcccaggaggttctccggcacctgcggcaggaggaaaaggaagagg
    ttactgtgggcagcttgaagacctcagcggtgcccagtacctccacgat
    gtcccaagagcctgagctcctcatcagtggaatggaaaagcccctccct
    ctccgcacggatttctcttgagacccagggtcaccaggccagagcctcc
    agtggtctccaagcctctggactgggggctctcttcagtggctgaatgt
    ccagcagagctatttccttccacagggggccttgcagggaagggtccag
    gacttgacatcttaagatgcgtcttgtccccttgggccagtcatttccc
    ctctctgagcctcggtgtcttcaacctgtgaaatgggatcataatcact
    gccttacctccctcacggttgttgtgaggactgagtgtgtggaagtttt
    tcataaactttggatgctagtgtacttagggggtgtgccaggtgtcttt
    catggggccttccagacccactccccacccttctccccttcctttgccc
    ggggacgccgaactctctcaatggtatcaacaggctccttcgccctctg
    gctcctggtcatgttccattattggggagccccagcagaagaatggaga
    ggaggaggaggctgagtttggggtattgaatcccccggctcccaccctg
    cagcatcaaggttgctatggactctcctgccgggcaactcttgcgtaat
    catgactatctctaggattctggcaccacttccttccctggccccttaa
    gcctagctgtgtatcggcacccccaccccactagagtactccctctcac
    ttgcggtttccttatactccacccctttctcaacggtccttttttaaag
    cacatctcagattacccaaaaaaaaaaaaaaaaaa. 
  • In some embodiments, the nucleic acid encoding STING is a nucleic acid with 40% to 99%, 45% to 99%, 50% to 99%, 55% to 99%, 60% to 99%, 65% to 99%, 70% to 99%, 75% to 99%, 80% to 99%, 85% to 99%, 90% to 99% or, 95% to 99% sequence identity with a wild type STING nucleic acid sequence. In some embodiments, the nucleic acid encoding STING is a nucleic acid with 40% to 50%, 50% to 60%, 60% to 70%, 70% to 80%, 80% to 90%, or 90 to 99% sequence identity with a wild type STING nucleic acid sequence. In some embodiments, the nucleic acid encoding STING is a nucleic acid with 40% or more, 45% or more, 50% or more, 55% or more, 60% or more, 70% or more, 75% or more, 80% or more, 85% or more, 90% or more, 95% or more or 99% or more sequence identity with a wild type STING nucleic acid sequence.
  • Amino acid sequences of STING include, but are not limited to, those described in: Nitta et al. Hepatology 57(1): 46-58 (2013) and Jin et al. J. Immunol. 190(6): 2835-2843 (2013) and those deposited in GENBANK and assigned deposit numbers: NM198282.2 and NP938023.1 (human); NM028261.1 and NP082537.1 (mus musculus); and NM057386.4 and NP476734.1 (Drosophila melanogaster).
  • In certain embodiments, the STING polypeptide has the following sequence:
  • (SEQ ID NO: 05)
    MPHSSLHPSIPCPRGHGAQKAALVLLSACLVTLWGLGEPPEHTLRYLVL
    HLASLQLGLLLNGVCSLAEELRHIHSRYRGSYWRTVRACLGCPLRRGAL
    LLLSIYFYYSLPNAVGPPFTWMLALLGLSQALNILLGLKGLAPAEISAV
    CEKGNFNVAHGLAWSYYIGYLRLILPELQARIRTYNQHYNNLLRGAVSQ
    RLYILLPLDCGVPDNLSMADPNIRFLDKLPQQTGDHAGIKDRVYSNSIY
    ELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRT
    LEDILADAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQEEKEEVTV
    GSLKTSAVPSTSTMSQEPELLISGMEKPLPLRTDFS.
  • In other embodiments, the STING polypeptide has the following sequence:
  • (SEQ ID NO: 06)
    MPHSSLHPSIPCPRGHGAQKAALVLLSACLVTLWGLGEPPEHTLRYLVL
    HLASLQLGLLLNGVCSLAEELHHIHSRYRGSYWRTVRACLGCPLRRGAL
    LLLSIYFYYSLPNAVGPPFTWMLALLGLSQALNILLGLKGLAPAEISAV
    CEKGNFNVAHGLAWSYYIGYLRLILPELQARIRTYNQHYNNLLRGAVSQ
    RLYILLPLDCGVPDNLSMADPNIRFLDKLPQQTADRAGIKDRVYSNSIY
    ELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCQT
    LEDILADAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQEEKEEVTV
    GSLKTSAVPSTSTMSQEPELLISGMEKPLPLRTDFS.
  • In some embodiments, the STING polypeptide is a polypeptide that has 40% to 99%, 45% to 99%, 50% to 99%, 55% to 99%, 60% to 99%, 65% to 99%, 70% to 99%, 75% to 99%, 80% to 99%, 85% to 99%, 90% to 99% or, 95% to 99% sequence identity with a wild type STING amino acid sequence. In some embodiments, the cGAS polypeptide is a polypeptide that has 40% to 50%, 50% to 60%, 60% to 70%, 70% to 80%, 80% to 90%, or 90 to 99% sequence identity with a wild type STING amino acid sequence. In some embodiments, the STING polypeptide is a polypeptide that has 40% or more, 45% or more, 50% or more, 55% or more, 60% or more, 70% or more, 75% or more, 80% or more, 85% or more, 90% or more, 95% or more or 99% or more sequence identity with a wild type STING amino acid sequence.
  • The above methods find use in a variety of different applications. Certain applications are now reviewed in the following Utility section.
  • Utility
  • The methods and compositions provided herein find use in a variety of applications, where such applications include increasing type I interferon (e.g., interferon-β) in a subject is desired. In addition, the methods and compositions provided herein find use in a variety of applications, where such applications include increasing STING mediated response in a subject is desired. Specific applications of interest include those in which a subject is treated for a disease condition that would benefit from an increase in type I interferon by providing the subject with a therapeutically effective amount of a cyclic-di-nucleotide active agent. In some instances, it may be desirable to increase a type I interferon or STING mediated response in a healthy individual, e.g., for the prevention of a disease or condition. As such, in some embodiments, the methods and compositions provided herein can be used to produce an ‘adjuvant’ effect in a vaccine to prevent an infection or other disease, wherein the active agent stimulates immunological memory to protect against future disease or infection.
  • In some embodiments, subjects suitable for treatment with a method described herein include individuals having an immunological or inflammatory disease or disorder including, but not limited to a cancer, an autoimmune disease or disorder, an allergic reaction, a chronic infectious disease and an immunodeficiency disease or disorder.
  • In some embodiments, subjects suitable for treatment with a method of the present invention include individuals having a cellular proliferative disease, such as a neoplastic disease (e.g., cancer). Cellular proliferative disease is characterized by the undesired propagation of cells, including, but not limited to, neoplastic disease conditions, e.g., cancer.
  • Examples of cellular proliferative disease include, but not limited to, abnormal stimulation of endothelial cells (e.g., atherosclerosis), solid tumors and tumor metastasis, benign tumors, for example, hemangiomas, acoustic neuromas, neurofibromas, trachomas, and pyogenic granulomas, vascular malfunctions, abnormal wound healing, inflammatory and immune disorders, Bechet's disease, gout or gouty arthritis, abnormal angiogenesis accompanying, for example, rheumatoid arthritis, psoriasis, diabetic retinopathy, other ocular angiogenic diseases such as retinopathy of prematurity (retrolental fibroplastic), macular degeneration, corneal graft rejection, neurovascular glaucoma and Oster Webber syndrome, psoriasis, restenosis, fungal, parasitic and viral infections such cytomegaloviral infections. Subjects to be treated according to the methods of the invention include any individual having any of the above-mentioned disorders.
  • In other embodiments, subjects suitable for treatment with a subject method include individuals who have been clinically diagnosed as infected with a virus. In some embodiments, the virus is a hepatitis virus (e.g., HAV, HBV, HCV, delta, etc.), particularly HCV, are suitable for treatment with the methods of the instant invention. Individuals who are infected with HCV are identified as having HCV RNA in their blood, and/or having anti-HCV antibody in their serum. Such individuals include naïve individuals (e.g., individuals not previously treated for HCV, particularly those who have not previously received IFN-α-based or ribavirin-based therapy) and individuals who have failed prior treatment for HCV.
  • In some embodiments, subjects suitable for treatment with a method provided herein include an individual with a neurodegenerative disease or disorder, including, but not limited to, Parkinson's disease, Alzheimer's disease, Huntington's disease, and Amyotrophic lateral sclerosis (ALS).
  • In other embodiments, subjects suitable for treatment with a method of the present invention include individuals having multiple sclerosis. Multiple sclerosis refers to an autoimmune neurodegenerative disease, which is marked by inflammation within the central nervous system with lymphocyte attack against myelin produced by oligodendrocytes, plaque formation and demyelization with destruction of the myelin sheath of axons in the brain and spinal cord, leading to significant neurological disability over time. Typically, at onset an otherwise healthy person presents with the acute or sub acute onset of neurological symptomatology (attack) manifested by unilateral loss of vision, vertigo, ataxia, dyscoordination, gait difficulties, sensory impairment characterized by paresthesia, dysesthesia, sensory loss, urinary disturbances until incontinence, diplopia, dysarthria or various degrees of motor weakness until paralysis. The symptoms may be painless, remain for several days to a few weeks, and then partially or completely resolve. After a period of remission, a second attack will occur. During this period after the first attack, the patient is defined to suffer from probable MS. Probable MS patients may remain undiagnosed for years. When the second attack occurs the diagnosis of clinically definite MS (CDMS) is made (Poser criteria 1983; C. M. Poser et al., Ann. Neurol. 1983; 13, 227).
  • The terms “subject” and “patient” mean a member or members of any mammalian or non-mammalian species that may have a need for the pharmaceutical methods, compositions and treatments described herein. Subjects and patients thus include, without limitation, primate (including humans), canine, feline, ungulate (e.g., equine, bovine, swine (e.g., pig)), avian, and other subjects. Humans and non-human animals having commercial importance (e.g., livestock and domesticated animals) are of particular interest.
  • “Mammal” means a member or members of any mammalian species, and includes, by way of example, canines; felines; equines; bovines; ovines; rodentia, etc. and primates, particularly humans. Non-human animal models, particularly mammals, e.g., primate, murine, lagomorpha, etc. may be used for experimental investigations.
  • “Treating” or “treatment” of a condition or disease includes: (1) preventing at least one symptom of the conditions, i.e., causing a clinical symptom to not significantly develop in a mammal that may be exposed to or predisposed to the disease but does not yet experience or display symptoms of the disease, (2) inhibiting the disease, i.e., arresting or reducing the development of the disease or its symptoms, or (3) relieving the disease, i.e., causing regression of the disease or its clinical symptoms. As used herein, the term “treating” is thus used to refer to both prevention of disease, and treatment of pre-existing conditions. For example, where the cyclic-di-nucleotide active agent is administered, the prevention of cellular proliferation can be accomplished by administration of the subject compounds prior to development of overt disease, e.g., to prevent the regrowth of tumors, prevent metastatic growth, etc. Alternatively the compounds are used to treat ongoing disease, by stabilizing or improving the clinical symptoms of the patient.
  • Combination Therapy
  • For use in the subject methods, the cyclic-di-nucleotide active agent described herein may be administered in combination with other pharmaceutically active agents, including other agents that treat the underlying condition or a symptom of the condition. “In combination with” as used herein refers to uses where, for example, the first compound is administered during the entire course of administration of the second compound; where the first compound is administered for a period of time that is overlapping with the administration of the second compound, e.g., where administration of the first compound begins before the administration of the second compound and the administration of the first compound ends before the administration of the second compound ends; where the administration of the second compound begins before the administration of the first compound and the administration of the second compound ends before the administration of the first compound ends; where the administration of the first compound begins before administration of the second compound begins and the administration of the second compound ends before the administration of the first compound ends; where the administration of the second compound begins before administration of the first compound begins and the administration of the first compound ends before the administration of the second compound ends. As such, “in combination” can also refer to regimen involving administration of two or more compounds. “In combination with” as used herein also refers to administration of two or more compounds that may be administered in the same or different formulations, by the same of different routes, and in the same or different dosage form type.
  • Examples of other agents for use in combination therapy of neoplastic disease include, but are not limited to, thalidomide, marimastat, COL-3, BMS-275291, squalamine, 2-ME, SU6668, neovastat, Medi-522, EMD121974, CAI, celecoxib, interleukin-12, IM862, TNP470, avastin, gleevec, herceptin, and mixtures thereof. Examples of chemotherapeutic agents for use in combination therapy include, but are not limited to, daunorubicin, daunomycin, dactinomycin, doxorubicin, epirubicin, idarubicin, esorubicin, bleomycin, mafosfamide, ifosfamide, cytosine arabinoside, bis-chloroethylnitrosurea, busulfan, mitomycin C, actinomycin D, mithramycin, prednisone, hydroxyprogesterone, testosterone, tamoxifen, dacarbazine, procarbazine, hexamethylmelamine, pentamethylmelamine, mitoxantrone, amsacrine, chlorambucil, methylcyclohexylnitrosurea, nitrogen mustards, melphalan, cyclophosphamide, 6-mercaptopurine, 6-thioguanine, cytarabine, 5-azacytidine, hydroxyurea, deoxycoformycin, 4-hydroxyperoxycyclophosphor-amide, 5-fluorouracil (5-FU), 5-fluorodeoxyuridine (5-FUdR), methotrexate (MTX), colchicine, taxol, vincristine, vinblastine, etoposide (VP-16), trimetrexate, irinotecan, topotecan, gemcitabine, teniposide, cisplatin and diethylstilbestrol (DES).
  • Other antiviral agents can also be delivered in the treatment methods of the invention. For example, compounds that inhibit inosine monophosphate dehydrogenase (IMPDH) may have the potential to exert direct anti viral activity, and such compounds can be administered in combination with the mutant Listeria, as described herein. Drugs that are effective inhibitors of hepatitis C NS3 protease may be administered in combination with the mutant Listeria, as described herein. Hepatitis C NS3 protease inhibitors inhibit viral replication. Other agents such as inhibitors of HCV NS3 helicase are also attractive drugs for combinational therapy, and are contemplated for use in combination therapies described herein. Ribozymes such as Heptazyme™ and phosphorothioate oligonucleotides which are complementary to HCV protein sequences and which inhibit the expression of viral core proteins are also suitable for use in combination therapies described herein. Examples of other agents for use in combination therapy of multiple sclerosis include, but are not limited to; glatiramer; corticosteroids; muscle relaxants, such as Tizanidine (Zanaflex) and baclofen (Lioresal); medications to reduce fatigue, such as amantadine (Symmetrel) or modafinil (Provigil); and other medications that may also be used for depression, pain and bladder or bowel control problems that can be associated with MS.
  • In the context of a combination therapy, combination therapy compounds may be administered by the same route of administration (e.g., intrapulmonary, oral, enteral, etc.) that the cyclic-di-nucleotide active agents are administered. In the alternative, the compounds for use in combination therapy with the cyclic-di-nucleotide active agent may be administered by a different route of administration.
  • Adjuvants
  • In certain embodiments, the cyclic di-nucleotide active agent functions as an adjuvant when administered together with a drug or vaccine to treat or prevent a disease or condition, including, but not limited to, those diseases and conditions provided herein. In some embodiments, the cyclic di-nucleotide active agents are administered together with a vaccine. Such active agents that are administered with a vaccine can function as an adjuvant to enhance the immune response elicited by the vaccine, including stimulating immunological memory to protect against future diseases and/or infections.
  • In certain embodiments, the cyclic di-nucleotide or STING active agents administered as an adjuvant for a vaccine can enhance the effectiveness of the vaccine by, e.g., increasing the immunogenicity of weaker antigens, reducing the amount of antigen required to elicit a immune response, reducing the frequency of immunization necessary to maintain protective immunity, enhance the efficacy of vaccines in immunocompromised or other individuals with reduced immune responses, and/or increase immunity at a target tissue, such as mucosal immunity. In such embodiments, the cyclic di-nucleotide active agents, when co-administered with one or more antigens, can induce a particular cytokine profile to promote cellular and humoral immunity against the antigen and increase the effectiveness of vaccination.
  • Antigens used to prepare vaccines may be derived from a variety of microorganisms such as viruses, bacteria and parasites that contain substances that are not normally present in the body, as well as tumor cells. These substances can be used as antigens to produce an immune response to destroy both the antigen and cells containing the antigen, such as a bacterial cell or cancer cell. In certain instances, isolated or crude antigens of microbial pathogens can be used in vaccines to treat infectious disease; isolated or crude tumor cell antigens can be used in vaccines to treat cancer; isolated or crude antigens known to be associated with a pathologically aberrant cell can be used to treat a variety of diseases in which it is beneficial to target particular cells for destruction.
  • Microorganisms that may be a source of antigen include clinically relevant microorganisms, such as bacteria, including pathogenic bacteria; viruses (e.g., Influenza, Measles, Coronavirus); parasites (e.g., Trypanosome, Plasmodium, Leishmania); fungi (e.g., Aspergillus, Candida, Coccidioides, Cryptococcus); and the like. For example, the antigen may be from bacteria, particularly pathogenic bacteria, such as the causative agent of anthrax (Bacillus anthracis), plague (Yersinia pestis), tuberculosis (Mycobacterium tuberculosis), salmonellosis (Salmonella enterica), stomach cancer (Helicobacter pylori), sexually transmitted diseases (Chlamydia trachomatis or Neisseria gonorrhea), and the like. Other representative examples include antigens from certain viruses, such as influenza virus(es), Norwalk virus, smallpox virus, West Nile virus, SARS virus, MERS virus, respiratory syncytial virus, measles virus, and the like. Fungi of interest include, but are not limited to Candida albicans or Aspergillus spp., and parasites of interest include the causative agents of trypanosomiasis, leishmania, pneumonic plague, and lyme disease (Borrellia burgdorferi).
  • A pathologically aberrant cell to be used in a vaccine can be obtained from any source such as one or more individuals having a pathological condition or ex vivo or in vitro cultured cells obtained from one or more such individuals, including a specific individual to be treated with the resulting vaccine.
  • A vaccine formulation for use with an adjuvant containing cyclic di-nucleotide active agents may include, e.g., attenuated and inactivated viral and bacterial pathogens from infected patients or propagated cultures, purified macromolecules, polysaccharides, toxoids, recombinant antigens, organisms containing a foreign gene from a pathogen, synthetic peptides, polynucleic acids, antibodies and tumor cells.
  • Recombinant antigens may be obtained, for example, by isolating and cloning a gene encoding any immunogenic polypeptide, in, e.g., bacterial, yeast, insect, reptile or mammalian cells using recombinant methods well known in the art and described, for example in Sambrook et al., Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory, New York (1992) and in Ansubel et al., Current Protocols in Molecular Biology, John Wiley and Sons, Baltimore, Md. (1998). A number of genes encoding surface antigens from viral, bacterial and protozoan pathogens have been successfully cloned, expressed and used as antigens for vaccine development. For example, the major surface antigen of hepatitis B virus, HbsAg, the b subunit of choleratoxin, the enterotoxin of E. coli, the circumsporozoite protein of the malaria parasite, and a glycoprotein membrane antigen from Epstein-Barr virus, as well as tumor cell antigens, have been expressed in various well known vector/host systems, purified and used in vaccines.
  • A vaccine formulation containing cyclic di-nucleotide or STING active agents may advantageously contain other vaccine adjuvants and carriers. These carriers and adjuvants include, but are not limited to, ion exchange resins, alumina, aluminum stearate, lecithin, serum proteins, such as human serum albumin, buffer substances such as phosphates, glycine, sorbic acid, potassium sorbate, partial glyceride mixtures of saturated vegetable fatty acids, phosphate buffered saline solution, water, emulsions (e.g. oil/water emulsion), salts or electrolytes such as protamine sulfate, disodium hydrogen phosphate, potassium hydrogen phosphate, sodium chloride, zinc salts, colloidal silica, magnesium trisilicate, polyvinyl pyrrolidone, cellulose-based substances and polyethylene glycol.
  • Any convenient method for determining if a vaccine compound or formulation induces an innate, humoral, cell-mediated, or any combination of these types of immune response may be employed. For example, the ability of a vaccine compound or formulation to induce an innate immune response through STING can be determined using methods described herein as well as other methods. Such methods for detecting an innate immune response can be generally performed within hours of vaccine administration. The ability of a vaccine compound or formulation to induce a humoral response can be determined by measuring the titer of antigen-specific antibodies in an animal primed with the vaccine and boosted with the antigen, or determining the presence of antibodies cross-reactive with an antigen by ELISA, Western blotting or other well-known methods. Cellular immune responses can be determined, for example, by measuring cytotoxic T cell response to antigen using a variety of methods, such as, e.g., FACS sorting, and other methods well known in the art. Methods of detecting humoral and cellular immune responses can be generally performed days or weeks after vaccine administration.
  • Cyclic-Di-Nucleotides
  • In another aspect, provided herein are 2′-5′ phosphodiester linkage containing cyclic-di-nucleotides. As used herein, “cyclic-di-nucleotide” refers to a compound containing two nucleosides (i.e., a first and second nucleoside), wherein the 2′ or 3′ carbon of each nucleoside is linked to the 5′ carbon of the other nucleoside by a phosphodiester bond. Therefore, a 2′-5′ phosphodiester linkage containing cyclic-di-nucleotide refers to a cyclic-di-nucleotide, wherein the 2′ carbon of at least one of the nucleosides is linked to the 5′ carbon of the other nucleoside. As discussed herein, 2′-5′ phosphodiester linkage containing cyclic-di-nucleotides can be used in practicing the methods described herein for increasing production of a type I interferon in a cell or subject. As used herein a “cyclic-di-nucleotide” also includes all of the stereoisomeric forms of the cyclic-di-nucleotides described herein.
  • As used herein, a “nucleoside” refers to a composition containing a nitrogenous base covalently attached to a sugar (e.g., ribose or deoxyribose) or an analog thereof. Examples of nucleosides include, but are not limited to cytidine, uridine, adenosine, guanosine, thymidine and inosine. In some embodiments, the nucleoside contains a deoxyribose sugar. Analogs of nucleosides include, but are not limited to dexoyadenosine analogues (e.g., Didanosine and Vidarabine); deoxycytidine analogues (e.g., Cytarabine, Ematricitabine, Lamivudine, and Zalcitabine); deoxyguanosine analogues (Abacavir and Entecavir); (deoxy-) thymidine analogues (e.g., Stavudine, Telbivudine, and Zidovudine); and deoxyuridine alaogues (e.g., Idoxuridine and Trifluridine).
  • While not being bound by any particular theory of operation, and as shown in the examples below, cyclic-di-nucleotides can increase type-I IFN production in a cell. In certain embodiments, cyclic-di-nucleotides increase type-I IFN production through a mechanism that involves stimulator of interferon genes (STING).
  • Cyclic-di-nucleotides include those specifically described herein as well as isoforms (e.g., tautomers) of those specifically described herein that can be used in practicing the subject methods. Cyclic-di-nucleotides can be obtained using any suitable method. For example, cyclic-di-nucleotides may be made by chemical synthesis using nucleoside derivatives as starting material. Cyclic-di-nucleotides can also be produced by in vitro synthesis, using recombinant purified cGAMP synthase (cGAS), as described in the Experimental Section below. Moreover, the structures of such cyclic-di-nucleotides can be confirmed using NMR analysis.
  • Cyclic-di-nucleotides provided herein can be described by the following nomenclature: cyclic[X1(A-5′)pX2(B-5′)p], wherein X1 and X2 are the first and second nucleoside, A is the carbon of the first nucleoside (e.g., 2′ or 3′ position) that is linked to the 5′ carbon of the second nucleoside via a phosphodiester bond and B is the carbon of the second nucleoside (e.g., 2′ or 3′ position) that is linked to the 5′ carbon of the first nucleoside by a phosphodiester bond. For instance, based on this nomenclature, cyclic[G(2′-5′)pA(3′-5′)p] has the following formula:
  • Figure US20140329889A1-20141106-C00016
  • In certain embodiments, the cyclic-di-nucleotide contains a 2′-5′ phosphodiester bond. In particular embodiments, the cyclic-di-nucleotide further contains a 3′-5′ phosphodiester bond (e.g., cyclic[X1(2′-5′)pX2(3′-5′)p] or cyclic[X1(3′-5′)pX2(2′-5′)p]). In other embodiments, the cyclic-di-nucleotide contains two 2′-5′ phosphodiester bonds (cyclic[X1(2′-5′)pX2(2′-5′)p]).
  • In certain embodiments, the cyclic-di-nucleotide is:
  • cyclic[A(2′-5′)pA2′-5′)p];
  • cyclic[T(2′-5′)pT(2′-5′)p];
  • cyclic[G(2′-5′)pG(2′-5′)p];
  • cyclic[C(2′-5′)pC(2′-5′)p]; or
  • cyclic[U(2′-5′)pU(2′-5′)p].
  • In certain embodiments, the cyclic-di-nucleotide is:
  • cyclic[A(2′-5′)pA(3′-5′)p];
  • cyclic[T(2′-5′)pT(3′-5′)p];
  • cyclic[G(2′-5′)pG(3′-5′)p];
  • cyclic[C(2′-5′)pC(3′-5′)p];
  • cyclic[U(2′-5′)pU(3′-5′)p];
  • cyclic[A(2′-5′)pT(3′-5′)p];
  • cyclic[T(2′-5′)pA(3′-5′)p];
  • cyclic[A(2′-5′)pG(3′-5′)p];
  • cyclic[G(2′-5′)pA(3′-5′)p];
  • cyclic[A(2′-5′)pC (3′-5′)p];
  • cyclic[C(2′-5′)pA(3′-5′)p];
  • cyclic[A(2′-5′)pU(3′-5′)p];
  • cyclic[U(2′-5′)pA(3′-5′)p];
  • cyclic[T(2′-5′)pG(3′-5′)p];
  • cyclic[G(2′-5′)pT(3′-5′)p];
  • cyclic[T2′-5′)pC(3′-5′)p];
  • cyclic[C(2′-5′)pT(3′-5′)p];
  • cyclic[T(2′-5′)pU(3′-5′)p];
  • cyclic[U(2′-5′)pT(3′-5′)p];
  • cyclic[G(2′-5′)pC(3′-5′)p];
  • cyclic[C2′-5′)pG(3′-5′)p];
  • cyclic[G(2′-5′)pU(3′-5′)p];
  • cyclic[U(2′-5′)pG(3′-5′)p];
  • cyclic[C(2′-5′)pU(3′-5′)p]; or
  • cyclic[U(2′-5′)pC(3′-5′)p].
  • In certain embodiments, the cyclic-di-nucleotide has the following formula:
  • Figure US20140329889A1-20141106-C00017
  • wherein X and Y can be any organic molecule including a nitrogenous base. As used herein a “nitrogenous base” refers to nitrogen-containing molecules having the chemical properties of a base including, but not limited to, pyrimidine derivatives (e.g., cytosine, thymine, and uracil) and purine derivatives (e.g., adenine and guanine), as well as substituted pyrimidine and purine derivatives, pyrimidine and purine analogs, and their tautomers. In certain embodiments, X and Y are each one of the following:
  • Figure US20140329889A1-20141106-C00018
  • In certain embodiments, the cyclic-di-nucleotide has the following formula (cyclic[G(2′5′)pA(3′5′)p]):
  • Figure US20140329889A1-20141106-C00019
  • In certain embodiments, the cyclic-di-nucleotide has the following formula (cyclic[G(3′5′)pA(2′5′)p]):
  • Figure US20140329889A1-20141106-C00020
  • In other embodiments, the cyclic-di-nucleotide has the following formula cyclic[G(2′5′)pA(2′5′)p]:
  • Figure US20140329889A1-20141106-C00021
  • In other embodiments, the cyclic-di-nucleotide has the following formula cyclic[A(2′5′)pA(3′5′)p]:
  • Figure US20140329889A1-20141106-C00022
  • In yet other embodiments, the cyclic-di-nucleotide has the following formula cyclic[G(2′5′)pG(3′5′)p]:
  • Figure US20140329889A1-20141106-C00023
  • In certain embodiments, the cyclic-di-nucleotide has the following formula cyclic[A(2′5′)pA(2′5′)p]:
  • Figure US20140329889A1-20141106-C00024
  • In certain embodiments, the cyclic-di-nucleotide has the following formula cyclic[G(2′5′)pG(2′5′)p]:
  • Figure US20140329889A1-20141106-C00025
  • In certain embodiments, the cyclic-di-nucleotide has one of the following formulas:
  • Figure US20140329889A1-20141106-C00026
    Figure US20140329889A1-20141106-C00027
    Figure US20140329889A1-20141106-C00028
    Figure US20140329889A1-20141106-C00029
  • wherein R is any amino acid side chain.
  • Pharmaceutical Compositions
  • In another aspect, provided herein is a pharmaceutical composition that contains any of the cyclic-di-nucleotide active agents provided herein and a pharmaceutically acceptable carrier. In certain embodiments of the pharmaceutical composition, the cyclic-di-nucleotide active agent is one or more cyclic-di-nucleotides.
  • The term “pharmaceutically acceptable” means approved by a regulatory agency of the Federal or a state government or listed in the U.S. Pharmacopeia or other generally recognized foreign pharmacopeia for use in animals, and more particularly in humans. The term “carrier” refers to a diluent, adjuvant, excipient, or vehicle with which the mitochondrial transport protein inhibitor is administered. Such pharmaceutical carriers can be, for example, sterile liquids, such as saline solutions in water and oils, including those of petroleum, animal, vegetable or synthetic origin, such as peanut oil, soybean oil, mineral oil, sesame oil and the like. A saline solution is a preferred carrier when the pharmaceutical composition is administered intravenously. Saline solutions and aqueous dextrose and glycerol solutions can also be employed as liquid carriers, particularly for injectable solutions. Suitable pharmaceutical excipients include starch, glucose, lactose, sucrose, gelatin, malt, rice, flour, chalk, silica gel, sodium stearate, glycerol monostearate, talc, sodium chloride, dried skim milk, glycerol, propylene glycol, water, ethanol and the like. The composition, if desired, can also contain minor amounts of wetting or emulsifying agents, or pH buffering agents. These compositions can take the form of solutions, suspensions, emulsion, tablets, pills, capsules, powders, sustained-release formulations and the like. The composition can be formulated as a suppository, with traditional binders and carriers such as triglycerides. The inhibitors can be formulated as neutral or salt forms. Pharmaceutically acceptable salts include those formed with free amino groups such as those derived from hydrochloric, phosphoric, acetic, oxalic, tartaric acids, etc., and those formed with free carboxyl groups such as those derived from sodium, potassium, ammonium, calcium, ferric hydroxides, isopropylamine, triethylamine, 2-ethylamino ethanol, histidine, procaine, etc. Examples of suitable pharmaceutical carriers are described in “Remington's Pharmaceutical Sciences” by E. W. Martin, hereby incorporated by reference herein in its entirety. Such compositions will contain a therapeutically effective amount of the mitochondrial transport protein (e.g., a Miro protein, a TRAK protein, or Khc) inhibitor, preferably in purified form, together with a suitable amount of carrier so as to provide the form for proper administration to the patient. The formulation should suit the mode of administration.
  • The pharmaceutical composition can also include any of a variety of stabilizing agents, such as an antioxidant for example. When the pharmaceutical composition includes a polypeptide, the polypeptide can be complexed with various well-known compounds that enhance the in vivo stability of the polypeptide, or otherwise enhance its pharmacological properties (e.g., increase the half-life of the polypeptide, reduce its toxicity, enhance solubility or uptake). Examples of such modifications or complexing agents include sulfate, gluconate, citrate and phosphate. The polypeptides of a composition can also be complexed with molecules that enhance their in vivo attributes. Such molecules include, for example, carbohydrates, polyamines, amino acids, other peptides, ions (e.g., sodium, potassium, calcium, magnesium, manganese), and lipids.
  • Further guidance regarding formulations that are suitable for various types of administration can be found in Remington's Pharmaceutical Sciences, Mace Publishing Company, Philadelphia, Pa., 17th ed. (1985). For a brief review of methods for drug delivery, see, Langer, Science 249:1527-1533 (1990).
  • The components used to formulate the pharmaceutical compositions are preferably of high purity and are substantially free of potentially harmful contaminants (e.g., at least National Food (NF) grade, generally at least analytical grade, and more typically at least pharmaceutical grade). Moreover, compositions intended for in vivo use may be sterile. To the extent that a given compound must be synthesized prior to use, the resulting product is typically substantially free of any potentially toxic agents, particularly any endotoxins, which may be present during the synthesis or purification process. Compositions for parental administration are also sterile, substantially isotonic and made under GMP conditions.
  • The pharmaceutical composition can be formulated for intravenous, oral, via implant, transmucosal, transdermal, intramuscular, intrathecal, or subcutaneous administration. In some embodiments, the pharmaceutical composition is formulated for intravenous administration. In other embodiments, the pharmaceutical composition is formulated for subcutaneous administration. The following delivery systems, which employ a number of routinely used pharmaceutical carriers, are only representative of the many embodiments envisioned for administering the instant compositions.
  • Injectable drug delivery systems include solutions, suspensions, gels, microspheres and polymeric injectables, and can comprise excipients such as solubility-altering agents (e.g., ethanol, propylene glycol and sucrose) and polymers (e.g., polycaprylactones and PLGAs). Implantable systems include rods and discs, and can contain excipients such as PLGA and polycaprylactone. Osteopontin or nucleic acids of the invention can also be administered attached to particles using a gene gun.
  • Oral delivery systems include tablets and capsules. These can contain excipients such as binders (e.g., hydroxypropylmethylcellulose, polyvinyl pyrilodone, other cellulosic materials and starch), diluents (e.g., lactose and other sugars, starch, dicalcium phosphate and cellulosic materials), disintegrating agents (e.g., starch polymers and cellulosic materials) and lubricating agents (e.g., stearates and talc).
  • Transmucosal delivery systems include patches, tablets, suppositories, pessaries, gels and creams, and can contain excipients such as solubilizers and enhancers (e.g., propylene glycol, bile salts and amino acids), and other vehicles (e.g., polyethylene glycol, fatty acid esters and derivatives, and hydrophilic polymers such as hydroxypropylmethylcellulose and hyaluronic acid).
  • Dermal delivery systems include, for example, aqueous and nonaqueous gels, creams, multiple emulsions, microemulsions, liposomes, ointments, aqueous and nonaqueous solutions, lotions, aerosols, hydrocarbon bases and powders, and can contain excipients such as solubilizers, permeation enhancers (e.g., fatty acids, fatty acid esters, fatty alcohols and amino acids), and hydrophilic polymers (e.g., polycarbophil and polyvinylpyrolidone). In one embodiment, the pharmaceutically acceptable carrier is a liposome or a transdermal enhancer.
  • In certain embodiments, the pharmaceutical composition containing the cyclic-di-nucleotide active agent is formulated to cross the blood brain barrier (BBB). One strategy for drug delivery through the blood brain barrier (BBB) entails disruption of the BBB, either by osmotic means such as mannitol or leukotrienes, or biochemically by the use of vasoactive substances such as bradykinin. A BBB disrupting agent can be co-administered with the therapeutic compositions when the compositions are administered by intravascular injection. Other strategies to go through the BBB may entail the use of endogenous transport systems, including caveoil-1 mediated transcytosis, carrier-mediated transporters such as glucose and amino acid carriers, receptor-mediated transcytosis for insulin or transferrin, and active efflux transporters such as p-glycoprotein. Active transport moieties may also be conjugated to the therapeutic compounds for use in the invention to facilitate transport across the endothelial wall of the blood vessel. Alternatively, drug delivery of the ND pharmaceutical composition behind the BBB may be by local delivery, for example by intrathecal delivery, e.g., through an Ommaya reservoir (see, e.g., U.S. Pat. Nos. 5,222,982 and 5,385,582, incorporated herein by reference); by bolus injection, e.g., by a syringe, e.g., intravitreally or intracranially; by continuous infusion, e.g., by cannulation, e.g., with convection (see, e.g., US Application No. 20070254842, incorporated here by reference); or by implanting a device upon which the inhibitor pharmaceutical composition has been reversably affixed (see e.g., US Application Nos. 20080081064 and 20090196903, incorporated herein by reference).
  • In certain embodiments, the pharmaceutical composition containing the cyclic-di-nucleotide or STING active agents is formulated in a delivery vehicle, e.g., to enhance cytosolic transport. Any convenient protocol may be employed to facilitate delivery of the cyclic-di-nucleotide active agent across the plasma membrane of a cell and into the cytosol. In certain embodiments, the cyclic-di-nucleotide or STING active agents and an antigen effective for use in a vaccine may be formulated together to be delivered by the same delivery vehicle in the pharmaceutical composition.
  • In some instances, the cyclic-di-nucleotide or STING active agents may be encapsulated in a delivery vehicle comprising liposomes in the pharmaceutical composition. Methods of using liposomes for drug delivery and other therapeutic uses are known in the art. See, e.g., U.S. Pat. No. 8,329,213, U.S. Pat. No. 6,465,008, U.S. Pat. No. 5,013,556, US Application No. 20070110798, and Andrews et al., Mol Pharm 2012 9:1118, which are incorporated herein by reference. Liposomes may be modified to render their surface more hydrophilic by adding polyethylene glycol (“pegylated”) to the bilayer, which increases their circulation time in the bloodstream. These are known as “stealth” liposomes and are especially useful as carriers for hydrophilic (water soluble) molecules, such as the cyclic-di-nucleotide active agents.
  • In certain embodiments, nano- or microparticles made from biodegradable materials such as poly(lactic acid), poly(γ-glutamic acid), poly(glycolic acid), polylactic-co-glycolic acid. Polyethylenimine, or alginate microparticles, and cationic microparticles, including dedrimers, such as cyclodextrins, may be employed as delivery vehicles for cyclic-di-nucleotide or STING active agents to promote cellular uptake. See, e.g., U.S. Pat. No. 8,187,571, Krishnamachari et al., Adv Drug Deliv Rev 2009 61:205, Garzon et al., 2005 Vaccine 23:1384, incorporated herein by reference.
  • In another embodiment, photochemical internalization may be employed to enhance cytosolic uptake of cyclic-di-nucleotide or STING active agents. See, e.g., US Application No. 20120226217, incorporated herein by reference. In such embodiments, the cyclic-di-nucleotide or STING active agents may be co-adiminstered with a photosensitizing agent. Then, exposure of the target cells to light of a specific wavelength triggers internalization of the cyclic-di-nucleotide or STING active agents.
  • In certain embodiments, the delivery vehicle for delivering the cyclic-di-nucleotide or STING active agents can also be targeting delivery vehicles, e.g., a liposome containing one or more targeting moieties or biodistribution modifiers on the surface of the liposome. A targeting moiety can be any agent that is capable of specifically binding or interacting with a desired target.
  • The specific binding agent can be any molecule that specifically binds to a protein, peptide, biomacromolecule, cell, tissue, etc. that is being targeted (e.g., a protein peptide, biomacromolecule, cell, tissue, etc. wherein the cyclic-di-nucleotide or STING active agent exerts its desired effect). Depending on the nature of the target site, the specific binding agent can be, but is not limited to, an antibody against an epitope of a peptidic analyte, or any recognition molecule, such as a member of a specific binding pair. For example, suitable specific binding pairs include, but are not limited to: a member of a receptor/ligand pair; a ligand-binding portion of a receptor; a member of an antibody/antigen pair; an antigen-binding fragment of an antibody; a hapten; a member of a lectin/carbohydrate pair; a member of an enzyme/substrate pair; biotin/avidin; biotin/streptavidin; digoxin/antidigoxin; a member of a peptide aptamer binding pair; and the like.
  • In certain embodiments, the specific binding moiety includes an antibody. An antibody as defined here may include fragments of antibodies which retain specific binding to antigen, including, but not limited to, Fab, Fv, scFv, and Fd fragments, chimeric antibodies, humanized antibodies, single-chain antibodies, and fusion proteins comprising an antigen-binding portion of an antibody and a non-antibody protein. The antibodies may also include Fab′, Fv, F(ab′)2, and or other antibody fragments that retain specific binding to antigen.
  • In certain embodiments, the targeting moiety is a binding agent that specifically interacts with a molecule expressed on a tumor cell or an immune cell (e.g., CD4, CD8, CD69, CD62L, and the like), such that the targeting delivery vehicle containing the cyclic-di-nucleotide or STING active agents is delivered to the site of a tumor or to specific immune cells.
  • Where desired, any combinations of the above listed delivery vehicles may be used advantageously to enhance delivery of the cyclic-di-nucleotide or STING active agents to the target cells.
  • Components of the pharmaceutical composition can be supplied either separately or mixed together in unit dosage form, for example, as a dry lyophilized powder or water free concentrate. Where the composition is to be administered by infusion, it can be dispensed with an infusion bottle containing sterile pharmaceutical grade water or saline. Where the composition is administered by injection, an ample of sterile water for injection or saline can be provided so that the ingredients may be mixed prior to administration.
  • In some embodiments, the pharmaceutical composition is supplied as a dry sterilized lyophilized powder that is capable of being reconstituted to the appropriate concentration for administration to a subject. In some embodiments, the pharmaceutical composition is supplied as a water free concentrate. In some embodiments, the pharmaceutical composition is supplied as a dry sterile lyophilized powder at a unit dosage of at least 0.5 mg, at least 1 mg, at least 2 mg, at least 3 mg, at least 5 mg, at least 10 mg, at least 15 mg, at least 25 mg, at least 30 mg, at least 35 mg, at least 45 mg, at least 50 mg, at least 60 mg, or at least 75 mg.
  • Solutions, suspensions and powders for reconstitutable delivery systems include vehicles such as suspending agents (e.g., gums, xanthans, cellulosics and sugars), humectants (e.g., sorbitol), solubilizers (e.g., ethanol, water, PEG and propylene glycol), surfactants (e.g., sodium lauryl sulfate, Spans, Tweens, and cetyl pyridine), preservatives and antioxidants (e.g., parabens, vitamins E and C, and ascorbic acid), anti-caking agents, coating agents, and chelating agents (e.g., EDTA).
  • In some embodiments, the pharmaceutical composition is formulated as a salt form. Pharmaceutically acceptable salts include those formed with anions such as those derived from hydrochloric, phosphoric, acetic, oxalic, tartaric acids, etc., and those formed with cations such as those derived from sodium, potassium, ammonium, calcium, ferric hydroxides, isopropylamine, triethylamine, 2-ethylamino ethanol, histidine, procaine, etc.
  • In certain embodiments, the pharmaceutical composition contains a prodrug derivative of any of the cyclic-di-nucleotide or STING active agents provided herein. Such prodrugs can be subsequently converted to an active form of the cyclic-di-nucleotide or STING active agent in the body of the subject administered the pharmaceutical composition.
  • Kits
  • Kits with unit doses of the subject cyclic-di-nucleotide active agents, e.g., one or more cyclic-di-nucleotides, e.g., in oral or injectable doses, are provided. In the subject kits, the one or more components are present in the same or different containers, as may be convenient or desirable.
  • In addition to the containers containing the unit doses will be instructions describing the use and attendant benefits of the cyclic-di-nucleotide in treating a pathological condition of interest. Instructions may be provided in a variety of different formats. In certain embodiments, the instructions may include complete protocols for practicing the subject methods or means for obtaining the same (e.g., a website URL directing the user to a webpage which provides the instructions), where these instructions may be printed on a substrate, where substrate may be one or more of: a package insert, the packaging, reagent containers and the like.
  • The following examples are put forth so as to provide those of ordinary skill in the art with a complete disclosure and description of how to make and use the present invention, and are not intended to limit the scope of what the inventors regard as their invention nor are they intended to represent that the experiments below are all or the only experiments performed. Efforts have been made to ensure accuracy with respect to numbers used (e.g., amounts, temperature, etc.) but some experimental errors and deviations should be accounted for. Unless indicated otherwise, parts are parts by weight, molecular weight is weight average molecular weight, temperature is in degrees Centigrade, and pressure is at or near atmospheric.
  • EXPERIMENTAL I. Results and Discussion
  • Recognition of pathogen-derived nucleic acid is a major mechanism by which innate immune responses are initiated in mammals (Barbalat et al., Annu Rev Immunol (2011) 29: 185). Several families of germ-line encoded nucleic acid sensors have been described, including the Toll-like receptors (TLRs) and RIG-1-like receptors (RLRs)(Palm et al., Immunol Rev (2009) 227: 221; Takeuchi et al., Cell (2010) 140: 805). Upon binding nucleic acids, these sensors initiate signaling cascades that lead to the production of cytokines and other immune effector proteins that provide host defense.
  • The cytosolic presence of foreign double-stranded (ds) DNA triggers a potent antiviral response dominated by the production of type I interferons (IFNs) (Ishii et al., Nat. Immunol. (2006) 7: 40; Stetson et al., Immunity (2006) 24: 93). However, the molecular mechanism linking dsDNA to interferon production has not been well characterized (Burdette & Vance, Nat. Immunol. (2013) 14: 19). A host protein, STING, was identified and shown to be required for the IFN response to cytosolic dsDNA (Ishikawa & Barber, Nature (2008) 455: 674; Ishikawa et al., Nature (2009) 461: 788; Sun et al., Proc Natl Acad Sci USA (2009) 106: 8653; and Zhong et al., Immunity (2008) 29: 538). STING was also shown to be required for the interferon response to bacterially-derived second messengers called cyclic-di-nucleotides (CDNs)(Jin et al., J Immunol (2011) 187: 2595; and Sauer et al., Infect Immun (2011) 79: 688). CDNs are secreted or released into the cytosol by certain bacterial pathogens (Woodward et al., Science (2010) 328: 1703) and bind directly to STING (Burdette et al., Nature (2011) 478: 515). Interestingly, however, a mutant (R231A) allele of mouse STING was identified that abolished responsiveness to CDNs but did not appreciably affect the interferon response to cytosolic DNA (Id). In contrast, 293T cells expressing wild-type mouse STING are responsive to CDNs but not to dsDNA. Thus, although the IFN responses to cytosolic CDNs and dsDNA both require STING, the responses to these chemically distinct ligands can be genetically uncoupled.
  • Based on two studies (Sun, et al., Science (2013) 339: 786; and Wu et al., Science (2013) 339: 826), it was proposed that the cytosolic presence of dsDNA leads to the production of a CDN, cyclic-GMP-AMP (cGAMP), by a DNA-dependent sensor called cGAMP synthase (cGAS). cGAMP was shown to bind and activate STING. However, it remained unclear how the STING R231A mutant could still initiate responses to dsDNA despite lacking responsiveness to CDNs. Therefore, the mechanism by which cGAS activates STING was investigated.
  • Previous studies (Sauer et al., Burdette et al.) focused primarily on mouse STING and it was not yet clear whether human STING could respond to CDNs (Conlon et al., J Immunol, (2013) 190: 5216). As previously reported (Sun et al., Wu et al.) it was found that the human THP-1 cell line responded robustly to CDNs in a manner dependent on STING (FIG. 1A, B). hSTING was cloned from THP-1 cells and compared its amino acid sequence to the previously widely studied reference allele (NP938023.1; denoted here as hSTINGREF) (7) (FIG. 2). It was found that hSTINGREF and hSTINGTHP-1 differ at four amino acid positions. Notably, hSTINGREF encodes a histidine (H) at amino acid position 232, whereas hSTINGTHP-1 encodes an arginine (R) at this position, which corresponds to R231 in mSTING that is critical for responsiveness to CDNs. Therefore, the functionality of individual hSTING alleles were tested by expressing these alleles in 293T cells that lack endogenous STING (Burdette et al.). As previously observed (Burdette et al.), overexpression of mSTING in 293T cells is sufficient to induce ligand-independent activation of an IFN-luciferase reporter construct; however, transfection of 293T cells with lower amounts of mSTING renders the cells responsive to CDNs. Likewise, 293T cells expressing hSTINGTHP-1 were responsive to CDN stimulation. In contrast, cells expressing hSTINGREF were poorly or non-responsive (FIG. 1C). Interestingly, it was observed that three recent crystal structures of STING bound to cyclic-di-GMP were of the poorly-responsive hSTINGREF protein (Huang, et al., Nature Struct. & Mol. Biol. (2012) 19: 728; Ouyang et al., Immunity (2012) 36: 1073; Yin et al., Mol Cell (2012) 46: 735).
  • 293T cells are not responsive to stimulation by dsDNA, presumably due to lack of expression of cGAS (Sun et al.) or perhaps other DNA sensors. Therefore, to test whether the hSTING variants could respond to DNA stimulation, STING-null (‘goldenticket’)(Sauer et al.), but (cGAS+) macrophages were transduced with hSTING expression vectors. Interestingly, even the hSTINGREF variant that is non-responsive to CDNs conferred responsiveness to dsDNA (FIG. 1D). hSTINGREF therefore phenocopies the R231A mutant of mouse STING, previously described that uncouples responsiveness to CDNs and dsDNA (Burdette et al.). Like the mSTINGR231A variant, hSTINGREF still bound to CDNs (FIG. 1E) (Huang et al., Ouyang et al., and Yin et al.), indicating that this allele is compromised at a step downstream of CDN binding.
  • Consistent with the above results with hSTING alleles, an R231H mutant of mSTING was poorly responsive to CDNs, as were R232A or R232H variants of hSTINGTHP (FIG. 3A). It was therefore concluded that arginine 231/232 is critical for responsiveness to CDNs in mouse/human STING. Introduction of an H232R mutation in hSTINGREF, however was not sufficient to restore the responsiveness to CDNs; indeed, it was observed that a second substitution (G230A) was also required (FIG. 4). Again, all the variant STING alleles that were tested bound cyclic-di-GMP, consistent with the fact that residues 230 and 232 are located in loops that cover but do not form the CDN binding pocket (FIG. 3B) (Burdette & Vance).
  • Importantly, mSTINGR231A was also non-responsive to chemically synthesized cGAMP (FIG. 1F) (Kellenberger, et al., J Am Chem. Soc. (2013). 135:4906). This raised the question of whether R231A/R232H variants of STING would be responsive to the cGAS enzyme that is believed to activate STING via production of cGAMP. It was found that human or mouse cGAS expression was sufficient to robustly activate hSTINGREF and mSTINGR231A variants, even at very low levels of cGAS expression (FIG. 5A). Several explanations were considered for this result. One explanation is that the response is due simply to overexpression of the synthase in mammalian cells; however, overexpression of a bacterial enzyme that produces cGAMP (DncV from V. cholerae) (Davies, Cell (2012)149: 358) did not activate hSTINGREF or mSTINGR231A but did activate wild-type mSTING and hSTINGTHP-1 (FIG. 5B). An alternative hypothesis is that cGAS might physically interact with STING and thereby activate STING in a manner independent of cGAMP production. However, this explanation also appears to be incorrect. As previously demonstrated (Sun et al.), overexpression of catalytically dead mutants of human or mouse cGAS failed to activate STING (GS>AA; FIG. 2A), arguing that cGAS signaling depends on the production of a second messenger rather than on a direct physical interaction with STING. To confirm this interpretation, the enzymatic product of cGAS was produced by providing ATP, GTP and dsDNA to purified recombinant cGAS in vitro. As a negative control, dsDNA (required to stimulate cGAS activity) was omitted from a parallel reaction. The resulting cGAS products were then purified and transfected into 293T cells expressing STING variants. In contrast to synthetic cGAMP, the cGAS product was able to activate hSTINGREF and mSTINGR231A (FIG. 5C). This experiment ruled out a model in which cGAS activates hSTINGREF via a direct physical interaction.
  • It was therefore hypothesized that the actual product of cGAS might not be a canonical CDN as previously proposed (Sun et al., Wu et al.). It was hypothesized that cGAS might produce a novel CDN containing 2′-5′ phosphodiester bond(s) that would be able to stimulate variant STING alleles. Importantly, such a non-canonical CDN would be of an identical mass to the canonical 3′-5′ phosphodiester-linked CDNs and the two products would not, therefore, have been easy to distinguish by previously published mass spectrometric analyses of the cGAS product (Sun et al., Wu et al.) To test this hypothesis radiolabelled α32P-GTP or α32P-ATP were provided to recombinant purified cGAS or V. cholerae DncV and the products were analyzed by thin-layer chromatography. As reported previously, DncV produced some c-di-AMP if provided only ATP, and some c-di-GMP if provided only GTP, but preferred to make cGAMP when provided both ATP and GTP (Davies, et al., Cell (2012)149: 358). (FIG. 6A). Interestingly, cGAS required both ATP and GTP substrates and the resulting product migratessignificantly differently than any of the canonical CDNs produced by DncV,
  • suggesting that cGAS produces a novel non-canonical CDN (FIG. 6A).
  • cGAS and DncV products were analyzed by specific nuclease digestion. The cGAS product was partially cleaved by nuclease P1, which selectively digests 3′-5′ phosphodiester linkages, suggesting that the cGAS product contains at least one 3′-5′ phosphodiester linkage (FIG. 6B). However, nuclease P1 digestion was incomplete as it did not lead to generation of GMP, in contrast to treatment of the cGAS product with snake venom phosphodiesterase, which cleaved both 2′-5′ and 3′-5′ phosphodiester linkages (FIG. 3B). This suggests that the cGAS product contains a 2′-5′ phosphodiester linkage.
  • CDNs have been proposed to be useful as vaccine adjuvants or immunotherapeutics (Chen, et al., Vaccine (2010) 28:3080). A synthetic STING activator, DMXAA, has been tested in human clinical trials as a novel chemotherapeutic agent. Unfortunately, DMXAA was not found to be efficacious in humans, likely because it is unable to stimulate hSTING (Conlon et al.). In this context, our results are significant as they indicate that non-canonical 2′-5′ linked CDNs function as potent pan-agonists of diverse STING variants, including those variants that are only poorly responsive to canonical CDNs or DMXAA.
  • II. Materials and Methods A. Mice and Cell Lines
  • THP-1 cells were grown in RPMI 1640 supplemented with 10% FBS, penicillin-streptomycin and L-glutamine. HEK293T cells were grown in DMEM supplemented with 10% FBS, penicillin-streptomycin and L-glutamine. Gp2 retroviral packaging cell lines were maintained in DMEM supplemented with 10% FBS, penicillin-streptomycin and L-glutamine. Animal protocols were approved by the University of California, Berkeley Animal Care and Use Committee.
  • B. STING Knockdown
  • Knockdown of human STING (clone ID NM198282.1-90151c1) was achieved using pLKO.1 (The RNAi Consortium). The sequence for knockdown of human STING is 5′-GCA GAG CTA TTT CCT TCC ACA (SEQ ID NO:07) which correspond to 5′-CCG GGC AGA GCT ATT TCC TTC CAC ACT CGA GTG TGG AAG GAA ATA GCT CTG CTT TTT G (SEQ ID NO:08) forward oligo and 5′-AAT TCA AAA AGC AGA GCT ATT TCC TTC CAC ACT CGA GTG TGG AAG GAA ATA GCT CTG C (SEQ ID NO:09) reverse oligo. Oligos were annealed and cloned into Agel and EcoRI digested pLKO.1 (Addgene) and retrovirally transduced into THP-1 cells in parallel with scramble shRNA control constructs. Stable cell lines were selected with puromycin. THP-1 cells were differentiated with 1 μg/mL PMA for 24 hours. Cells were allowed to rest for 24 hours and then restimulated for 6 hours with the indicated ligands. IFN induction was measured by qRT-PCR as described below.
  • C. Cell Stimulation and Reagents
  • Bone marrow macrophages and HEK293T cells were stimulated using Lipofectamine 2000 (Invitrogen). Unless otherwise specified, cyclic-di-GMP, cyclic-di-AMP, polyl:C and Vaccinia Virus 70 mer DNA was prepared as described previously (Burdette et al.) and used at similar concentrations. Sendai virus was purchased from Charles River Laboratories. cGAMP was synthesized as previously described (Kellenberger et al).
  • D. Cloning, Mutagenesis and Plasmids
  • The THP-1 STING allele was amplified from cDNA using 5′ hSTING HindIII(5′-ATCGAA GCT TCC ACC ATG CCC CAC TCC AGC CTG) (SEQ ID NO:10) and 3′ hSTING NotI (5′-ATC GGC GGC CGC TCA GGC ATA GTC AGG CAC GTC ATA AGG ATA AGA GAA ATC CGT GCG GAG AG) (SEQ ID NO:11). Resulting PCR product was cloned into pCDNA3 using HindIII/NotI digestion. THP-1 STING was amplified and cloned into MSCV2.2 using the 3′ primer listed above and 5′ hSTING XhoI (5′-ATC GCT CGA GCC ACC ATG CCC CAC TCC AGC CTG) (SEQ ID NO:12) and XhoI/NotI digestion. IFN-luciferase, TK-Renilla and mouse STING plasmids were used as previously described (Burdette et al.). Mutations in human STING were introduced using Quikchange Site Directed Mutagenesis Kit (Stratagene). cDNA clones corresponding to mouse and human cGAS (MGC Fully Sequenced Human MB21D1 cDNA, Accession: BC108714.1, Clone ID: 6015929; EST Fully Sequenced Mouse E330016A19Rik cDNA, Accession: BC145653.1, Clone ID: 40130956) were obtained from Open Biosystems and correspond to those described previously (Sun et al., Wu et al.). Mouse cGAS was amplified from cDNA clones with an N-terminal flag tag with forward oligo 5′-mcGAS-KpnI (5′-ATC GGG TAC CCC ACC ATG GAT TAC AAG GAT GAC GAT GAC AAG GAA GAT CCG CGT AGA AGG) (SEQ ID NO:13) and reverse oligo 3′-mcGAS-NotI (5′-ATC GGC GGC CGC TCA AAG CTT GTC AAA AAT TGG) (SEQ ID NO:14). Likewise, hcGAS was amplified with forward oligo 5′-hcGAS-flag-KpnI (5′-ATC GGG TAC CCC ACC ATG GAT TAC AAG GAT GAC GAT GAC AAG CAG CCT TGG CAC GGA AAG G) (SEQ ID NO:15) and reverse 3′-hcGAS-NotI (5′ATC GGC GGC CGC TCA AAA TTC ATC AAA AAC TGG AAA C) (SEQ ID NO:16). Both PCR products were cloned into pCDNA3 at KpnI and NotI restriction enzyme sites. DncV was amplified using DncV fwd BamHI (5′-GCA TGG ATC CGC CAC CAT GAC TTG GAA CTT TCA CCA G) (SEQ ID NO:17) and DncV rev NotI (5′-GCA TGC GGC CGC TCA GCC ACT TAC CAT TGT GCT GC) (SEQ ID NO:18) and cloned into pCDNA3 using BamHI and NotI. For cloning into MSCV2.2, DncV was amplified using DncV fwd XhoI (5′-GCA TCT CGA GCC ACC ATG ACT TGG AAC TTT CAC CAG) (SEQ ID NO:19) and DncV rev NotI. Resulting DNA was cloned into MSCV 2.2 digested with XhoI/NotI. Constructs for bacterial mcGAS overexpression were constructed as follows. N terminal His6-SUMO tag amplified by PCR using His6 SUMO Nco (5′-TAA TAA GGA GAT ATA CCA TGG GCA GCA GCC) (SEQ ID NO:20) and His6 SUMO Sal (5′-GAA TTC GTC GAC ACC AAT CTG TTC TCT GTG AGC) (SEQ ID NO:21) off of pCDF-Duet2 template (gift from M. Rape lab, UC-Berkeley) and cloned into pET28a using NcoI and SalI to make pET28a-H6SUMO. Full length mcGAS was PCR amplified from the mouse cDNA clone described above using mcGAS fwd Sal (5′-GAT GTC GAC ATG GAA GAT CCG CGT AGA AGG ACG) (SEQ ID NO:22) and mcGAS rev Xho (5′-ATC CTC GAG TCA AAG CTT GTC AAA AAT TGG AAA CC) (SEQ ID NO:23) and cloned into pET28a-H6SUMO using SalI and XhoI to make pET28a-H6SUMO-mcGAS that expresses full length mcGAS fused to an N-terminal His6 SUMO tag.
  • E. Protein Purifications
  • WspR construct (pQE-WspR*) was a generous gift from Steve Lory (Harvard). WspR purification and c-di-GMP synthesis reactions were carried out as previously described (Merighi, et al., Mol Microbiol (2007)65: 876). Overexpression strains and plasmids for DncV and mutant DncV were provided by J. Mekalanos. DncV protein was overexpressed and purified as previously described (Davies et al.). Briefly, DncV protein production was induced in mid-log phase for 3 h at 37° C. with 1 mM IPTG. Cells were lysed and DncV protein was purified under denaturing conditions. Cleared lysate was incubated with Ni-NTA and eluted in Urea Elution buffer (2M Urea, 10 mM Tris pH=8.0, 150 mM NaCl, 250 mM Imidazole). Eluted protein was dialyzed to 25 mM Tris-Cl, pH=7.5, 300 mM NaCl, 5 mM Mg(OAc)2, 10% glycerol, 2 mM DTT. H6SUMO-mcGAS was expressed in Rosetta(DE3) pLysS cells by overnight induction with 0.5 mM IPTG at 18° C. Cells were lysed into 50 mM Tris-Cl, pH=8, 300 mM NaCl, 20 mM Imidazole, 5 mM BME and 0.2 mM PMSF by French Press. Cleared lysate was incubated with Ni-NTA and bound protein was eluted with 20 mM Tris-Cl, pH=7.4, 150 mM NaCl, 300 mM Imidazole. Eluant was dialyzed to 20 mM Tris-Cl, pH=7.4, 150 mM NaCl, 5 mM β-mercaptoethanol with 10% glycerol. Protein was flash frozen and stored at −80° C.
  • F. cGAS Product Purification and Structural Characterization
  • The cGAS product was purified using reverse-phase HPLC on an Agilent 1260 Infinity HPLC equipped with an Agilent Polaris C18-A column (5 μm, 250 mm×10 mm, 180 Å). Purification conditions include a 100% to 0% gradient of solvent A over 20 min at 50° C. and a flow rate of 5 mL/min, where solvent A is 100 mM ammonium acetate in water and solvent B is acetonitrile. Purified elution fractions were evaporated multiple times in order to remove excess ammonia. Resonance assignments were made using COSY, 1H-13C HSQC, NOESY, 1H-13C HMBC, and 1H-31P HMBC. Characterization of cGAS product: 1H NMR (900 MHz, D2O, 50° C., δ): 8.44 (1H, s), 8.42 (1H, s), 8.03 (1H, s), 6.31 (1H, s), 6.09 (1H, J=8 Hz, d), 5.75 (1H, m), 5.18 (1H, m), 4.93 (1H, s), 4.74, 4.62, 4.59 (1H, J=12 Hz, d), 4.55 (1H, s), 4.38 (1H, m), 4.33 (1H, J=12 Hz, d), 4.28 (1H, J=12 Hz, d); 31P {1H decoupled} NMR (600 MHz, D20, 50° C., δ): (all resonances are singlets)-0.96, −1.86; HRMS (m/z): [M-H]-monoisotopic mass calculated for C20H24N10O13P2, 673.0927. found, 673.0909. [M+Na 2H]-monoisotopic mass calculated for C20H24N10O13P2, 695.0752. found, 695.0728.
  • G. Luciferase Assay
  • HEK293T cells were plated in TC-treated 96-well plates at 0.5%°-%106% cells°/0 ml-1. The next day, the cells were transfected with indicated constructs, together with IFN-β-firefly luciferase and TKRenilla luciferase reporter constructs. Following stimulation for 6% h with the indicated ligands, the cells were lysed in passive lysis buffer (Promega) for 5% min at 25° C. The cell lysates were incubated with firefly luciferase substrate (Biosynth) and the Renilla luciferase substrate coelenterazine (Biotium), and luminescence was measured on a SpectraMax L microplate reader (Molecular Devices). The relative lfnb expression was calculated as firefly luminescence relative to Renilla luminescence.
  • H. In Vitro Cyclic-Di-Nucleotide Synthesis
  • In vitro DncV reactions were carried out in 20 mM Tris-Cl, pH=8, 20 Mg(OAc)2, 10% glycerol and 1 mM DTT, 0.1 mg/mL BSA. Reactions contained 250 μM GTP, 250 μM ATP or 125 μM GTP and 125 μM ATP as indicated in figures. In addition, 33 nM α32P-GTP (3000Ci/mmol, Perkin-Elmer) or 33 nM α32P-ATP (3000Ci/mmol, Perkin-Elmer) was included in reaction where indicated. Reactions were started by addition of 1 μM purified DncV protein. In vitro cGAS reactions were carried out in 40 mM Tris-Cl, pH=7.5, 100 mM NaCl, 10 mM MgCl2. Cold nucleotide and alpha-labeled GTP is at the same concentrations as in DncV reactions. Reactions were started by addition of 200 nM purified cGAS. Where indicated, herring testes DNA (Sigma) was added to reactions at a final concentration of 0.1 mg/mL. WspR reactions were performed as described previously (14). Reactions were incubated for 1 hour at 37° C., boiled for 5 min at 95° C., and spun for 10 minutes at 13,000 rpm. Reactions were removed and mixed 1:5 with TLC running buffer (1:1.5 (v/v) saturated NH4SO4 and 1.5M KH2PO4, pH 3.6) and spotted on PEIcellulose TLC plate (Sigma). Following solvent migration, the TLC plate was exposed to a phosphorimager screen and imaged using Typhoon scanner. For in vitro product transfection into 293T cells, reactions were scaled up, radiolabeled nucleotide was omitted and the concentration of ATP and GTP was increased to 2 mM.
  • I. Nuclease Digests
  • Nuclease P1 from Penicillium citrinum and Snake venom phosphodiesterase I from Crotalus_adamanteus were purchased from Sigma. Reactions from in vitro cyclic-di-nucleotide synthesis labeled with α32P-GTP were diluted 1:5 in either P1 buffer (40 mM Tris-Cl, pH=6, 2 mM ZnCl2) or SVPD buffer (40 mM Tris-Cl, pH=8, mM MgCl2) followed by digestion with 2.5mU of nuclease P1 or SVPD, respectively. Digestions were incubated for 45 minutes at 37° C. and nucleotide products were resolved by TLC.
  • J. NMR Data
  • In the 1H-31P HMBC spectrum shown in FIG. 6C, the phosphorous nucleus, P-11, is correlated to the 2′ ribose proton (H-12) of guanosine as well as to the 5′ ribose methylene protons (H-10) and the 4′ ribose proton (H-9) of adenosine. The other phosphorous nucleus (P-22) is correlated to the 3′ ribose proton (H-8) of adenosine as well as to the 5′ ribose methylene protons (H-21) and 4′ ribose proton (H-20) of guanosine. Thus, the regiochemistry of the phosphodiester linkages was determined to be cyclic[G(2′-5′)pA(3′-5′)p]. In order to assign the above peaks, it was critical to accurately identify the ribose spin systems corresponding to guanosine and adenosine, respectively. The protons corresponding to the adenine nucleobase (H-2, H-5) and guanine nucleobase (H-17) were assigned based upon reference spectra for the individual nucleobases, 1H-13C HMBC, and 1H-13C HSQC NMR (FIG. 7A and 7B). The 1H-1H NOESY experiment showed through-space interactions_between the adenine proton H-5 and the 3′ ribose proton (H-8) as well as between the guanine proton H-17 and the 1′ ribose proton (H-18) (FIG. 7D). The remaining protons in the corresponding ribose spin systems were identified by 1H-1H COSY (FIG. 7C), and multiplicity edited 1H-13C HSQC (FIGS. 7A and 7B), which distinguished the 5′ methylene protons in particular (H-10 and H-21).
  • K. RNA, cDNA Synthesis, and Quantitative RT-PCR
  • RNA from mammalian cell lines was extracted using Trizol reagent (Invitrogen) or RNeasy Mini Kit (Qiagen). RNA was treated with RQ1 RNase-free DNase (Promega). RNA was reverse transcribed with Superscript III (Invitrogen). Mouse ifnB was quantified relative to mouse rps17 as described previously (Woodward et al). Human ifnB was quantified relative to human S9 as described previously (Wu et al).
  • The preceding merely illustrates the principles of the invention. It will be appreciated that those skilled in the art will be able to devise various arrangements which, although not explicitly described or shown herein, embody the principles of the invention and are included within its spirit and scope. Furthermore, all examples and conditional language recited herein are principally intended to aid the reader in understanding the principles of the invention and the concepts contributed by the inventors to furthering the art, and are to be construed as being without limitation to such specifically recited examples and conditions. Moreover, all statements herein reciting principles, aspects, and embodiments of the invention as well as specific examples thereof, are intended to encompass both structural and functional equivalents thereof. Additionally, it is intended that such equivalents include both currently known equivalents and equivalents developed in the future, i.e., any elements developed that perform the same function, regardless of structure. The scope of the present invention, therefore, is not intended to be limited to the exemplary embodiments shown and described herein. Rather, the scope and spirit of the present invention is embodied by the appended claims.
  • All publications and patent applications cited in this specification are herein incorporated by reference as if each individual publication or patent application were specifically and individually indicated to be incorporated by reference. The citation of any publication is for its disclosure prior to the filing date and should not be construed as an admission that the present invention is not entitled to antedate such publication by virtue of prior invention.

Claims (25)

1. A method for increasing the production of a type I interferon (IFN) in a cell, the method comprising:
increasing the level of a 2′-5′ phosphodiester linkage comprising cyclic-di-nucleotide in the cell in a manner sufficient to increase production of the type I interferon (IFN) by the cell.
2. The method according to claim 1, wherein the method comprises contacting the cell with the cyclic-di-nucleotide.
3. The method according to claim 1, wherein the cyclic-di-nucleotide comprises a two 2′-5′ phosphodiester linkage.
4. The method according to claim 3, wherein the cyclic-di-nucleotide comprises a 2′5′ phosphodiester linkage and a 3′-5′ phosphodiester linkage.
5. The method according to claim 1, wherein the cyclic-di-nucleotide comprises a guanosine nucleoside.
6. The method according to claim 5, wherein the cyclic-di-nucleotide comprises two guanosine nucleosides.
7. The method according to claim 1, wherein the cyclic-di-nucleotide comprises an adenosine nucleoside.
8. The method according to claim 7, wherein the cyclic-di-nucleotide comprises two adenosine nucleosides.
9. The method according to claim 1, wherein the cyclic-di-nucleotide comprises an adenosine nucleoside and a guanosine nucleoside.
10. The method according to claim 1, wherein the cyclic-di-nucleotide is described by the formula:
Figure US20140329889A1-20141106-C00030
wherein X and Y are each:
Figure US20140329889A1-20141106-C00031
11. The method according to claim 10, wherein the cyclic-di-nucleotide is described by the formula:
Figure US20140329889A1-20141106-C00032
12. The method according to claim 1, wherein the cyclic-di-nucleotide is described by the formula:
Figure US20140329889A1-20141106-C00033
wherein X and Y are each:
Figure US20140329889A1-20141106-C00034
13. The method according to claim 1, wherein the level of the cyclic-di-nucleotide is increased by increasing the activity of a cGAMP synthase (cGAS) in the cell.
14-15. (canceled)
16. The method according to claim 1, wherein the IFN is interferon alpha.
17. The method according to claim 1, wherein the IFN is interferon beta.
18. The method according to claim 1, wherein the cell is a mammalian cell.
19. The method according to claim 18, wherein the mammalian cell is a human cell.
20-21. (canceled)
22. A method for increasing the production of a type I interferon (IFN) in a subject, the method comprising:
administering to the subject an amount of a 2′-5′ phosphodiester linkage comprising cyclic-di-nucleotide active agent effective to increase the production of the type I interferon in the subject.
23-42. (canceled)
43. A cyclic-di-nucleotide comprising a 2′-5′ phosphodiester linkage.
44-64. (canceled)
65. A method for increasing a stimulator of interferon genes (STING) mediated response in a subject, the method comprising:
administering to the subject an amount of a STING active agent effective to increase a STING
66-86. (canceled)
US14/268,967 2013-05-03 2014-05-02 Cyclic di-nucleotide induction of type i interferon Abandoned US20140329889A1 (en)

Priority Applications (3)

Application Number Priority Date Filing Date Title
US14/268,967 US20140329889A1 (en) 2013-05-03 2014-05-02 Cyclic di-nucleotide induction of type i interferon
US16/279,950 US20190292216A1 (en) 2013-05-03 2019-02-19 Cyclic Di-Nucleotide Induction of Type I Interferon
US17/464,494 US11873319B2 (en) 2013-05-03 2021-09-01 Cyclic di-nucleotide induction of type I interferon

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201361819499P 2013-05-03 2013-05-03
US14/268,967 US20140329889A1 (en) 2013-05-03 2014-05-02 Cyclic di-nucleotide induction of type i interferon

Related Child Applications (1)

Application Number Title Priority Date Filing Date
US16/279,950 Continuation US20190292216A1 (en) 2013-05-03 2019-02-19 Cyclic Di-Nucleotide Induction of Type I Interferon

Publications (1)

Publication Number Publication Date
US20140329889A1 true US20140329889A1 (en) 2014-11-06

Family

ID=51841746

Family Applications (3)

Application Number Title Priority Date Filing Date
US14/268,967 Abandoned US20140329889A1 (en) 2013-05-03 2014-05-02 Cyclic di-nucleotide induction of type i interferon
US16/279,950 Abandoned US20190292216A1 (en) 2013-05-03 2019-02-19 Cyclic Di-Nucleotide Induction of Type I Interferon
US17/464,494 Active 2034-12-29 US11873319B2 (en) 2013-05-03 2021-09-01 Cyclic di-nucleotide induction of type I interferon

Family Applications After (2)

Application Number Title Priority Date Filing Date
US16/279,950 Abandoned US20190292216A1 (en) 2013-05-03 2019-02-19 Cyclic Di-Nucleotide Induction of Type I Interferon
US17/464,494 Active 2034-12-29 US11873319B2 (en) 2013-05-03 2021-09-01 Cyclic di-nucleotide induction of type I interferon

Country Status (6)

Country Link
US (3) US20140329889A1 (en)
EP (1) EP2992000B1 (en)
JP (3) JP2016518140A (en)
CN (1) CN105377867B (en)
ES (1) ES2822584T3 (en)
WO (1) WO2014179760A1 (en)

Cited By (61)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2016096174A1 (en) 2014-12-16 2016-06-23 Invivogen Fluorinated cyclic dinucleotides for cytokine induction
WO2016096577A1 (en) * 2014-12-16 2016-06-23 Invivogen Combined use of a chemotherapeutic agent and a cyclic dinucleotide for cancer treatment
US9549944B2 (en) 2013-05-18 2017-01-24 Aduro Biotech, Inc. Compositions and methods for inhibiting “stimulator of interferon gene”—dependent signalling
WO2017062838A1 (en) 2015-10-07 2017-04-13 Nant Holdings Ip, Llc Activation of immune-related signalling pathways in cells via optofection
WO2017075477A1 (en) * 2015-10-28 2017-05-04 Aduro Biotech, Inc. Compositions and methods for activating "stimulator of interferon gene"-dependent signalling
WO2017106740A1 (en) * 2015-12-16 2017-06-22 Aduro Biotech, Inc. Methods for identifying inhibitors of "stimulator of interferon gene"-dependent interferon production
US9695212B2 (en) 2012-12-13 2017-07-04 Aduro Biotech, Inc. Compositions comprising cyclic purine dinucleotides having defined stereochemistries and methods for their preparation and use
US9718848B2 (en) 2015-12-03 2017-08-01 Glaxosmithkline Intellectual Property Development Limited Compounds
US9724408B2 (en) 2013-05-18 2017-08-08 Aduro Biotech, Inc. Compositions and methods for activating stimulator of interferon gene-dependent signalling
WO2017161349A1 (en) * 2016-03-18 2017-09-21 Immune Sensor, Llc Cyclic di-nucleotide compounds and methods of use
US9770467B2 (en) 2012-06-08 2017-09-26 Aduro Biotech, Inc. Compositions and methods for cancer immunotherapy
US9809597B2 (en) 2015-08-20 2017-11-07 The Board Of Trustees Of The Leland Stanford Junior University Ganciclovir derivatives for modulating innate and adaptive immunity and for use in immunotherapy
US9840533B2 (en) 2013-04-29 2017-12-12 Memorial Sloan Kettering Cancer Center Compositions and methods for altering second messenger signaling
WO2018009652A1 (en) * 2016-07-06 2018-01-11 Sperovie Biosciences, Inc. Compounds, compositions, and methods for the treatment of disease
WO2018009648A1 (en) * 2016-07-06 2018-01-11 Sperovie Biosciences, Inc. Compounds, compositions, and methods for the treatment of disease
WO2018060323A1 (en) 2016-09-30 2018-04-05 Boehringer Ingelheim International Gmbh Cyclic dinucleotide compounds
WO2018065360A1 (en) 2016-10-07 2018-04-12 Biolog Life Science Institute Forschungslabor Und Biochemica-Vertrieb Gmbh Cyclic dinucleotides containing benzimidazole, method for the production of same, and use of same to activate stimulator of interferon genes (sting)-dependent signaling pathways
WO2018119325A1 (en) * 2016-12-22 2018-06-28 Mavupharma, Inc. Compositions and methods of enhancing or augmenting type i ifn production
US10047115B2 (en) 2015-01-29 2018-08-14 Glaxosmithkline Intellectual Property Development Limited Cyclic dinucleotides useful for the treatment of inter alia cancer
WO2018152450A1 (en) 2017-02-17 2018-08-23 Eisai R&D Management Co., Ltd. Cyclic di-nucleotides compounds for the treatment of cancer
US20180243387A1 (en) * 2017-02-17 2018-08-30 Riken Technology for controlling immune cells
WO2018172206A1 (en) 2017-03-22 2018-09-27 Boehringer Ingelheim International Gmbh Modified cyclic dinucleotide compounds
US10106574B2 (en) 2015-08-13 2018-10-23 Merck Sharp & Dohme Corp. Cyclic di-nucleotide compounds as sting agonists
EP3233089A4 (en) * 2014-12-17 2018-11-14 Lipogen LLC Method of treating cancer with cgamp or cgasmp
US10176292B2 (en) 2013-07-31 2019-01-08 Memorial Sloan-Kettering Cancer Center STING crystals and modulators
US10336786B2 (en) 2012-12-19 2019-07-02 Board Of Regents, The University Of Texas System Pharmaceutical targeting of a mammalian cyclic di-nucleotide signaling pathway
WO2019161171A1 (en) * 2018-02-16 2019-08-22 Sperovie Biosciences, Inc. Nanoparticle formulations of sting agonists
US10414747B2 (en) 2016-10-04 2019-09-17 Merck Sharp & Dohme Corp. Benzo[b]thiophene compounds as sting agonists
US10413612B2 (en) 2016-08-30 2019-09-17 Dana-Farber Cancer Institute, Inc. Method of treating cancer with a biomaterial and a toll-like receptor agonist
WO2019185477A1 (en) 2018-03-27 2019-10-03 Boehringer Ingelheim International Gmbh Cyclic dinucleotide compounds containing 2-aza-hypoxanthine or 6h-pytazolo[1,5-d][1,2,4]triazin-7-one as sting agonists
WO2019185476A1 (en) 2018-03-27 2019-10-03 Boehringer Ingelheim International Gmbh Modified cyclic dinucleotide compounds
US10450341B2 (en) 2014-06-04 2019-10-22 Glaxosmithkline Intellectual Property Development Limited Cyclic di-nucleotides as modulators of STING
WO2019222500A1 (en) * 2018-05-17 2019-11-21 The Regents Of The University Of California Methods of modulating activity of a cyclic dinucleotide (cdn) with a cdn transporter-modulating agent
WO2019232392A1 (en) 2018-06-01 2019-12-05 Eisai R&D Management Co., Ltd. Methods for the treatment of bladder cancer
WO2020006038A1 (en) * 2018-06-29 2020-01-02 Dana-Farber Cancer Institute, Inc. Structure of the human cgas-dna complex and uses thereof
WO2020092379A1 (en) 2018-10-29 2020-05-07 Genocea Biosciences, Inc. Treatment methods
CN111655281A (en) * 2018-01-26 2020-09-11 加利福尼亚大学董事会 Intranasal delivery of cyclic dinucleotide adjuvanted vaccines for tuberculosis
US10793557B2 (en) 2018-04-03 2020-10-06 Merck Sharp & Dohme Corp. Sting agonist compounds
US10859566B2 (en) 2017-03-20 2020-12-08 Genocea Biosciences, Inc. Treatment methods
US10881730B2 (en) 2017-02-01 2021-01-05 Modernatx, Inc. Immunomodulatory therapeutic MRNA compositions encoding activating oncogene mutation peptides
US20210017541A1 (en) * 2018-03-26 2021-01-21 University Of Miami Recombinant viral vector and uses thereof
WO2021041532A1 (en) 2019-08-26 2021-03-04 Dana-Farber Cancer Institute, Inc. Use of heparin to promote type 1 interferon signaling
EA037513B1 (en) * 2016-09-17 2021-04-06 ИММЬЮН СЕНСОР, ЭлЭлСи Cyclic dinucleotide compounds and methods of use thereof
CN113265435A (en) * 2021-06-16 2021-08-17 中国农业科学院兰州兽医研究所 Preparation method of bacterial second messenger molecule cyclic dinucleotide
WO2021184017A1 (en) 2020-03-13 2021-09-16 Codiak Biosciences, Inc. Extracellular vesicles for treating neurological disorders
US11149052B2 (en) * 2018-04-06 2021-10-19 Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. 2′3′-cyclic dinucleotides
US11285131B2 (en) 2017-08-04 2022-03-29 Merck Sharp & Dohme Corp. Benzo[b]thiophene STING agonists for cancer treatment
US11312772B2 (en) 2017-08-04 2022-04-26 Merck Sharp & Dohme Corp. Combinations of PD-1 antagonists and benzo [b] thiophene STING agonists for cancer treatment
CN114765953A (en) * 2019-10-07 2022-07-19 总医院公司 Lung surfactant-biomimetic nanoparticle compositions and methods
US11453697B1 (en) 2015-08-13 2022-09-27 Merck Sharp & Dohme Llc Cyclic di-nucleotide compounds as sting agonists
US11466047B2 (en) 2017-05-12 2022-10-11 Merck Sharp & Dohme Llc Cyclic di-nucleotide compounds as sting agonists
WO2022245634A1 (en) * 2021-05-20 2022-11-24 Shielded. Beauty, Llc Antimicrobial skincare composition and treatment
US11584774B2 (en) 2017-09-11 2023-02-21 F-star Therapeutics, Inc. Compounds, compositions, and methods for the treatment of disease
US11685761B2 (en) 2017-12-20 2023-06-27 Merck Sharp & Dohme Llc Cyclic di-nucleotide compounds as sting agonists
US11691990B2 (en) 2018-08-16 2023-07-04 Eisai R&D Management Co., Ltd Salts of compounds and crystals thereof
US11702430B2 (en) 2018-04-03 2023-07-18 Merck Sharp & Dohme Llc Aza-benzothiophene compounds as STING agonists
US11707531B2 (en) 2017-09-11 2023-07-25 F-star Therapeutics, Inc. Compounds, compositions, and methods for the treatment of disease
US11874276B2 (en) 2018-04-05 2024-01-16 Dana-Farber Cancer Institute, Inc. STING levels as a biomarker for cancer immunotherapy
US11873319B2 (en) 2013-05-03 2024-01-16 The Regents Of The University Of California Cyclic di-nucleotide induction of type I interferon
WO2024036275A1 (en) * 2022-08-10 2024-02-15 Aldevron Llc Methods for producing cyclic dinucleotides
US12291548B2 (en) 2018-07-10 2025-05-06 Sperovie Biosciences, Inc. Compounds, compositions, and methods for the treatment of disease

Families Citing this family (87)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JO3746B1 (en) 2015-03-10 2021-01-31 Aduro Biotech Inc Compositions and methods for activating “stimulator of interferon gene”-dependent signalling
CN106692967A (en) * 2015-08-12 2017-05-24 聊城市奥润生物医药科技有限公司 Application of cyclic dinucleotide cGAMP combined PD1 antibody (Nivolumab) in preparation of antitumor drugs
CN106540255A (en) * 2015-09-18 2017-03-29 聊城市奥润生物医药科技有限公司 Ring dinucleotide cGAMP combines application of the Avastin in antitumor
CN106539812B (en) * 2015-11-18 2019-12-03 杭州星鳌生物科技有限公司 Application of cyclic dinucleotide cGAMP in anti-hepatic metastasis of colorectal cancer
CN106539813B (en) * 2015-11-30 2019-12-03 杭州星鳌生物科技有限公司 Anti-inflammation application of interferon-stimulated gene (STING) activator
CN106539814A (en) * 2015-12-09 2017-03-29 聊城市奥润生物医药科技有限公司 Interferon gene stimulatory protein(SP)(STING)Application of the agonist in the diseases such as resisting rheumatoid arthritis
CN106540260A (en) * 2015-12-09 2017-03-29 聊城市奥润生物医药科技有限公司 Interferon gene stimulatory protein(SP)(STING)Application of the agonist in anti-alzheimer's disease
CN106539811B (en) * 2016-01-16 2019-12-20 杭州星鳌生物科技有限公司 Application of cyclic dinucleotide cGAMP in preventing and treating complications induced by antineoplastic drugs or reducing toxic and side effects induced by chemotherapeutic drugs
CN106539815B (en) * 2016-01-21 2019-12-03 杭州星鳌生物科技有限公司 Application of Cyclic Dinucleotides in Prevention and Treatment of Multiple Sclerosis
CN106539757A (en) * 2016-03-20 2017-03-29 聊城市奥润生物医药科技有限公司 Application of the ring dinucleotide cGAMP- liposomees in antitumor
CN106540256A (en) * 2016-03-27 2017-03-29 聊城市奥润生物医药科技有限公司 Ring dinucleotide-application of the liposome conjugated monoclonal antibodies in antitumor
CN105969754A (en) * 2016-04-29 2016-09-28 山东省农业科学院畜牧兽医研究所 Improved nucleotide cyclase and applications thereof
US10696985B1 (en) 2016-06-06 2020-06-30 Vanderbilt University Reversibly crosslinked endosomolytic polymer vesicles for cytosolic drug delivery
CN106552265A (en) * 2016-06-21 2017-04-05 聊城市奥润生物医药科技有限公司 STING agonist and application of the IDO1 inhibitor drug combinations in antitumor
EP3507367A4 (en) 2016-07-05 2020-03-25 Aduro BioTech, Inc. Locked nucleic acid cyclic dinucleotide compounds and uses thereof
NL2017270B1 (en) 2016-08-02 2018-02-09 Aduro Biotech Holdings Europe B V New anti-hCTLA-4 antibodies
FI3526323T3 (en) 2016-10-14 2023-06-06 Prec Biosciences Inc Engineered meganucleases specific for recognition sequences in the hepatitis b virus genome
PT3512861T (en) 2016-12-01 2021-04-29 Takeda Pharmaceuticals Co Cyclic dinucleotides as sting (stimulator of inteferon genes) agonists
MX2019007256A (en) * 2016-12-22 2019-11-18 Mavupharma Inc Phosphodiesterase inhibitors and methods of microbial treatment.
US11492367B2 (en) * 2017-01-27 2022-11-08 Janssen Biotech, Inc. Cyclic dinucleotides as sting agonists
CN106727331B (en) * 2017-03-13 2022-02-01 杭州星鳌生物科技有限公司 Composition of immunoliposome-cycloddinucleotide, preparation method and application of immunoliposome-cycloducleotide in resisting tumor
CN106667914B (en) * 2017-03-13 2022-02-01 杭州星鳌生物科技有限公司 Composition of targeted liposome-cyclic dinucleotide, preparation method and application of targeted liposome-cyclic dinucleotide in resisting tumors
WO2018190719A2 (en) 2017-04-13 2018-10-18 Aduro Biotech Holdings, Europe B.V. Anti-sirp alpha antibodies
KR102808275B1 (en) 2017-04-14 2025-05-20 탈락 테라퓨틱스, 인크. Immunomodulatory polynucleotides, antibody conjugates thereof, and methods of use thereof
KR20240151869A (en) 2017-09-08 2024-10-18 더 보드 어브 트러스티스 어브 더 리랜드 스탠포드 주니어 유니버시티 Enpp1 inhibitors and their use for the treatment of cancer
CN107619438B (en) * 2017-10-11 2021-12-03 广州云启科技有限公司 Novel cyclic dinucleotide receptor and method and kit for screening agonist or inhibitor thereof
CN109694397B (en) * 2017-10-23 2021-08-31 上海弘翊生物科技有限公司 Cyclic dinucleotide compounds, preparation method and application thereof
MX2020004858A (en) 2017-11-10 2020-10-01 Takeda Pharmaceuticals Co Sting modulator compounds, and methods of making and using.
KR102492187B1 (en) 2017-12-20 2023-01-27 인스티튜트 오브 오가닉 케미스트리 앤드 바이오케미스트리 에이에스 씨알 브이.브이.아이. 3'3' cyclic dinucleotides with phosphonate linkages that activate STING adapter proteins
JP7098748B2 (en) 2017-12-20 2022-07-11 インスティチュート オブ オーガニック ケミストリー アンド バイオケミストリー エーエスシーアール,ヴイ.ヴイ.アイ. 2'3'cyclic dinucleotide with phosphonate binding that activates the STING adapter protein
KR102526964B1 (en) 2018-02-26 2023-04-28 길리애드 사이언시즈, 인코포레이티드 Substituted pyrrolizine compounds as HBV replication inhibitors
WO2019183578A1 (en) 2018-03-23 2019-09-26 Codiak Biosciences, Inc. Extracellular vesicles comprising sting-agonist
US10870691B2 (en) 2018-04-05 2020-12-22 Gilead Sciences, Inc. Antibodies and fragments thereof that bind hepatitis B virus protein X
TWI833744B (en) 2018-04-06 2024-03-01 捷克科學院有機化學與生物化學研究所 3'3'-cyclic dinucleotides
TW202005654A (en) 2018-04-06 2020-02-01 捷克科學院有機化學與生物化學研究所 2'2'-cyclic dinucleotides
TW201945388A (en) 2018-04-12 2019-12-01 美商精密生物科學公司 Optimized engineered meganucleases having specificity for a recognition sequence in the hepatitis B virus genome
CN108310378A (en) * 2018-04-28 2018-07-24 杭州星鳌生物科技有限公司 The preparation and its application of a kind of conjuncted antitumor original new drug of novel immune
US20190359645A1 (en) 2018-05-03 2019-11-28 Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. 2'3'-cyclic dinucleotides comprising carbocyclic nucleotide
WO2020028097A1 (en) 2018-08-01 2020-02-06 Gilead Sciences, Inc. Solid forms of (r)-11-(methoxymethyl)-12-(3-methoxypropoxy)-3,3-dimethyl-8-0x0-2,3,8,13b-tetrahydro-1h-pyrido[2,1-a]pyrrolo[1,2-c] phthalazine-7-c arboxylic acid
WO2020041720A1 (en) 2018-08-24 2020-02-27 Codiak Biosciences, Inc. Extracellular vesicles targeting dendritic cells and uses thereof
WO2020057546A1 (en) 2018-09-21 2020-03-26 上海迪诺医药科技有限公司 Cyclic dinucleotide analogue, pharmaceutical composition thereof, and application
US12508233B2 (en) 2018-10-30 2025-12-30 Vanderbilt University Graft copolymers, methods of forming graft copolymers, and methods of use thereof
PE20211655A1 (en) 2018-10-31 2021-08-24 Gilead Sciences Inc 6-AZABENZIMIDAZOLE COMPOUNDS SUBSTITUTED AS HPK1 INHIBITORS
WO2020092528A1 (en) 2018-10-31 2020-05-07 Gilead Sciences, Inc. Substituted 6-azabenzimidazole compounds having hpk1 inhibitory activity
JP7251838B2 (en) * 2019-03-01 2023-04-04 ヤマサ醤油株式会社 Practical Enzymatic Synthesis of 3',3'-cGAMP
WO2020178768A1 (en) 2019-03-07 2020-09-10 Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. 3'3'-cyclic dinucleotide analogue comprising a cyclopentanyl modified nucleotide as sting modulator
CN113543851B (en) 2019-03-07 2025-03-18 捷克共和国有机化学与生物化学研究所 2'3'-Cyclic dinucleotides and prodrugs thereof
WO2020178770A1 (en) 2019-03-07 2020-09-10 Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. 3'3'-cyclic dinucleotides and prodrugs thereof
US12502427B2 (en) 2019-03-21 2025-12-23 Lonza Sales Ag Extracellular vesicles for vaccine delivery
CA3133314A1 (en) 2019-03-21 2020-09-24 Codiak Biosciences, Inc. Extracellular vesicle conjugates and uses thereof
TW202210480A (en) 2019-04-17 2022-03-16 美商基利科學股份有限公司 Solid forms of a toll-like receptor modulator
TW202212339A (en) 2019-04-17 2022-04-01 美商基利科學股份有限公司 Solid forms of a toll-like receptor modulator
AU2020267486B2 (en) 2019-05-09 2025-12-18 Aligos Therapeutics, Inc. Modified cyclic dinucleoside compounds as STING modulators
TWI826690B (en) 2019-05-23 2023-12-21 美商基利科學股份有限公司 Substituted eneoxindoles and uses thereof
AU2020301161B2 (en) 2019-06-25 2023-10-26 Gilead Sciences, Inc. FLT3L-Fc fusion proteins and methods of use
US20220251200A1 (en) 2019-07-03 2022-08-11 Codiak Biosciences, Inc. Extracellular vesicles targeting t cells and uses thereof
WO2021034804A1 (en) 2019-08-19 2021-02-25 Gilead Sciences, Inc. Pharmaceutical formulations of tenofovir alafenamide
EP3785719A1 (en) * 2019-08-28 2021-03-03 Helmholtz-Zentrum für Infektionsforschung GmbH New use of cyclic dinucleotides
US12616712B2 (en) 2019-09-25 2026-05-05 Lonza Sales Ag Sting agonist comprising exosomes for treating neuroimmunological disorders
JP2022549328A (en) 2019-09-25 2022-11-24 コディアック バイオサイエンシーズ, インコーポレイテッド extracellular vesicle composition
WO2021062290A1 (en) 2019-09-25 2021-04-01 Codiak Biosciences, Inc. Methods of producing extracellular vesicles
KR20220094221A (en) 2019-09-25 2022-07-05 코디악 바이오사이언시즈, 인크. Exosomes with STING agonists in combination with IL-12 displaying exosomes for the treatment of tumors
EP4458975A3 (en) 2019-09-30 2025-02-12 Gilead Sciences, Inc. Hbv vaccines and methods treating hbv
ES3022990T3 (en) 2019-12-06 2025-05-29 Prec Biosciences Inc Optimized engineered meganucleases having specificity for a recognition sequence in the hepatitis b virus genome
US11920136B2 (en) 2020-02-28 2024-03-05 Tallac Therapeutics, Inc. Transglutaminase-mediated conjugation
CA3169348A1 (en) 2020-03-20 2021-09-23 Gilead Sciences, Inc. Prodrugs of 4'-c-substituted-2-halo-2'-deoxyadenosine nucleosides and methods of making and using the same
JP2023518414A (en) 2020-03-20 2023-05-01 コディアック バイオサイエンシーズ, インコーポレイテッド Extracellular vesicles for therapy
WO2021237100A1 (en) 2020-05-21 2021-11-25 Codiak Biosciences, Inc. Methods of targeting extracellular vesicles to lung
ES3054072T3 (en) 2020-08-07 2026-01-29 Gilead Sciences Inc Prodrugs of phosphonamide nucleotide analogues and their pharmaceutical use
BR112023004271A2 (en) 2020-09-08 2023-04-04 Univ Texas MULTIPURPOSE STING ACTIVATION COMPOSITIONS AND THEIR USES
WO2022066883A1 (en) 2020-09-23 2022-03-31 Codiak Biosciences, Inc. Extracellular vesicles comprising kras antigens and uses thereof
US20240082389A1 (en) 2020-09-23 2024-03-14 Lonza Sales Ag Methods of producing extracellular vesicles
MX2023005381A (en) 2020-11-09 2023-05-23 Takeda Pharmaceuticals Co Antibody drug conjugates.
US20240076666A1 (en) * 2021-02-12 2024-03-07 The Regents Of The University Of California Immunomodulators Targeting MORC3 for Interferon Induction
AU2022274607A1 (en) 2021-05-13 2023-11-16 Gilead Sciences, Inc. COMBINATION OF A TLR8 MODULATING COMPOUND AND ANTI-HBV siRNA THERAPEUTICS
TW202313094A (en) 2021-05-18 2023-04-01 美商基利科學股份有限公司 Methods of using flt3l-fc fusion proteins
WO2022271659A1 (en) 2021-06-23 2022-12-29 Gilead Sciences, Inc. Diacylglyercol kinase modulating compounds
WO2022271650A1 (en) 2021-06-23 2022-12-29 Gilead Sciences, Inc. Diacylglyercol kinase modulating compounds
EP4359415A1 (en) 2021-06-23 2024-05-01 Gilead Sciences, Inc. Diacylglyercol kinase modulating compounds
US11932634B2 (en) 2021-06-23 2024-03-19 Gilead Sciences, Inc. Diacylglycerol kinase modulating compounds
WO2023056468A1 (en) 2021-09-30 2023-04-06 Codiak Biosciences, Inc. Extracellular vesicle comprising cholesterol tagged sting-agonist
CN117224686A (en) * 2023-10-12 2023-12-15 上海市肺科医院(上海市职业病防治院) Application of TAK1 inhibitors in the preparation of drugs for the treatment of STING-related autoimmune diseases
WO2025240244A1 (en) 2024-05-13 2025-11-20 Gilead Sciences, Inc. Combination therapies comprising bulevirtide and lonafarnib for use in the treatment of hepatitis d virus infection
WO2025240243A1 (en) 2024-05-13 2025-11-20 Gilead Sciences, Inc. Combination therapies with bulevirtide and an inhibitory nucleic acid targeting hepatitis b virus
WO2025240242A1 (en) 2024-05-13 2025-11-20 Gilead Sciences, Inc. Combination therapies with ribavirin
WO2025240246A1 (en) 2024-05-13 2025-11-20 Gilead Sciences, Inc. Combination therapies with ribavirin
WO2026027944A1 (en) 2024-07-30 2026-02-05 Sairopa B.V. Anti-sirp alpha antibody formulations and uses thereof

Citations (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US7592326B2 (en) * 2004-03-15 2009-09-22 Karaolis David K R Method for stimulating the immune, inflammatory or neuroprotective response
US8283328B2 (en) * 2002-08-19 2012-10-09 Coley Pharmaceutical Group, Inc. Immunostimulatory nucleic acids
US8367716B2 (en) * 2003-07-28 2013-02-05 Karaolis David K R Method for attentuating virulence of microbial pathogens and for inhibiting microbial biofilm formation
US9090646B2 (en) * 2012-12-05 2015-07-28 Rutgers, The State University Of New Jersey Biotinylated compounds
US9549944B2 (en) * 2013-05-18 2017-01-24 Aduro Biotech, Inc. Compositions and methods for inhibiting “stimulator of interferon gene”—dependent signalling

Family Cites Families (72)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5013556A (en) 1989-10-20 1991-05-07 Liposome Technology, Inc. Liposomes with enhanced circulation time
CA2103705C (en) 1991-02-11 1996-01-30 Ayub K. Ommaya Spinal fluid driven artificial organ
US5222982A (en) 1991-02-11 1993-06-29 Ommaya Ayub K Spinal fluid driven artificial organ
GB9110808D0 (en) 1991-05-17 1991-07-10 Retroscreen Ltd Aids vaccine and method for its production
GB2257704B (en) 1991-07-18 1995-03-01 Erba Carlo Spa Cyclic oligonucleotides phosphorothioates
US5637483A (en) 1991-10-04 1997-06-10 Whitehead Institute For Biomedical Research Irradiated tumor cell vaccine engineered to express GM-CSF
US5904920A (en) 1991-10-04 1999-05-18 Whitehead Institute For Biomedical Research Regulation of systemic immune responses utilizing cytokines and antigens
IT1262895B (en) 1992-03-02 1996-07-22 Protein extracted from cytotoxic strains of Helicobacter pylori, gene expressing it, use of the protein as a vaccine or for diagnostic purposes.
US5635160A (en) 1995-06-07 1997-06-03 The University Of North Carolina At Chapel Hill Dinucleotides useful for the treatment of cystic fibrosis and for hydrating mucus secretions
US6033674A (en) 1995-12-28 2000-03-07 Johns Hopkins University School Of Medicine Method of treating cancer with a tumor cell line having modified cytokine expression
US6277368B1 (en) 1996-07-25 2001-08-21 The Regents Of The University Of California Cancer immunotherapy using autologous tumor cells combined with cells expressing a membrane cytokine
CA2318372C (en) 1998-02-02 2008-08-19 Johns Hopkins University School Of Medicine A universal immunomodulatory cytokine-expressing bystander cell line and related compositions and methods of manufacture and use
ATE238039T1 (en) 1998-09-16 2003-05-15 Alza Corp TOPOISOMERASE INHIBITORS ENCLOSED IN LIPOSOMES
CN1194002C (en) * 1999-02-15 2005-03-23 日本新药株式会社 Shortened-chain polynucleotide and process for the preparation thereof
US6558670B1 (en) 1999-04-19 2003-05-06 Smithkline Beechman Biologicals S.A. Vaccine adjuvants
EP1189611B1 (en) 1999-06-14 2006-05-03 Cancer Research Technology Limited Cancer therapy
MXPA02001857A (en) 1999-08-24 2003-07-14 Cellgate Inc COMPOSITIONS AND METHODS TO INCREASE DRUG DELIVERY THROUGH AND WITHIN EPITHELIAL FABRICS.
US7229961B2 (en) 1999-08-24 2007-06-12 Cellgate, Inc. Compositions and methods for enhancing drug delivery across and into ocular tissues
US7256286B2 (en) 1999-11-30 2007-08-14 The Board Of Trustees Of The Leland Stanford Junior University Bryostatin analogues, synthetic methods and uses
AU2001290860A1 (en) 2000-09-21 2002-04-02 The Regents Of The University Of California Spas-1 cancer antigen
US7279883B2 (en) 2001-01-23 2007-10-09 Lydia L. Sohn Particle analyzer and methods for use thereof
MXPA03007358A (en) 2001-02-16 2004-12-13 Cellgate Inc Transporters comprising spaced arginine moieties.
TW200303759A (en) 2001-11-27 2003-09-16 Schering Corp Methods for treating cancer
US20050281783A1 (en) 2003-10-15 2005-12-22 Kinch Michael S Listeria-based EphA2 vaccines
KR20060123170A (en) 2003-10-24 2006-12-01 알자 코포레이션 Method of producing lipid particles
JP4931798B2 (en) 2004-03-15 2012-05-16 ケイ.アール. カラオリス,デイヴィッド Methods for immune, inflammatory or neuroprotective responses
CA2821167C (en) 2004-05-03 2016-06-28 Merrimack Pharmaceuticals, Inc. Drug delivery liposomes containing anionic polyols or anionic sugars
US8658203B2 (en) 2004-05-03 2014-02-25 Merrimack Pharmaceuticals, Inc. Liposomes useful for drug delivery to the brain
US8187571B1 (en) 2004-10-05 2012-05-29 Gp Medical, Inc. Pharmaceutical composition of nanoparticles
CA2607579A1 (en) 2005-05-06 2006-11-23 The Regents Of The University Of California Microfluidic system for identifying or sizing individual particles passing through a channel
US20070059683A1 (en) 2005-09-15 2007-03-15 Tom Barber Veterinary diagnostic system
EP1782826A1 (en) 2005-11-08 2007-05-09 GBF Gesellschaft für Biotechnologische Forschung mbH PQS and c-diGMP and its conjugates as adjuvants and their uses in pharmaceutical compositions
EP3000480A1 (en) 2005-12-01 2016-03-30 ProNAi Therapeutics, Inc. Cancer therapies and pharmaceutical compositions used therein
PL2019683T5 (en) 2006-04-25 2022-12-05 The Regents Of The University Of California Administration of growth factors for the treatment of cns disorders
AU2007292302A1 (en) 2006-09-05 2008-03-13 Bipar Sciences, Inc. Methods for designing PARP inhibitors and uses thereof
US20080081064A1 (en) 2006-09-28 2008-04-03 Surmodics, Inc. Implantable Medical Device with Apertures for Delivery of Bioactive Agents
EP2205268B1 (en) * 2007-06-15 2012-08-15 HI-STEM Heidelberg Institute for Stem Cell Technology and Experimental Medicine gemeinnützige GmbH Interferon alpha sequential regimen for treating cancers
WO2009097468A2 (en) 2008-01-29 2009-08-06 Kliman Gilbert H Drug delivery devices, kits and methods therefor
WO2009133560A1 (en) 2008-04-29 2009-11-05 Smart Assays Non-hydrolyzable and permeable cyclic bis-[nucleotide monophosphate] derivatives and uses thereof
WO2010017248A2 (en) 2008-08-04 2010-02-11 University Of Miami Sting (stimulator of interferon genes), a regulator of innate immune responses
US8840881B2 (en) 2008-08-28 2014-09-23 Aduro Gvax Inc. Methods and compositions for treating prostate cancer or inducing a humoral immune response against prostate cancer
WO2010067262A1 (en) 2008-12-09 2010-06-17 Pfizer Inc. Immunostimulatory oligonucleotides
WO2010104883A1 (en) 2009-03-09 2010-09-16 Molecular Express, Inc. Methods and compositions for liposomal formulation of antigens and uses thereof
US8414630B2 (en) 2009-03-10 2013-04-09 Marc Evan Richelsoph Active bone screw
SI2437753T1 (en) 2009-06-05 2016-12-30 Infectious Disease Research Institute Synthetic glucopyranosyl lipid adjuvants and vaccine compositions containing them
US20120178710A1 (en) 2009-07-01 2012-07-12 Rutgers, The State University Of New Jersey Synthesis of cyclic diguanosine monophosphate and thiophosphate analogs thereof
GB0914287D0 (en) 2009-08-14 2009-09-30 Pci Biotech As Compositions
US8771933B2 (en) 2009-10-06 2014-07-08 Massachusetts Institute Of Technology Continuous-flow deformability-based cell separation
US20120064505A1 (en) 2010-03-22 2012-03-15 Massachusetts Institute Of Technology Measurement of material properties and related methods and compositions
BR112012027745A2 (en) 2010-04-27 2017-01-10 Univ Johns Hopkins method and immunogenic composition for treatment of neoplasia
US8450293B2 (en) 2010-08-10 2013-05-28 Rutgers, The State University Of New Jersey Synthesis and characterization of C8 analogs of c-di-GMP
SI2640842T1 (en) 2010-11-17 2018-09-28 Aduro Biotech, Inc. Methods and compositions for inducing an immune response to egfrviii
US9061048B2 (en) * 2010-12-15 2015-06-23 The Regents Of The University Of California Cyclic di-AMP induction of type I interferon
EP2655392B1 (en) 2010-12-22 2018-04-18 Alios Biopharma, Inc. Cyclic nucleotide analogs
US9880084B2 (en) 2011-04-15 2018-01-30 The University Of British Columbia Apparatus for separation of particles
CN111053918A (en) * 2011-09-05 2020-04-24 韩美科学株式会社 A kind of anticancer pharmaceutical composition comprising interferon alpha-conjugate
WO2013086331A1 (en) 2011-12-07 2013-06-13 President And Fellows Of Harvard College High efficiency di-nucleotide cyclase
JP2015516989A (en) 2012-04-30 2015-06-18 バーバー, グレン, エヌ.BARBER, Glen, N. Modulation of immune response
NZ702392A (en) 2012-06-08 2017-03-31 Aduro Biotech Compositions and methods for cancer immunotherapy
EA201590396A1 (en) * 2012-12-13 2015-12-30 Адуро Биотек, Инк. COMPOSITION CONTAINING CYCLIC PURINE DYNUCLEOTIDES WITH A SPECIFIC STEREHEMISTRY, AND THE METHOD OF ITS PREPARATION AND APPLICATION
PT2934598T (en) * 2012-12-19 2018-07-24 Univ Texas Pharmaceutical targeting of a mammalian cyclic di-nucleotide signaling pathway
ES2982836T3 (en) 2013-04-29 2024-10-17 Memorial Sloan Kettering Cancer Center Compositions and methods for altering second messenger signaling
EP2992000B1 (en) 2013-05-03 2020-07-08 The Regents of The University of California Cyclic di-nucleotide induction of type i interferon
ME03586B (en) 2013-05-18 2020-07-20 Univ California Compositions and methods for activating "stimulator of interferon gene"-dependent signalling
WO2014189806A1 (en) 2013-05-18 2014-11-27 Aduro Biotech, Inc. Compositions and methods for inhibiting "stimulator of interferon gene" dependent signalling
US10176292B2 (en) 2013-07-31 2019-01-08 Memorial Sloan-Kettering Cancer Center STING crystals and modulators
EP3060056A4 (en) 2013-10-21 2017-10-18 Drexel University Use of sting agonists to treat chronic hepatitis b virus infection
EP3071209A4 (en) 2013-11-19 2017-08-16 The University of Chicago Use of sting agonist as cancer treatment
EP3071229A4 (en) 2013-11-22 2017-05-10 Brock University Use of fluorinated cyclic dinucleotides as oral vaccine adjuvants
US10421971B2 (en) 2014-01-15 2019-09-24 The University Of Chicago Anti-tumor therapy
WO2015185565A1 (en) 2014-06-04 2015-12-10 Glaxosmithkline Intellectual Property Development Limited Cyclic di-nucleotides as modulators of sting
MX2018001814A (en) * 2015-08-13 2018-05-07 Merck Sharp & Dohme CYCLIC DINUCLEOTID COMPOUNDS AS AGONISTS OF THE INTERFERON GENE STIMULATOR.

Patent Citations (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US8283328B2 (en) * 2002-08-19 2012-10-09 Coley Pharmaceutical Group, Inc. Immunostimulatory nucleic acids
US8304396B2 (en) * 2002-08-19 2012-11-06 Coley Pharmaceutical Group, Inc. Immunostimulatory nucleic acids
US8367716B2 (en) * 2003-07-28 2013-02-05 Karaolis David K R Method for attentuating virulence of microbial pathogens and for inhibiting microbial biofilm formation
US7592326B2 (en) * 2004-03-15 2009-09-22 Karaolis David K R Method for stimulating the immune, inflammatory or neuroprotective response
US9090646B2 (en) * 2012-12-05 2015-07-28 Rutgers, The State University Of New Jersey Biotinylated compounds
US9549944B2 (en) * 2013-05-18 2017-01-24 Aduro Biotech, Inc. Compositions and methods for inhibiting “stimulator of interferon gene”—dependent signalling

Non-Patent Citations (4)

* Cited by examiner, † Cited by third party
Title
(R) Patel et al., Filing receipt plus Specification minus claims for US 61/817,269, filed April 29, 2013. *
(S) Patel et al., Filing receipt minus Specification plus claims for US 61/817,269, filed April 29, 2013. *
(T) Porter et al. (eds.), Merck Manual of Diagnosis and Therapy, 19th Ed., Chapter 124, Section 9, Whitehouse Station, NJ, 2011, only pages 1059-1062 supplied. *
(U) Venes et al. (eds.), Taber's Cyclopedic Medical Dictionary, 21st Ed., F. A. Davis Co.,Inc., Philadelphia, PA, 2009, only page 1163 supplied, see "Immunotherapy." *

Cited By (111)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US9770467B2 (en) 2012-06-08 2017-09-26 Aduro Biotech, Inc. Compositions and methods for cancer immunotherapy
US9695212B2 (en) 2012-12-13 2017-07-04 Aduro Biotech, Inc. Compositions comprising cyclic purine dinucleotides having defined stereochemistries and methods for their preparation and use
US10414789B2 (en) 2012-12-13 2019-09-17 Aduro Biotech, Inc. Compositions comprising cyclic purine dinucleotides having defined stereochemistries and methods for their preparation and use
US11492368B2 (en) 2012-12-19 2022-11-08 The Board Of Regents Of The University Of Texas System Pharmaceutical targeting of a mammalian cyclic di-nucleotide signaling pathway
US10633411B2 (en) 2012-12-19 2020-04-28 The Board Of Regents Of The University Of Texas System Pharmaceutical targeting of a mammalian cyclic di-nucleotide signaling pathway
US10508129B2 (en) 2012-12-19 2019-12-17 The Board Of Regents Of The University Of Texas System Pharmaceutical targeting of a mammalian cyclic di-nucleotide signaling pathway
US10696710B2 (en) 2012-12-19 2020-06-30 The Board Of Regents Of The University Of Texas System Pharmaceutical targeting of a mammalian cyclic di-nucleotide signaling pathway
US10336786B2 (en) 2012-12-19 2019-07-02 Board Of Regents, The University Of Texas System Pharmaceutical targeting of a mammalian cyclic di-nucleotide signaling pathway
US10131686B2 (en) 2013-04-29 2018-11-20 Memorial Sloan Kettering Cancer Center Compositions and methods for altering second messenger signaling
US11014956B2 (en) 2013-04-29 2021-05-25 Memorial Sloan Kettering Cancer Center; The Rockefeller Compositions and methods for altering second messenger signaling
US10385091B2 (en) 2013-04-29 2019-08-20 Memorial Sloan Kettering Cancer Center Compositions and methods for altering second messenger signaling
US9840533B2 (en) 2013-04-29 2017-12-12 Memorial Sloan Kettering Cancer Center Compositions and methods for altering second messenger signaling
US11873319B2 (en) 2013-05-03 2024-01-16 The Regents Of The University Of California Cyclic di-nucleotide induction of type I interferon
US9549944B2 (en) 2013-05-18 2017-01-24 Aduro Biotech, Inc. Compositions and methods for inhibiting “stimulator of interferon gene”—dependent signalling
US10653774B2 (en) 2013-05-18 2020-05-19 Aduro Biotech, Inc. Compositions and methods for activating “stimulator of interferon gene”-dependent signalling
US10189873B2 (en) 2013-05-18 2019-01-29 Aduro Biotech, Inc. Compositions and methods for inhibiting “stimulator of interferon gene”-dependent signalling
US9724408B2 (en) 2013-05-18 2017-08-08 Aduro Biotech, Inc. Compositions and methods for activating stimulator of interferon gene-dependent signalling
US10176292B2 (en) 2013-07-31 2019-01-08 Memorial Sloan-Kettering Cancer Center STING crystals and modulators
US10450341B2 (en) 2014-06-04 2019-10-22 Glaxosmithkline Intellectual Property Development Limited Cyclic di-nucleotides as modulators of STING
WO2016096174A1 (en) 2014-12-16 2016-06-23 Invivogen Fluorinated cyclic dinucleotides for cytokine induction
US10011630B2 (en) 2014-12-16 2018-07-03 Invivogen Cyclic dinucleotides for cytokine induction
EP3546473B1 (en) * 2014-12-16 2025-12-10 Kayla Therapeutics Fluorinated cyclic [(2',5')p(3',5')p]-dinucleotides for cytokine induction
WO2016096577A1 (en) * 2014-12-16 2016-06-23 Invivogen Combined use of a chemotherapeutic agent and a cyclic dinucleotide for cancer treatment
EP3546473A1 (en) 2014-12-16 2019-10-02 Kayla Therapeutics Cyclic [(2',5')p(3',5')p]-dinucleotides for cytokine induction
US11667664B2 (en) 2014-12-16 2023-06-06 Kayla Therapeutics Cyclic dinucleotides for cytokine induction
US11053272B2 (en) 2014-12-16 2021-07-06 Kayla Therapeutics Cyclic dinucleotides for cytokine induction
US10562929B2 (en) 2014-12-16 2020-02-18 Kayla Therapeutics Cyclic dinucleotides for cytokine induction
CN112626153A (en) * 2014-12-17 2021-04-09 立博美华基因科技有限责任公司 Methods of treating cancer with cGAMP or cGAsMP
EP3233089A4 (en) * 2014-12-17 2018-11-14 Lipogen LLC Method of treating cancer with cgamp or cgasmp
US10047115B2 (en) 2015-01-29 2018-08-14 Glaxosmithkline Intellectual Property Development Limited Cyclic dinucleotides useful for the treatment of inter alia cancer
US10759825B2 (en) 2015-08-13 2020-09-01 Merck Sharp & Dohme Corp. Cyclic di-nucleotide compounds as STING agonists
US11453697B1 (en) 2015-08-13 2022-09-27 Merck Sharp & Dohme Llc Cyclic di-nucleotide compounds as sting agonists
US10738074B2 (en) 2015-08-13 2020-08-11 Merck Sharp & Dohme Corp. Cyclic di-nucleotide compounds as STING agonists
US10766919B2 (en) 2015-08-13 2020-09-08 Merck Sharp & Dohme Corp. Cyclic di-nucleotide compounds as sting agonists
US10106574B2 (en) 2015-08-13 2018-10-23 Merck Sharp & Dohme Corp. Cyclic di-nucleotide compounds as sting agonists
US9809597B2 (en) 2015-08-20 2017-11-07 The Board Of Trustees Of The Leland Stanford Junior University Ganciclovir derivatives for modulating innate and adaptive immunity and for use in immunotherapy
WO2017062838A1 (en) 2015-10-07 2017-04-13 Nant Holdings Ip, Llc Activation of immune-related signalling pathways in cells via optofection
US10322177B2 (en) 2015-10-07 2019-06-18 Nant Holdings Ip, Llc Activation of immune-related signaling pathways in cells via optofection
WO2017075477A1 (en) * 2015-10-28 2017-05-04 Aduro Biotech, Inc. Compositions and methods for activating "stimulator of interferon gene"-dependent signalling
US10906930B2 (en) 2015-10-28 2021-02-02 Chinook Therapeutics, Inc. Compositions and methods for activating “stimulator of interferon gene”-dependent signalling
US9994607B2 (en) 2015-12-03 2018-06-12 Glaxosmithkline Intellectual Property Development Limited Compounds
US10364266B2 (en) 2015-12-03 2019-07-30 Glaxosmithkline Intellectual Property Development Limited Compounds
US10730907B2 (en) 2015-12-03 2020-08-04 Glaxosmithkline Intellectual Property Development Limited Compounds
US9718848B2 (en) 2015-12-03 2017-08-01 Glaxosmithkline Intellectual Property Development Limited Compounds
WO2017106740A1 (en) * 2015-12-16 2017-06-22 Aduro Biotech, Inc. Methods for identifying inhibitors of "stimulator of interferon gene"-dependent interferon production
KR20190018408A (en) * 2016-03-18 2019-02-22 이뮨 센서, 엘엘씨 Cyclic di-nucleotide compounds and methods of use
WO2017161349A1 (en) * 2016-03-18 2017-09-21 Immune Sensor, Llc Cyclic di-nucleotide compounds and methods of use
US11299512B2 (en) 2016-03-18 2022-04-12 Immunesensor Therapeutics, Inc. Cyclic di-nucleotide compounds and methods of use
CN109475570A (en) * 2016-03-18 2019-03-15 免疫传感器公司 Cyclic dinucleotide compounds and methods of use
US10519188B2 (en) 2016-03-18 2019-12-31 Immunesensor Therapeutics, Inc. Cyclic di-nucleotide compounds and methods of use
EP3692996A1 (en) * 2016-03-18 2020-08-12 Immune Sensor, LLC Cyclic di-nucleotide compounds and methods of use
KR102530488B1 (en) 2016-03-18 2023-05-08 이뮨 센서, 엘엘씨 Cyclic di-nucleotide compounds and methods of use
TWI689514B (en) * 2016-07-06 2020-04-01 美商史貝羅威生物科學有限公司 Compounds, compositions and methods for treating diseases
WO2018009648A1 (en) * 2016-07-06 2018-01-11 Sperovie Biosciences, Inc. Compounds, compositions, and methods for the treatment of disease
WO2018009652A1 (en) * 2016-07-06 2018-01-11 Sperovie Biosciences, Inc. Compounds, compositions, and methods for the treatment of disease
US11033569B2 (en) 2016-07-06 2021-06-15 Sperovie Biosciences, Inc. Compounds,Compositions, and methods for the treatment of disease
US11744845B2 (en) 2016-07-06 2023-09-05 F-star Therapeutics, Inc. Compounds,compositions, and methods for the treatment of disease
US10413612B2 (en) 2016-08-30 2019-09-17 Dana-Farber Cancer Institute, Inc. Method of treating cancer with a biomaterial and a toll-like receptor agonist
US10435469B2 (en) 2016-08-30 2019-10-08 Dana-Farber Cancer Institute, Inc. Drug delivery compositions and uses thereof
US10836826B2 (en) 2016-08-30 2020-11-17 Dana-Farber Cancer Institute, Inc. Drug delivery compositions and uses thereof
US11021539B2 (en) 2016-08-30 2021-06-01 Dana-Farber Cancer Institute, Inc. Drug delivery compositions and uses thereof
EA037513B1 (en) * 2016-09-17 2021-04-06 ИММЬЮН СЕНСОР, ЭлЭлСи Cyclic dinucleotide compounds and methods of use thereof
WO2018060323A1 (en) 2016-09-30 2018-04-05 Boehringer Ingelheim International Gmbh Cyclic dinucleotide compounds
US10703738B2 (en) 2016-10-04 2020-07-07 Merck Sharp & Dohme Corp. Benzo[b]thiophene compounds as STING agonists
US10730849B2 (en) 2016-10-04 2020-08-04 Merck Sharp & Dohme Corp. Benzo[b]thiophene compounds as STING agonists
US10414747B2 (en) 2016-10-04 2019-09-17 Merck Sharp & Dohme Corp. Benzo[b]thiophene compounds as sting agonists
WO2018065360A1 (en) 2016-10-07 2018-04-12 Biolog Life Science Institute Forschungslabor Und Biochemica-Vertrieb Gmbh Cyclic dinucleotides containing benzimidazole, method for the production of same, and use of same to activate stimulator of interferon genes (sting)-dependent signaling pathways
WO2018119325A1 (en) * 2016-12-22 2018-06-28 Mavupharma, Inc. Compositions and methods of enhancing or augmenting type i ifn production
US10881730B2 (en) 2017-02-01 2021-01-05 Modernatx, Inc. Immunomodulatory therapeutic MRNA compositions encoding activating oncogene mutation peptides
US10618930B2 (en) 2017-02-17 2020-04-14 Eisai R&D Management Co., Ltd. Compounds for the treatment of cancer
WO2018152450A1 (en) 2017-02-17 2018-08-23 Eisai R&D Management Co., Ltd. Cyclic di-nucleotides compounds for the treatment of cancer
WO2018152453A1 (en) 2017-02-17 2018-08-23 Eisai R&D Management Co., Ltd. Cyclic di-nucleotides derivative for the treatment of cancer
US20180243387A1 (en) * 2017-02-17 2018-08-30 Riken Technology for controlling immune cells
US10246480B2 (en) 2017-02-17 2019-04-02 Eisai R&D Management Co., Ltd. Compounds for the treatment of cancer
EP4008403A1 (en) 2017-02-17 2022-06-08 Eisai R&D Management Co., Ltd. Cyclic di-nucleotides compounds for the treatment of cancer
US11339188B2 (en) 2017-02-17 2022-05-24 Eisai R&D Management Co., Ltd. Compounds for the treatment of cancer
US10859566B2 (en) 2017-03-20 2020-12-08 Genocea Biosciences, Inc. Treatment methods
WO2018172206A1 (en) 2017-03-22 2018-09-27 Boehringer Ingelheim International Gmbh Modified cyclic dinucleotide compounds
US11466047B2 (en) 2017-05-12 2022-10-11 Merck Sharp & Dohme Llc Cyclic di-nucleotide compounds as sting agonists
US11285131B2 (en) 2017-08-04 2022-03-29 Merck Sharp & Dohme Corp. Benzo[b]thiophene STING agonists for cancer treatment
US11312772B2 (en) 2017-08-04 2022-04-26 Merck Sharp & Dohme Corp. Combinations of PD-1 antagonists and benzo [b] thiophene STING agonists for cancer treatment
US11707531B2 (en) 2017-09-11 2023-07-25 F-star Therapeutics, Inc. Compounds, compositions, and methods for the treatment of disease
US12390668B2 (en) 2017-09-11 2025-08-19 Invox Pharma Limited Compounds, compositions, and methods for the treatment of disease
US12187761B2 (en) 2017-09-11 2025-01-07 Invox Pharma Limited Compounds, compositions, and methods for the treatment of disease
US11584774B2 (en) 2017-09-11 2023-02-21 F-star Therapeutics, Inc. Compounds, compositions, and methods for the treatment of disease
US11685761B2 (en) 2017-12-20 2023-06-27 Merck Sharp & Dohme Llc Cyclic di-nucleotide compounds as sting agonists
CN111655281A (en) * 2018-01-26 2020-09-11 加利福尼亚大学董事会 Intranasal delivery of cyclic dinucleotide adjuvanted vaccines for tuberculosis
WO2019161171A1 (en) * 2018-02-16 2019-08-22 Sperovie Biosciences, Inc. Nanoparticle formulations of sting agonists
US20210017541A1 (en) * 2018-03-26 2021-01-21 University Of Miami Recombinant viral vector and uses thereof
WO2019185476A1 (en) 2018-03-27 2019-10-03 Boehringer Ingelheim International Gmbh Modified cyclic dinucleotide compounds
WO2019185477A1 (en) 2018-03-27 2019-10-03 Boehringer Ingelheim International Gmbh Cyclic dinucleotide compounds containing 2-aza-hypoxanthine or 6h-pytazolo[1,5-d][1,2,4]triazin-7-one as sting agonists
US10793557B2 (en) 2018-04-03 2020-10-06 Merck Sharp & Dohme Corp. Sting agonist compounds
US11702430B2 (en) 2018-04-03 2023-07-18 Merck Sharp & Dohme Llc Aza-benzothiophene compounds as STING agonists
US11874276B2 (en) 2018-04-05 2024-01-16 Dana-Farber Cancer Institute, Inc. STING levels as a biomarker for cancer immunotherapy
US11149052B2 (en) * 2018-04-06 2021-10-19 Institute Of Organic Chemistry And Biochemistry Ascr, V.V.I. 2′3′-cyclic dinucleotides
EP3794010A4 (en) * 2018-05-17 2022-03-23 The Regents of The University of California METHOD OF MODULATING THE ACTIVITY OF A CYCLIC DINUCLEOTIDE (CDN) WITH A CDN TRANSPORTER-MODULATING AGENT
WO2019222500A1 (en) * 2018-05-17 2019-11-21 The Regents Of The University Of California Methods of modulating activity of a cyclic dinucleotide (cdn) with a cdn transporter-modulating agent
WO2019232392A1 (en) 2018-06-01 2019-12-05 Eisai R&D Management Co., Ltd. Methods for the treatment of bladder cancer
US12251394B2 (en) 2018-06-01 2025-03-18 Eisai R&D Management Co., Ltd. Methods for the treatment of bladder cancer
WO2020006038A1 (en) * 2018-06-29 2020-01-02 Dana-Farber Cancer Institute, Inc. Structure of the human cgas-dna complex and uses thereof
US12146168B2 (en) 2018-06-29 2024-11-19 President And Fellows Of Harvard College Human CGAS-DNA complex and encoded protein
US12291548B2 (en) 2018-07-10 2025-05-06 Sperovie Biosciences, Inc. Compounds, compositions, and methods for the treatment of disease
US11691990B2 (en) 2018-08-16 2023-07-04 Eisai R&D Management Co., Ltd Salts of compounds and crystals thereof
WO2020092379A1 (en) 2018-10-29 2020-05-07 Genocea Biosciences, Inc. Treatment methods
WO2021041532A1 (en) 2019-08-26 2021-03-04 Dana-Farber Cancer Institute, Inc. Use of heparin to promote type 1 interferon signaling
CN114765953A (en) * 2019-10-07 2022-07-19 总医院公司 Lung surfactant-biomimetic nanoparticle compositions and methods
US20220362153A1 (en) * 2019-10-07 2022-11-17 The General Hospital Corporation Compositions and methods for pulmonary surfactant-biomimetic nanoparticles
WO2021184017A1 (en) 2020-03-13 2021-09-16 Codiak Biosciences, Inc. Extracellular vesicles for treating neurological disorders
WO2022245634A1 (en) * 2021-05-20 2022-11-24 Shielded. Beauty, Llc Antimicrobial skincare composition and treatment
CN113265435A (en) * 2021-06-16 2021-08-17 中国农业科学院兰州兽医研究所 Preparation method of bacterial second messenger molecule cyclic dinucleotide
WO2024036275A1 (en) * 2022-08-10 2024-02-15 Aldevron Llc Methods for producing cyclic dinucleotides

Also Published As

Publication number Publication date
JP2016518140A (en) 2016-06-23
WO2014179760A1 (en) 2014-11-06
EP2992000A1 (en) 2016-03-09
JP2021074025A (en) 2021-05-20
CN105377867B (en) 2019-11-12
US20220081464A1 (en) 2022-03-17
EP2992000B1 (en) 2020-07-08
US11873319B2 (en) 2024-01-16
EP2992000A4 (en) 2017-01-04
JP2019068829A (en) 2019-05-09
US20190292216A1 (en) 2019-09-26
ES2822584T3 (en) 2021-05-04
CN105377867A (en) 2016-03-02

Similar Documents

Publication Publication Date Title
US11873319B2 (en) Cyclic di-nucleotide induction of type I interferon
AU2023201482B2 (en) Cytokine conjugates for the treatment of autoimmune diseases
US10155014B2 (en) Cyclic di-AMP induction of type I interferon
AU2026203176A1 (en) Il-2 conjugates and methods of use thereof
US20230015146A1 (en) Nucleic acid products and methods of administration thereof
US20220273767A1 (en) Interleukin 10 Conjugates and Uses Thereof
EP3600342B1 (en) Method for designing rig-i ligands
US10273484B2 (en) Double-stranded RNA conjugates and their use
US20260116986A1 (en) Epo receptor agonists and antagonists
WO2023284742A1 (en) Cells modified by conjugated n-terminal glycine and uses thereof
JP2017530948A (en) Anti-tumor compositions and methods
US20210275547A1 (en) Methods of Modulating Activity of a Cyclic Dinucleotide (CDN) with a CDN Transporter-Modulating Agent
WO2021141862A1 (en) Methods of modulating sting pathway activation
RU2829811C1 (en) Interleukin 10 conjugates and applications thereof
WO2006106839A1 (en) METHOD FOR SCREENING AUXILIARY AGENT CAPABLE OF PROMOTING THE INDUCTION OF INTERFERON-α AND/OR -β (IFN-α/β) EXPRESSION

Legal Events

Date Code Title Description
AS Assignment

Owner name: THE REGENTS OF THE UNIVERSITY OF CALIFORNIA, CALIF

Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:VANCE, RUSSELL E.;HAMMOND, MING C.;BURDETTE, DARA;AND OTHERS;SIGNING DATES FROM 20140718 TO 20140722;REEL/FRAME:033604/0910

AS Assignment

Owner name: NATIONAL INSTITUTES OF HEALTH (NIH), U.S. DEPT. OF

Free format text: CONFIRMATORY LICENSE;ASSIGNOR:UNIVERSITY OF CALIFORNIA BERKELEY;REEL/FRAME:036485/0332

Effective date: 20150825

STPP Information on status: patent application and granting procedure in general

Free format text: ADVISORY ACTION MAILED

STCB Information on status: application discontinuation

Free format text: ABANDONED -- FAILURE TO RESPOND TO AN OFFICE ACTION