WO2021141862A1 - Methods of modulating sting pathway activation - Google Patents
Methods of modulating sting pathway activation Download PDFInfo
- Publication number
- WO2021141862A1 WO2021141862A1 PCT/US2021/012094 US2021012094W WO2021141862A1 WO 2021141862 A1 WO2021141862 A1 WO 2021141862A1 US 2021012094 W US2021012094 W US 2021012094W WO 2021141862 A1 WO2021141862 A1 WO 2021141862A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- cell
- sting
- cdn
- golgi
- pi4kb
- Prior art date
Links
- 238000000034 method Methods 0.000 title claims abstract description 205
- 230000037361 pathway Effects 0.000 title claims abstract description 99
- 230000004913 activation Effects 0.000 title claims abstract description 84
- 101150037787 Sting gene Proteins 0.000 title 1
- 101150060741 Sting1 gene Proteins 0.000 title 1
- 101000643024 Homo sapiens Stimulator of interferon genes protein Proteins 0.000 claims abstract description 99
- 102100035533 Stimulator of interferon genes protein Human genes 0.000 claims abstract description 99
- 101710188589 Phosphatidylinositol 4-kinase beta Proteins 0.000 claims abstract description 84
- 102100032619 Phosphatidylinositol 4-kinase beta Human genes 0.000 claims abstract description 84
- 230000000694 effects Effects 0.000 claims abstract description 59
- 239000000203 mixture Substances 0.000 claims abstract description 50
- 230000007115 recruitment Effects 0.000 claims abstract description 50
- 101000926911 Homo sapiens Golgi resident protein GCP60 Proteins 0.000 claims abstract description 48
- 102100033415 Golgi resident protein GCP60 Human genes 0.000 claims abstract description 44
- 239000003795 chemical substances by application Substances 0.000 claims description 126
- 125000004122 cyclic group Chemical group 0.000 claims description 65
- 229940044665 STING agonist Drugs 0.000 claims description 55
- 230000001965 increasing effect Effects 0.000 claims description 34
- 238000001727 in vivo Methods 0.000 claims description 21
- 230000003247 decreasing effect Effects 0.000 claims description 19
- 238000000338 in vitro Methods 0.000 claims description 19
- 102000002227 Interferon Type I Human genes 0.000 claims description 17
- 108010014726 Interferon Type I Proteins 0.000 claims description 17
- 230000002708 enhancing effect Effects 0.000 claims description 12
- 230000002401 inhibitory effect Effects 0.000 claims description 12
- 230000014567 type I interferon production Effects 0.000 claims description 5
- 230000001419 dependent effect Effects 0.000 claims description 4
- 102000006992 Interferon-alpha Human genes 0.000 claims description 3
- 108010047761 Interferon-alpha Proteins 0.000 claims description 3
- 102000003996 Interferon-beta Human genes 0.000 claims description 3
- 108090000467 Interferon-beta Proteins 0.000 claims description 3
- 229960001388 interferon-beta Drugs 0.000 claims description 3
- 102000044160 oxysterol binding protein Human genes 0.000 abstract description 47
- 108010040421 oxysterol binding protein Proteins 0.000 abstract description 47
- 206010028980 Neoplasm Diseases 0.000 abstract description 27
- 208000027866 inflammatory disease Diseases 0.000 abstract description 15
- 201000011510 cancer Diseases 0.000 abstract description 14
- 230000001225 therapeutic effect Effects 0.000 abstract description 11
- 210000004027 cell Anatomy 0.000 description 178
- 108090000623 proteins and genes Proteins 0.000 description 100
- 102000004169 proteins and genes Human genes 0.000 description 76
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 42
- 235000018102 proteins Nutrition 0.000 description 41
- 230000014509 gene expression Effects 0.000 description 37
- 150000001875 compounds Chemical class 0.000 description 36
- 201000010099 disease Diseases 0.000 description 36
- -1 lgG4 Proteins 0.000 description 35
- 239000003112 inhibitor Substances 0.000 description 34
- 239000013543 active substance Substances 0.000 description 31
- 239000013598 vector Substances 0.000 description 30
- 108090000765 processed proteins & peptides Proteins 0.000 description 28
- 230000037396 body weight Effects 0.000 description 27
- 239000008194 pharmaceutical composition Substances 0.000 description 27
- 150000007523 nucleic acids Chemical class 0.000 description 26
- 102000039446 nucleic acids Human genes 0.000 description 25
- 108020004707 nucleic acids Proteins 0.000 description 25
- 102000004196 processed proteins & peptides Human genes 0.000 description 24
- 230000027455 binding Effects 0.000 description 22
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 21
- 239000002777 nucleoside Substances 0.000 description 21
- 229920001184 polypeptide Polymers 0.000 description 21
- 238000011282 treatment Methods 0.000 description 21
- 238000004519 manufacturing process Methods 0.000 description 20
- 150000004713 phosphodiesters Chemical group 0.000 description 20
- RYYWUUFWQRZTIU-UHFFFAOYSA-K thiophosphate Chemical compound [O-]P([O-])([O-])=S RYYWUUFWQRZTIU-UHFFFAOYSA-K 0.000 description 20
- 239000012634 fragment Substances 0.000 description 19
- 239000002773 nucleotide Substances 0.000 description 19
- 150000003839 salts Chemical class 0.000 description 19
- 239000000427 antigen Substances 0.000 description 18
- 108091007433 antigens Proteins 0.000 description 18
- 102000036639 antigens Human genes 0.000 description 18
- 108010078791 Carrier Proteins Proteins 0.000 description 16
- 150000003384 small molecules Chemical class 0.000 description 16
- 108020004414 DNA Proteins 0.000 description 14
- 102000008394 Immunoglobulin Fragments Human genes 0.000 description 14
- 108010021625 Immunoglobulin Fragments Proteins 0.000 description 14
- 229910019142 PO4 Inorganic materials 0.000 description 14
- NBIIXXVUZAFLBC-UHFFFAOYSA-K phosphate Chemical compound [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 description 14
- 239000010452 phosphate Substances 0.000 description 14
- XRILCFTWUCUKJR-INFSMZHSSA-N 2'-3'-cGAMP Chemical compound C([C@H]([C@H]1O)O2)OP(O)(=O)O[C@H]3[C@@H](O)[C@H](N4C5=NC=NC(N)=C5N=C4)O[C@@H]3COP(O)(=O)O[C@H]1[C@@H]2N1C=NC2=C1NC(N)=NC2=O XRILCFTWUCUKJR-INFSMZHSSA-N 0.000 description 13
- 108020004999 messenger RNA Proteins 0.000 description 13
- OKTJSMMVPCPJKN-UHFFFAOYSA-N Carbon Chemical group [C] OKTJSMMVPCPJKN-UHFFFAOYSA-N 0.000 description 12
- DNIAPMSPPWPWGF-UHFFFAOYSA-N Propylene glycol Chemical compound CC(O)CO DNIAPMSPPWPWGF-UHFFFAOYSA-N 0.000 description 12
- 229910052799 carbon Inorganic materials 0.000 description 12
- 210000001519 tissue Anatomy 0.000 description 12
- 108091026890 Coding region Proteins 0.000 description 11
- 150000003833 nucleoside derivatives Chemical class 0.000 description 11
- 208000024891 symptom Diseases 0.000 description 11
- 102000014150 Interferons Human genes 0.000 description 10
- 108010050904 Interferons Proteins 0.000 description 10
- 241000700605 Viruses Species 0.000 description 10
- 239000000556 agonist Substances 0.000 description 10
- 239000005557 antagonist Substances 0.000 description 10
- 229940079322 interferon Drugs 0.000 description 10
- 239000000243 solution Substances 0.000 description 10
- 239000003981 vehicle Substances 0.000 description 10
- 102100031256 Cyclic GMP-AMP synthase Human genes 0.000 description 9
- 101710118064 Cyclic GMP-AMP synthase Proteins 0.000 description 9
- 102000004127 Cytokines Human genes 0.000 description 9
- 108090000695 Cytokines Proteins 0.000 description 9
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 9
- 241000124008 Mammalia Species 0.000 description 9
- 102100024267 Proton-coupled folate transporter Human genes 0.000 description 9
- 230000000692 anti-sense effect Effects 0.000 description 9
- 238000002648 combination therapy Methods 0.000 description 9
- 230000007423 decrease Effects 0.000 description 9
- 238000010362 genome editing Methods 0.000 description 9
- 239000002502 liposome Substances 0.000 description 9
- 230000001404 mediated effect Effects 0.000 description 9
- 230000004044 response Effects 0.000 description 9
- 230000011664 signaling Effects 0.000 description 9
- 230000009870 specific binding Effects 0.000 description 9
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 9
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 8
- 125000003275 alpha amino acid group Chemical group 0.000 description 8
- 230000005975 antitumor immune response Effects 0.000 description 8
- 230000008499 blood brain barrier function Effects 0.000 description 8
- 210000001218 blood-brain barrier Anatomy 0.000 description 8
- 230000009368 gene silencing by RNA Effects 0.000 description 8
- 230000028993 immune response Effects 0.000 description 8
- 230000001575 pathological effect Effects 0.000 description 8
- 102000005962 receptors Human genes 0.000 description 8
- 108020003175 receptors Proteins 0.000 description 8
- 230000032258 transport Effects 0.000 description 8
- 102000040650 (ribonucleotides)n+m Human genes 0.000 description 7
- 108700028369 Alleles Proteins 0.000 description 7
- 208000023275 Autoimmune disease Diseases 0.000 description 7
- 102000003939 Membrane transport proteins Human genes 0.000 description 7
- 108090000301 Membrane transport proteins Proteins 0.000 description 7
- 108091030071 RNAI Proteins 0.000 description 7
- 108091007566 SLC46A1 Proteins 0.000 description 7
- 108020004459 Small interfering RNA Proteins 0.000 description 7
- 235000001014 amino acid Nutrition 0.000 description 7
- 150000001413 amino acids Chemical class 0.000 description 7
- 230000001363 autoimmune Effects 0.000 description 7
- 230000001413 cellular effect Effects 0.000 description 7
- 230000001086 cytosolic effect Effects 0.000 description 7
- 239000003814 drug Substances 0.000 description 7
- 230000006870 function Effects 0.000 description 7
- 238000001415 gene therapy Methods 0.000 description 7
- 239000000463 material Substances 0.000 description 7
- 239000000546 pharmaceutical excipient Substances 0.000 description 7
- 230000001105 regulatory effect Effects 0.000 description 7
- 239000004055 small Interfering RNA Substances 0.000 description 7
- IJGRMHOSHXDMSA-UHFFFAOYSA-N Atomic nitrogen Chemical compound N#N IJGRMHOSHXDMSA-UHFFFAOYSA-N 0.000 description 6
- 238000010453 CRISPR/Cas method Methods 0.000 description 6
- IAZDPXIOMUYVGZ-UHFFFAOYSA-N Dimethylsulphoxide Chemical compound CS(C)=O IAZDPXIOMUYVGZ-UHFFFAOYSA-N 0.000 description 6
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 6
- 241001465754 Metazoa Species 0.000 description 6
- 108050009454 Reduced Folate Carrier Proteins 0.000 description 6
- 102100029753 Reduced folate transporter Human genes 0.000 description 6
- ZMANZCXQSJIPKH-UHFFFAOYSA-N Triethylamine Chemical compound CCN(CC)CC ZMANZCXQSJIPKH-UHFFFAOYSA-N 0.000 description 6
- 125000000217 alkyl group Chemical group 0.000 description 6
- 239000003153 chemical reaction reagent Substances 0.000 description 6
- 238000002512 chemotherapy Methods 0.000 description 6
- 238000011161 development Methods 0.000 description 6
- 208000035475 disorder Diseases 0.000 description 6
- 229940079593 drug Drugs 0.000 description 6
- 239000003937 drug carrier Substances 0.000 description 6
- 238000001959 radiotherapy Methods 0.000 description 6
- 230000008685 targeting Effects 0.000 description 6
- 238000013518 transcription Methods 0.000 description 6
- 230000035897 transcription Effects 0.000 description 6
- 210000004881 tumor cell Anatomy 0.000 description 6
- 241000701161 unidentified adenovirus Species 0.000 description 6
- 241000702421 Dependoparvovirus Species 0.000 description 5
- NYHBQMYGNKIUIF-UUOKFMHZSA-N Guanosine Chemical compound C1=NC=2C(=O)NC(N)=NC=2N1[C@@H]1O[C@H](CO)[C@@H](O)[C@H]1O NYHBQMYGNKIUIF-UUOKFMHZSA-N 0.000 description 5
- 241000282412 Homo Species 0.000 description 5
- 229940076838 Immune checkpoint inhibitor Drugs 0.000 description 5
- 102000017727 Immunoglobulin Variable Region Human genes 0.000 description 5
- 108010067060 Immunoglobulin Variable Region Proteins 0.000 description 5
- 102000037984 Inhibitory immune checkpoint proteins Human genes 0.000 description 5
- 108091008026 Inhibitory immune checkpoint proteins Proteins 0.000 description 5
- 241000288906 Primates Species 0.000 description 5
- 102000002689 Toll-like receptor Human genes 0.000 description 5
- 108020000411 Toll-like receptor Proteins 0.000 description 5
- OIRDTQYFTABQOQ-KQYNXXCUSA-N adenosine Chemical compound C1=NC=2C(N)=NC=NC=2N1[C@@H]1O[C@H](CO)[C@@H](O)[C@H]1O OIRDTQYFTABQOQ-KQYNXXCUSA-N 0.000 description 5
- 230000000840 anti-viral effect Effects 0.000 description 5
- 239000011230 binding agent Substances 0.000 description 5
- 239000000969 carrier Substances 0.000 description 5
- 230000016396 cytokine production Effects 0.000 description 5
- 238000012377 drug delivery Methods 0.000 description 5
- 238000009472 formulation Methods 0.000 description 5
- 239000012274 immune-checkpoint protein inhibitor Substances 0.000 description 5
- 239000012528 membrane Substances 0.000 description 5
- 230000001613 neoplastic effect Effects 0.000 description 5
- 125000003835 nucleoside group Chemical group 0.000 description 5
- 210000000056 organ Anatomy 0.000 description 5
- 230000002062 proliferating effect Effects 0.000 description 5
- 230000002829 reductive effect Effects 0.000 description 5
- 239000011780 sodium chloride Substances 0.000 description 5
- 241000894007 species Species 0.000 description 5
- 235000000346 sugar Nutrition 0.000 description 5
- YBJHBAHKTGYVGT-ZKWXMUAHSA-N (+)-Biotin Chemical compound N1C(=O)N[C@@H]2[C@H](CCCCC(=O)O)SC[C@@H]21 YBJHBAHKTGYVGT-ZKWXMUAHSA-N 0.000 description 4
- VHVPQPYKVGDNFY-DFMJLFEVSA-N 2-[(2r)-butan-2-yl]-4-[4-[4-[4-[[(2r,4s)-2-(2,4-dichlorophenyl)-2-(1,2,4-triazol-1-ylmethyl)-1,3-dioxolan-4-yl]methoxy]phenyl]piperazin-1-yl]phenyl]-1,2,4-triazol-3-one Chemical compound O=C1N([C@H](C)CC)N=CN1C1=CC=C(N2CCN(CC2)C=2C=CC(OC[C@@H]3O[C@](CN4N=CN=C4)(OC3)C=3C(=CC(Cl)=CC=3)Cl)=CC=2)C=C1 VHVPQPYKVGDNFY-DFMJLFEVSA-N 0.000 description 4
- 241000894006 Bacteria Species 0.000 description 4
- 241000283690 Bos taurus Species 0.000 description 4
- 239000002126 C01EB10 - Adenosine Substances 0.000 description 4
- 229940045513 CTLA4 antagonist Drugs 0.000 description 4
- 102000053642 Catalytic RNA Human genes 0.000 description 4
- 108090000994 Catalytic RNA Proteins 0.000 description 4
- MIKUYHXYGGJMLM-GIMIYPNGSA-N Crotonoside Natural products C1=NC2=C(N)NC(=O)N=C2N1[C@H]1O[C@@H](CO)[C@H](O)[C@@H]1O MIKUYHXYGGJMLM-GIMIYPNGSA-N 0.000 description 4
- NYHBQMYGNKIUIF-UHFFFAOYSA-N D-guanosine Natural products C1=2NC(N)=NC(=O)C=2N=CN1C1OC(CO)C(O)C1O NYHBQMYGNKIUIF-UHFFFAOYSA-N 0.000 description 4
- 241000283073 Equus caballus Species 0.000 description 4
- 108060003951 Immunoglobulin Proteins 0.000 description 4
- 201000004681 Psoriasis Diseases 0.000 description 4
- 208000027066 STING-associated vasculopathy with onset in infancy Diseases 0.000 description 4
- 102100032876 Solute carrier family 46 member 3 Human genes 0.000 description 4
- 229920002472 Starch Polymers 0.000 description 4
- 208000031981 Thrombocytopenic Idiopathic Purpura Diseases 0.000 description 4
- RJURFGZVJUQBHK-UHFFFAOYSA-N actinomycin D Natural products CC1OC(=O)C(C(C)C)N(C)C(=O)CN(C)C(=O)C2CCCN2C(=O)C(C(C)C)NC(=O)C1NC(=O)C1=C(N)C(=O)C(C)=C2OC(C(C)=CC=C3C(=O)NC4C(=O)NC(C(N5CCCC5C(=O)N(C)CC(=O)N(C)C(C(C)C)C(=O)OC4C)=O)C(C)C)=C3N=C21 RJURFGZVJUQBHK-UHFFFAOYSA-N 0.000 description 4
- 229960005305 adenosine Drugs 0.000 description 4
- 239000002671 adjuvant Substances 0.000 description 4
- 230000003321 amplification Effects 0.000 description 4
- 238000002619 cancer immunotherapy Methods 0.000 description 4
- 230000008859 change Effects 0.000 description 4
- 235000014113 dietary fatty acids Nutrition 0.000 description 4
- 210000003527 eukaryotic cell Anatomy 0.000 description 4
- 229930195729 fatty acid Natural products 0.000 description 4
- 239000000194 fatty acid Substances 0.000 description 4
- 235000019152 folic acid Nutrition 0.000 description 4
- 229940029575 guanosine Drugs 0.000 description 4
- 230000036039 immunity Effects 0.000 description 4
- 102000018358 immunoglobulin Human genes 0.000 description 4
- 238000009169 immunotherapy Methods 0.000 description 4
- 230000001939 inductive effect Effects 0.000 description 4
- 229960004130 itraconazole Drugs 0.000 description 4
- 230000007246 mechanism Effects 0.000 description 4
- QJGQUHMNIGDVPM-UHFFFAOYSA-N nitrogen group Chemical group [N] QJGQUHMNIGDVPM-UHFFFAOYSA-N 0.000 description 4
- 238000003199 nucleic acid amplification method Methods 0.000 description 4
- 239000002245 particle Substances 0.000 description 4
- 230000004952 protein activity Effects 0.000 description 4
- 208000017502 proteosome-associated autoinflammatory syndrome Diseases 0.000 description 4
- 150000003212 purines Chemical class 0.000 description 4
- 150000003230 pyrimidines Chemical class 0.000 description 4
- 206010039073 rheumatoid arthritis Diseases 0.000 description 4
- 108091092562 ribozyme Proteins 0.000 description 4
- 239000008107 starch Substances 0.000 description 4
- 235000019698 starch Nutrition 0.000 description 4
- 239000000126 substance Substances 0.000 description 4
- 239000000725 suspension Substances 0.000 description 4
- 238000003786 synthesis reaction Methods 0.000 description 4
- 230000009885 systemic effect Effects 0.000 description 4
- 238000002560 therapeutic procedure Methods 0.000 description 4
- 208000033237 Aicardi-Goutières syndrome Diseases 0.000 description 3
- 201000001320 Atherosclerosis Diseases 0.000 description 3
- 108091033409 CRISPR Proteins 0.000 description 3
- OYPRJOBELJOOCE-UHFFFAOYSA-N Calcium Chemical compound [Ca] OYPRJOBELJOOCE-UHFFFAOYSA-N 0.000 description 3
- 241000282465 Canis Species 0.000 description 3
- 229940046168 CpG oligodeoxynucleotide Drugs 0.000 description 3
- UHDGCWIWMRVCDJ-CCXZUQQUSA-N Cytarabine Chemical compound O=C1N=C(N)C=CN1[C@H]1[C@@H](O)[C@H](O)[C@@H](CO)O1 UHDGCWIWMRVCDJ-CCXZUQQUSA-N 0.000 description 3
- 241000282324 Felis Species 0.000 description 3
- 102000037909 Folate transporters Human genes 0.000 description 3
- 108091006783 Folate transporters Proteins 0.000 description 3
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 3
- 108020005004 Guide RNA Proteins 0.000 description 3
- 102100034458 Hepatitis A virus cellular receptor 2 Human genes 0.000 description 3
- 101710083479 Hepatitis A virus cellular receptor 2 homolog Proteins 0.000 description 3
- DGAQECJNVWCQMB-PUAWFVPOSA-M Ilexoside XXIX Chemical compound C[C@@H]1CC[C@@]2(CC[C@@]3(C(=CC[C@H]4[C@]3(CC[C@@H]5[C@@]4(CC[C@@H](C5(C)C)OS(=O)(=O)[O-])C)C)[C@@H]2[C@]1(C)O)C)C(=O)O[C@H]6[C@@H]([C@H]([C@@H]([C@H](O6)CO)O)O)O.[Na+] DGAQECJNVWCQMB-PUAWFVPOSA-M 0.000 description 3
- 208000003456 Juvenile Arthritis Diseases 0.000 description 3
- 206010059176 Juvenile idiopathic arthritis Diseases 0.000 description 3
- 241000713666 Lentivirus Species 0.000 description 3
- ZLMJMSJWJFRBEC-UHFFFAOYSA-N Potassium Chemical compound [K] ZLMJMSJWJFRBEC-UHFFFAOYSA-N 0.000 description 3
- 102100040678 Programmed cell death protein 1 Human genes 0.000 description 3
- 101710089372 Programmed cell death protein 1 Proteins 0.000 description 3
- 102000002114 Reduced Folate Carrier Human genes 0.000 description 3
- 108091006778 SLC19A1 Proteins 0.000 description 3
- 101800001838 Serine protease/helicase NS3 Proteins 0.000 description 3
- 241000282898 Sus scrofa Species 0.000 description 3
- 229940126547 T-cell immunoglobulin mucin-3 Drugs 0.000 description 3
- IQFYYKKMVGJFEH-XLPZGREQSA-N Thymidine Chemical compound O=C1NC(=O)C(C)=CN1[C@@H]1O[C@H](CO)[C@@H](O)C1 IQFYYKKMVGJFEH-XLPZGREQSA-N 0.000 description 3
- 208000036142 Viral infection Diseases 0.000 description 3
- UJVUMTUBMCYKBK-BNOPZSDTSA-N [(2r)-2-hexadecanoyloxy-3-[hydroxy-[(2r,3r,5s,6r)-2,3,5,6-tetrahydroxy-4-phosphonooxycyclohexyl]oxyphosphoryl]oxypropyl] hexadecanoate Chemical compound CCCCCCCCCCCCCCCC(=O)OC[C@@H](OC(=O)CCCCCCCCCCCCCCC)COP(O)(=O)OC1[C@H](O)[C@H](O)C(OP(O)(O)=O)[C@H](O)[C@H]1O UJVUMTUBMCYKBK-BNOPZSDTSA-N 0.000 description 3
- 230000001594 aberrant effect Effects 0.000 description 3
- 230000002159 abnormal effect Effects 0.000 description 3
- 238000009825 accumulation Methods 0.000 description 3
- 239000002246 antineoplastic agent Substances 0.000 description 3
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 3
- 230000004071 biological effect Effects 0.000 description 3
- 230000015572 biosynthetic process Effects 0.000 description 3
- 239000000872 buffer Substances 0.000 description 3
- 239000011575 calcium Substances 0.000 description 3
- 229910052791 calcium Inorganic materials 0.000 description 3
- 150000001720 carbohydrates Chemical class 0.000 description 3
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 description 3
- 230000004700 cellular uptake Effects 0.000 description 3
- 208000019069 chronic childhood arthritis Diseases 0.000 description 3
- 125000000151 cysteine group Chemical class N[C@@H](CS)C(=O)* 0.000 description 3
- 210000000805 cytoplasm Anatomy 0.000 description 3
- 229940127089 cytotoxic agent Drugs 0.000 description 3
- 239000003085 diluting agent Substances 0.000 description 3
- 229950009791 durvalumab Drugs 0.000 description 3
- 239000002158 endotoxin Substances 0.000 description 3
- 239000003623 enhancer Substances 0.000 description 3
- 229940014144 folate Drugs 0.000 description 3
- OVBPIULPVIDEAO-LBPRGKRZSA-N folic acid Chemical compound C=1N=C2NC(N)=NC(=O)C2=NC=1CNC1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 OVBPIULPVIDEAO-LBPRGKRZSA-N 0.000 description 3
- 239000011724 folic acid Substances 0.000 description 3
- 239000000499 gel Substances 0.000 description 3
- 230000002068 genetic effect Effects 0.000 description 3
- 102000046567 human ACBD3 Human genes 0.000 description 3
- 230000005934 immune activation Effects 0.000 description 3
- 210000002865 immune cell Anatomy 0.000 description 3
- 229940072221 immunoglobulins Drugs 0.000 description 3
- 208000015181 infectious disease Diseases 0.000 description 3
- 238000001802 infusion Methods 0.000 description 3
- 230000005764 inhibitory process Effects 0.000 description 3
- 238000002347 injection Methods 0.000 description 3
- 239000007924 injection Substances 0.000 description 3
- 230000003993 interaction Effects 0.000 description 3
- 230000035990 intercellular signaling Effects 0.000 description 3
- 201000002215 juvenile rheumatoid arthritis Diseases 0.000 description 3
- 239000003446 ligand Substances 0.000 description 3
- 239000008176 lyophilized powder Substances 0.000 description 3
- 239000011859 microparticle Substances 0.000 description 3
- 230000004048 modification Effects 0.000 description 3
- 238000012986 modification Methods 0.000 description 3
- 229940035032 monophosphoryl lipid a Drugs 0.000 description 3
- 201000006417 multiple sclerosis Diseases 0.000 description 3
- 229910052757 nitrogen Inorganic materials 0.000 description 3
- 229940046166 oligodeoxynucleotide Drugs 0.000 description 3
- 238000011275 oncology therapy Methods 0.000 description 3
- 239000000902 placebo Substances 0.000 description 3
- 229940068196 placebo Drugs 0.000 description 3
- 229920001223 polyethylene glycol Polymers 0.000 description 3
- 239000011591 potassium Substances 0.000 description 3
- 229910052700 potassium Inorganic materials 0.000 description 3
- 239000000843 powder Substances 0.000 description 3
- 229940002612 prodrug Drugs 0.000 description 3
- 239000000651 prodrug Substances 0.000 description 3
- 229940044601 receptor agonist Drugs 0.000 description 3
- 239000000018 receptor agonist Substances 0.000 description 3
- 239000011734 sodium Substances 0.000 description 3
- 229910052708 sodium Inorganic materials 0.000 description 3
- 239000002904 solvent Substances 0.000 description 3
- 238000006467 substitution reaction Methods 0.000 description 3
- 239000000758 substrate Substances 0.000 description 3
- 150000008163 sugars Chemical class 0.000 description 3
- 201000000596 systemic lupus erythematosus Diseases 0.000 description 3
- 239000003826 tablet Substances 0.000 description 3
- 230000014616 translation Effects 0.000 description 3
- 230000009385 viral infection Effects 0.000 description 3
- IAKHMKGGTNLKSZ-INIZCTEOSA-N (S)-colchicine Chemical compound C1([C@@H](NC(C)=O)CC2)=CC(=O)C(OC)=CC=C1C1=C2C=C(OC)C(OC)=C1OC IAKHMKGGTNLKSZ-INIZCTEOSA-N 0.000 description 2
- 0 *C(C1OO*)OC(COP(O)(O*)=*)C1O* Chemical compound *C(C1OO*)OC(COP(O)(O*)=*)C1O* 0.000 description 2
- VBICKXHEKHSIBG-UHFFFAOYSA-N 1-monostearoylglycerol Chemical compound CCCCCCCCCCCCCCCCCC(=O)OCC(O)CO VBICKXHEKHSIBG-UHFFFAOYSA-N 0.000 description 2
- MIJDSYMOBYNHOT-UHFFFAOYSA-N 2-(ethylamino)ethanol Chemical compound CCNCCO MIJDSYMOBYNHOT-UHFFFAOYSA-N 0.000 description 2
- YFGHCGITMMYXAQ-UHFFFAOYSA-N 2-[(diphenylmethyl)sulfinyl]acetamide Chemical compound C=1C=CC=CC=1C(S(=O)CC(=O)N)C1=CC=CC=C1 YFGHCGITMMYXAQ-UHFFFAOYSA-N 0.000 description 2
- ASJSAQIRZKANQN-CRCLSJGQSA-N 2-deoxy-D-ribose Chemical compound OC[C@@H](O)[C@@H](O)CC=O ASJSAQIRZKANQN-CRCLSJGQSA-N 0.000 description 2
- MPXTYZZFIJTPPA-UHFFFAOYSA-N 3beta,16beta,17alpha-trihydroxycholest-5-en-22-one 16-O-(2-O-(4-methoxybenzoyl)-beta-D-xylopyranosyl)-(1-3)-(2-O-acetyl-alpha-arabinopyranoside) Natural products C1=CC(OC)=CC=C1C(=O)OC1C(OC2C(C(OC3C(C4(C)CCC5C6(C)CCC(O)CC6=CCC5C4C3)(O)C(C)C(=O)CCC(C)C)OCC2O)OC(C)=O)OCC(O)C1O MPXTYZZFIJTPPA-UHFFFAOYSA-N 0.000 description 2
- STQGQHZAVUOBTE-UHFFFAOYSA-N 7-Cyan-hept-2t-en-4,6-diinsaeure Natural products C1=2C(O)=C3C(=O)C=4C(OC)=CC=CC=4C(=O)C3=C(O)C=2CC(O)(C(C)=O)CC1OC1CC(N)C(O)C(C)O1 STQGQHZAVUOBTE-UHFFFAOYSA-N 0.000 description 2
- 241000710929 Alphavirus Species 0.000 description 2
- QGZKDVFQNNGYKY-UHFFFAOYSA-O Ammonium Chemical compound [NH4+] QGZKDVFQNNGYKY-UHFFFAOYSA-O 0.000 description 2
- CIWBSHSKHKDKBQ-JLAZNSOCSA-N Ascorbic acid Chemical compound OC[C@H](O)[C@H]1OC(=O)C(O)=C1O CIWBSHSKHKDKBQ-JLAZNSOCSA-N 0.000 description 2
- 206010003591 Ataxia Diseases 0.000 description 2
- 206010064539 Autoimmune myocarditis Diseases 0.000 description 2
- 206010050245 Autoimmune thrombocytopenia Diseases 0.000 description 2
- 102100029822 B- and T-lymphocyte attenuator Human genes 0.000 description 2
- KPYSYYIEGFHWSV-UHFFFAOYSA-N Baclofen Chemical compound OC(=O)CC(CN)C1=CC=C(Cl)C=C1 KPYSYYIEGFHWSV-UHFFFAOYSA-N 0.000 description 2
- 102000003930 C-Type Lectins Human genes 0.000 description 2
- 108090000342 C-Type Lectins Proteins 0.000 description 2
- 206010073960 CANDLE syndrome Diseases 0.000 description 2
- 102000008203 CTLA-4 Antigen Human genes 0.000 description 2
- 108010021064 CTLA-4 Antigen Proteins 0.000 description 2
- 201000003762 Chilblain lupus Diseases 0.000 description 2
- 108010092160 Dactinomycin Proteins 0.000 description 2
- AOJJSUZBOXZQNB-TZSSRYMLSA-N Doxorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 AOJJSUZBOXZQNB-TZSSRYMLSA-N 0.000 description 2
- 238000002965 ELISA Methods 0.000 description 2
- 201000005569 Gout Diseases 0.000 description 2
- 102000002812 Heat-Shock Proteins Human genes 0.000 description 2
- 108010004889 Heat-Shock Proteins Proteins 0.000 description 2
- 208000005176 Hepatitis C Diseases 0.000 description 2
- 101000864344 Homo sapiens B- and T-lymphocyte attenuator Proteins 0.000 description 2
- 101000727836 Homo sapiens Reduced folate transporter Proteins 0.000 description 2
- 101000831007 Homo sapiens T-cell immunoreceptor with Ig and ITIM domains Proteins 0.000 description 2
- 206010021245 Idiopathic thrombocytopenic purpura Diseases 0.000 description 2
- 208000029462 Immunodeficiency disease Diseases 0.000 description 2
- 102000009786 Immunoglobulin Constant Regions Human genes 0.000 description 2
- 108010009817 Immunoglobulin Constant Regions Proteins 0.000 description 2
- 102000001706 Immunoglobulin Fab Fragments Human genes 0.000 description 2
- 108010054477 Immunoglobulin Fab Fragments Proteins 0.000 description 2
- 208000022559 Inflammatory bowel disease Diseases 0.000 description 2
- 108010065805 Interleukin-12 Proteins 0.000 description 2
- 102000013462 Interleukin-12 Human genes 0.000 description 2
- HNDVDQJCIGZPNO-YFKPBYRVSA-N L-histidine Chemical compound OC(=O)[C@@H](N)CC1=CN=CN1 HNDVDQJCIGZPNO-YFKPBYRVSA-N 0.000 description 2
- FBOZXECLQNJBKD-ZDUSSCGKSA-N L-methotrexate Chemical compound C=1N=C2N=C(N)N=C(N)C2=NC=1CN(C)C1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 FBOZXECLQNJBKD-ZDUSSCGKSA-N 0.000 description 2
- 239000005517 L01XE01 - Imatinib Substances 0.000 description 2
- 102000017578 LAG3 Human genes 0.000 description 2
- GUBGYTABKSRVRQ-QKKXKWKRSA-N Lactose Natural products OC[C@H]1O[C@@H](O[C@H]2[C@H](O)[C@@H](O)C(O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@H]1O GUBGYTABKSRVRQ-QKKXKWKRSA-N 0.000 description 2
- 101150030213 Lag3 gene Proteins 0.000 description 2
- GQYIWUVLTXOXAJ-UHFFFAOYSA-N Lomustine Chemical compound ClCCN(N=O)C(=O)NC1CCCCC1 GQYIWUVLTXOXAJ-UHFFFAOYSA-N 0.000 description 2
- 241001529936 Murinae Species 0.000 description 2
- 208000031888 Mycoses Diseases 0.000 description 2
- NWIBSHFKIJFRCO-WUDYKRTCSA-N Mytomycin Chemical compound C1N2C(C(C(C)=C(N)C3=O)=O)=C3[C@@H](COC(N)=O)[C@@]2(OC)[C@@H]2[C@H]1N2 NWIBSHFKIJFRCO-WUDYKRTCSA-N 0.000 description 2
- HSHXDCVZWHOWCS-UHFFFAOYSA-N N'-hexadecylthiophene-2-carbohydrazide Chemical compound CCCCCCCCCCCCCCCCNNC(=O)c1cccs1 HSHXDCVZWHOWCS-UHFFFAOYSA-N 0.000 description 2
- 101710163270 Nuclease Proteins 0.000 description 2
- MAGWLGAJMLWPLZ-UHFFFAOYSA-N OSW-1 Natural products COc1ccc(cc1)C(=O)OC2C(O)C(O)COC2OC3C(O)COC(OC4CC5C6CC=C7CC(O)CCC7(C)C6CCC5(C)C4(O)OC(C)C(=O)CCC(C)C)C3OC(=O)C MAGWLGAJMLWPLZ-UHFFFAOYSA-N 0.000 description 2
- 108091034117 Oligonucleotide Proteins 0.000 description 2
- 239000002202 Polyethylene glycol Substances 0.000 description 2
- 208000033273 Proteasome-associated autoinflammatory syndrome Diseases 0.000 description 2
- KDCGOANMDULRCW-UHFFFAOYSA-N Purine Natural products N1=CNC2=NC=NC2=C1 KDCGOANMDULRCW-UHFFFAOYSA-N 0.000 description 2
- 241000283984 Rodentia Species 0.000 description 2
- 108091006171 SLC19 Proteins 0.000 description 2
- 108091006195 SLC46 Proteins 0.000 description 2
- 108091007570 SLC46A3 Proteins 0.000 description 2
- 208000017571 Singleton-Merten dysplasia Diseases 0.000 description 2
- 208000021386 Sjogren Syndrome Diseases 0.000 description 2
- 208000008950 Spondyloenchondrodysplasia Diseases 0.000 description 2
- 208000026246 Spondyloenchondrodysplasia with immune dysregulation Diseases 0.000 description 2
- 229930006000 Sucrose Natural products 0.000 description 2
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 2
- 102100024834 T-cell immunoreceptor with Ig and ITIM domains Human genes 0.000 description 2
- 238000010459 TALEN Methods 0.000 description 2
- NKANXQFJJICGDU-QPLCGJKRSA-N Tamoxifen Chemical compound C=1C=CC=CC=1C(/CC)=C(C=1C=CC(OCCN(C)C)=CC=1)/C1=CC=CC=C1 NKANXQFJJICGDU-QPLCGJKRSA-N 0.000 description 2
- FEWJPZIEWOKRBE-UHFFFAOYSA-N Tartaric Acid Chemical class [H+].[H+].[O-]C(=O)C(O)C(O)C([O-])=O FEWJPZIEWOKRBE-UHFFFAOYSA-N 0.000 description 2
- MUMGGOZAMZWBJJ-DYKIIFRCSA-N Testostosterone Chemical compound O=C1CC[C@]2(C)[C@H]3CC[C@](C)([C@H](CC4)O)[C@@H]4[C@@H]3CCC2=C1 MUMGGOZAMZWBJJ-DYKIIFRCSA-N 0.000 description 2
- 201000007023 Thrombotic Thrombocytopenic Purpura Diseases 0.000 description 2
- 108010043645 Transcription Activator-Like Effector Nucleases Proteins 0.000 description 2
- 206010067584 Type 1 diabetes mellitus Diseases 0.000 description 2
- ISAKRJDGNUQOIC-UHFFFAOYSA-N Uracil Chemical compound O=C1C=CNC(=O)N1 ISAKRJDGNUQOIC-UHFFFAOYSA-N 0.000 description 2
- DRTQHJPVMGBUCF-XVFCMESISA-N Uridine Chemical compound O[C@@H]1[C@H](O)[C@@H](CO)O[C@H]1N1C(=O)NC(=O)C=C1 DRTQHJPVMGBUCF-XVFCMESISA-N 0.000 description 2
- 241000711975 Vesicular stomatitis virus Species 0.000 description 2
- 108010017070 Zinc Finger Nucleases Proteins 0.000 description 2
- MPXTYZZFIJTPPA-JOQRFCRPSA-N [(2s,3r,4s,5r)-2-[(2s,3r,4s,5s)-3-acetyloxy-2-[[(3r,8s,9r,10r,13s,14r,16r,17s)-3,17-dihydroxy-10,13-dimethyl-17-[(2s)-6-methyl-3-oxoheptan-2-yl]-1,2,3,4,7,8,9,11,12,14,15,16-dodecahydrocyclopenta[a]phenanthren-16-yl]oxy]-5-hydroxyoxan-4-yl]oxy-4,5-dihydro Chemical compound C1=CC(OC)=CC=C1C(=O)O[C@H]1[C@H](O[C@@H]2[C@H]([C@H](O[C@H]3[C@]([C@@]4(C)CC[C@H]5[C@@]6(C)CC[C@@H](O)CC6=CC[C@@H]5[C@H]4C3)(O)[C@H](C)C(=O)CCC(C)C)OC[C@@H]2O)OC(C)=O)OC[C@@H](O)[C@@H]1O MPXTYZZFIJTPPA-JOQRFCRPSA-N 0.000 description 2
- JLCPHMBAVCMARE-UHFFFAOYSA-N [3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-hydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methyl [5-(6-aminopurin-9-yl)-2-(hydroxymethyl)oxolan-3-yl] hydrogen phosphate Polymers Cc1cn(C2CC(OP(O)(=O)OCC3OC(CC3OP(O)(=O)OCC3OC(CC3O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c3nc(N)[nH]c4=O)C(COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3CO)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cc(C)c(=O)[nH]c3=O)n3cc(C)c(=O)[nH]c3=O)n3ccc(N)nc3=O)n3cc(C)c(=O)[nH]c3=O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)O2)c(=O)[nH]c1=O JLCPHMBAVCMARE-UHFFFAOYSA-N 0.000 description 2
- RJURFGZVJUQBHK-IIXSONLDSA-N actinomycin D Chemical compound C[C@H]1OC(=O)[C@H](C(C)C)N(C)C(=O)CN(C)C(=O)[C@@H]2CCCN2C(=O)[C@@H](C(C)C)NC(=O)[C@H]1NC(=O)C1=C(N)C(=O)C(C)=C2OC(C(C)=CC=C3C(=O)N[C@@H]4C(=O)N[C@@H](C(N5CCC[C@H]5C(=O)N(C)CC(=O)N(C)[C@@H](C(C)C)C(=O)O[C@@H]4C)=O)C(C)C)=C3N=C21 RJURFGZVJUQBHK-IIXSONLDSA-N 0.000 description 2
- 230000003213 activating effect Effects 0.000 description 2
- SHGAZHPCJJPHSC-YCNIQYBTSA-N all-trans-retinoic acid Chemical compound OC(=O)\C=C(/C)\C=C\C=C(/C)\C=C\C1=C(C)CCCC1(C)C SHGAZHPCJJPHSC-YCNIQYBTSA-N 0.000 description 2
- 229960000473 altretamine Drugs 0.000 description 2
- DKNWSYNQZKUICI-UHFFFAOYSA-N amantadine Chemical compound C1C(C2)CC3CC2CC1(N)C3 DKNWSYNQZKUICI-UHFFFAOYSA-N 0.000 description 2
- 238000010171 animal model Methods 0.000 description 2
- 238000011394 anticancer treatment Methods 0.000 description 2
- 239000003963 antioxidant agent Substances 0.000 description 2
- 235000006708 antioxidants Nutrition 0.000 description 2
- 239000003443 antiviral agent Substances 0.000 description 2
- 229960003852 atezolizumab Drugs 0.000 description 2
- 230000002238 attenuated effect Effects 0.000 description 2
- 201000003710 autoimmune thrombocytopenic purpura Diseases 0.000 description 2
- 229950002916 avelumab Drugs 0.000 description 2
- 230000001580 bacterial effect Effects 0.000 description 2
- 230000008901 benefit Effects 0.000 description 2
- 125000001797 benzyl group Chemical group [H]C1=C([H])C([H])=C(C([H])=C1[H])C([H])([H])* 0.000 description 2
- IQFYYKKMVGJFEH-UHFFFAOYSA-N beta-L-thymidine Natural products O=C1NC(=O)C(C)=CN1C1OC(CO)C(O)C1 IQFYYKKMVGJFEH-UHFFFAOYSA-N 0.000 description 2
- 238000004166 bioassay Methods 0.000 description 2
- 239000013060 biological fluid Substances 0.000 description 2
- 230000033228 biological regulation Effects 0.000 description 2
- 229960002685 biotin Drugs 0.000 description 2
- 235000020958 biotin Nutrition 0.000 description 2
- 239000011616 biotin Substances 0.000 description 2
- 230000000903 blocking effect Effects 0.000 description 2
- 239000001506 calcium phosphate Substances 0.000 description 2
- 239000002775 capsule Substances 0.000 description 2
- 235000014633 carbohydrates Nutrition 0.000 description 2
- 238000004113 cell culture Methods 0.000 description 2
- 210000000170 cell membrane Anatomy 0.000 description 2
- 229940121420 cemiplimab Drugs 0.000 description 2
- 230000000295 complement effect Effects 0.000 description 2
- 239000012141 concentrate Substances 0.000 description 2
- 239000006071 cream Substances 0.000 description 2
- PDXMFTWFFKBFIN-XPWFQUROSA-N cyclic di-AMP Chemical compound C([C@H]1O2)OP(O)(=O)O[C@H]3[C@@H](O)[C@H](N4C5=NC=NC(N)=C5N=C4)O[C@@H]3COP(O)(=O)O[C@H]1[C@@H](O)[C@@H]2N1C(N=CN=C2N)=C2N=C1 PDXMFTWFFKBFIN-XPWFQUROSA-N 0.000 description 2
- 235000018417 cysteine Nutrition 0.000 description 2
- 229960000684 cytarabine Drugs 0.000 description 2
- OPTASPLRGRRNAP-UHFFFAOYSA-N cytosine Chemical compound NC=1C=CNC(=O)N=1 OPTASPLRGRRNAP-UHFFFAOYSA-N 0.000 description 2
- 210000000172 cytosol Anatomy 0.000 description 2
- 229960000640 dactinomycin Drugs 0.000 description 2
- STQGQHZAVUOBTE-VGBVRHCVSA-N daunorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(C)=O)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 STQGQHZAVUOBTE-VGBVRHCVSA-N 0.000 description 2
- 238000013461 design Methods 0.000 description 2
- 239000000539 dimer Substances 0.000 description 2
- 238000010494 dissociation reaction Methods 0.000 description 2
- 230000005593 dissociations Effects 0.000 description 2
- 239000002552 dosage form Substances 0.000 description 2
- 239000000839 emulsion Substances 0.000 description 2
- 150000004665 fatty acids Chemical class 0.000 description 2
- ODKNJVUHOIMIIZ-RRKCRQDMSA-N floxuridine Chemical compound C1[C@H](O)[C@@H](CO)O[C@H]1N1C(=O)NC(=O)C(F)=C1 ODKNJVUHOIMIIZ-RRKCRQDMSA-N 0.000 description 2
- 229960000961 floxuridine Drugs 0.000 description 2
- 239000012530 fluid Substances 0.000 description 2
- 150000002224 folic acids Chemical class 0.000 description 2
- 230000037433 frameshift Effects 0.000 description 2
- 125000000524 functional group Chemical group 0.000 description 2
- 108020001507 fusion proteins Proteins 0.000 description 2
- 102000037865 fusion proteins Human genes 0.000 description 2
- 238000003197 gene knockdown Methods 0.000 description 2
- 239000008103 glucose Substances 0.000 description 2
- UYTPUPDQBNUYGX-UHFFFAOYSA-N guanine Chemical compound O=C1NC(N)=NC2=C1N=CN2 UYTPUPDQBNUYGX-UHFFFAOYSA-N 0.000 description 2
- 229910052736 halogen Inorganic materials 0.000 description 2
- 150000002367 halogens Chemical class 0.000 description 2
- 210000003958 hematopoietic stem cell Anatomy 0.000 description 2
- 208000006454 hepatitis Diseases 0.000 description 2
- 231100000283 hepatitis Toxicity 0.000 description 2
- 125000005842 heteroatom Chemical group 0.000 description 2
- 125000000623 heterocyclic group Chemical group 0.000 description 2
- UUVWYPNAQBNQJQ-UHFFFAOYSA-N hexamethylmelamine Chemical compound CN(C)C1=NC(N(C)C)=NC(N(C)C)=N1 UUVWYPNAQBNQJQ-UHFFFAOYSA-N 0.000 description 2
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 2
- 229920001477 hydrophilic polymer Polymers 0.000 description 2
- 150000004679 hydroxides Chemical class 0.000 description 2
- 239000001866 hydroxypropyl methyl cellulose Substances 0.000 description 2
- 235000010979 hydroxypropyl methyl cellulose Nutrition 0.000 description 2
- 229920003088 hydroxypropyl methyl cellulose Polymers 0.000 description 2
- HOMGKSMUEGBAAB-UHFFFAOYSA-N ifosfamide Chemical compound ClCCNP1(=O)OCCCN1CCCl HOMGKSMUEGBAAB-UHFFFAOYSA-N 0.000 description 2
- 229960001101 ifosfamide Drugs 0.000 description 2
- KTUFNOKKBVMGRW-UHFFFAOYSA-N imatinib Chemical compound C1CN(C)CCN1CC1=CC=C(C(=O)NC=2C=C(NC=3N=C(C=CN=3)C=3C=NC=CC=3)C(C)=CC=2)C=C1 KTUFNOKKBVMGRW-UHFFFAOYSA-N 0.000 description 2
- 208000026278 immune system disease Diseases 0.000 description 2
- 108020004201 indoleamine 2,3-dioxygenase Proteins 0.000 description 2
- 102000006639 indoleamine 2,3-dioxygenase Human genes 0.000 description 2
- 230000015788 innate immune response Effects 0.000 description 2
- NOESYZHRGYRDHS-UHFFFAOYSA-N insulin Chemical compound N1C(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(NC(=O)CN)C(C)CC)CSSCC(C(NC(CO)C(=O)NC(CC(C)C)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CCC(N)=O)C(=O)NC(CC(C)C)C(=O)NC(CCC(O)=O)C(=O)NC(CC(N)=O)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CSSCC(NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2C=CC(O)=CC=2)NC(=O)C(CC(C)C)NC(=O)C(C)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2NC=NC=2)NC(=O)C(CO)NC(=O)CNC2=O)C(=O)NCC(=O)NC(CCC(O)=O)C(=O)NC(CCCNC(N)=N)C(=O)NCC(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC(O)=CC=3)C(=O)NC(C(C)O)C(=O)N3C(CCC3)C(=O)NC(CCCCN)C(=O)NC(C)C(O)=O)C(=O)NC(CC(N)=O)C(O)=O)=O)NC(=O)C(C(C)CC)NC(=O)C(CO)NC(=O)C(C(C)O)NC(=O)C1CSSCC2NC(=O)C(CC(C)C)NC(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CC(N)=O)NC(=O)C(NC(=O)C(N)CC=1C=CC=CC=1)C(C)C)CC1=CN=CN1 NOESYZHRGYRDHS-UHFFFAOYSA-N 0.000 description 2
- 230000002452 interceptive effect Effects 0.000 description 2
- 230000003834 intracellular effect Effects 0.000 description 2
- 238000007913 intrathecal administration Methods 0.000 description 2
- 238000001990 intravenous administration Methods 0.000 description 2
- 229960005386 ipilimumab Drugs 0.000 description 2
- JJWLVOIRVHMVIS-UHFFFAOYSA-N isopropylamine Chemical compound CC(C)N JJWLVOIRVHMVIS-UHFFFAOYSA-N 0.000 description 2
- 239000008101 lactose Substances 0.000 description 2
- 229920006008 lipopolysaccharide Polymers 0.000 description 2
- 239000007788 liquid Substances 0.000 description 2
- 210000002540 macrophage Anatomy 0.000 description 2
- 208000002780 macular degeneration Diseases 0.000 description 2
- 238000002483 medication Methods 0.000 description 2
- GLVAUDGFNGKCSF-UHFFFAOYSA-N mercaptopurine Chemical compound S=C1NC=NC2=C1NC=N2 GLVAUDGFNGKCSF-UHFFFAOYSA-N 0.000 description 2
- 229960000485 methotrexate Drugs 0.000 description 2
- 230000000394 mitotic effect Effects 0.000 description 2
- 210000000822 natural killer cell Anatomy 0.000 description 2
- 230000000926 neurological effect Effects 0.000 description 2
- 229960003301 nivolumab Drugs 0.000 description 2
- 210000004882 non-tumor cell Anatomy 0.000 description 2
- 125000003729 nucleotide group Chemical group 0.000 description 2
- 208000035824 paresthesia Diseases 0.000 description 2
- 244000052769 pathogen Species 0.000 description 2
- 230000001717 pathogenic effect Effects 0.000 description 2
- 229960002621 pembrolizumab Drugs 0.000 description 2
- 229950010773 pidilizumab Drugs 0.000 description 2
- 108700002563 poly ICLC Proteins 0.000 description 2
- 229920001606 poly(lactic acid-co-glycolic acid) Polymers 0.000 description 2
- 229920000642 polymer Polymers 0.000 description 2
- 102000040430 polynucleotide Human genes 0.000 description 2
- 108091033319 polynucleotide Proteins 0.000 description 2
- 239000002157 polynucleotide Substances 0.000 description 2
- 230000003389 potentiating effect Effects 0.000 description 2
- 230000002265 prevention Effects 0.000 description 2
- MFDFERRIHVXMIY-UHFFFAOYSA-N procaine Chemical compound CCN(CC)CCOC(=O)C1=CC=C(N)C=C1 MFDFERRIHVXMIY-UHFFFAOYSA-N 0.000 description 2
- 229960004919 procaine Drugs 0.000 description 2
- 125000000561 purinyl group Chemical group N1=C(N=C2N=CNC2=C1)* 0.000 description 2
- 238000011160 research Methods 0.000 description 2
- 238000012552 review Methods 0.000 description 2
- 125000000548 ribosyl group Chemical group C1([C@H](O)[C@H](O)[C@H](O1)CO)* 0.000 description 2
- 210000002966 serum Anatomy 0.000 description 2
- RYYKJJJTJZKILX-UHFFFAOYSA-M sodium octadecanoate Chemical compound [Na+].CCCCCCCCCCCCCCCCCC([O-])=O RYYKJJJTJZKILX-UHFFFAOYSA-M 0.000 description 2
- 229950007213 spartalizumab Drugs 0.000 description 2
- 230000000087 stabilizing effect Effects 0.000 description 2
- 230000000638 stimulation Effects 0.000 description 2
- 238000007920 subcutaneous administration Methods 0.000 description 2
- 125000005017 substituted alkenyl group Chemical group 0.000 description 2
- 125000004426 substituted alkynyl group Chemical group 0.000 description 2
- 125000003107 substituted aryl group Chemical group 0.000 description 2
- 239000005720 sucrose Substances 0.000 description 2
- 239000000829 suppository Substances 0.000 description 2
- 239000000454 talc Substances 0.000 description 2
- 229910052623 talc Inorganic materials 0.000 description 2
- 235000002906 tartaric acid Nutrition 0.000 description 2
- RWQNBRDOKXIBIV-UHFFFAOYSA-N thymine Chemical compound CC1=CNC(=O)NC1=O RWQNBRDOKXIBIV-UHFFFAOYSA-N 0.000 description 2
- WYWHKKSPHMUBEB-UHFFFAOYSA-N tioguanine Chemical compound N1C(N)=NC(=S)C2=C1N=CN2 WYWHKKSPHMUBEB-UHFFFAOYSA-N 0.000 description 2
- XFYDIVBRZNQMJC-UHFFFAOYSA-N tizanidine Chemical compound ClC=1C=CC2=NSN=C2C=1NC1=NCCN1 XFYDIVBRZNQMJC-UHFFFAOYSA-N 0.000 description 2
- 231100000331 toxic Toxicity 0.000 description 2
- 230000002588 toxic effect Effects 0.000 description 2
- 230000002103 transcriptional effect Effects 0.000 description 2
- 230000031998 transcytosis Effects 0.000 description 2
- 238000001890 transfection Methods 0.000 description 2
- 238000013519 translation Methods 0.000 description 2
- 229950007217 tremelimumab Drugs 0.000 description 2
- 229960001727 tretinoin Drugs 0.000 description 2
- 125000004953 trihalomethyl group Chemical group 0.000 description 2
- 208000001072 type 2 diabetes mellitus Diseases 0.000 description 2
- 241001529453 unidentified herpesvirus Species 0.000 description 2
- 241001430294 unidentified retrovirus Species 0.000 description 2
- 229960005486 vaccine Drugs 0.000 description 2
- 230000003612 virological effect Effects 0.000 description 2
- KIUKXJAPPMFGSW-DNGZLQJQSA-N (2S,3S,4S,5R,6R)-6-[(2S,3R,4R,5S,6R)-3-Acetamido-2-[(2S,3S,4R,5R,6R)-6-[(2R,3R,4R,5S,6R)-3-acetamido-2,5-dihydroxy-6-(hydroxymethyl)oxan-4-yl]oxy-2-carboxy-4,5-dihydroxyoxan-3-yl]oxy-5-hydroxy-6-(hydroxymethyl)oxan-4-yl]oxy-3,4,5-trihydroxyoxane-2-carboxylic acid Chemical compound CC(=O)N[C@H]1[C@H](O)O[C@H](CO)[C@@H](O)[C@@H]1O[C@H]1[C@H](O)[C@@H](O)[C@H](O[C@H]2[C@@H]([C@@H](O[C@H]3[C@@H]([C@@H](O)[C@H](O)[C@H](O3)C(O)=O)O)[C@H](O)[C@@H](CO)O2)NC(C)=O)[C@@H](C(O)=O)O1 KIUKXJAPPMFGSW-DNGZLQJQSA-N 0.000 description 1
- YLOCGHYTXIINAI-XKUOMLDTSA-N (2s)-2-amino-3-(4-hydroxyphenyl)propanoic acid;(2s)-2-aminopentanedioic acid;(2s)-2-aminopropanoic acid;(2s)-2,6-diaminohexanoic acid Chemical compound C[C@H](N)C(O)=O.NCCCC[C@H](N)C(O)=O.OC(=O)[C@@H](N)CCC(O)=O.OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 YLOCGHYTXIINAI-XKUOMLDTSA-N 0.000 description 1
- GTXSRFUZSLTDFX-HRCADAONSA-N (2s)-n-[(2s)-3,3-dimethyl-1-(methylamino)-1-oxobutan-2-yl]-4-methyl-2-[[(2s)-2-sulfanyl-4-(3,4,4-trimethyl-2,5-dioxoimidazolidin-1-yl)butanoyl]amino]pentanamide Chemical compound CNC(=O)[C@H](C(C)(C)C)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](S)CCN1C(=O)N(C)C(C)(C)C1=O GTXSRFUZSLTDFX-HRCADAONSA-N 0.000 description 1
- XSAKVDNHFRWJKS-IIZANFQQSA-N (2s)-n-benzyl-1-[(2s)-1-[(2s)-2-[[(2s)-2-[[(2s)-2-(dimethylamino)-3-methylbutanoyl]amino]-3-methylbutanoyl]-methylamino]-3-methylbutanoyl]pyrrolidine-2-carbonyl]pyrrolidine-2-carboxamide Chemical compound CC(C)[C@H](N(C)C)C(=O)N[C@@H](C(C)C)C(=O)N(C)[C@@H](C(C)C)C(=O)N1CCC[C@H]1C(=O)N1[C@H](C(=O)NCC=2C=CC=CC=2)CCC1 XSAKVDNHFRWJKS-IIZANFQQSA-N 0.000 description 1
- YPBKTZBXSBLTDK-PKNBQFBNSA-N (3e)-3-[(3-bromo-4-fluoroanilino)-nitrosomethylidene]-4-[2-(sulfamoylamino)ethylamino]-1,2,5-oxadiazole Chemical compound NS(=O)(=O)NCCNC1=NON\C1=C(N=O)/NC1=CC=C(F)C(Br)=C1 YPBKTZBXSBLTDK-PKNBQFBNSA-N 0.000 description 1
- WRONAJQPZWDYAR-ZDUSSCGKSA-N (3s)-4-(6-amino-1-methylpyrazolo[3,4-d]pyrimidin-4-yl)-n-(4-methoxy-2-methylphenyl)-3-methylpiperazine-1-carboxamide Chemical compound CC1=CC(OC)=CC=C1NC(=O)N1C[C@H](C)N(C=2C=3C=NN(C)C=3N=C(N)N=2)CC1 WRONAJQPZWDYAR-ZDUSSCGKSA-N 0.000 description 1
- OMJKFYKNWZZKTK-POHAHGRESA-N (5z)-5-(dimethylaminohydrazinylidene)imidazole-4-carboxamide Chemical compound CN(C)N\N=C1/N=CN=C1C(N)=O OMJKFYKNWZZKTK-POHAHGRESA-N 0.000 description 1
- IEXUMDBQLIVNHZ-YOUGDJEHSA-N (8s,11r,13r,14s,17s)-11-[4-(dimethylamino)phenyl]-17-hydroxy-17-(3-hydroxypropyl)-13-methyl-1,2,6,7,8,11,12,14,15,16-decahydrocyclopenta[a]phenanthren-3-one Chemical compound C1=CC(N(C)C)=CC=C1[C@@H]1C2=C3CCC(=O)C=C3CC[C@H]2[C@H](CC[C@]2(O)CCCO)[C@@]2(C)C1 IEXUMDBQLIVNHZ-YOUGDJEHSA-N 0.000 description 1
- LKJPYSCBVHEWIU-KRWDZBQOSA-N (R)-bicalutamide Chemical compound C([C@@](O)(C)C(=O)NC=1C=C(C(C#N)=CC=1)C(F)(F)F)S(=O)(=O)C1=CC=C(F)C=C1 LKJPYSCBVHEWIU-KRWDZBQOSA-N 0.000 description 1
- 102000001556 1-Phosphatidylinositol 4-Kinase Human genes 0.000 description 1
- 108010029190 1-Phosphatidylinositol 4-Kinase Proteins 0.000 description 1
- UHDGCWIWMRVCDJ-UHFFFAOYSA-N 1-beta-D-Xylofuranosyl-NH-Cytosine Natural products O=C1N=C(N)C=CN1C1C(O)C(O)C(CO)O1 UHDGCWIWMRVCDJ-UHFFFAOYSA-N 0.000 description 1
- VSNHCAURESNICA-NJFSPNSNSA-N 1-oxidanylurea Chemical compound N[14C](=O)NO VSNHCAURESNICA-NJFSPNSNSA-N 0.000 description 1
- DBPWSSGDRRHUNT-CEGNMAFCSA-N 17α-hydroxyprogesterone Chemical compound C1CC2=CC(=O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@@](C(=O)C)(O)[C@@]1(C)CC2 DBPWSSGDRRHUNT-CEGNMAFCSA-N 0.000 description 1
- YKBGVTZYEHREMT-KVQBGUIXSA-N 2'-deoxyguanosine Chemical class C1=NC=2C(=O)NC(N)=NC=2N1[C@H]1C[C@H](O)[C@@H](CO)O1 YKBGVTZYEHREMT-KVQBGUIXSA-N 0.000 description 1
- MXHRCPNRJAMMIM-SHYZEUOFSA-N 2'-deoxyuridine Chemical compound C1[C@H](O)[C@@H](CO)O[C@H]1N1C(=O)NC(=O)C=C1 MXHRCPNRJAMMIM-SHYZEUOFSA-N 0.000 description 1
- CKTSBUTUHBMZGZ-SHYZEUOFSA-N 2'‐deoxycytidine Chemical class O=C1N=C(N)C=CN1[C@@H]1O[C@H](CO)[C@@H](O)C1 CKTSBUTUHBMZGZ-SHYZEUOFSA-N 0.000 description 1
- ROZCIVXTLACYNY-UHFFFAOYSA-N 2,3,4,5,6-pentafluoro-n-(3-fluoro-4-methoxyphenyl)benzenesulfonamide Chemical compound C1=C(F)C(OC)=CC=C1NS(=O)(=O)C1=C(F)C(F)=C(F)C(F)=C1F ROZCIVXTLACYNY-UHFFFAOYSA-N 0.000 description 1
- UPAQRWMRKQCLSD-HTIIIDOHSA-N 2,3-dipalmitoyl-S-glycerylcysteine Chemical compound CCCCCCCCCCCCCCCC(=O)OCC(CSC[C@H](N)C(O)=O)OC(=O)CCCCCCCCCCCCCCC UPAQRWMRKQCLSD-HTIIIDOHSA-N 0.000 description 1
- UEJJHQNACJXSKW-UHFFFAOYSA-N 2-(2,6-dioxopiperidin-3-yl)-1H-isoindole-1,3(2H)-dione Chemical compound O=C1C2=CC=CC=C2C(=O)N1C1CCC(=O)NC1=O UEJJHQNACJXSKW-UHFFFAOYSA-N 0.000 description 1
- YMZPQKXPKZZSFV-CPWYAANMSA-N 2-[3-[(1r)-1-[(2s)-1-[(2s)-2-[(1r)-cyclohex-2-en-1-yl]-2-(3,4,5-trimethoxyphenyl)acetyl]piperidine-2-carbonyl]oxy-3-(3,4-dimethoxyphenyl)propyl]phenoxy]acetic acid Chemical compound C1=C(OC)C(OC)=CC=C1CC[C@H](C=1C=C(OCC(O)=O)C=CC=1)OC(=O)[C@H]1N(C(=O)[C@@H]([C@H]2C=CCCC2)C=2C=C(OC)C(OC)=C(OC)C=2)CCCC1 YMZPQKXPKZZSFV-CPWYAANMSA-N 0.000 description 1
- JKMHFZQWWAIEOD-UHFFFAOYSA-N 2-[4-(2-hydroxyethyl)piperazin-1-yl]ethanesulfonic acid Chemical compound OCC[NH+]1CCN(CCS([O-])(=O)=O)CC1 JKMHFZQWWAIEOD-UHFFFAOYSA-N 0.000 description 1
- PBUUPFTVAPUWDE-UGZDLDLSSA-N 2-[[(2S,4S)-2-[bis(2-chloroethyl)amino]-2-oxo-1,3,2lambda5-oxazaphosphinan-4-yl]sulfanyl]ethanesulfonic acid Chemical compound OS(=O)(=O)CCS[C@H]1CCO[P@](=O)(N(CCCl)CCCl)N1 PBUUPFTVAPUWDE-UGZDLDLSSA-N 0.000 description 1
- VDCRFBBZFHHYGT-IOSLPCCCSA-N 2-amino-9-[(2r,3r,4s,5r)-3,4-dihydroxy-5-(hydroxymethyl)oxolan-2-yl]-7-prop-2-enyl-3h-purine-6,8-dione Chemical compound O=C1N(CC=C)C=2C(=O)NC(N)=NC=2N1[C@@H]1O[C@H](CO)[C@@H](O)[C@H]1O VDCRFBBZFHHYGT-IOSLPCCCSA-N 0.000 description 1
- MWYDSXOGIBMAET-UHFFFAOYSA-N 2-amino-N-[7-methoxy-8-(3-morpholin-4-ylpropoxy)-2,3-dihydro-1H-imidazo[1,2-c]quinazolin-5-ylidene]pyrimidine-5-carboxamide Chemical compound NC1=NC=C(C=N1)C(=O)N=C1N=C2C(=C(C=CC2=C2N1CCN2)OCCCN1CCOCC1)OC MWYDSXOGIBMAET-UHFFFAOYSA-N 0.000 description 1
- DJIOGHZNVKFYHH-UHFFFAOYSA-N 2-hexadecylpyridine Chemical compound CCCCCCCCCCCCCCCCC1=CC=CC=N1 DJIOGHZNVKFYHH-UHFFFAOYSA-N 0.000 description 1
- XIFVTSIIYVGRHJ-UHFFFAOYSA-N 2-n,2-n,4-n,4-n,6-n-pentamethyl-1,3,5-triazine-2,4,6-triamine Chemical compound CNC1=NC(N(C)C)=NC(N(C)C)=N1 XIFVTSIIYVGRHJ-UHFFFAOYSA-N 0.000 description 1
- INBGSXNNRGWLJU-ZHHJOTBYSA-N 25-hydroxycholesterol Chemical compound C1C=C2C[C@@H](O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@H]([C@@H](CCCC(C)(C)O)C)[C@@]1(C)CC2 INBGSXNNRGWLJU-ZHHJOTBYSA-N 0.000 description 1
- INBGSXNNRGWLJU-UHFFFAOYSA-N 25epsilon-Hydroxycholesterin Natural products C1C=C2CC(O)CCC2(C)C2C1C1CCC(C(CCCC(C)(C)O)C)C1(C)CC2 INBGSXNNRGWLJU-UHFFFAOYSA-N 0.000 description 1
- FFRFGVHNKJYNOV-DOVUUNBWSA-N 3',4'-Anhydrovinblastine Chemical compound C([C@@H](C[C@]1(C(=O)OC)C=2C(=CC3=C([C@]45[C@H]([C@@]([C@H](OC(C)=O)[C@]6(CC)C=CCN([C@H]56)CC4)(O)C(=O)OC)N3C)C=2)OC)C=C(C2)CC)N2CCC2=C1NC1=CC=CC=C21 FFRFGVHNKJYNOV-DOVUUNBWSA-N 0.000 description 1
- MAUCONCHVWBMHK-UHFFFAOYSA-N 3-[(dimethylamino)methyl]-N-[2-[4-[(hydroxyamino)-oxomethyl]phenoxy]ethyl]-2-benzofurancarboxamide Chemical compound O1C2=CC=CC=C2C(CN(C)C)=C1C(=O)NCCOC1=CC=C(C(=O)NO)C=C1 MAUCONCHVWBMHK-UHFFFAOYSA-N 0.000 description 1
- NHFDRBXTEDBWCZ-ZROIWOOFSA-N 3-[2,4-dimethyl-5-[(z)-(2-oxo-1h-indol-3-ylidene)methyl]-1h-pyrrol-3-yl]propanoic acid Chemical compound OC(=O)CCC1=C(C)NC(\C=C/2C3=CC=CC=C3NC\2=O)=C1C NHFDRBXTEDBWCZ-ZROIWOOFSA-N 0.000 description 1
- AOJJSUZBOXZQNB-VTZDEGQISA-N 4'-epidoxorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)[C@H]1C[C@H](N)[C@@H](O)[C@H](C)O1 AOJJSUZBOXZQNB-VTZDEGQISA-N 0.000 description 1
- NMUSYJAQQFHJEW-UHFFFAOYSA-N 5-Azacytidine Natural products O=C1N=C(N)N=CN1C1C(O)C(O)C(CO)O1 NMUSYJAQQFHJEW-UHFFFAOYSA-N 0.000 description 1
- IDPUKCWIGUEADI-UHFFFAOYSA-N 5-[bis(2-chloroethyl)amino]uracil Chemical compound ClCCN(CCCl)C1=CNC(=O)NC1=O IDPUKCWIGUEADI-UHFFFAOYSA-N 0.000 description 1
- XAUDJQYHKZQPEU-KVQBGUIXSA-N 5-aza-2'-deoxycytidine Chemical compound O=C1N=C(N)N=CN1[C@@H]1O[C@H](CO)[C@@H](O)C1 XAUDJQYHKZQPEU-KVQBGUIXSA-N 0.000 description 1
- NMUSYJAQQFHJEW-KVTDHHQDSA-N 5-azacytidine Chemical compound O=C1N=C(N)N=CN1[C@H]1[C@H](O)[C@H](O)[C@@H](CO)O1 NMUSYJAQQFHJEW-KVTDHHQDSA-N 0.000 description 1
- AILRADAXUVEEIR-UHFFFAOYSA-N 5-chloro-4-n-(2-dimethylphosphorylphenyl)-2-n-[2-methoxy-4-[4-(4-methylpiperazin-1-yl)piperidin-1-yl]phenyl]pyrimidine-2,4-diamine Chemical compound COC1=CC(N2CCC(CC2)N2CCN(C)CC2)=CC=C1NC(N=1)=NC=C(Cl)C=1NC1=CC=CC=C1P(C)(C)=O AILRADAXUVEEIR-UHFFFAOYSA-N 0.000 description 1
- FHVDTGUDJYJELY-UHFFFAOYSA-N 6-{[2-carboxy-4,5-dihydroxy-6-(phosphanyloxy)oxan-3-yl]oxy}-4,5-dihydroxy-3-phosphanyloxane-2-carboxylic acid Chemical compound O1C(C(O)=O)C(P)C(O)C(O)C1OC1C(C(O)=O)OC(OP)C(O)C1O FHVDTGUDJYJELY-UHFFFAOYSA-N 0.000 description 1
- KABRXLINDSPGDF-UHFFFAOYSA-N 7-bromoisoquinoline Chemical compound C1=CN=CC2=CC(Br)=CC=C21 KABRXLINDSPGDF-UHFFFAOYSA-N 0.000 description 1
- RHXHGRAEPCAFML-UHFFFAOYSA-N 7-cyclopentyl-n,n-dimethyl-2-[(5-piperazin-1-ylpyridin-2-yl)amino]pyrrolo[2,3-d]pyrimidine-6-carboxamide Chemical compound N1=C2N(C3CCCC3)C(C(=O)N(C)C)=CC2=CN=C1NC(N=C1)=CC=C1N1CCNCC1 RHXHGRAEPCAFML-UHFFFAOYSA-N 0.000 description 1
- 229940126253 ADU-S100 Drugs 0.000 description 1
- 102100033350 ATP-dependent translocase ABCB1 Human genes 0.000 description 1
- 102100032814 ATP-dependent zinc metalloprotease YME1L1 Human genes 0.000 description 1
- 229930024421 Adenine Natural products 0.000 description 1
- GFFGJBXGBJISGV-UHFFFAOYSA-N Adenine Chemical compound NC1=NC=NC2=C1N=CN2 GFFGJBXGBJISGV-UHFFFAOYSA-N 0.000 description 1
- 241000702423 Adeno-associated virus - 2 Species 0.000 description 1
- 241000202702 Adeno-associated virus - 3 Species 0.000 description 1
- 241000580270 Adeno-associated virus - 4 Species 0.000 description 1
- 241001634120 Adeno-associated virus - 5 Species 0.000 description 1
- 241000972680 Adeno-associated virus - 6 Species 0.000 description 1
- 241001164823 Adeno-associated virus - 7 Species 0.000 description 1
- 241001164825 Adeno-associated virus - 8 Species 0.000 description 1
- GUBGYTABKSRVRQ-XLOQQCSPSA-N Alpha-Lactose Chemical compound O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@H]1O[C@@H]1[C@@H](CO)O[C@H](O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-XLOQQCSPSA-N 0.000 description 1
- 108020000948 Antisense Oligonucleotides Proteins 0.000 description 1
- 102100037435 Antiviral innate immune response receptor RIG-I Human genes 0.000 description 1
- 101710127675 Antiviral innate immune response receptor RIG-I Proteins 0.000 description 1
- 101150032427 Arf1 gene Proteins 0.000 description 1
- 241000271566 Aves Species 0.000 description 1
- 108090001008 Avidin Proteins 0.000 description 1
- MLDQJTXFUGDVEO-UHFFFAOYSA-N BAY-43-9006 Chemical compound C1=NC(C(=O)NC)=CC(OC=2C=CC(NC(=O)NC=3C=C(C(Cl)=CC=3)C(F)(F)F)=CC=2)=C1 MLDQJTXFUGDVEO-UHFFFAOYSA-N 0.000 description 1
- 208000035143 Bacterial infection Diseases 0.000 description 1
- DWRXFEITVBNRMK-UHFFFAOYSA-N Beta-D-1-Arabinofuranosylthymine Natural products O=C1NC(=O)C(C)=CN1C1C(O)C(O)C(CO)O1 DWRXFEITVBNRMK-UHFFFAOYSA-N 0.000 description 1
- 108010006654 Bleomycin Proteins 0.000 description 1
- 201000004569 Blindness Diseases 0.000 description 1
- 108091003079 Bovine Serum Albumin Proteins 0.000 description 1
- 101800004538 Bradykinin Proteins 0.000 description 1
- COVZYZSDYWQREU-UHFFFAOYSA-N Busulfan Chemical compound CS(=O)(=O)OCCCCOS(C)(=O)=O COVZYZSDYWQREU-UHFFFAOYSA-N 0.000 description 1
- 102100036848 C-C motif chemokine 20 Human genes 0.000 description 1
- 102100032367 C-C motif chemokine 5 Human genes 0.000 description 1
- 102100025248 C-X-C motif chemokine 10 Human genes 0.000 description 1
- 101150013553 CD40 gene Proteins 0.000 description 1
- 102100025221 CD70 antigen Human genes 0.000 description 1
- 238000010354 CRISPR gene editing Methods 0.000 description 1
- 238000010446 CRISPR interference Methods 0.000 description 1
- 101100508413 Caenorhabditis elegans ifc-1 gene Proteins 0.000 description 1
- 101100454807 Caenorhabditis elegans lgg-1 gene Proteins 0.000 description 1
- 101100454808 Caenorhabditis elegans lgg-2 gene Proteins 0.000 description 1
- 101100217502 Caenorhabditis elegans lgg-3 gene Proteins 0.000 description 1
- 239000004215 Carbon black (E152) Substances 0.000 description 1
- DLGOEMSEDOSKAD-UHFFFAOYSA-N Carmustine Chemical compound ClCCNC(=O)N(N=O)CCCl DLGOEMSEDOSKAD-UHFFFAOYSA-N 0.000 description 1
- 102000014914 Carrier Proteins Human genes 0.000 description 1
- 108010055166 Chemokine CCL5 Proteins 0.000 description 1
- 108091092236 Chimeric RNA Proteins 0.000 description 1
- KRKNYBCHXYNGOX-UHFFFAOYSA-K Citrate Chemical compound [O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O KRKNYBCHXYNGOX-UHFFFAOYSA-K 0.000 description 1
- 208000015943 Coeliac disease Diseases 0.000 description 1
- 206010009900 Colitis ulcerative Diseases 0.000 description 1
- 208000035473 Communicable disease Diseases 0.000 description 1
- 206010011017 Corneal graft rejection Diseases 0.000 description 1
- 108091029430 CpG site Proteins 0.000 description 1
- 208000011231 Crohn disease Diseases 0.000 description 1
- 229930188224 Cryptophycin Natural products 0.000 description 1
- 229920000858 Cyclodextrin Polymers 0.000 description 1
- CMSMOCZEIVJLDB-UHFFFAOYSA-N Cyclophosphamide Chemical compound ClCCN(CCCl)P1(=O)NCCCO1 CMSMOCZEIVJLDB-UHFFFAOYSA-N 0.000 description 1
- UHDGCWIWMRVCDJ-PSQAKQOGSA-N Cytidine Natural products O=C1N=C(N)C=CN1[C@@H]1[C@@H](O)[C@@H](O)[C@H](CO)O1 UHDGCWIWMRVCDJ-PSQAKQOGSA-N 0.000 description 1
- 206010011827 Cytomegaloviral infections Diseases 0.000 description 1
- 241000701022 Cytomegalovirus Species 0.000 description 1
- FBPFZTCFMRRESA-FSIIMWSLSA-N D-Glucitol Natural products OC[C@H](O)[C@H](O)[C@@H](O)[C@H](O)CO FBPFZTCFMRRESA-FSIIMWSLSA-N 0.000 description 1
- FBPFZTCFMRRESA-KVTDHHQDSA-N D-Mannitol Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-KVTDHHQDSA-N 0.000 description 1
- RGHNJXZEOKUKBD-SQOUGZDYSA-M D-gluconate Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@@H](O)C([O-])=O RGHNJXZEOKUKBD-SQOUGZDYSA-M 0.000 description 1
- HMFHBZSHGGEWLO-SOOFDHNKSA-N D-ribofuranose Chemical compound OC[C@H]1OC(O)[C@H](O)[C@@H]1O HMFHBZSHGGEWLO-SOOFDHNKSA-N 0.000 description 1
- 230000005778 DNA damage Effects 0.000 description 1
- 231100000277 DNA damage Toxicity 0.000 description 1
- 230000004543 DNA replication Effects 0.000 description 1
- ZBNZXTGUTAYRHI-UHFFFAOYSA-N Dasatinib Chemical compound C=1C(N2CCN(CCO)CC2)=NC(C)=NC=1NC(S1)=NC=C1C(=O)NC1=C(C)C=CC=C1Cl ZBNZXTGUTAYRHI-UHFFFAOYSA-N 0.000 description 1
- WEAHRLBPCANXCN-UHFFFAOYSA-N Daunomycin Natural products CCC1(O)CC(OC2CC(N)C(O)C(C)O2)c3cc4C(=O)c5c(OC)cccc5C(=O)c4c(O)c3C1 WEAHRLBPCANXCN-UHFFFAOYSA-N 0.000 description 1
- 101710088194 Dehydrogenase Proteins 0.000 description 1
- 102100034289 Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 Human genes 0.000 description 1
- 206010012689 Diabetic retinopathy Diseases 0.000 description 1
- 235000019739 Dicalciumphosphate Nutrition 0.000 description 1
- BXZVVICBKDXVGW-NKWVEPMBSA-N Didanosine Chemical compound O1[C@H](CO)CC[C@@H]1N1C(NC=NC2=O)=C2N=C1 BXZVVICBKDXVGW-NKWVEPMBSA-N 0.000 description 1
- LTMHDMANZUZIPE-AMTYYWEZSA-N Digoxin Natural products O([C@H]1[C@H](C)O[C@H](O[C@@H]2C[C@@H]3[C@@](C)([C@@H]4[C@H]([C@]5(O)[C@](C)([C@H](O)C4)[C@H](C4=CC(=O)OC4)CC5)CC3)CC2)C[C@@H]1O)[C@H]1O[C@H](C)[C@@H](O[C@H]2O[C@@H](C)[C@H](O)[C@@H](O)C2)[C@@H](O)C1 LTMHDMANZUZIPE-AMTYYWEZSA-N 0.000 description 1
- 208000003164 Diplopia Diseases 0.000 description 1
- LQKSHSFQQRCAFW-UHFFFAOYSA-N Dolastatin 15 Natural products COC1=CC(=O)N(C(=O)C(OC(=O)C2N(CCC2)C(=O)C2N(CCC2)C(=O)C(C(C)C)N(C)C(=O)C(NC(=O)C(C(C)C)N(C)C)C(C)C)C(C)C)C1CC1=CC=CC=C1 LQKSHSFQQRCAFW-UHFFFAOYSA-N 0.000 description 1
- 206010013886 Dysaesthesia Diseases 0.000 description 1
- 206010013887 Dysarthria Diseases 0.000 description 1
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 1
- 239000001692 EU approved anti-caking agent Substances 0.000 description 1
- 102100025137 Early activation antigen CD69 Human genes 0.000 description 1
- 102000004190 Enzymes Human genes 0.000 description 1
- 108090000790 Enzymes Proteins 0.000 description 1
- HTIJFSOGRVMCQR-UHFFFAOYSA-N Epirubicin Natural products COc1cccc2C(=O)c3c(O)c4CC(O)(CC(OC5CC(N)C(=O)C(C)O5)c4c(O)c3C(=O)c12)C(=O)CO HTIJFSOGRVMCQR-UHFFFAOYSA-N 0.000 description 1
- HKVAMNSJSFKALM-GKUWKFKPSA-N Everolimus Chemical compound C1C[C@@H](OCCO)[C@H](OC)C[C@@H]1C[C@@H](C)[C@H]1OC(=O)[C@@H]2CCCCN2C(=O)C(=O)[C@](O)(O2)[C@H](C)CC[C@H]2C[C@H](OC)/C(C)=C/C=C/C=C/[C@@H](C)C[C@@H](C)C(=O)[C@H](OC)[C@H](O)/C(C)=C/[C@@H](C)C(=O)C1 HKVAMNSJSFKALM-GKUWKFKPSA-N 0.000 description 1
- 108010008177 Fd immunoglobulins Proteins 0.000 description 1
- 241000282326 Felis catus Species 0.000 description 1
- 108010040721 Flagellin Proteins 0.000 description 1
- GHASVSINZRGABV-UHFFFAOYSA-N Fluorouracil Chemical compound FC1=CNC(=O)NC1=O GHASVSINZRGABV-UHFFFAOYSA-N 0.000 description 1
- 206010017533 Fungal infection Diseases 0.000 description 1
- 108010010803 Gelatin Proteins 0.000 description 1
- 206010064571 Gene mutation Diseases 0.000 description 1
- 108700028146 Genetic Enhancer Elements Proteins 0.000 description 1
- 108010072051 Glatiramer Acetate Proteins 0.000 description 1
- 208000010412 Glaucoma Diseases 0.000 description 1
- 206010018364 Glomerulonephritis Diseases 0.000 description 1
- 206010018634 Gouty Arthritis Diseases 0.000 description 1
- 108010017213 Granulocyte-Macrophage Colony-Stimulating Factor Proteins 0.000 description 1
- 102100039620 Granulocyte-macrophage colony-stimulating factor Human genes 0.000 description 1
- QXZGBUJJYSLZLT-UHFFFAOYSA-N H-Arg-Pro-Pro-Gly-Phe-Ser-Pro-Phe-Arg-OH Natural products NC(N)=NCCCC(N)C(=O)N1CCCC1C(=O)N1C(C(=O)NCC(=O)NC(CC=2C=CC=CC=2)C(=O)NC(CO)C(=O)N2C(CCC2)C(=O)NC(CC=2C=CC=CC=2)C(=O)NC(CCCN=C(N)N)C(O)=O)CCC1 QXZGBUJJYSLZLT-UHFFFAOYSA-N 0.000 description 1
- 239000007995 HEPES buffer Substances 0.000 description 1
- 241000606768 Haemophilus influenzae Species 0.000 description 1
- 239000012981 Hank's balanced salt solution Substances 0.000 description 1
- 101000684275 Homo sapiens ADP-ribosylation factor 3 Proteins 0.000 description 1
- 101000713099 Homo sapiens C-C motif chemokine 20 Proteins 0.000 description 1
- 101000858088 Homo sapiens C-X-C motif chemokine 10 Proteins 0.000 description 1
- 101000934356 Homo sapiens CD70 antigen Proteins 0.000 description 1
- 101000934374 Homo sapiens Early activation antigen CD69 Proteins 0.000 description 1
- 101001011382 Homo sapiens Interferon regulatory factor 3 Proteins 0.000 description 1
- 101001032342 Homo sapiens Interferon regulatory factor 7 Proteins 0.000 description 1
- 101001082060 Homo sapiens Interferon-induced protein with tetratricopeptide repeats 3 Proteins 0.000 description 1
- 101001018097 Homo sapiens L-selectin Proteins 0.000 description 1
- 101001116987 Homo sapiens Proton-coupled folate transporter Proteins 0.000 description 1
- 101001130437 Homo sapiens Ras-related protein Rap-2b Proteins 0.000 description 1
- 101100148631 Homo sapiens SLC46A3 gene Proteins 0.000 description 1
- 101000655462 Homo sapiens Solute carrier family 46 member 3 Proteins 0.000 description 1
- 101000716102 Homo sapiens T-cell surface glycoprotein CD4 Proteins 0.000 description 1
- 101000946843 Homo sapiens T-cell surface glycoprotein CD8 alpha chain Proteins 0.000 description 1
- 101000801234 Homo sapiens Tumor necrosis factor receptor superfamily member 18 Proteins 0.000 description 1
- 101001057508 Homo sapiens Ubiquitin-like protein ISG15 Proteins 0.000 description 1
- 206010020751 Hypersensitivity Diseases 0.000 description 1
- XQFRJNBWHJMXHO-RRKCRQDMSA-N IDUR Chemical compound C1[C@H](O)[C@@H](CO)O[C@H]1N1C(=O)NC(=O)C(I)=C1 XQFRJNBWHJMXHO-RRKCRQDMSA-N 0.000 description 1
- GRSZFWQUAKGDAV-KQYNXXCUSA-N IMP Chemical compound O[C@@H]1[C@H](O)[C@@H](COP(O)(O)=O)O[C@H]1N1C(NC=NC2=O)=C2N=C1 GRSZFWQUAKGDAV-KQYNXXCUSA-N 0.000 description 1
- XDXDZDZNSLXDNA-TZNDIEGXSA-N Idarubicin Chemical compound C1[C@H](N)[C@H](O)[C@H](C)O[C@H]1O[C@@H]1C2=C(O)C(C(=O)C3=CC=CC=C3C3=O)=C3C(O)=C2C[C@@](O)(C(C)=O)C1 XDXDZDZNSLXDNA-TZNDIEGXSA-N 0.000 description 1
- XDXDZDZNSLXDNA-UHFFFAOYSA-N Idarubicin Natural products C1C(N)C(O)C(C)OC1OC1C2=C(O)C(C(=O)C3=CC=CC=C3C3=O)=C3C(O)=C2CC(O)(C(C)=O)C1 XDXDZDZNSLXDNA-UHFFFAOYSA-N 0.000 description 1
- 208000010159 IgA glomerulonephritis Diseases 0.000 description 1
- 206010021263 IgA nephropathy Diseases 0.000 description 1
- 108091008028 Immune checkpoint receptors Proteins 0.000 description 1
- 102000037978 Immune checkpoint receptors Human genes 0.000 description 1
- 206010021639 Incontinence Diseases 0.000 description 1
- 206010061218 Inflammation Diseases 0.000 description 1
- 229930010555 Inosine Natural products 0.000 description 1
- UGQMRVRMYYASKQ-KQYNXXCUSA-N Inosine Chemical compound O[C@@H]1[C@H](O)[C@@H](CO)O[C@H]1N1C2=NC=NC(O)=C2N=C1 UGQMRVRMYYASKQ-KQYNXXCUSA-N 0.000 description 1
- 108090001061 Insulin Proteins 0.000 description 1
- 102000004877 Insulin Human genes 0.000 description 1
- 102100034343 Integrase Human genes 0.000 description 1
- 108010061833 Integrases Proteins 0.000 description 1
- 108010032038 Interferon Regulatory Factor-3 Proteins 0.000 description 1
- 102000007578 Interferon Regulatory Factor-3 Human genes 0.000 description 1
- 102100038070 Interferon regulatory factor 7 Human genes 0.000 description 1
- 102100027302 Interferon-induced protein with tetratricopeptide repeats 3 Human genes 0.000 description 1
- 108090000172 Interleukin-15 Proteins 0.000 description 1
- 108010002350 Interleukin-2 Proteins 0.000 description 1
- 208000005615 Interstitial Cystitis Diseases 0.000 description 1
- 102000002698 KIR Receptors Human genes 0.000 description 1
- 108010043610 KIR Receptors Proteins 0.000 description 1
- 102100035792 Kininogen-1 Human genes 0.000 description 1
- 102100033467 L-selectin Human genes 0.000 description 1
- 239000005411 L01XE02 - Gefitinib Substances 0.000 description 1
- 239000005551 L01XE03 - Erlotinib Substances 0.000 description 1
- 239000002147 L01XE04 - Sunitinib Substances 0.000 description 1
- 239000005511 L01XE05 - Sorafenib Substances 0.000 description 1
- 239000002067 L01XE06 - Dasatinib Substances 0.000 description 1
- 239000002136 L01XE07 - Lapatinib Substances 0.000 description 1
- 239000005536 L01XE08 - Nilotinib Substances 0.000 description 1
- 239000003798 L01XE11 - Pazopanib Substances 0.000 description 1
- 239000002118 L01XE12 - Vandetanib Substances 0.000 description 1
- 239000002145 L01XE14 - Bosutinib Substances 0.000 description 1
- 239000002146 L01XE16 - Crizotinib Substances 0.000 description 1
- 239000002144 L01XE18 - Ruxolitinib Substances 0.000 description 1
- 239000002138 L01XE21 - Regorafenib Substances 0.000 description 1
- 239000002137 L01XE24 - Ponatinib Substances 0.000 description 1
- 239000002176 L01XE26 - Cabozantinib Substances 0.000 description 1
- 239000002177 L01XE27 - Ibrutinib Substances 0.000 description 1
- JVTAAEKCZFNVCJ-UHFFFAOYSA-M Lactate Chemical compound CC(O)C([O-])=O JVTAAEKCZFNVCJ-UHFFFAOYSA-M 0.000 description 1
- 241000283953 Lagomorpha Species 0.000 description 1
- 108090001090 Lectins Proteins 0.000 description 1
- 102000004856 Lectins Human genes 0.000 description 1
- 108010028921 Lipopeptides Proteins 0.000 description 1
- 241000186779 Listeria monocytogenes Species 0.000 description 1
- 108060001084 Luciferase Proteins 0.000 description 1
- 239000005089 Luciferase Substances 0.000 description 1
- FYYHWMGAXLPEAU-UHFFFAOYSA-N Magnesium Chemical compound [Mg] FYYHWMGAXLPEAU-UHFFFAOYSA-N 0.000 description 1
- PWHULOQIROXLJO-UHFFFAOYSA-N Manganese Chemical compound [Mn] PWHULOQIROXLJO-UHFFFAOYSA-N 0.000 description 1
- 229930195725 Mannitol Natural products 0.000 description 1
- 102100025169 Max-binding protein MNT Human genes 0.000 description 1
- 229930126263 Maytansine Natural products 0.000 description 1
- 108010047230 Member 1 Subfamily B ATP Binding Cassette Transporter Proteins 0.000 description 1
- 206010027476 Metastases Diseases 0.000 description 1
- 108700011259 MicroRNAs Proteins 0.000 description 1
- 101710167336 Mitochondrial Rho GTPase Proteins 0.000 description 1
- 241000202889 Mycoplasma salivarium Species 0.000 description 1
- 108010083674 Myelin Proteins Proteins 0.000 description 1
- 102000006386 Myelin Proteins Human genes 0.000 description 1
- 235000009421 Myristica fragrans Nutrition 0.000 description 1
- GXCLVBGFBYZDAG-UHFFFAOYSA-N N-[2-(1H-indol-3-yl)ethyl]-N-methylprop-2-en-1-amine Chemical compound CN(CCC1=CNC2=C1C=CC=C2)CC=C GXCLVBGFBYZDAG-UHFFFAOYSA-N 0.000 description 1
- YALNUENQHAQXEA-UHFFFAOYSA-N N-[4-[(hydroxyamino)-oxomethyl]phenyl]carbamic acid [6-(diethylaminomethyl)-2-naphthalenyl]methyl ester Chemical compound C1=CC2=CC(CN(CC)CC)=CC=C2C=C1COC(=O)NC1=CC=C(C(=O)NO)C=C1 YALNUENQHAQXEA-UHFFFAOYSA-N 0.000 description 1
- ZDZOTLJHXYCWBA-VCVYQWHSSA-N N-debenzoyl-N-(tert-butoxycarbonyl)-10-deacetyltaxol Chemical compound O([C@H]1[C@H]2[C@@](C([C@H](O)C3=C(C)[C@@H](OC(=O)[C@H](O)[C@@H](NC(=O)OC(C)(C)C)C=4C=CC=CC=4)C[C@]1(O)C3(C)C)=O)(C)[C@@H](O)C[C@H]1OC[C@]12OC(=O)C)C(=O)C1=CC=CC=C1 ZDZOTLJHXYCWBA-VCVYQWHSSA-N 0.000 description 1
- PAWIYAYFNXQGAP-UHFFFAOYSA-N N-hydroxy-2-[4-[[(1-methyl-3-indolyl)methylamino]methyl]-1-piperidinyl]-5-pyrimidinecarboxamide Chemical compound C12=CC=CC=C2N(C)C=C1CNCC(CC1)CCN1C1=NC=C(C(=O)NO)C=N1 PAWIYAYFNXQGAP-UHFFFAOYSA-N 0.000 description 1
- 108010084333 N-palmitoyl-S-(2,3-bis(palmitoyloxy)propyl)cysteinyl-seryl-lysyl-lysyl-lysyl-lysine Proteins 0.000 description 1
- 108010057466 NF-kappa B Proteins 0.000 description 1
- 102000003945 NF-kappa B Human genes 0.000 description 1
- 102000012064 NLR Proteins Human genes 0.000 description 1
- 238000005481 NMR spectroscopy Methods 0.000 description 1
- 108091005686 NOD-like receptors Proteins 0.000 description 1
- XRILCFTWUCUKJR-UHFFFAOYSA-N Nc1c2nc[n](C(C3O)OC(COP(O)(OC4C([n]5c(N=C(N)NC6=O)c6nc5)OC(CO5)C4O)=O)C3OP5(O)=O)c2ncn1 Chemical compound Nc1c2nc[n](C(C3O)OC(COP(O)(OC4C([n]5c(N=C(N)NC6=O)c6nc5)OC(CO5)C4O)=O)C3OP5(O)=O)c2ncn1 XRILCFTWUCUKJR-UHFFFAOYSA-N 0.000 description 1
- FAFONCPHZLORMH-UHFFFAOYSA-N Nc1c2nc[n](C(C3OP(O)(OCC(C(C4O)OP(O)(OC5)=O)OC4[n]4c(N=C(N)NC6=O)c6nc4)=O)OC5C3O)c2ncn1 Chemical compound Nc1c2nc[n](C(C3OP(O)(OCC(C(C4O)OP(O)(OC5)=O)OC4[n]4c(N=C(N)NC6=O)c6nc4)=O)OC5C3O)c2ncn1 FAFONCPHZLORMH-UHFFFAOYSA-N 0.000 description 1
- 241000244206 Nematoda Species 0.000 description 1
- 201000004404 Neurofibroma Diseases 0.000 description 1
- 108091028043 Nucleic acid sequence Proteins 0.000 description 1
- RMINQIRDFIBNLE-NNRWGFCXSA-N O-[N-acetyl-alpha-neuraminyl-(2->6)-N-acetyl-alpha-D-galactosaminyl]-L-serine Chemical compound O1[C@H](OC[C@H](N)C(O)=O)[C@H](NC(=O)C)[C@@H](O)[C@@H](O)[C@H]1CO[C@@]1(C(O)=O)O[C@@H]([C@H](O)[C@H](O)CO)[C@H](NC(C)=O)[C@@H](O)C1 RMINQIRDFIBNLE-NNRWGFCXSA-N 0.000 description 1
- YGACXVRLDHEXKY-WXRXAMBDSA-N O[C@H](C[C@H]1c2c(cccc2F)-c2cncn12)[C@H]1CC[C@H](O)CC1 Chemical compound O[C@H](C[C@H]1c2c(cccc2F)-c2cncn12)[C@H]1CC[C@H](O)CC1 YGACXVRLDHEXKY-WXRXAMBDSA-N 0.000 description 1
- 241000283973 Oryctolagus cuniculus Species 0.000 description 1
- 240000007594 Oryza sativa Species 0.000 description 1
- 235000007164 Oryza sativa Nutrition 0.000 description 1
- 102100040557 Osteopontin Human genes 0.000 description 1
- 108010081689 Osteopontin Proteins 0.000 description 1
- 101710116435 Outer membrane protein Proteins 0.000 description 1
- 239000012270 PD-1 inhibitor Substances 0.000 description 1
- 239000012668 PD-1-inhibitor Substances 0.000 description 1
- 239000012271 PD-L1 inhibitor Substances 0.000 description 1
- 239000012648 POLY-ICLC Substances 0.000 description 1
- 229930012538 Paclitaxel Natural products 0.000 description 1
- 108090000526 Papain Proteins 0.000 description 1
- 206010033799 Paralysis Diseases 0.000 description 1
- 208000030852 Parasitic disease Diseases 0.000 description 1
- 235000019483 Peanut oil Nutrition 0.000 description 1
- 241001494479 Pecora Species 0.000 description 1
- 102000057297 Pepsin A Human genes 0.000 description 1
- 108090000284 Pepsin A Proteins 0.000 description 1
- 108010079855 Peptide Aptamers Proteins 0.000 description 1
- 229920000148 Polycarbophil calcium Polymers 0.000 description 1
- 229920002873 Polyethylenimine Polymers 0.000 description 1
- 229920000954 Polyglycolide Polymers 0.000 description 1
- HFVNWDWLWUCIHC-GUPDPFMOSA-N Prednimustine Chemical compound O=C([C@@]1(O)CC[C@H]2[C@H]3[C@@H]([C@]4(C=CC(=O)C=C4CC3)C)[C@@H](O)C[C@@]21C)COC(=O)CCCC1=CC=C(N(CCCl)CCCl)C=C1 HFVNWDWLWUCIHC-GUPDPFMOSA-N 0.000 description 1
- 101800000795 Proadrenomedullin N-20 terminal peptide Proteins 0.000 description 1
- 102100030090 Probable ATP-dependent RNA helicase DHX58 Human genes 0.000 description 1
- 101710127370 Probable head completion protein 1 Proteins 0.000 description 1
- 239000004365 Protease Substances 0.000 description 1
- 108010029485 Protein Isoforms Proteins 0.000 description 1
- 102000001708 Protein Isoforms Human genes 0.000 description 1
- 206010037649 Pyogenic granuloma Diseases 0.000 description 1
- 101150060955 RAB11A gene Proteins 0.000 description 1
- 108091005685 RIG-I-like receptors Proteins 0.000 description 1
- 238000012228 RNA interference-mediated gene silencing Methods 0.000 description 1
- 102100022873 Ras-related protein Rab-11A Human genes 0.000 description 1
- 102100031421 Ras-related protein Rap-2b Human genes 0.000 description 1
- 101710182657 Reduced folate transporter Proteins 0.000 description 1
- 108700008625 Reporter Genes Proteins 0.000 description 1
- 206010038933 Retinopathy of prematurity Diseases 0.000 description 1
- OWPCHSCAPHNHAV-UHFFFAOYSA-N Rhizoxin Natural products C1C(O)C2(C)OC2C=CC(C)C(OC(=O)C2)CC2CC2OC2C(=O)OC1C(C)C(OC)C(C)=CC=CC(C)=CC1=COC(C)=N1 OWPCHSCAPHNHAV-UHFFFAOYSA-N 0.000 description 1
- IWUCXVSUMQZMFG-AFCXAGJDSA-N Ribavirin Chemical compound N1=C(C(=O)N)N=CN1[C@H]1[C@H](O)[C@H](O)[C@@H](CO)O1 IWUCXVSUMQZMFG-AFCXAGJDSA-N 0.000 description 1
- PYMYPHUHKUWMLA-LMVFSUKVSA-N Ribose Natural products OC[C@@H](O)[C@@H](O)[C@@H](O)C=O PYMYPHUHKUWMLA-LMVFSUKVSA-N 0.000 description 1
- 108010038122 S-(2,3-bis(palmitoyloxy)propyl)cysteine Proteins 0.000 description 1
- 108700019718 SAM Domain and HD Domain-Containing Protein 1 Proteins 0.000 description 1
- 101150114242 SAMHD1 gene Proteins 0.000 description 1
- 102000013968 STAT6 Transcription Factor Human genes 0.000 description 1
- 108010011005 STAT6 Transcription Factor Proteins 0.000 description 1
- 229940124639 Selective inhibitor Drugs 0.000 description 1
- 206010040030 Sensory loss Diseases 0.000 description 1
- 206010040047 Sepsis Diseases 0.000 description 1
- 206010040070 Septic Shock Diseases 0.000 description 1
- VYPSYNLAJGMNEJ-UHFFFAOYSA-N Silicium dioxide Chemical compound O=[Si]=O VYPSYNLAJGMNEJ-UHFFFAOYSA-N 0.000 description 1
- 241000700584 Simplexvirus Species 0.000 description 1
- DBMJMQXJHONAFJ-UHFFFAOYSA-M Sodium laurylsulphate Chemical compound [Na+].CCCCCCCCCCCCOS([O-])(=O)=O DBMJMQXJHONAFJ-UHFFFAOYSA-M 0.000 description 1
- UIRKNQLZZXALBI-MSVGPLKSSA-N Squalamine Chemical compound C([C@@H]1C[C@H]2O)[C@@H](NCCCNCCCCN)CC[C@]1(C)[C@@H]1[C@@H]2[C@@H]2CC[C@H]([C@H](C)CC[C@H](C(C)C)OS(O)(=O)=O)[C@@]2(C)CC1 UIRKNQLZZXALBI-MSVGPLKSSA-N 0.000 description 1
- UIRKNQLZZXALBI-UHFFFAOYSA-N Squalamine Natural products OC1CC2CC(NCCCNCCCCN)CCC2(C)C2C1C1CCC(C(C)CCC(C(C)C)OS(O)(=O)=O)C1(C)CC2 UIRKNQLZZXALBI-UHFFFAOYSA-N 0.000 description 1
- XNKLLVCARDGLGL-JGVFFNPUSA-N Stavudine Chemical compound O=C1NC(=O)C(C)=CN1[C@H]1C=C[C@@H](CO)O1 XNKLLVCARDGLGL-JGVFFNPUSA-N 0.000 description 1
- 108010090804 Streptavidin Proteins 0.000 description 1
- QAOWNCQODCNURD-UHFFFAOYSA-L Sulfate Chemical compound [O-]S([O-])(=O)=O QAOWNCQODCNURD-UHFFFAOYSA-L 0.000 description 1
- 206010051379 Systemic Inflammatory Response Syndrome Diseases 0.000 description 1
- 102100036011 T-cell surface glycoprotein CD4 Human genes 0.000 description 1
- 102100034922 T-cell surface glycoprotein CD8 alpha chain Human genes 0.000 description 1
- 210000001744 T-lymphocyte Anatomy 0.000 description 1
- NAVMQTYZDKMPEU-UHFFFAOYSA-N Targretin Chemical compound CC1=CC(C(CCC2(C)C)(C)C)=C2C=C1C(=C)C1=CC=C(C(O)=O)C=C1 NAVMQTYZDKMPEU-UHFFFAOYSA-N 0.000 description 1
- 229940123237 Taxane Drugs 0.000 description 1
- 108010017842 Telomerase Proteins 0.000 description 1
- CBPNZQVSJQDFBE-FUXHJELOSA-N Temsirolimus Chemical compound C1C[C@@H](OC(=O)C(C)(CO)CO)[C@H](OC)C[C@@H]1C[C@@H](C)[C@H]1OC(=O)[C@@H]2CCCCN2C(=O)C(=O)[C@](O)(O2)[C@H](C)CC[C@H]2C[C@H](OC)/C(C)=C/C=C/C=C/[C@@H](C)C[C@@H](C)C(=O)[C@H](OC)[C@H](O)/C(C)=C/[C@@H](C)C(=O)C1 CBPNZQVSJQDFBE-FUXHJELOSA-N 0.000 description 1
- 244000269722 Thea sinensis Species 0.000 description 1
- JZRWCGZRTZMZEH-UHFFFAOYSA-N Thiamine Natural products CC1=C(CCO)SC=[N+]1CC1=CN=C(C)N=C1N JZRWCGZRTZMZEH-UHFFFAOYSA-N 0.000 description 1
- 241000390203 Trachoma Species 0.000 description 1
- 102000004338 Transferrin Human genes 0.000 description 1
- 108090000901 Transferrin Proteins 0.000 description 1
- 206010052779 Transplant rejections Diseases 0.000 description 1
- 108060008682 Tumor Necrosis Factor Proteins 0.000 description 1
- 102000000852 Tumor Necrosis Factor-alpha Human genes 0.000 description 1
- 102100033728 Tumor necrosis factor receptor superfamily member 18 Human genes 0.000 description 1
- 102100040245 Tumor necrosis factor receptor superfamily member 5 Human genes 0.000 description 1
- 208000029265 Type 1 interferonopathy Diseases 0.000 description 1
- 102100027266 Ubiquitin-like protein ISG15 Human genes 0.000 description 1
- 201000006704 Ulcerative Colitis Diseases 0.000 description 1
- 206010047115 Vasculitis Diseases 0.000 description 1
- 241000251539 Vertebrata <Metazoa> Species 0.000 description 1
- 208000012886 Vertigo Diseases 0.000 description 1
- 241000607626 Vibrio cholerae Species 0.000 description 1
- OIRDTQYFTABQOQ-UHTZMRCNSA-N Vidarabine Chemical compound C1=NC=2C(N)=NC=NC=2N1[C@@H]1O[C@H](CO)[C@@H](O)[C@@H]1O OIRDTQYFTABQOQ-UHTZMRCNSA-N 0.000 description 1
- JXLYSJRDGCGARV-WWYNWVTFSA-N Vinblastine Natural products O=C(O[C@H]1[C@](O)(C(=O)OC)[C@@H]2N(C)c3c(cc(c(OC)c3)[C@]3(C(=O)OC)c4[nH]c5c(c4CCN4C[C@](O)(CC)C[C@H](C3)C4)cccc5)[C@@]32[C@H]2[C@@]1(CC)C=CCN2CC3)C JXLYSJRDGCGARV-WWYNWVTFSA-N 0.000 description 1
- 108010015780 Viral Core Proteins Proteins 0.000 description 1
- 108700005077 Viral Genes Proteins 0.000 description 1
- WREGKURFCTUGRC-POYBYMJQSA-N Zalcitabine Chemical compound O=C1N=C(N)C=CN1[C@@H]1O[C@H](CO)CC1 WREGKURFCTUGRC-POYBYMJQSA-N 0.000 description 1
- HCHKCACWOHOZIP-UHFFFAOYSA-N Zinc Chemical compound [Zn] HCHKCACWOHOZIP-UHFFFAOYSA-N 0.000 description 1
- 101710185494 Zinc finger protein Proteins 0.000 description 1
- 102100023597 Zinc finger protein 816 Human genes 0.000 description 1
- 229960004748 abacavir Drugs 0.000 description 1
- MCGSCOLBFJQGHM-SCZZXKLOSA-N abacavir Chemical compound C=12N=CN([C@H]3C=C[C@@H](CO)C3)C2=NC(N)=NC=1NC1CC1 MCGSCOLBFJQGHM-SCZZXKLOSA-N 0.000 description 1
- 229960000446 abciximab Drugs 0.000 description 1
- 229950001573 abemaciclib Drugs 0.000 description 1
- 229950008805 abexinostat Drugs 0.000 description 1
- 229960004103 abiraterone acetate Drugs 0.000 description 1
- UVIQSJCZCSLXRZ-UBUQANBQSA-N abiraterone acetate Chemical compound C([C@@H]1[C@]2(C)CC[C@@H]3[C@@]4(C)CC[C@@H](CC4=CC[C@H]31)OC(=O)C)C=C2C1=CC=CN=C1 UVIQSJCZCSLXRZ-UBUQANBQSA-N 0.000 description 1
- WDENQIQQYWYTPO-IBGZPJMESA-N acalabrutinib Chemical compound CC#CC(=O)N1CCC[C@H]1C1=NC(C=2C=CC(=CC=2)C(=O)NC=2N=CC=CC=2)=C2N1C=CN=C2N WDENQIQQYWYTPO-IBGZPJMESA-N 0.000 description 1
- 229950009821 acalabrutinib Drugs 0.000 description 1
- 239000002253 acid Substances 0.000 description 1
- 150000007513 acids Chemical class 0.000 description 1
- 208000004064 acoustic neuroma Diseases 0.000 description 1
- 230000009471 action Effects 0.000 description 1
- 230000009056 active transport Effects 0.000 description 1
- 230000001154 acute effect Effects 0.000 description 1
- 229960000643 adenine Drugs 0.000 description 1
- 239000000443 aerosol Substances 0.000 description 1
- 229960001686 afatinib Drugs 0.000 description 1
- ULXXDDBFHOBEHA-CWDCEQMOSA-N afatinib Chemical compound N1=CN=C2C=C(O[C@@H]3COCC3)C(NC(=O)/C=C/CN(C)C)=CC2=C1NC1=CC=C(F)C(Cl)=C1 ULXXDDBFHOBEHA-CWDCEQMOSA-N 0.000 description 1
- 229950001741 agatolimod Drugs 0.000 description 1
- 206010064930 age-related macular degeneration Diseases 0.000 description 1
- 229960001611 alectinib Drugs 0.000 description 1
- KDGFLJKFZUIJMX-UHFFFAOYSA-N alectinib Chemical compound CCC1=CC=2C(=O)C(C3=CC=C(C=C3N3)C#N)=C3C(C)(C)C=2C=C1N(CC1)CCC1N1CCOCC1 KDGFLJKFZUIJMX-UHFFFAOYSA-N 0.000 description 1
- 229960000548 alemtuzumab Drugs 0.000 description 1
- 229940072056 alginate Drugs 0.000 description 1
- 235000010443 alginic acid Nutrition 0.000 description 1
- 229920000615 alginic acid Polymers 0.000 description 1
- 125000003545 alkoxy group Chemical group 0.000 description 1
- 208000030961 allergic reaction Diseases 0.000 description 1
- HMFHBZSHGGEWLO-UHFFFAOYSA-N alpha-D-Furanose-Ribose Natural products OCC1OC(O)C(O)C1O HMFHBZSHGGEWLO-UHFFFAOYSA-N 0.000 description 1
- VREFGVBLTWBCJP-UHFFFAOYSA-N alprazolam Chemical compound C12=CC(Cl)=CC=C2N2C(C)=NN=C2CN=C1C1=CC=CC=C1 VREFGVBLTWBCJP-UHFFFAOYSA-N 0.000 description 1
- 229960003805 amantadine Drugs 0.000 description 1
- 150000001412 amines Chemical class 0.000 description 1
- 125000000539 amino acid group Chemical group 0.000 description 1
- 125000003277 amino group Chemical group 0.000 description 1
- XCPGHVQEEXUHNC-UHFFFAOYSA-N amsacrine Chemical compound COC1=CC(NS(C)(=O)=O)=CC=C1NC1=C(C=CC=C2)C2=NC2=CC=CC=C12 XCPGHVQEEXUHNC-UHFFFAOYSA-N 0.000 description 1
- 229960001220 amsacrine Drugs 0.000 description 1
- 239000012491 analyte Substances 0.000 description 1
- 230000033115 angiogenesis Effects 0.000 description 1
- 230000002491 angiogenic effect Effects 0.000 description 1
- 229950001104 anhydrovinblastine Drugs 0.000 description 1
- 150000001450 anions Chemical class 0.000 description 1
- 230000003432 anti-folate effect Effects 0.000 description 1
- 230000002223 anti-pathogen Effects 0.000 description 1
- 230000000259 anti-tumor effect Effects 0.000 description 1
- 230000005809 anti-tumor immunity Effects 0.000 description 1
- 230000010056 antibody-dependent cellular cytotoxicity Effects 0.000 description 1
- 238000011319 anticancer therapy Methods 0.000 description 1
- 229940127074 antifolate Drugs 0.000 description 1
- 230000003078 antioxidant effect Effects 0.000 description 1
- 239000000074 antisense oligonucleotide Substances 0.000 description 1
- 238000012230 antisense oligonucleotides Methods 0.000 description 1
- 238000002617 apheresis Methods 0.000 description 1
- 239000007864 aqueous solution Substances 0.000 description 1
- 206010003246 arthritis Diseases 0.000 description 1
- 125000003118 aryl group Chemical group 0.000 description 1
- 235000010323 ascorbic acid Nutrition 0.000 description 1
- 229960005070 ascorbic acid Drugs 0.000 description 1
- 239000011668 ascorbic acid Substances 0.000 description 1
- 108010044540 auristatin Proteins 0.000 description 1
- 229940120638 avastin Drugs 0.000 description 1
- 229960003005 axitinib Drugs 0.000 description 1
- RITAVMQDGBJQJZ-FMIVXFBMSA-N axitinib Chemical compound CNC(=O)C1=CC=CC=C1SC1=CC=C(C(\C=C\C=2N=CC=CC=2)=NN2)C2=C1 RITAVMQDGBJQJZ-FMIVXFBMSA-N 0.000 description 1
- 210000003050 axon Anatomy 0.000 description 1
- 229960002756 azacitidine Drugs 0.000 description 1
- VSRXQHXAPYXROS-UHFFFAOYSA-N azanide;cyclobutane-1,1-dicarboxylic acid;platinum(2+) Chemical compound [NH2-].[NH2-].[Pt+2].OC(=O)C1(C(O)=O)CCC1 VSRXQHXAPYXROS-UHFFFAOYSA-N 0.000 description 1
- 210000003719 b-lymphocyte Anatomy 0.000 description 1
- 229960000794 baclofen Drugs 0.000 description 1
- 208000022362 bacterial infectious disease Diseases 0.000 description 1
- 239000003855 balanced salt solution Substances 0.000 description 1
- 238000002869 basic local alignment search tool Methods 0.000 description 1
- 229960003094 belinostat Drugs 0.000 description 1
- NCNRHFGMJRPRSK-MDZDMXLPSA-N belinostat Chemical compound ONC(=O)\C=C\C1=CC=CC(S(=O)(=O)NC=2C=CC=CC=2)=C1 NCNRHFGMJRPRSK-MDZDMXLPSA-N 0.000 description 1
- 229960002707 bendamustine Drugs 0.000 description 1
- YTKUWDBFDASYHO-UHFFFAOYSA-N bendamustine Chemical compound ClCCN(CCCl)C1=CC=C2N(C)C(CCCC(O)=O)=NC2=C1 YTKUWDBFDASYHO-UHFFFAOYSA-N 0.000 description 1
- DRTQHJPVMGBUCF-PSQAKQOGSA-N beta-L-uridine Natural products O[C@H]1[C@@H](O)[C@H](CO)O[C@@H]1N1C(=O)NC(=O)C=C1 DRTQHJPVMGBUCF-PSQAKQOGSA-N 0.000 description 1
- 229960000397 bevacizumab Drugs 0.000 description 1
- 229960002938 bexarotene Drugs 0.000 description 1
- 229960000997 bicalutamide Drugs 0.000 description 1
- 239000003833 bile salt Substances 0.000 description 1
- 229940093761 bile salts Drugs 0.000 description 1
- ACWZRVQXLIRSDF-UHFFFAOYSA-N binimetinib Chemical compound OCCONC(=O)C=1C=C2N(C)C=NC2=C(F)C=1NC1=CC=C(Br)C=C1F ACWZRVQXLIRSDF-UHFFFAOYSA-N 0.000 description 1
- 229950003054 binimetinib Drugs 0.000 description 1
- 238000001574 biopsy Methods 0.000 description 1
- 229960001561 bleomycin Drugs 0.000 description 1
- OYVAGSVQBOHSSS-UAPAGMARSA-O bleomycin A2 Chemical compound N([C@H](C(=O)N[C@H](C)[C@@H](O)[C@H](C)C(=O)N[C@@H]([C@H](O)C)C(=O)NCCC=1SC=C(N=1)C=1SC=C(N=1)C(=O)NCCC[S+](C)C)[C@@H](O[C@H]1[C@H]([C@@H](O)[C@H](O)[C@H](CO)O1)O[C@@H]1[C@H]([C@@H](OC(N)=O)[C@H](O)[C@@H](CO)O1)O)C=1N=CNC=1)C(=O)C1=NC([C@H](CC(N)=O)NC[C@H](N)C(N)=O)=NC(N)=C1C OYVAGSVQBOHSSS-UAPAGMARSA-O 0.000 description 1
- 239000002981 blocking agent Substances 0.000 description 1
- 210000004369 blood Anatomy 0.000 description 1
- 239000008280 blood Substances 0.000 description 1
- 210000000601 blood cell Anatomy 0.000 description 1
- 210000004204 blood vessel Anatomy 0.000 description 1
- UBJAHGAUPNGZFF-XOVTVWCYSA-N bms-184476 Chemical compound O([C@H]1[C@@H]2[C@]3(OC(C)=O)CO[C@@H]3C[C@@H]([C@]2(C(=O)[C@H](OC(C)=O)C2=C(C)[C@@H](OC(=O)[C@H](O)[C@@H](NC(=O)C=3C=CC=CC=3)C=3C=CC=CC=3)C[C@]1(O)C2(C)C)C)OCSC)C(=O)C1=CC=CC=C1 UBJAHGAUPNGZFF-XOVTVWCYSA-N 0.000 description 1
- 210000002449 bone cell Anatomy 0.000 description 1
- 210000001185 bone marrow Anatomy 0.000 description 1
- UBPYILGKFZZVDX-UHFFFAOYSA-N bosutinib Chemical compound C1=C(Cl)C(OC)=CC(NC=2C3=CC(OC)=C(OCCCN4CCN(C)CC4)C=C3N=CC=2C#N)=C1Cl UBPYILGKFZZVDX-UHFFFAOYSA-N 0.000 description 1
- 229960003736 bosutinib Drugs 0.000 description 1
- QXZGBUJJYSLZLT-FDISYFBBSA-N bradykinin Chemical compound NC(=N)NCCC[C@H](N)C(=O)N1CCC[C@H]1C(=O)N1[C@H](C(=O)NCC(=O)N[C@@H](CC=2C=CC=CC=2)C(=O)N[C@@H](CO)C(=O)N2[C@@H](CCC2)C(=O)N[C@@H](CC=2C=CC=CC=2)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O)CCC1 QXZGBUJJYSLZLT-FDISYFBBSA-N 0.000 description 1
- 210000004556 brain Anatomy 0.000 description 1
- 229960000455 brentuximab vedotin Drugs 0.000 description 1
- 229950004272 brigatinib Drugs 0.000 description 1
- 229960002092 busulfan Drugs 0.000 description 1
- RFCBNSCSPXMEBK-INFSMZHSSA-N c-GMP-AMP Chemical compound C([C@H]1O2)OP(O)(=O)O[C@H]3[C@@H](O)[C@H](N4C5=NC=NC(N)=C5N=C4)O[C@@H]3COP(O)(=O)O[C@H]1[C@@H](O)[C@@H]2N1C(N=C(NC2=O)N)=C2N=C1 RFCBNSCSPXMEBK-INFSMZHSSA-N 0.000 description 1
- 210000004899 c-terminal region Anatomy 0.000 description 1
- BMQGVNUXMIRLCK-OAGWZNDDSA-N cabazitaxel Chemical compound O([C@H]1[C@@H]2[C@]3(OC(C)=O)CO[C@@H]3C[C@@H]([C@]2(C(=O)[C@H](OC)C2=C(C)[C@@H](OC(=O)[C@H](O)[C@@H](NC(=O)OC(C)(C)C)C=3C=CC=CC=3)C[C@]1(O)C2(C)C)C)OC)C(=O)C1=CC=CC=C1 BMQGVNUXMIRLCK-OAGWZNDDSA-N 0.000 description 1
- 229960001573 cabazitaxel Drugs 0.000 description 1
- 229960001292 cabozantinib Drugs 0.000 description 1
- ONIQOQHATWINJY-UHFFFAOYSA-N cabozantinib Chemical compound C=12C=C(OC)C(OC)=CC2=NC=CC=1OC(C=C1)=CC=C1NC(=O)C1(C(=O)NC=2C=CC(F)=CC=2)CC1 ONIQOQHATWINJY-UHFFFAOYSA-N 0.000 description 1
- 229910000389 calcium phosphate Inorganic materials 0.000 description 1
- 235000011010 calcium phosphates Nutrition 0.000 description 1
- 239000012830 cancer therapeutic Substances 0.000 description 1
- 229940022399 cancer vaccine Drugs 0.000 description 1
- 238000009566 cancer vaccine Methods 0.000 description 1
- 125000002915 carbonyl group Chemical group [*:2]C([*:1])=O 0.000 description 1
- 229960004562 carboplatin Drugs 0.000 description 1
- WNRZHQBJSXRYJK-UHFFFAOYSA-N carboxyamidotriazole Chemical compound NC1=C(C(=O)N)N=NN1CC(C=C1Cl)=CC(Cl)=C1C(=O)C1=CC=C(Cl)C=C1 WNRZHQBJSXRYJK-UHFFFAOYSA-N 0.000 description 1
- 229960005243 carmustine Drugs 0.000 description 1
- 230000003197 catalytic effect Effects 0.000 description 1
- 125000002091 cationic group Chemical group 0.000 description 1
- 150000001768 cations Chemical class 0.000 description 1
- 229960000590 celecoxib Drugs 0.000 description 1
- RZEKVGVHFLEQIL-UHFFFAOYSA-N celecoxib Chemical compound C1=CC(C)=CC=C1C1=CC(C(F)(F)F)=NN1C1=CC=C(S(N)(=O)=O)C=C1 RZEKVGVHFLEQIL-UHFFFAOYSA-N 0.000 description 1
- 230000004663 cell proliferation Effects 0.000 description 1
- 230000007541 cellular toxicity Effects 0.000 description 1
- 108010046713 cemadotin Proteins 0.000 description 1
- 229950009017 cemadotin Drugs 0.000 description 1
- 210000003169 central nervous system Anatomy 0.000 description 1
- 229960001602 ceritinib Drugs 0.000 description 1
- WRXDGGCKOUEOPW-UHFFFAOYSA-N ceritinib Chemical compound CC=1C=C(NC=2N=C(NC=3C(=CC=CC=3)NS(=O)(=O)C(C)C)C(Cl)=CN=2)C(OC(C)C)=CC=1C1CCNCC1 WRXDGGCKOUEOPW-UHFFFAOYSA-N 0.000 description 1
- 229960005395 cetuximab Drugs 0.000 description 1
- 238000012512 characterization method Methods 0.000 description 1
- 239000002738 chelating agent Substances 0.000 description 1
- OKYYOKGIPDRZJA-CPSXWDTOSA-N chembl2103792 Chemical compound O=C1NC(=O)C(C)=CN1[C@@H]1O[C@H](COP(O)(=S)O[C@@H]2[C@H](O[C@H](C2)N2C(N=C(N)C=C2)=O)COP(O)(=S)O[C@@H]2[C@H](O[C@H](C2)N2C3=C(C(NC(N)=N3)=O)N=C2)COP(O)(=S)O[C@@H]2[C@H](O[C@H](C2)N2C(NC(=O)C(C)=C2)=O)COP(O)(=S)O[C@@H]2[C@H](O[C@H](C2)N2C(N=C(N)C=C2)=O)COP(O)(=S)O[C@@H]2[C@H](O[C@H](C2)N2C3=C(C(NC(N)=N3)=O)N=C2)COP(O)(=S)O[C@@H]2[C@H](O[C@H](C2)N2C(NC(=O)C(C)=C2)=O)COP(O)(=S)O[C@@H]2[C@H](O[C@H](C2)N2C(NC(=O)C(C)=C2)=O)COP(O)(=S)O[C@@H]2[C@H](O[C@H](C2)N2C(NC(=O)C(C)=C2)=O)COP(O)(=S)O[C@@H]2[C@H](O[C@H](C2)N2C(NC(=O)C(C)=C2)=O)COP(O)(=S)O[C@@H]2[C@H](O[C@H](C2)N2C3=C(C(NC(N)=N3)=O)N=C2)COP(O)(=S)O[C@@H]2[C@H](O[C@H](C2)N2C(NC(=O)C(C)=C2)=O)COP(O)(=S)O[C@@H]2[C@H](O[C@H](C2)N2C(N=C(N)C=C2)=O)COP(O)(=S)O[C@@H]2[C@H](O[C@H](C2)N2C3=C(C(NC(N)=N3)=O)N=C2)COP(O)(=S)O[C@@H]2[C@H](O[C@H](C2)N2C(NC(=O)C(C)=C2)=O)COP(O)(=S)O[C@@H]2[C@H](O[C@H](C2)N2C(NC(=O)C(C)=C2)=O)COP(O)(=S)O[C@@H]2[C@H](O[C@H](C2)N2C(NC(=O)C(C)=C2)=O)COP(O)(=S)O[C@@H]2[C@H](O[C@H](C2)N2C(NC(=O)C(C)=C2)=O)COP(O)(=S)O[C@@H]2[C@H](O[C@H](C2)N2C3=C(C(NC(N)=N3)=O)N=C2)COP(O)(=S)O[C@@H]2[C@H](O[C@H](C2)N2C(NC(=O)C(C)=C2)=O)COP(O)(=S)O[C@@H]2[C@H](O[C@H](C2)N2C(N=C(N)C=C2)=O)COP(O)(=S)O[C@@H]2[C@H](O[C@H](C2)N2C3=C(C(NC(N)=N3)=O)N=C2)COP(O)(=S)O[C@@H]2[C@H](O[C@H](C2)N2C(NC(=O)C(C)=C2)=O)COP(O)(=S)O[C@@H]2[C@H](O[C@H](C2)N2C(NC(=O)C(C)=C2)=O)CO)[C@@H](O)C1 OKYYOKGIPDRZJA-CPSXWDTOSA-N 0.000 description 1
- ZXFCRFYULUUSDW-OWXODZSWSA-N chembl2104970 Chemical compound C([C@H]1C2)C3=CC=CC(O)=C3C(=O)C1=C(O)[C@@]1(O)[C@@H]2CC(O)=C(C(=O)N)C1=O ZXFCRFYULUUSDW-OWXODZSWSA-N 0.000 description 1
- 238000012412 chemical coupling Methods 0.000 description 1
- 125000003636 chemical group Chemical group 0.000 description 1
- 238000007385 chemical modification Methods 0.000 description 1
- 229950009221 chidamide Drugs 0.000 description 1
- 229960004630 chlorambucil Drugs 0.000 description 1
- JCKYGMPEJWAADB-UHFFFAOYSA-N chlorambucil Chemical compound OC(=O)CCCC1=CC=C(N(CCCl)CCCl)C=C1 JCKYGMPEJWAADB-UHFFFAOYSA-N 0.000 description 1
- 230000001684 chronic effect Effects 0.000 description 1
- AMLYAMJWYAIXIA-VWNVYAMZSA-N cilengitide Chemical compound N1C(=O)[C@H](CC(O)=O)NC(=O)CNC(=O)[C@H](CCCN=C(N)N)NC(=O)[C@H](C(C)C)N(C)C(=O)[C@H]1CC1=CC=CC=C1 AMLYAMJWYAIXIA-VWNVYAMZSA-N 0.000 description 1
- 229950009003 cilengitide Drugs 0.000 description 1
- DQLATGHUWYMOKM-UHFFFAOYSA-L cisplatin Chemical compound N[Pt](N)(Cl)Cl DQLATGHUWYMOKM-UHFFFAOYSA-L 0.000 description 1
- 229960004316 cisplatin Drugs 0.000 description 1
- 239000011248 coating agent Substances 0.000 description 1
- 229960002271 cobimetinib Drugs 0.000 description 1
- RESIMIUSNACMNW-BXRWSSRYSA-N cobimetinib fumarate Chemical compound OC(=O)\C=C\C(O)=O.C1C(O)([C@H]2NCCCC2)CN1C(=O)C1=CC=C(F)C(F)=C1NC1=CC=C(I)C=C1F.C1C(O)([C@H]2NCCCC2)CN1C(=O)C1=CC=C(F)C(F)=C1NC1=CC=C(I)C=C1F RESIMIUSNACMNW-BXRWSSRYSA-N 0.000 description 1
- 229960001338 colchicine Drugs 0.000 description 1
- 239000008139 complexing agent Substances 0.000 description 1
- 229940125773 compound 10 Drugs 0.000 description 1
- 238000010276 construction Methods 0.000 description 1
- 230000030944 contact inhibition Effects 0.000 description 1
- 239000000356 contaminant Substances 0.000 description 1
- 229950002550 copanlisib Drugs 0.000 description 1
- 239000003246 corticosteroid Substances 0.000 description 1
- 229960001334 corticosteroids Drugs 0.000 description 1
- 230000000139 costimulatory effect Effects 0.000 description 1
- 229960005061 crizotinib Drugs 0.000 description 1
- KTEIFNKAUNYNJU-GFCCVEGCSA-N crizotinib Chemical compound O([C@H](C)C=1C(=C(F)C=CC=1Cl)Cl)C(C(=NC=1)N)=CC=1C(=C1)C=NN1C1CCNCC1 KTEIFNKAUNYNJU-GFCCVEGCSA-N 0.000 description 1
- 238000004132 cross linking Methods 0.000 description 1
- 108010006226 cryptophycin Proteins 0.000 description 1
- PSNOPSMXOBPNNV-VVCTWANISA-N cryptophycin 1 Chemical compound C1=C(Cl)C(OC)=CC=C1C[C@@H]1C(=O)NC[C@@H](C)C(=O)O[C@@H](CC(C)C)C(=O)O[C@H]([C@H](C)[C@@H]2[C@H](O2)C=2C=CC=CC=2)C/C=C/C(=O)N1 PSNOPSMXOBPNNV-VVCTWANISA-N 0.000 description 1
- PSNOPSMXOBPNNV-UHFFFAOYSA-N cryptophycin-327 Natural products C1=C(Cl)C(OC)=CC=C1CC1C(=O)NCC(C)C(=O)OC(CC(C)C)C(=O)OC(C(C)C2C(O2)C=2C=CC=CC=2)CC=CC(=O)N1 PSNOPSMXOBPNNV-UHFFFAOYSA-N 0.000 description 1
- 210000004748 cultured cell Anatomy 0.000 description 1
- 238000005520 cutting process Methods 0.000 description 1
- 229940097362 cyclodextrins Drugs 0.000 description 1
- 229960004397 cyclophosphamide Drugs 0.000 description 1
- UHDGCWIWMRVCDJ-ZAKLUEHWSA-N cytidine Chemical compound O=C1N=C(N)C=CN1[C@H]1[C@H](O)[C@@H](O)[C@H](CO)O1 UHDGCWIWMRVCDJ-ZAKLUEHWSA-N 0.000 description 1
- 229940104302 cytosine Drugs 0.000 description 1
- 229960002465 dabrafenib Drugs 0.000 description 1
- BFSMGDJOXZAERB-UHFFFAOYSA-N dabrafenib Chemical compound S1C(C(C)(C)C)=NC(C=2C(=C(NS(=O)(=O)C=3C(=CC=CC=3F)F)C=CC=2)F)=C1C1=CC=NC(N)=N1 BFSMGDJOXZAERB-UHFFFAOYSA-N 0.000 description 1
- 229960003901 dacarbazine Drugs 0.000 description 1
- 229960002806 daclizumab Drugs 0.000 description 1
- 230000006378 damage Effects 0.000 description 1
- 229960002448 dasatinib Drugs 0.000 description 1
- 229960000975 daunorubicin Drugs 0.000 description 1
- 229960003603 decitabine Drugs 0.000 description 1
- 230000002950 deficient Effects 0.000 description 1
- 230000006735 deficit Effects 0.000 description 1
- 238000012217 deletion Methods 0.000 description 1
- 230000037430 deletion Effects 0.000 description 1
- CFCUWKMKBJTWLW-UHFFFAOYSA-N deoliosyl-3C-alpha-L-digitoxosyl-MTM Natural products CC=1C(O)=C2C(O)=C3C(=O)C(OC4OC(C)C(O)C(OC5OC(C)C(O)C(OC6OC(C)C(O)C(C)(O)C6)C5)C4)C(C(OC)C(=O)C(O)C(C)O)CC3=CC2=CC=1OC(OC(C)C1O)CC1OC1CC(O)C(O)C(C)O1 CFCUWKMKBJTWLW-UHFFFAOYSA-N 0.000 description 1
- 201000001981 dermatomyositis Diseases 0.000 description 1
- MXHRCPNRJAMMIM-UHFFFAOYSA-N desoxyuridine Natural products C1C(O)C(CO)OC1N1C(=O)NC(=O)C=C1 MXHRCPNRJAMMIM-UHFFFAOYSA-N 0.000 description 1
- 239000008121 dextrose Substances 0.000 description 1
- 238000003745 diagnosis Methods 0.000 description 1
- 239000000032 diagnostic agent Substances 0.000 description 1
- 229940039227 diagnostic agent Drugs 0.000 description 1
- NEFBYIFKOOEVPA-UHFFFAOYSA-K dicalcium phosphate Chemical compound [Ca+2].[Ca+2].[O-]P([O-])([O-])=O NEFBYIFKOOEVPA-UHFFFAOYSA-K 0.000 description 1
- 229910000390 dicalcium phosphate Inorganic materials 0.000 description 1
- 229940038472 dicalcium phosphate Drugs 0.000 description 1
- 229960002656 didanosine Drugs 0.000 description 1
- RGLYKWWBQGJZGM-ISLYRVAYSA-N diethylstilbestrol Chemical compound C=1C=C(O)C=CC=1C(/CC)=C(\CC)C1=CC=C(O)C=C1 RGLYKWWBQGJZGM-ISLYRVAYSA-N 0.000 description 1
- 230000029087 digestion Effects 0.000 description 1
- LTMHDMANZUZIPE-PUGKRICDSA-N digoxin Chemical compound C1[C@H](O)[C@H](O)[C@@H](C)O[C@H]1O[C@@H]1[C@@H](C)O[C@@H](O[C@@H]2[C@H](O[C@@H](O[C@@H]3C[C@@H]4[C@]([C@@H]5[C@H]([C@]6(CC[C@@H]([C@@]6(C)[C@H](O)C5)C=5COC(=O)C=5)O)CC4)(C)CC3)C[C@@H]2O)C)C[C@@H]1O LTMHDMANZUZIPE-PUGKRICDSA-N 0.000 description 1
- 229960005156 digoxin Drugs 0.000 description 1
- LTMHDMANZUZIPE-UHFFFAOYSA-N digoxine Natural products C1C(O)C(O)C(C)OC1OC1C(C)OC(OC2C(OC(OC3CC4C(C5C(C6(CCC(C6(C)C(O)C5)C=5COC(=O)C=5)O)CC4)(C)CC3)CC2O)C)CC1O LTMHDMANZUZIPE-UHFFFAOYSA-N 0.000 description 1
- 229940042399 direct acting antivirals protease inhibitors Drugs 0.000 description 1
- 230000006806 disease prevention Effects 0.000 description 1
- 239000006185 dispersion Substances 0.000 description 1
- 229960003668 docetaxel Drugs 0.000 description 1
- AMRJKAQTDDKMCE-UHFFFAOYSA-N dolastatin Chemical compound CC(C)C(N(C)C)C(=O)NC(C(C)C)C(=O)N(C)C(C(C)C)C(OC)CC(=O)N1CCCC1C(OC)C(C)C(=O)NC(C=1SC=CN=1)CC1=CC=CC=C1 AMRJKAQTDDKMCE-UHFFFAOYSA-N 0.000 description 1
- 229930188854 dolastatin Natural products 0.000 description 1
- 229960004679 doxorubicin Drugs 0.000 description 1
- 230000002500 effect on skin Effects 0.000 description 1
- 238000004520 electroporation Methods 0.000 description 1
- 239000003995 emulsifying agent Substances 0.000 description 1
- DYLUUSLLRIQKOE-UHFFFAOYSA-N enasidenib Chemical compound N=1C(C=2N=C(C=CC=2)C(F)(F)F)=NC(NCC(C)(O)C)=NC=1NC1=CC=NC(C(F)(F)F)=C1 DYLUUSLLRIQKOE-UHFFFAOYSA-N 0.000 description 1
- 229950010133 enasidenib Drugs 0.000 description 1
- 229950001969 encorafenib Drugs 0.000 description 1
- 210000002889 endothelial cell Anatomy 0.000 description 1
- 230000003511 endothelial effect Effects 0.000 description 1
- 238000005516 engineering process Methods 0.000 description 1
- 229960000980 entecavir Drugs 0.000 description 1
- YXPVEXCTPGULBZ-WQYNNSOESA-N entecavir hydrate Chemical compound O.C1=NC=2C(=O)NC(N)=NC=2N1[C@H]1C[C@H](O)[C@@H](CO)C1=C YXPVEXCTPGULBZ-WQYNNSOESA-N 0.000 description 1
- INVTYAOGFAGBOE-UHFFFAOYSA-N entinostat Chemical compound NC1=CC=CC=C1NC(=O)C(C=C1)=CC=C1CNC(=O)OCC1=CC=CN=C1 INVTYAOGFAGBOE-UHFFFAOYSA-N 0.000 description 1
- 229950005837 entinostat Drugs 0.000 description 1
- 229950000521 entrectinib Drugs 0.000 description 1
- 229960004671 enzalutamide Drugs 0.000 description 1
- WXCXUHSOUPDCQV-UHFFFAOYSA-N enzalutamide Chemical compound C1=C(F)C(C(=O)NC)=CC=C1N1C(C)(C)C(=O)N(C=2C=C(C(C#N)=CC=2)C(F)(F)F)C1=S WXCXUHSOUPDCQV-UHFFFAOYSA-N 0.000 description 1
- 229940088598 enzyme Drugs 0.000 description 1
- 229950006370 epacadostat Drugs 0.000 description 1
- 229960001904 epirubicin Drugs 0.000 description 1
- 229950004444 erdafitinib Drugs 0.000 description 1
- 229960001433 erlotinib Drugs 0.000 description 1
- AAKJLRGGTJKAMG-UHFFFAOYSA-N erlotinib Chemical compound C=12C=C(OCCOC)C(OCCOC)=CC2=NC=NC=1NC1=CC=CC(C#C)=C1 AAKJLRGGTJKAMG-UHFFFAOYSA-N 0.000 description 1
- 229950002017 esorubicin Drugs 0.000 description 1
- ITSGNOIFAJAQHJ-BMFNZSJVSA-N esorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)[C@H]1C[C@H](N)C[C@H](C)O1 ITSGNOIFAJAQHJ-BMFNZSJVSA-N 0.000 description 1
- ADFOJJHRTBFFOF-RBRWEJTLSA-N estramustine phosphate Chemical compound ClCCN(CCCl)C(=O)OC1=CC=C2[C@H]3CC[C@](C)([C@H](CC4)OP(O)(O)=O)[C@@H]4[C@@H]3CCC2=C1 ADFOJJHRTBFFOF-RBRWEJTLSA-N 0.000 description 1
- 229960004750 estramustine phosphate Drugs 0.000 description 1
- JEFPWOBULVSOTM-PPHPATTJSA-N ethyl n-[(2s)-5-amino-2-methyl-3-phenyl-1,2-dihydropyrido[3,4-b]pyrazin-7-yl]carbamate;2-hydroxyethanesulfonic acid Chemical compound OCCS(O)(=O)=O.C=1([C@H](C)NC=2C=C(N=C(N)C=2N=1)NC(=O)OCC)C1=CC=CC=C1 JEFPWOBULVSOTM-PPHPATTJSA-N 0.000 description 1
- VJJPUSNTGOMMGY-MRVIYFEKSA-N etoposide Chemical compound COC1=C(O)C(OC)=CC([C@@H]2C3=CC=4OCOC=4C=C3[C@@H](O[C@H]3[C@@H]([C@@H](O)[C@@H]4O[C@H](C)OC[C@H]4O3)O)[C@@H]3[C@@H]2C(OC3)=O)=C1 VJJPUSNTGOMMGY-MRVIYFEKSA-N 0.000 description 1
- 229960005167 everolimus Drugs 0.000 description 1
- 239000006277 exogenous ligand Substances 0.000 description 1
- 238000002474 experimental method Methods 0.000 description 1
- 239000013604 expression vector Substances 0.000 description 1
- 150000002191 fatty alcohols Chemical class 0.000 description 1
- 239000012894 fetal calf serum Substances 0.000 description 1
- 210000002950 fibroblast Anatomy 0.000 description 1
- 230000002344 fibroplastic effect Effects 0.000 description 1
- DBEPLOCGEIEOCV-WSBQPABSSA-N finasteride Chemical compound N([C@@H]1CC2)C(=O)C=C[C@]1(C)[C@@H]1[C@@H]2[C@@H]2CC[C@H](C(=O)NC(C)(C)C)[C@@]2(C)CC1 DBEPLOCGEIEOCV-WSBQPABSSA-N 0.000 description 1
- 229960004039 finasteride Drugs 0.000 description 1
- 235000013312 flour Nutrition 0.000 description 1
- 108700014844 flt3 ligand Proteins 0.000 description 1
- 229960002949 fluorouracil Drugs 0.000 description 1
- 229960002074 flutamide Drugs 0.000 description 1
- MKXKFYHWDHIYRV-UHFFFAOYSA-N flutamide Chemical compound CC(C)C(=O)NC1=CC=C([N+]([O-])=O)C(C(F)(F)F)=C1 MKXKFYHWDHIYRV-UHFFFAOYSA-N 0.000 description 1
- 108020005243 folate receptor Proteins 0.000 description 1
- 102000006815 folate receptor Human genes 0.000 description 1
- 239000004052 folic acid antagonist Substances 0.000 description 1
- 235000013305 food Nutrition 0.000 description 1
- 231100000221 frame shift mutation induction Toxicity 0.000 description 1
- 230000008014 freezing Effects 0.000 description 1
- 238000007710 freezing Methods 0.000 description 1
- 230000002538 fungal effect Effects 0.000 description 1
- 230000005021 gait Effects 0.000 description 1
- 210000001035 gastrointestinal tract Anatomy 0.000 description 1
- 229960002584 gefitinib Drugs 0.000 description 1
- XGALLCVXEZPNRQ-UHFFFAOYSA-N gefitinib Chemical compound C=12C=C(OCCCN3CCOCC3)C(OC)=CC2=NC=NC=1NC1=CC=C(F)C(Cl)=C1 XGALLCVXEZPNRQ-UHFFFAOYSA-N 0.000 description 1
- 239000008273 gelatin Substances 0.000 description 1
- 229920000159 gelatin Polymers 0.000 description 1
- 235000019322 gelatine Nutrition 0.000 description 1
- 235000011852 gelatine desserts Nutrition 0.000 description 1
- 229960005277 gemcitabine Drugs 0.000 description 1
- SDUQYLNIPVEERB-QPPQHZFASA-N gemcitabine Chemical compound O=C1N=C(N)C=CN1[C@H]1C(F)(F)[C@H](O)[C@@H](CO)O1 SDUQYLNIPVEERB-QPPQHZFASA-N 0.000 description 1
- 238000003209 gene knockout Methods 0.000 description 1
- 238000012239 gene modification Methods 0.000 description 1
- 230000030279 gene silencing Effects 0.000 description 1
- 238000012226 gene silencing method Methods 0.000 description 1
- 230000005017 genetic modification Effects 0.000 description 1
- 235000013617 genetically modified food Nutrition 0.000 description 1
- 210000004602 germ cell Anatomy 0.000 description 1
- 229950010415 givinostat Drugs 0.000 description 1
- 229940042385 glatiramer Drugs 0.000 description 1
- 229940080856 gleevec Drugs 0.000 description 1
- 229940050410 gluconate Drugs 0.000 description 1
- 239000004220 glutamic acid Substances 0.000 description 1
- YQEMORVAKMFKLG-UHFFFAOYSA-N glycerine monostearate Natural products CCCCCCCCCCCCCCCCCC(=O)OC(CO)CO YQEMORVAKMFKLG-UHFFFAOYSA-N 0.000 description 1
- SVUQHVRAGMNPLW-UHFFFAOYSA-N glycerol monostearate Natural products CCCCCCCCCCCCCCCCC(=O)OCC(O)CO SVUQHVRAGMNPLW-UHFFFAOYSA-N 0.000 description 1
- 210000002288 golgi apparatus Anatomy 0.000 description 1
- 229940045808 haemophilus influenzae type b Drugs 0.000 description 1
- 230000036541 health Effects 0.000 description 1
- 238000003505 heat denaturation Methods 0.000 description 1
- 201000011066 hemangioma Diseases 0.000 description 1
- 229940022353 herceptin Drugs 0.000 description 1
- 239000003906 humectant Substances 0.000 description 1
- 229920002674 hyaluronan Polymers 0.000 description 1
- 229960003160 hyaluronic acid Drugs 0.000 description 1
- 229930195733 hydrocarbon Natural products 0.000 description 1
- 150000002430 hydrocarbons Chemical class 0.000 description 1
- 229910052739 hydrogen Inorganic materials 0.000 description 1
- 239000001257 hydrogen Substances 0.000 description 1
- 230000002209 hydrophobic effect Effects 0.000 description 1
- 125000002887 hydroxy group Chemical group [H]O* 0.000 description 1
- 229960002899 hydroxyprogesterone Drugs 0.000 description 1
- 229960001507 ibrutinib Drugs 0.000 description 1
- XYFPWWZEPKGCCK-GOSISDBHSA-N ibrutinib Chemical compound C1=2C(N)=NC=NC=2N([C@H]2CN(CCC2)C(=O)C=C)N=C1C(C=C1)=CC=C1OC1=CC=CC=C1 XYFPWWZEPKGCCK-GOSISDBHSA-N 0.000 description 1
- 229960000908 idarubicin Drugs 0.000 description 1
- 229960004716 idoxuridine Drugs 0.000 description 1
- 229960002411 imatinib Drugs 0.000 description 1
- 229960002751 imiquimod Drugs 0.000 description 1
- DOUYETYNHWVLEO-UHFFFAOYSA-N imiquimod Chemical compound C1=CC=CC2=C3N(CC(C)C)C=NC3=C(N)N=C21 DOUYETYNHWVLEO-UHFFFAOYSA-N 0.000 description 1
- 230000002519 immonomodulatory effect Effects 0.000 description 1
- 230000001900 immune effect Effects 0.000 description 1
- 230000005847 immunogenicity Effects 0.000 description 1
- 239000002955 immunomodulating agent Substances 0.000 description 1
- 229940121354 immunomodulator Drugs 0.000 description 1
- 230000002584 immunomodulator Effects 0.000 description 1
- 230000001024 immunotherapeutic effect Effects 0.000 description 1
- 230000001771 impaired effect Effects 0.000 description 1
- 239000007943 implant Substances 0.000 description 1
- 230000001976 improved effect Effects 0.000 description 1
- 230000002757 inflammatory effect Effects 0.000 description 1
- 230000004054 inflammatory process Effects 0.000 description 1
- 229960000598 infliximab Drugs 0.000 description 1
- 239000004615 ingredient Substances 0.000 description 1
- 230000000977 initiatory effect Effects 0.000 description 1
- 210000005007 innate immune system Anatomy 0.000 description 1
- 229960003786 inosine Drugs 0.000 description 1
- 235000013902 inosinic acid Nutrition 0.000 description 1
- 238000003780 insertion Methods 0.000 description 1
- 230000037431 insertion Effects 0.000 description 1
- 229940125396 insulin Drugs 0.000 description 1
- 229940117681 interleukin-12 Drugs 0.000 description 1
- 210000000936 intestine Anatomy 0.000 description 1
- 238000007918 intramuscular administration Methods 0.000 description 1
- 238000011835 investigation Methods 0.000 description 1
- 230000005865 ionizing radiation Effects 0.000 description 1
- 150000002500 ions Chemical class 0.000 description 1
- 229960004768 irinotecan Drugs 0.000 description 1
- UWKQSNNFCGGAFS-XIFFEERXSA-N irinotecan Chemical compound C1=C2C(CC)=C3CN(C(C4=C([C@@](C(=O)OC4)(O)CC)C=4)=O)C=4C3=NC2=CC=C1OC(=O)N(CC1)CCC1N1CCCCC1 UWKQSNNFCGGAFS-XIFFEERXSA-N 0.000 description 1
- ZLVXBBHTMQJRSX-VMGNSXQWSA-N jdtic Chemical compound C1([C@]2(C)CCN(C[C@@H]2C)C[C@H](C(C)C)NC(=O)[C@@H]2NCC3=CC(O)=CC=C3C2)=CC=CC(O)=C1 ZLVXBBHTMQJRSX-VMGNSXQWSA-N 0.000 description 1
- 230000002147 killing effect Effects 0.000 description 1
- 229960001627 lamivudine Drugs 0.000 description 1
- JTEGQNOMFQHVDC-NKWVEPMBSA-N lamivudine Chemical compound O=C1N=C(N)C=CN1[C@H]1O[C@@H](CO)SC1 JTEGQNOMFQHVDC-NKWVEPMBSA-N 0.000 description 1
- 229960004891 lapatinib Drugs 0.000 description 1
- BCFGMOOMADDAQU-UHFFFAOYSA-N lapatinib Chemical compound O1C(CNCCS(=O)(=O)C)=CC=C1C1=CC=C(N=CN=C2NC=3C=C(Cl)C(OCC=4C=C(F)C=CC=4)=CC=3)C2=C1 BCFGMOOMADDAQU-UHFFFAOYSA-N 0.000 description 1
- 229950005692 larotaxel Drugs 0.000 description 1
- SEFGUGYLLVNFIJ-QDRLFVHASA-N larotaxel dihydrate Chemical compound O.O.O([C@@H]1[C@@]2(C[C@@H](C(C)=C(C2(C)C)[C@H](C([C@@]23[C@H]1[C@@]1(CO[C@@H]1C[C@@H]2C3)OC(C)=O)=O)OC(=O)C)OC(=O)[C@H](O)[C@@H](NC(=O)OC(C)(C)C)C=1C=CC=CC=1)O)C(=O)C1=CC=CC=C1 SEFGUGYLLVNFIJ-QDRLFVHASA-N 0.000 description 1
- 239000002523 lectin Substances 0.000 description 1
- 229950000822 lefitolimod Drugs 0.000 description 1
- 229960004942 lenalidomide Drugs 0.000 description 1
- GOTYRUGSSMKFNF-UHFFFAOYSA-N lenalidomide Chemical compound C1C=2C(N)=CC=CC=2C(=O)N1C1CCC(=O)NC1=O GOTYRUGSSMKFNF-UHFFFAOYSA-N 0.000 description 1
- 229960003784 lenvatinib Drugs 0.000 description 1
- WOSKHXYHFSIKNG-UHFFFAOYSA-N lenvatinib Chemical compound C=12C=C(C(N)=O)C(OC)=CC2=NC=CC=1OC(C=C1Cl)=CC=C1NC(=O)NC1CC1 WOSKHXYHFSIKNG-UHFFFAOYSA-N 0.000 description 1
- 210000000265 leukocyte Anatomy 0.000 description 1
- 150000002617 leukotrienes Chemical class 0.000 description 1
- CMJCXYNUCSMDBY-ZDUSSCGKSA-N lgx818 Chemical compound COC(=O)N[C@@H](C)CNC1=NC=CC(C=2C(=NN(C=2)C(C)C)C=2C(=C(NS(C)(=O)=O)C=C(Cl)C=2)F)=N1 CMJCXYNUCSMDBY-ZDUSSCGKSA-N 0.000 description 1
- UGFHIPBXIWJXNA-UHFFFAOYSA-N liarozole Chemical compound ClC1=CC=CC(C(C=2C=C3NC=NC3=CC=2)N2C=NC=C2)=C1 UGFHIPBXIWJXNA-UHFFFAOYSA-N 0.000 description 1
- 229950007056 liarozole Drugs 0.000 description 1
- 108010052322 limitin Proteins 0.000 description 1
- 230000000670 limiting effect Effects 0.000 description 1
- 229940063721 lioresal Drugs 0.000 description 1
- 150000002632 lipids Chemical class 0.000 description 1
- 210000004185 liver Anatomy 0.000 description 1
- 244000144972 livestock Species 0.000 description 1
- 230000033001 locomotion Effects 0.000 description 1
- 229960002247 lomustine Drugs 0.000 description 1
- 230000007774 longterm Effects 0.000 description 1
- 229960003538 lonidamine Drugs 0.000 description 1
- WDRYRZXSPDWGEB-UHFFFAOYSA-N lonidamine Chemical compound C12=CC=CC=C2C(C(=O)O)=NN1CC1=CC=C(Cl)C=C1Cl WDRYRZXSPDWGEB-UHFFFAOYSA-N 0.000 description 1
- 208000018769 loss of vision Diseases 0.000 description 1
- 231100000864 loss of vision Toxicity 0.000 description 1
- 230000004777 loss-of-function mutation Effects 0.000 description 1
- 239000006210 lotion Substances 0.000 description 1
- 229950005634 loxoribine Drugs 0.000 description 1
- 239000000314 lubricant Substances 0.000 description 1
- 210000004072 lung Anatomy 0.000 description 1
- 206010025135 lupus erythematosus Diseases 0.000 description 1
- 210000004698 lymphocyte Anatomy 0.000 description 1
- 210000003712 lysosome Anatomy 0.000 description 1
- 230000001868 lysosomic effect Effects 0.000 description 1
- 239000001115 mace Substances 0.000 description 1
- 229950000547 mafosfamide Drugs 0.000 description 1
- 239000011777 magnesium Substances 0.000 description 1
- 229910052749 magnesium Inorganic materials 0.000 description 1
- 230000007257 malfunction Effects 0.000 description 1
- 210000004962 mammalian cell Anatomy 0.000 description 1
- 210000001161 mammalian embryo Anatomy 0.000 description 1
- 229910052748 manganese Inorganic materials 0.000 description 1
- 239000011572 manganese Substances 0.000 description 1
- 239000000594 mannitol Substances 0.000 description 1
- 235000010355 mannitol Nutrition 0.000 description 1
- 229950008959 marimastat Drugs 0.000 description 1
- OCSMOTCMPXTDND-OUAUKWLOSA-N marimastat Chemical compound CNC(=O)[C@H](C(C)(C)C)NC(=O)[C@H](CC(C)C)[C@H](O)C(=O)NO OCSMOTCMPXTDND-OUAUKWLOSA-N 0.000 description 1
- 239000011159 matrix material Substances 0.000 description 1
- WKPWGQKGSOKKOO-RSFHAFMBSA-N maytansine Chemical compound CO[C@@H]([C@@]1(O)C[C@](OC(=O)N1)([C@H]([C@@H]1O[C@@]1(C)[C@@H](OC(=O)[C@H](C)N(C)C(C)=O)CC(=O)N1C)C)[H])\C=C\C=C(C)\CC2=CC(OC)=C(Cl)C1=C2 WKPWGQKGSOKKOO-RSFHAFMBSA-N 0.000 description 1
- 229960004961 mechlorethamine Drugs 0.000 description 1
- HAWPXGHAZFHHAD-UHFFFAOYSA-N mechlorethamine Chemical compound ClCCN(C)CCCl HAWPXGHAZFHHAD-UHFFFAOYSA-N 0.000 description 1
- 229960001924 melphalan Drugs 0.000 description 1
- SGDBTWWWUNNDEQ-LBPRGKRZSA-N melphalan Chemical compound OC(=O)[C@@H](N)CC1=CC=C(N(CCCl)CCCl)C=C1 SGDBTWWWUNNDEQ-LBPRGKRZSA-N 0.000 description 1
- 230000009061 membrane transport Effects 0.000 description 1
- 229960001428 mercaptopurine Drugs 0.000 description 1
- 230000009401 metastasis Effects 0.000 description 1
- 230000006510 metastatic growth Effects 0.000 description 1
- 239000004530 micro-emulsion Substances 0.000 description 1
- 239000002679 microRNA Substances 0.000 description 1
- 238000000520 microinjection Methods 0.000 description 1
- 239000004005 microsphere Substances 0.000 description 1
- 229950010895 midostaurin Drugs 0.000 description 1
- BMGQWWVMWDBQGC-IIFHNQTCSA-N midostaurin Chemical compound CN([C@H]1[C@H]([C@]2(C)O[C@@H](N3C4=CC=CC=C4C4=C5C(=O)NCC5=C5C6=CC=CC=C6N2C5=C43)C1)OC)C(=O)C1=CC=CC=C1 BMGQWWVMWDBQGC-IIFHNQTCSA-N 0.000 description 1
- 239000002480 mineral oil Substances 0.000 description 1
- 235000010446 mineral oil Nutrition 0.000 description 1
- CFCUWKMKBJTWLW-BKHRDMLASA-N mithramycin Chemical compound O([C@@H]1C[C@@H](O[C@H](C)[C@H]1O)OC=1C=C2C=C3C[C@H]([C@@H](C(=O)C3=C(O)C2=C(O)C=1C)O[C@@H]1O[C@H](C)[C@@H](O)[C@H](O[C@@H]2O[C@H](C)[C@H](O)[C@H](O[C@@H]3O[C@H](C)[C@@H](O)[C@@](C)(O)C3)C2)C1)[C@H](OC)C(=O)[C@@H](O)[C@@H](C)O)[C@H]1C[C@@H](O)[C@H](O)[C@@H](C)O1 CFCUWKMKBJTWLW-BKHRDMLASA-N 0.000 description 1
- 230000026326 mitochondrial transport Effects 0.000 description 1
- 229960004857 mitomycin Drugs 0.000 description 1
- KKZJGLLVHKMTCM-UHFFFAOYSA-N mitoxantrone Chemical compound O=C1C2=C(O)C=CC(O)=C2C(=O)C2=C1C(NCCNCCO)=CC=C2NCCNCCO KKZJGLLVHKMTCM-UHFFFAOYSA-N 0.000 description 1
- 229960001156 mitoxantrone Drugs 0.000 description 1
- 229960001165 modafinil Drugs 0.000 description 1
- 239000003607 modifier Substances 0.000 description 1
- 210000001616 monocyte Anatomy 0.000 description 1
- 208000018731 motor weakness Diseases 0.000 description 1
- 229960003816 muromonab-cd3 Drugs 0.000 description 1
- 210000003205 muscle Anatomy 0.000 description 1
- 210000000663 muscle cell Anatomy 0.000 description 1
- 229940035363 muscle relaxants Drugs 0.000 description 1
- 210000005012 myelin Anatomy 0.000 description 1
- 210000003007 myelin sheath Anatomy 0.000 description 1
- 239000003158 myorelaxant agent Substances 0.000 description 1
- OLAHOMJCDNXHFI-UHFFFAOYSA-N n'-(3,5-dimethoxyphenyl)-n'-[3-(1-methylpyrazol-4-yl)quinoxalin-6-yl]-n-propan-2-ylethane-1,2-diamine Chemical compound COC1=CC(OC)=CC(N(CCNC(C)C)C=2C=C3N=C(C=NC3=CC=2)C2=CN(C)N=C2)=C1 OLAHOMJCDNXHFI-UHFFFAOYSA-N 0.000 description 1
- WXHHICFWKXDFOW-BJMVGYQFSA-N n-(2-amino-5-fluorophenyl)-4-[[[(e)-3-pyridin-3-ylprop-2-enoyl]amino]methyl]benzamide Chemical compound NC1=CC=C(F)C=C1NC(=O)C(C=C1)=CC=C1CNC(=O)\C=C\C1=CC=CN=C1 WXHHICFWKXDFOW-BJMVGYQFSA-N 0.000 description 1
- SIBDJDZVNXVLEX-QGZVFWFLSA-N n-[(1r)-1-(4-fluorophenyl)ethyl]-3-(2-isoquinolin-3-yl-1h-imidazol-5-yl)benzamide Chemical compound C1([C@H](NC(=O)C=2C=C(C=CC=2)C=2N=C(NC=2)C=2N=CC3=CC=CC=C3C=2)C)=CC=C(F)C=C1 SIBDJDZVNXVLEX-QGZVFWFLSA-N 0.000 description 1
- HAYYBYPASCDWEQ-UHFFFAOYSA-N n-[5-[(3,5-difluorophenyl)methyl]-1h-indazol-3-yl]-4-(4-methylpiperazin-1-yl)-2-(oxan-4-ylamino)benzamide Chemical compound C1CN(C)CCN1C(C=C1NC2CCOCC2)=CC=C1C(=O)NC(C1=C2)=NNC1=CC=C2CC1=CC(F)=CC(F)=C1 HAYYBYPASCDWEQ-UHFFFAOYSA-N 0.000 description 1
- UZWDCWONPYILKI-UHFFFAOYSA-N n-[5-[(4-ethylpiperazin-1-yl)methyl]pyridin-2-yl]-5-fluoro-4-(7-fluoro-2-methyl-3-propan-2-ylbenzimidazol-5-yl)pyrimidin-2-amine Chemical compound C1CN(CC)CCN1CC(C=N1)=CC=C1NC1=NC=C(F)C(C=2C=C3N(C(C)C)C(C)=NC3=C(F)C=2)=N1 UZWDCWONPYILKI-UHFFFAOYSA-N 0.000 description 1
- JFVNFXCESCXMBC-UHFFFAOYSA-N n-[5-[4-chloro-3-(2-hydroxyethylsulfamoyl)phenyl]-4-methyl-1,3-thiazol-2-yl]acetamide Chemical compound S1C(=N/C(=O)C)\NC(C)=C1C1=CC=C(Cl)C(S(=O)(=O)NCCO)=C1 JFVNFXCESCXMBC-UHFFFAOYSA-N 0.000 description 1
- 239000002105 nanoparticle Substances 0.000 description 1
- 229950007250 navoximod Drugs 0.000 description 1
- 239000013642 negative control Substances 0.000 description 1
- 229950008835 neratinib Drugs 0.000 description 1
- JWNPDZNEKVCWMY-VQHVLOKHSA-N neratinib Chemical compound C=12C=C(NC(=O)\C=C\CN(C)C)C(OCC)=CC2=NC=C(C#N)C=1NC(C=C1Cl)=CC=C1OCC1=CC=CC=N1 JWNPDZNEKVCWMY-VQHVLOKHSA-N 0.000 description 1
- 230000004770 neurodegeneration Effects 0.000 description 1
- 208000015122 neurodegenerative disease Diseases 0.000 description 1
- 210000002569 neuron Anatomy 0.000 description 1
- 230000007935 neutral effect Effects 0.000 description 1
- HHZIURLSWUIHRB-UHFFFAOYSA-N nilotinib Chemical compound C1=NC(C)=CN1C1=CC(NC(=O)C=2C=C(NC=3N=C(C=CN=3)C=3C=NC=CC=3)C(C)=CC=2)=CC(C(F)(F)F)=C1 HHZIURLSWUIHRB-UHFFFAOYSA-N 0.000 description 1
- 229960001346 nilotinib Drugs 0.000 description 1
- 229960002653 nilutamide Drugs 0.000 description 1
- XWXYUMMDTVBTOU-UHFFFAOYSA-N nilutamide Chemical compound O=C1C(C)(C)NC(=O)N1C1=CC=C([N+]([O-])=O)C(C(F)(F)F)=C1 XWXYUMMDTVBTOU-UHFFFAOYSA-N 0.000 description 1
- PCHKPVIQAHNQLW-CQSZACIVSA-N niraparib Chemical compound N1=C2C(C(=O)N)=CC=CC2=CN1C(C=C1)=CC=C1[C@@H]1CCCNC1 PCHKPVIQAHNQLW-CQSZACIVSA-N 0.000 description 1
- 229950011068 niraparib Drugs 0.000 description 1
- 239000012457 nonaqueous media Substances 0.000 description 1
- 239000003921 oil Substances 0.000 description 1
- 235000019198 oils Nutrition 0.000 description 1
- 239000002674 ointment Substances 0.000 description 1
- 229960000572 olaparib Drugs 0.000 description 1
- FAQDUNYVKQKNLD-UHFFFAOYSA-N olaparib Chemical compound FC1=CC=C(CC2=C3[CH]C=CC=C3C(=O)N=N2)C=C1C(=O)N(CC1)CCN1C(=O)C1CC1 FAQDUNYVKQKNLD-UHFFFAOYSA-N 0.000 description 1
- 210000004248 oligodendroglia Anatomy 0.000 description 1
- 229960000470 omalizumab Drugs 0.000 description 1
- 229950011093 onapristone Drugs 0.000 description 1
- 150000002894 organic compounds Chemical class 0.000 description 1
- 229960003278 osimertinib Drugs 0.000 description 1
- DUYJMQONPNNFPI-UHFFFAOYSA-N osimertinib Chemical compound COC1=CC(N(C)CCN(C)C)=C(NC(=O)C=C)C=C1NC1=NC=CC(C=2C3=CC=CC=C3N(C)C=2)=N1 DUYJMQONPNNFPI-UHFFFAOYSA-N 0.000 description 1
- 230000003204 osmotic effect Effects 0.000 description 1
- 229960005030 other vaccine in atc Drugs 0.000 description 1
- 229910052760 oxygen Inorganic materials 0.000 description 1
- 239000006179 pH buffering agent Substances 0.000 description 1
- 238000004806 packaging method and process Methods 0.000 description 1
- 229960001592 paclitaxel Drugs 0.000 description 1
- 229960004390 palbociclib Drugs 0.000 description 1
- AHJRHEGDXFFMBM-UHFFFAOYSA-N palbociclib Chemical compound N1=C2N(C3CCCC3)C(=O)C(C(=O)C)=C(C)C2=CN=C1NC(N=C1)=CC=C1N1CCNCC1 AHJRHEGDXFFMBM-UHFFFAOYSA-N 0.000 description 1
- 210000000496 pancreas Anatomy 0.000 description 1
- 229960005184 panobinostat Drugs 0.000 description 1
- FWZRWHZDXBDTFK-ZHACJKMWSA-N panobinostat Chemical compound CC1=NC2=CC=C[CH]C2=C1CCNCC1=CC=C(\C=C\C(=O)NO)C=C1 FWZRWHZDXBDTFK-ZHACJKMWSA-N 0.000 description 1
- 229940055729 papain Drugs 0.000 description 1
- 235000019834 papain Nutrition 0.000 description 1
- 244000045947 parasite Species 0.000 description 1
- 230000003071 parasitic effect Effects 0.000 description 1
- 230000036961 partial effect Effects 0.000 description 1
- 235000015927 pasta Nutrition 0.000 description 1
- 230000007119 pathological manifestation Effects 0.000 description 1
- 230000007170 pathology Effects 0.000 description 1
- 229960000639 pazopanib Drugs 0.000 description 1
- CUIHSIWYWATEQL-UHFFFAOYSA-N pazopanib Chemical compound C1=CC2=C(C)N(C)N=C2C=C1N(C)C(N=1)=CC=NC=1NC1=CC=C(C)C(S(N)(=O)=O)=C1 CUIHSIWYWATEQL-UHFFFAOYSA-N 0.000 description 1
- 229940121655 pd-1 inhibitor Drugs 0.000 description 1
- 229940121656 pd-l1 inhibitor Drugs 0.000 description 1
- 239000000312 peanut oil Substances 0.000 description 1
- 229960002340 pentostatin Drugs 0.000 description 1
- FPVKHBSQESCIEP-JQCXWYLXSA-N pentostatin Chemical compound C1[C@H](O)[C@@H](CO)O[C@H]1N1C(N=CNC[C@H]2O)=C2N=C1 FPVKHBSQESCIEP-JQCXWYLXSA-N 0.000 description 1
- 229940111202 pepsin Drugs 0.000 description 1
- 239000000137 peptide hydrolase inhibitor Substances 0.000 description 1
- 229940083251 peripheral vasodilators purine derivative Drugs 0.000 description 1
- 239000003208 petroleum Substances 0.000 description 1
- 239000008177 pharmaceutical agent Substances 0.000 description 1
- 229940124531 pharmaceutical excipient Drugs 0.000 description 1
- 230000000144 pharmacologic effect Effects 0.000 description 1
- 239000008363 phosphate buffer Substances 0.000 description 1
- 239000002953 phosphate buffered saline Substances 0.000 description 1
- 238000000053 physical method Methods 0.000 description 1
- 239000006187 pill Substances 0.000 description 1
- 230000007505 plaque formation Effects 0.000 description 1
- 239000013612 plasmid Substances 0.000 description 1
- 229960003171 plicamycin Drugs 0.000 description 1
- 210000001778 pluripotent stem cell Anatomy 0.000 description 1
- 229940115270 poly iclc Drugs 0.000 description 1
- 229920000747 poly(lactic acid) Polymers 0.000 description 1
- 229920000768 polyamine Polymers 0.000 description 1
- 229950005134 polycarbophil Drugs 0.000 description 1
- 208000005987 polymyositis Diseases 0.000 description 1
- 229920000136 polysorbate Polymers 0.000 description 1
- PHXJVRSECIGDHY-UHFFFAOYSA-N ponatinib Chemical compound C1CN(C)CCN1CC(C(=C1)C(F)(F)F)=CC=C1NC(=O)C1=CC=C(C)C(C#CC=2N3N=CC=CC3=NC=2)=C1 PHXJVRSECIGDHY-UHFFFAOYSA-N 0.000 description 1
- 229960001131 ponatinib Drugs 0.000 description 1
- 230000001323 posttranslational effect Effects 0.000 description 1
- 239000002243 precursor Substances 0.000 description 1
- 229960004694 prednimustine Drugs 0.000 description 1
- XOFYZVNMUHMLCC-ZPOLXVRWSA-N prednisone Chemical compound O=C1C=C[C@]2(C)[C@H]3C(=O)C[C@](C)([C@@](CC4)(O)C(=O)CO)[C@@H]4[C@@H]3CCC2=C1 XOFYZVNMUHMLCC-ZPOLXVRWSA-N 0.000 description 1
- 229960004618 prednisone Drugs 0.000 description 1
- 239000003755 preservative agent Substances 0.000 description 1
- CPTBDICYNRMXFX-UHFFFAOYSA-N procarbazine Chemical compound CNNCC1=CC=C(C(=O)NC(C)C)C=C1 CPTBDICYNRMXFX-UHFFFAOYSA-N 0.000 description 1
- 229960000624 procarbazine Drugs 0.000 description 1
- 210000001236 prokaryotic cell Anatomy 0.000 description 1
- 230000001737 promoting effect Effects 0.000 description 1
- 230000001681 protective effect Effects 0.000 description 1
- 230000004850 protein–protein interaction Effects 0.000 description 1
- 229940117394 provigil Drugs 0.000 description 1
- 238000000746 purification Methods 0.000 description 1
- 229940083082 pyrimidine derivative acting on arteriolar smooth muscle Drugs 0.000 description 1
- 229950010654 quisinostat Drugs 0.000 description 1
- 230000009467 reduction Effects 0.000 description 1
- 229960004836 regorafenib Drugs 0.000 description 1
- FNHKPVJBJVTLMP-UHFFFAOYSA-N regorafenib Chemical compound C1=NC(C(=O)NC)=CC(OC=2C=C(F)C(NC(=O)NC=3C=C(C(Cl)=CC=3)C(F)(F)F)=CC=2)=C1 FNHKPVJBJVTLMP-UHFFFAOYSA-N 0.000 description 1
- 229950010550 resiquimod Drugs 0.000 description 1
- BXNMTOQRYBFHNZ-UHFFFAOYSA-N resiquimod Chemical compound C1=CC=CC2=C(N(C(COCC)=N3)CC(C)(C)O)C3=C(N)N=C21 BXNMTOQRYBFHNZ-UHFFFAOYSA-N 0.000 description 1
- FECGNJPYVFEKOD-VMPITWQZSA-N resminostat Chemical compound C1=CC(CN(C)C)=CC=C1S(=O)(=O)N1C=C(\C=C\C(=O)NO)C=C1 FECGNJPYVFEKOD-VMPITWQZSA-N 0.000 description 1
- 229950002821 resminostat Drugs 0.000 description 1
- 208000037803 restenosis Diseases 0.000 description 1
- 230000000717 retained effect Effects 0.000 description 1
- 229930002330 retinoic acid Natural products 0.000 description 1
- 230000002441 reversible effect Effects 0.000 description 1
- OWPCHSCAPHNHAV-LMONGJCWSA-N rhizoxin Chemical compound C/C([C@H](OC)[C@@H](C)[C@@H]1C[C@H](O)[C@]2(C)O[C@@H]2/C=C/[C@@H](C)[C@]2([H])OC(=O)C[C@@](C2)(C[C@@H]2O[C@H]2C(=O)O1)[H])=C\C=C\C(\C)=C\C1=COC(C)=N1 OWPCHSCAPHNHAV-LMONGJCWSA-N 0.000 description 1
- 229960000329 ribavirin Drugs 0.000 description 1
- HZCAHMRRMINHDJ-DBRKOABJSA-N ribavirin Natural products O[C@@H]1[C@H](O)[C@@H](CO)O[C@H]1N1N=CN=C1 HZCAHMRRMINHDJ-DBRKOABJSA-N 0.000 description 1
- 229950003687 ribociclib Drugs 0.000 description 1
- 235000009566 rice Nutrition 0.000 description 1
- 229960004641 rituximab Drugs 0.000 description 1
- 229920002477 rna polymer Polymers 0.000 description 1
- OHRURASPPZQGQM-GCCNXGTGSA-N romidepsin Chemical compound O1C(=O)[C@H](C(C)C)NC(=O)C(=C/C)/NC(=O)[C@H]2CSSCC\C=C\[C@@H]1CC(=O)N[C@H](C(C)C)C(=O)N2 OHRURASPPZQGQM-GCCNXGTGSA-N 0.000 description 1
- 229960003452 romidepsin Drugs 0.000 description 1
- 108010091666 romidepsin Proteins 0.000 description 1
- OHRURASPPZQGQM-UHFFFAOYSA-N romidepsin Natural products O1C(=O)C(C(C)C)NC(=O)C(=CC)NC(=O)C2CSSCCC=CC1CC(=O)NC(C(C)C)C(=O)N2 OHRURASPPZQGQM-UHFFFAOYSA-N 0.000 description 1
- HMABYWSNWIZPAG-UHFFFAOYSA-N rucaparib Chemical compound C1=CC(CNC)=CC=C1C(N1)=C2CCNC(=O)C3=C2C1=CC(F)=C3 HMABYWSNWIZPAG-UHFFFAOYSA-N 0.000 description 1
- 229950004707 rucaparib Drugs 0.000 description 1
- 229960000215 ruxolitinib Drugs 0.000 description 1
- HFNKQEVNSGCOJV-OAHLLOKOSA-N ruxolitinib Chemical compound C1([C@@H](CC#N)N2N=CC(=C2)C=2C=3C=CNC=3N=CN=2)CCCC1 HFNKQEVNSGCOJV-OAHLLOKOSA-N 0.000 description 1
- 230000035945 sensitivity Effects 0.000 description 1
- 230000001953 sensory effect Effects 0.000 description 1
- 238000000926 separation method Methods 0.000 description 1
- 230000036303 septic shock Effects 0.000 description 1
- 239000008159 sesame oil Substances 0.000 description 1
- 235000011803 sesame oil Nutrition 0.000 description 1
- 230000019491 signal transduction Effects 0.000 description 1
- 239000000741 silica gel Substances 0.000 description 1
- 229910002027 silica gel Inorganic materials 0.000 description 1
- 235000020183 skimmed milk Nutrition 0.000 description 1
- 210000003491 skin Anatomy 0.000 description 1
- 235000019333 sodium laurylsulphate Nutrition 0.000 description 1
- 210000001082 somatic cell Anatomy 0.000 description 1
- 229960003787 sorafenib Drugs 0.000 description 1
- 239000000600 sorbitol Substances 0.000 description 1
- 229950005814 sotrastaurin Drugs 0.000 description 1
- OAVGBZOFDPFGPJ-UHFFFAOYSA-N sotrastaurin Chemical compound C1CN(C)CCN1C1=NC(C=2C(NC(=O)C=2C=2C3=CC=CC=C3NC=2)=O)=C(C=CC=C2)C2=N1 OAVGBZOFDPFGPJ-UHFFFAOYSA-N 0.000 description 1
- 239000003549 soybean oil Substances 0.000 description 1
- 235000012424 soybean oil Nutrition 0.000 description 1
- 210000000278 spinal cord Anatomy 0.000 description 1
- 210000000952 spleen Anatomy 0.000 description 1
- 229950001248 squalamine Drugs 0.000 description 1
- 239000003381 stabilizer Substances 0.000 description 1
- 239000007858 starting material Substances 0.000 description 1
- 229960001203 stavudine Drugs 0.000 description 1
- 239000008227 sterile water for injection Substances 0.000 description 1
- 150000003431 steroids Chemical class 0.000 description 1
- 210000002784 stomach Anatomy 0.000 description 1
- 229960001052 streptozocin Drugs 0.000 description 1
- ZSJLQEPLLKMAKR-GKHCUFPYSA-N streptozocin Chemical compound O=NN(C)C(=O)N[C@H]1[C@@H](O)O[C@H](CO)[C@@H](O)[C@@H]1O ZSJLQEPLLKMAKR-GKHCUFPYSA-N 0.000 description 1
- 229910052717 sulfur Inorganic materials 0.000 description 1
- 229960001796 sunitinib Drugs 0.000 description 1
- WINHZLLDWRZWRT-ATVHPVEESA-N sunitinib Chemical compound CCN(CC)CCNC(=O)C1=C(C)NC(\C=C/2C3=CC(F)=CC=C3NC\2=O)=C1C WINHZLLDWRZWRT-ATVHPVEESA-N 0.000 description 1
- 239000004094 surface-active agent Substances 0.000 description 1
- 238000001356 surgical procedure Methods 0.000 description 1
- 239000000375 suspending agent Substances 0.000 description 1
- 238000013268 sustained release Methods 0.000 description 1
- 239000012730 sustained-release form Substances 0.000 description 1
- 208000011580 syndromic disease Diseases 0.000 description 1
- 229960001603 tamoxifen Drugs 0.000 description 1
- 229960003102 tasonermin Drugs 0.000 description 1
- RCINICONZNJXQF-MZXODVADSA-N taxol Chemical compound O([C@@H]1[C@@]2(C[C@@H](C(C)=C(C2(C)C)[C@H](C([C@]2(C)[C@@H](O)C[C@H]3OC[C@]3([C@H]21)OC(C)=O)=O)OC(=O)C)OC(=O)[C@H](O)[C@@H](NC(=O)C=1C=CC=CC=1)C=1C=CC=CC=1)O)C(=O)C1=CC=CC=C1 RCINICONZNJXQF-MZXODVADSA-N 0.000 description 1
- 229960005311 telbivudine Drugs 0.000 description 1
- IQFYYKKMVGJFEH-CSMHCCOUSA-N telbivudine Chemical compound O=C1NC(=O)C(C)=CN1[C@H]1O[C@@H](CO)[C@H](O)C1 IQFYYKKMVGJFEH-CSMHCCOUSA-N 0.000 description 1
- 229960000235 temsirolimus Drugs 0.000 description 1
- QFJCIRLUMZQUOT-UHFFFAOYSA-N temsirolimus Natural products C1CC(O)C(OC)CC1CC(C)C1OC(=O)C2CCCCN2C(=O)C(=O)C(O)(O2)C(C)CCC2CC(OC)C(C)=CC=CC=CC(C)CC(C)C(=O)C(OC)C(O)C(C)=CC(C)C(=O)C1 QFJCIRLUMZQUOT-UHFFFAOYSA-N 0.000 description 1
- NRUKOCRGYNPUPR-QBPJDGROSA-N teniposide Chemical compound COC1=C(O)C(OC)=CC([C@@H]2C3=CC=4OCOC=4C=C3[C@@H](O[C@H]3[C@@H]([C@@H](O)[C@@H]4O[C@@H](OC[C@H]4O3)C=3SC=CC=3)O)[C@@H]3[C@@H]2C(OC3)=O)=C1 NRUKOCRGYNPUPR-QBPJDGROSA-N 0.000 description 1
- 229960001278 teniposide Drugs 0.000 description 1
- 238000012360 testing method Methods 0.000 description 1
- 229960003604 testosterone Drugs 0.000 description 1
- 229960003433 thalidomide Drugs 0.000 description 1
- 238000010257 thawing Methods 0.000 description 1
- 229940124597 therapeutic agent Drugs 0.000 description 1
- 235000019157 thiamine Nutrition 0.000 description 1
- KYMBYSLLVAOCFI-UHFFFAOYSA-N thiamine Chemical compound CC1=C(CCO)SCN1CC1=CN=C(C)N=C1N KYMBYSLLVAOCFI-UHFFFAOYSA-N 0.000 description 1
- 229960003495 thiamine Drugs 0.000 description 1
- 239000011721 thiamine Substances 0.000 description 1
- 125000003396 thiol group Chemical group [H]S* 0.000 description 1
- 229940104230 thymidine Drugs 0.000 description 1
- 229940113082 thymine Drugs 0.000 description 1
- 229950007121 tilsotolimod Drugs 0.000 description 1
- 229960003087 tioguanine Drugs 0.000 description 1
- 230000000451 tissue damage Effects 0.000 description 1
- 231100000827 tissue damage Toxicity 0.000 description 1
- 229960000488 tizanidine Drugs 0.000 description 1
- 229960000303 topotecan Drugs 0.000 description 1
- UCFGDBYHRUNTLO-QHCPKHFHSA-N topotecan Chemical compound C1=C(O)C(CN(C)C)=C2C=C(CN3C4=CC5=C(C3=O)COC(=O)[C@]5(O)CC)C4=NC2=C1 UCFGDBYHRUNTLO-QHCPKHFHSA-N 0.000 description 1
- 229960005267 tositumomab Drugs 0.000 description 1
- 231100000167 toxic agent Toxicity 0.000 description 1
- 239000003440 toxic substance Substances 0.000 description 1
- 230000001988 toxicity Effects 0.000 description 1
- 231100000419 toxicity Toxicity 0.000 description 1
- 206010044325 trachoma Diseases 0.000 description 1
- 229960004066 trametinib Drugs 0.000 description 1
- LIRYPHYGHXZJBZ-UHFFFAOYSA-N trametinib Chemical compound CC(=O)NC1=CC=CC(N2C(N(C3CC3)C(=O)C3=C(NC=4C(=CC(I)=CC=4)F)N(C)C(=O)C(C)=C32)=O)=C1 LIRYPHYGHXZJBZ-UHFFFAOYSA-N 0.000 description 1
- 108091006107 transcriptional repressors Proteins 0.000 description 1
- 230000002463 transducing effect Effects 0.000 description 1
- 239000012581 transferrin Substances 0.000 description 1
- 230000009466 transformation Effects 0.000 description 1
- 229960000575 trastuzumab Drugs 0.000 description 1
- 150000003626 triacylglycerols Chemical class 0.000 description 1
- QORWJWZARLRLPR-UHFFFAOYSA-H tricalcium bis(phosphate) Chemical compound [Ca+2].[Ca+2].[Ca+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O QORWJWZARLRLPR-UHFFFAOYSA-H 0.000 description 1
- 229960003962 trifluridine Drugs 0.000 description 1
- VSQQQLOSPVPRAZ-RRKCRQDMSA-N trifluridine Chemical compound C1[C@H](O)[C@@H](CO)O[C@H]1N1C(=O)NC(=O)C(C(F)(F)F)=C1 VSQQQLOSPVPRAZ-RRKCRQDMSA-N 0.000 description 1
- 230000001960 triggered effect Effects 0.000 description 1
- 229960001099 trimetrexate Drugs 0.000 description 1
- NOYPYLRCIDNJJB-UHFFFAOYSA-N trimetrexate Chemical compound COC1=C(OC)C(OC)=CC(NCC=2C(=C3C(N)=NC(N)=NC3=CC=2)C)=C1 NOYPYLRCIDNJJB-UHFFFAOYSA-N 0.000 description 1
- 229940035893 uracil Drugs 0.000 description 1
- DRTQHJPVMGBUCF-UHFFFAOYSA-N uracil arabinoside Natural products OC1C(O)C(CO)OC1N1C(=O)NC(=O)C=C1 DRTQHJPVMGBUCF-UHFFFAOYSA-N 0.000 description 1
- 229960001055 uracil mustard Drugs 0.000 description 1
- 229940045145 uridine Drugs 0.000 description 1
- 230000002485 urinary effect Effects 0.000 description 1
- 229960000241 vandetanib Drugs 0.000 description 1
- UHTHHESEBZOYNR-UHFFFAOYSA-N vandetanib Chemical compound COC1=CC(C(/N=CN2)=N/C=3C(=CC(Br)=CC=3)F)=C2C=C1OCC1CCN(C)CC1 UHTHHESEBZOYNR-UHFFFAOYSA-N 0.000 description 1
- 230000002792 vascular Effects 0.000 description 1
- 210000003556 vascular endothelial cell Anatomy 0.000 description 1
- 230000002227 vasoactive effect Effects 0.000 description 1
- 229950000578 vatalanib Drugs 0.000 description 1
- YCOYDOIWSSHVCK-UHFFFAOYSA-N vatalanib Chemical compound C1=CC(Cl)=CC=C1NC(C1=CC=CC=C11)=NN=C1CC1=CC=NC=C1 YCOYDOIWSSHVCK-UHFFFAOYSA-N 0.000 description 1
- 235000013311 vegetables Nutrition 0.000 description 1
- 229960003862 vemurafenib Drugs 0.000 description 1
- GPXBXXGIAQBQNI-UHFFFAOYSA-N vemurafenib Chemical compound CCCS(=O)(=O)NC1=CC=C(F)C(C(=O)C=2C3=CC(=CN=C3NC=2)C=2C=CC(Cl)=CC=2)=C1F GPXBXXGIAQBQNI-UHFFFAOYSA-N 0.000 description 1
- 229960001183 venetoclax Drugs 0.000 description 1
- LQBVNQSMGBZMKD-UHFFFAOYSA-N venetoclax Chemical compound C=1C=C(Cl)C=CC=1C=1CC(C)(C)CCC=1CN(CC1)CCN1C(C=C1OC=2C=C3C=CNC3=NC=2)=CC=C1C(=O)NS(=O)(=O)C(C=C1[N+]([O-])=O)=CC=C1NCC1CCOCC1 LQBVNQSMGBZMKD-UHFFFAOYSA-N 0.000 description 1
- 231100000889 vertigo Toxicity 0.000 description 1
- 230000035899 viability Effects 0.000 description 1
- 229960003636 vidarabine Drugs 0.000 description 1
- 229960003048 vinblastine Drugs 0.000 description 1
- JXLYSJRDGCGARV-XQKSVPLYSA-N vincaleukoblastine Chemical compound C([C@@H](C[C@]1(C(=O)OC)C=2C(=CC3=C([C@]45[C@H]([C@@]([C@H](OC(C)=O)[C@]6(CC)C=CCN([C@H]56)CC4)(O)C(=O)OC)N3C)C=2)OC)C[C@@](C2)(O)CC)N2CCC2=C1NC1=CC=CC=C21 JXLYSJRDGCGARV-XQKSVPLYSA-N 0.000 description 1
- 229960004528 vincristine Drugs 0.000 description 1
- OGWKCGZFUXNPDA-XQKSVPLYSA-N vincristine Chemical compound C([N@]1C[C@@H](C[C@]2(C(=O)OC)C=3C(=CC4=C([C@]56[C@H]([C@@]([C@H](OC(C)=O)[C@]7(CC)C=CCN([C@H]67)CC5)(O)C(=O)OC)N4C=O)C=3)OC)C[C@@](C1)(O)CC)CC1=C2NC2=CC=CC=C12 OGWKCGZFUXNPDA-XQKSVPLYSA-N 0.000 description 1
- OGWKCGZFUXNPDA-UHFFFAOYSA-N vincristine Natural products C1C(CC)(O)CC(CC2(C(=O)OC)C=3C(=CC4=C(C56C(C(C(OC(C)=O)C7(CC)C=CCN(C67)CC5)(O)C(=O)OC)N4C=O)C=3)OC)CN1CCC1=C2NC2=CC=CC=C12 OGWKCGZFUXNPDA-UHFFFAOYSA-N 0.000 description 1
- 229960005212 vindesine sulfate Drugs 0.000 description 1
- NMDYYWFGPIMTKO-HBVLKOHWSA-N vinflunine Chemical compound C([C@@](C1=C(C2=CC=CC=C2N1)C1)(C2=C(OC)C=C3N(C)[C@@H]4[C@@]5(C3=C2)CCN2CC=C[C@]([C@@H]52)([C@H]([C@]4(O)C(=O)OC)OC(C)=O)CC)C(=O)OC)[C@H]2C[C@@H](C(C)(F)F)CN1C2 NMDYYWFGPIMTKO-HBVLKOHWSA-N 0.000 description 1
- 229960000922 vinflunine Drugs 0.000 description 1
- 229920002554 vinyl polymer Polymers 0.000 description 1
- 230000029812 viral genome replication Effects 0.000 description 1
- 239000013603 viral vector Substances 0.000 description 1
- 230000004393 visual impairment Effects 0.000 description 1
- 235000019154 vitamin C Nutrition 0.000 description 1
- 239000011718 vitamin C Substances 0.000 description 1
- 235000019165 vitamin E Nutrition 0.000 description 1
- 239000011709 vitamin E Substances 0.000 description 1
- 229960000237 vorinostat Drugs 0.000 description 1
- WAEXFXRVDQXREF-UHFFFAOYSA-N vorinostat Chemical compound ONC(=O)CCCCCCC(=O)NC1=CC=CC=C1 WAEXFXRVDQXREF-UHFFFAOYSA-N 0.000 description 1
- 238000009736 wetting Methods 0.000 description 1
- 239000000080 wetting agent Substances 0.000 description 1
- 230000029663 wound healing Effects 0.000 description 1
- 229920001285 xanthan gum Polymers 0.000 description 1
- 229960000523 zalcitabine Drugs 0.000 description 1
- 229940000119 zanaflex Drugs 0.000 description 1
- 229960002555 zidovudine Drugs 0.000 description 1
- HBOMLICNUCNMMY-XLPZGREQSA-N zidovudine Chemical compound O=C1NC(=O)C(C)=CN1[C@@H]1O[C@H](CO)[C@@H](N=[N+]=[N-])C1 HBOMLICNUCNMMY-XLPZGREQSA-N 0.000 description 1
- 239000011701 zinc Substances 0.000 description 1
- 229910052725 zinc Inorganic materials 0.000 description 1
- DGVVWUTYPXICAM-UHFFFAOYSA-N β‐Mercaptoethanol Chemical compound OCCS DGVVWUTYPXICAM-UHFFFAOYSA-N 0.000 description 1
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K45/00—Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
- A61K45/06—Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/495—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with two or more nitrogen atoms as the only ring heteroatoms, e.g. piperazine or tetrazines
- A61K31/496—Non-condensed piperazines containing further heterocyclic rings, e.g. rifampin, thiothixene or sparfloxacin
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/70—Carbohydrates; Sugars; Derivatives thereof
- A61K31/7028—Compounds having saccharide radicals attached to non-saccharide compounds by glycosidic linkages
- A61K31/7034—Compounds having saccharide radicals attached to non-saccharide compounds by glycosidic linkages attached to a carbocyclic compound, e.g. phloridzin
- A61K31/704—Compounds having saccharide radicals attached to non-saccharide compounds by glycosidic linkages attached to a carbocyclic compound, e.g. phloridzin attached to a condensed carbocyclic ring system, e.g. sennosides, thiocolchicosides, escin, daunorubicin
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/70—Carbohydrates; Sugars; Derivatives thereof
- A61K31/7084—Compounds having two nucleosides or nucleotides, e.g. nicotinamide-adenine dinucleotide, flavine-adenine dinucleotide
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
- A61P37/04—Immunostimulants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
- A61P37/06—Immunosuppressants, e.g. drugs for graft rejection
Definitions
- the innate immune system once activated, is directly protective to the host and also initiates broader immune responses mediated by T cells, B cells and NK cells.
- the accumulation of DNA in the cytosol of infected, cancerous or mutant cells can trigger an innate immune response via the cGAS/STING pathway.
- the response is initiated by the binding of cytosolic DNA to the cytosolic enzyme cGAMP synthase (cGAS), leading to the synthesis of the second messenger 2’3’- cyclic GMP-AMP (2’3’-cGAMP).
- 2’3’-cGAMP activates the protein ‘stimulator of interferon genes’ (STING), which in turn activates the transcription factors IRF3 and NF-KB, and consequently the production of cytokines, including type I interferons, that support a broader immune response.
- STING protein ‘stimulator of interferon genes’
- the cGAS/STING pathway senses cytosolic DNA originating from viruses and bacteria. STING is also activated by cytosolic self-DNA, which accumulates in cells in certain autoinflammatory disorders, including Aicardi-Goutieres Syndrome and systemic lupus erythematosus. Furthermore, cytosolic DNA accumulates in cells subjected to DNA damage, as occurs in tumor cells, resulting in activation of the cGAS/STING pathway and the initiation of an anti-tumor immune response.
- the natural anti-tumor immune response can be weak.
- An amplified anti-tumor immune response can occur when STING agonists, such as cyclic dinucleotides (CDNs), are introduced into the tumor microenvironment, leading to immune activation and tumor regression.
- STING agonists such as cyclic dinucleotides (CDNs)
- STING stimulator of interferon genes
- aspects of the methods include modulating Phosphatidylinositol 4-Kinase Beta (PI4KB) recruitment to the Golgi, e.g., via modulation of acyl-coenzyme A binding domain containing 3 (ACBD3) and/or oxysterol-binding protein (OSBP) activity, to modulate STING pathway activation.
- compositions and kits for use in practicing the subject methods find use in a variety of applications, including therapeutic applications, such as methods of treating cancer or an inflammatory disease.
- FIGS. 1 A to 3C provide experimental details as reported in the experimental section, below.
- administering refers without limitation to contact of an exogenous ligand, reagent, placebo, small molecule, pharmaceutical agent, therapeutic agent, diagnostic agent, or composition to the subject, cell, tissue, organ, or biological fluid, and the like.
- administering can refer, e.g., to therapeutic, pharmacokinetic, diagnostic, research, placebo, and experimental methods. Treatment of a cell encompasses contact of a reagent to the cell, as well as contact of a reagent to a fluid, where the fluid is in contact with the cell.
- administering also encompasses in vitro and ex vivo treatments, e.g., of a cell, by a reagent, diagnostic, binding composition, or by another cell.
- administered together it is not meant to be implied that two or more agents be administered as a single composition.
- administration as a single composition is contemplated by the present disclosure, such agents may be delivered to a single subject as separate administrations, which may be at the same or different time, and which may be by the same route or different routes of administration.
- affinity refers to the equilibrium constant for the reversible binding of two agents; “affinity” can be expressed as a dissociation constant (Kd).
- binding refers to a direct association between two molecules, due to, for example, covalent, electrostatic, hydrophobic, and ionic and/or hydrogen-bond interactions, including interactions such as salt bridges and water bridges.
- cell uptake and “cellular uptake” are used interchangeably herein and refer to the movement of a compound from the extracellular environment or matrix and into a cell, e.g., to the cytoplasm of a cell.
- Fv is the minimum antibody fragment which contains a complete antigen- recognition and -binding site. This region consists of a dimer of one heavy- and one light- chain variable domain in tight, non-covalent association. It is in this configuration that the three CDRs of each variable domain interact to define an antigen-binding site on the surface of the VH-VL dimer. Collectively, the six CDRs confer antigen-binding specificity to the antibody. However, even a single variable domain (or half of an Fv comprising only three CDRs specific for an antigen) has the ability to recognize and bind antigen, although at a lower affinity than the entire binding site.
- the “Fab” fragment also contains the constant domain of the light chain and the first constant domain (CH1) of the heavy chain.
- Fab fragments differ from Fab' fragments by the addition of a few residues at the carboxyl terminus of the heavy chain CH1 domain including one or more cysteines from the antibody hinge region.
- Fab'-SH is the designation herein for Fab' in which the cysteine residue(s) of the constant domains bear a free thiol group.
- F(ab')2 antibody fragments originally were produced as pairs of Fab' fragments which have hinge cysteines between them. Other chemical couplings of antibody fragments are also known.
- immunoglobulins The "light chains" of antibodies (immunoglobulins) from any vertebrate species can be assigned to one of two clearly distinct types, called kappa and lambda, based on the amino acid sequences of their constant domains. Depending on the amino acid sequence of the constant domain of their heavy chains, immunoglobulins can be assigned to different classes. There are five major classes of immunoglobulins: IgA, IgD, IgE, IgG, and IgM, and several of these can be further divided into subclasses (isotypes), e.g., lgG1 , lgG2, lgG3, lgG4, IgA, and lgA2.
- immunoglobulins There are five major classes of immunoglobulins: IgA, IgD, IgE, IgG, and IgM, and several of these can be further divided into subclasses (isotypes), e.g., lgG1 ,
- Single-chain Fv or “sFv” antibody fragments comprise the VH and VL domains of antibody, wherein these domains are present in a single polypeptide chain.
- the Fv polypeptide further comprises a polypeptide linker between the VH and VL domains, which enables the sFv to form the desired structure for antigen binding.
- subject refers to a member or members of any mammalian or non-mammalian species that may have a need for the pharmaceutical methods, compositions and treatments described herein.
- Subjects and patients thus include, without limitation, primate (including humans), canine, feline, ungulate (e.g., equine, bovine, swine (e.g., pig)), avian, and other subjects.
- primate including humans
- canine feline
- ungulate e.g., equine, bovine, swine (e.g., pig)
- avian avian
- Humans and non-human animals having commercial importance are of particular interest.
- “Mammal” means a member or members of any mammalian species, and includes, by way of example, canines; felines; equines; bovines; ovines; rodentia, etc. and primates, particularly humans.
- Non-human animal models, particularly mammals, e.g., primate, murine, lagomorpha, etc. may be used for experimental investigations.
- Treating" or “treatment” of a condition or disease includes: (1) preventing at least one symptom of the conditions, i.e., causing a clinical symptom to not significantly develop in a mammal that may be exposed to or predisposed to the disease but does not yet experience or display symptoms of the disease, (2) inhibiting the disease, i.e., arresting or reducing the development of the disease or its symptoms, or (3) relieving the disease, i.e., causing regression of the disease or its clinical symptoms.
- the term “treating” is thus used to refer to both prevention of disease, and treatment of pre-existing conditions.
- the prevention of cellular proliferation can be accomplished by administration of the subject compounds prior to development of overt disease, e.g., to prevent the regrowth of tumors, prevent metastatic growth, etc.
- the compounds are used to treat ongoing disease, by stabilizing or improving the clinical symptoms of the patient.
- STING stimulator of interferon genes
- aspects of the methods include modulating Phosphatidylinositol 4-Kinase Beta (PI4KB) recruitment to the Golgi, e.g., via modulation of acyl-coenzyme A binding domain containing 3 (ACBD3) and/or oxysterol-binding protein (OSBP) activity, to modulate STING pathway activation.
- compositions and kits for use in practicing the subject methods find use in a variety of applications, including therapeutic applications, such as methods of treating cancer or an inflammatory disease.
- modulating STING pathway activation is meant altering STING pathway activation, e.g., by increasing STING pathway activation or decreasing STING pathway activation, or by altering the specific outcomes of STING pathway activation with respect to which cytokines or mediators that are produced.
- embodiments of the invention include methods of increasing STING pathway activation in a cell.
- the magnitude of increase in such embodiments relative to a suitable control e.g., where a PI4KB Golgi recruitment modulating agent, such as described below, is not employed
- Other embodiments of the invention include methods of decreasing STING pathway activation in a cell.
- the magnitude of decrease in such embodiments relative to a suitable control may vary, where in some instances the magnitude is 2-fold or more, such as 5-fold or more, including 10-fold or more.
- aspects of the methods include modulating Phosphatidylinositol 4-Kinase Beta (PI4KB) recruitment to the Golgi in a cell (i.e., PI4KB Golgi recruitment), e.g., via modulation of acyl-coenzyme A binding domain containing 3 (ACBD3) and/or oxysterol-binding protein (OSBP) activity, to modulate STING pathway activation.
- PI4KB is a soluble protein shuttling between the cytoplasm and the nucleus, and can be recruited to the membranes of the Golgi system via protein-protein interactions, e.g.
- the methods include increasing PI4KB Golgi recruitment in a cell.
- the magnitude of increase in such embodiments relative to a suitable control may vary, where in some instances the magnitude is 2-fold or more, such as 5-fold or more, including 10-fold or more.
- Other embodiments of the invention include decreasing PI4KB Golgi recruitment in a cell.
- the magnitude of decrease in such embodiments relative to a suitable control may vary, where in some instances the magnitude is 2-fold or more, such as 5-fold or more, including 10-fold or more.
- the methods may include increasing ACBD3 activity and/or decreasing OSBP activity.
- the methods may include increasing ACBD3 activity in the cell.
- the magnitude of increase in such embodiments relative to a suitable control may vary, where in some instances the magnitude is 2-fold or more, such as 5-fold or more, including 10-fold or more.
- the methods may include decreasing OSBP activity in the cell.
- the magnitude of decrease in such embodiments relative to a suitable control may vary, where in some instances the magnitude is 2-fold or more, such as 5-fold or more, including 10-fold or more.
- the methods include both increasing ACBD3 activity in the cell and decreasing OSBP activity in the cell.
- the methods may include decreasing ACBD3 activity and/or increasing OSBP activity.
- the methods may include decreasing ACBD3 activity in the cell.
- the magnitude of decrease in such embodiments relative to a suitable control may vary, where in some instances the magnitude is 2-fold or more, such as 5-fold or more, including 10-fold or more.
- the methods may include increasing OSBP activity in the cell.
- the magnitude of increase in such embodiments relative to a suitable control may vary, where in some instances the magnitude is 2-fold or more, such as 5-fold or more, including 10-fold or more.
- the methods include both decreasing ACBD3 activity in the cell and increasing OSBP activity in the cell.
- modulating STING pathway activation means increasing or enhancing the activity of a STING agonist, e.g., cyclic dinucleotide (CDN) or other STING agonist (e.g., amidobenzimidazole STING receptor agonists, such as described in Ramanjulu et al., "Design of amidobenzimidazole STING receptor agonists with systemic activity," Nature (2018) 564: 439-443), in a cell, in vitro or in vivo.
- STING pathway activation is increased, one or more activities of a STING agonist, e.g., CDN or other STING agonist, of interest can also be increased or enhanced.
- activities of a STING agonist that are increased or enhanced include, but are not limited to, production of type I interferon (IFN), e.g., to provide an anti-tumor immune response or an immune response against a pathogen, and intercellular 2’3’-cGAMP signaling, e.g., between virus- infected cells and uninfected cells or between tumor cells and non-tumor cells.
- IFN type I interferon
- 2’3’-cGAMP signaling e.g., between virus- infected cells and uninfected cells or between tumor cells and non-tumor cells.
- the parameter of interest e.g., production of a type I interferon in a cell
- 10% or more such as 20% or more, 30% or more, 40% or more, 50% or more, 60% or more, 70% or more, 80% or more, 90% or more, 100% or more, 2-fold or more, 3-fold or more, or even more, e.g., relative to a suitable control.
- Modulating STING pathway activation is meant to encompass enhancing the treatment of a pathologic or disease condition in which a STING agonist, e.g., CDN, finds use, e.g., relative to treatment in the absence of a STING pathway activation modulating agent.
- Pathologic or disease conditions of interest are described herein and include, but are not limited to, cellular proliferative disease, cancer, autoimmune or inflammatory disease, viral infection (e.g., hepatitis virus), infections with intracellular bacteria and parasites.
- Enhancing the treatment of a pathologic or disease condition may include amelioration of the symptoms of a particular condition, arresting or reducing the development of the disease or its symptoms, and/or stabilizing or improving the clinical symptoms of the patient.
- Modulating STING pathway activation is also meant to encompass treatment of a pathologic or disease condition with reduced amounts of a STING agonist as compared to what would otherwise be required in the absence of STING pathway activation in accordance with the present invention.
- modulating STING pathway activation is also meant to encompass treatment of a pathologic or disease condition with effective amount of a CDN that is reduced relative to the amount of the CDN that would otherwise be utilized as effective in the absence of the STING pathway activation modulating agent.
- Modulating STING pathway activation is also meant to encompass treatment of a pathologic or disease condition without administration of a STING agonist, such as a CDN, e.g., where there is intrinsic but weak activation of the pathway due to, e.g.
- dysregulated DNA replication for example in cancer cells, or e.g., in certain infections, such that STING pathway modulation in accordance with embodiments of the invention enhances those responses sufficiently to induce an anti-tumor or anti-pathogen response without applying a STING agonist.
- modulating the STING pathway activation means decreasing or inhibiting the activity of a CDN in a cell, in vitro or in vivo.
- STING pathway activation is decreased, one or more activities of a CDN of interest can also be decreased or inhibited.
- Modulating the activity of a CDN in a cell is meant to encompass ameliorating undesirable side effects of a CDN therapy for a pathologic or disease condition, e.g., relative to CDN therapy in the absence of the PI4KB Golgi recruitment modulating agent.
- activities of a CDN that are decreased or inhibited include, but are not limited to, intercellular 2’3’-cGAMP signaling and cell toxicity.
- the parameter of interest is decreased or inhibited by 10% or more, such as 20% or more, 30% or more, 40% or more, 50% or more, 60% or more, 70% or more, 80% or more, 90% or more, 100% or more, 2-fold or more, 3-fold or more, or even more, e.g., relative to a suitable control.
- aspects of the subject methods include use of agents that modulate PI4KB Golgi recruitment, as described above.
- aspects of the subject methods include contacting a cell with a PI4KB Golgi recruitment-modulating agent to modulate PI4KB Golgi recruitment in a cell thereby modulating STING pathway activation and, in some instances, the activity of the CDN of interest in the cell.
- a PI4KB Golgi recruitment - modulating agent is an agent that is capable of modulating the PI4KB Golgi recruitment either directly (e.g., via direct binding to produce an enhancing or inhibiting effect) or indirectly (e.g., via modulating expression of an activity of interest, e.g., ACDB3 and/or OSBP).
- any convenient agent that is capable of modulating the activity of a target protein can be adapted for use in the subject methods.
- the agent directly binds to a target protein, e.g., ACDB3, OSBP, etc., to modulate its activity.
- the agent acts indirectly, e.g., via modulating expression of the target protein.
- PI4KB Golgi recruitment-modulating agents of interest include, but are not limited to, small molecule, nucleic acid, e.g., RNA or DNA, and peptide, e.g., protein, agents.
- PI4KB Golgi recruitment-modulating agents include small molecule compounds that selectively inhibit the activity of the target protein, e.g., ACDB3 or OSBP, of interest.
- PI4KB Golgi recruitment-modulating agents include small molecules that selectively enhance the activity of the target protein. Small molecule compounds that specifically and directly bind to the target protein are of interest.
- Naturally occurring or synthetic small molecule compounds of interest include numerous chemical classes, such as organic molecules, e.g., small organic compounds having a molecular weight of more than 50 and less than about 2,500 daltons.
- the compounds can include functional groups for structural interaction with proteins, particularly hydrogen bonding, and typically include at least an amine, carbonyl, hydroxyl or carboxyl group, preferably at least two of the functional chemical groups.
- the candidate agents may include cyclical carbon or heterocyclic structures and/or aromatic or polyaromatic structures substituted with one or more of the above functional groups.
- a small molecule inhibitor of OSBP is employed. Any convenient small molecule inhibitor of OSBP may be employed, where examples of such inhibitors include, but are not limited to: 25- hydroxycholesterol [250HC], T-00127-HEV2, AN-12-H5, itraconazole [ITZ], OSW-1 , Osw-1 analogs and conjugates, e.g., as described in published PCT application Publication No. WO2012159027A2, the disclosure of which is herein incorporated by reference, TTP-8307, and the like.
- a small molecule inhibitor of ACBD3 or PI4KB is employed. Any convenient small molecule inhibitor of ACBD3 may be employed.
- any convenient small molecule inhibitor of PI4KB may be employed, where examples of such inhibitors include, but are not limited to: MI356, Compound 10, PIK93, UCB9608, those compounds described in published PCT application Publication Nos. WO2019141694A1 , WO2017055305A1 , WO2017097871 A1 , WO2015193167A1 (the disclosures of which are herein incorporated by reference, those compounds described in Chinese Patent No. CN102453712B and European Patent No.
- EP2319926B1 (the disclosures of which are herein incorporated by reference, those compounds described in Rutaganira et al., "Design and Structural Characterization of Potent and Selective Inhibitors of Phosphatidylinositol 4 Kinase IIIb," J. Med. Chem. (2016) 59: 1830-1839, and the like.
- PI4KB Golgi recruitment-modulating agents are also found among biomolecules including proteins, peptides, saccharides, fatty acids, steroids, purines, pyrimidines, derivatives, structural analogs or combinations thereof. Such molecules may be identified using any convenient methods.
- useful PI4KB Golgi recruitment -modulating agents exhibit an affinity (Kd) for a target protein, such as ACBD3 or OSBP, that is sufficient to provide for the desired modulation of PI4KB Golgi recruitment.
- the affinity of the PI4KB Golgi recruitment -modulating agent can be at least 1 -fold greater, at least 2-fold greater, at least 3-fold greater, at least 4-fold greater, at least 5-fold greater, at least 6-fold greater, at least 7-fold greater, at least 8-fold greater, at least 9-fold greater, at least 10-fold greater, at least 20-fold greater, at least 30-fold greater, at least 40-fold greater, at least 50-fold greater, at least 60-fold greater, at least 70-fold greater, at least 80-fold greater, at least 90-fold greater, at least 100-fold greater, or at least 1000-fold greater, or more, than the affinity of the agent for unrelated protein.
- the affinity of a PI4KB Golgi recruitment - modulating agents to a target protein can be, for example, from about 100 nanomolar (nM) to about 1 nM, from about 100 nanomolar (nM) to about 0.1 nM, from about 100 nM to about 1 picomolar (pM), or from about 100 nM to about 1 femtomolar (fM), or from about 10 nanomolar (nM) to about 0.1 nM.
- the affinity between the agent and a target protein is characterized by a K d (dissociation constant) of 10 6 M or less, such as 10 7 M or less, including 10 8 M or less, e.g., 10 9 M or less, 10 10 M or less, 10 11 M or less, 10 12 M or less, 10 13 M or less, 10 14 M or less, including 10 15 M or less.
- K d dissociation constant
- PI4KB Golgi recruitment-modulating agents include antibodies that specifically bind to a target protein.
- the antibody specifically binds an epitope of the target protein that provides for inhibition of the function of the target protein.
- the antibody specifically binds a distinct epitope of the target protein that provides for the desired modulation of STING pathway activation in a cell.
- Antibodies that can be used as PI4KB Golgi recruitment-modulating agents in connection with the present disclosure can encompass, but are not limited to, monoclonal antibodies, polyclonal antibodies, bispecific antibodies, Fab antibody fragments, F(ab) 2 antibody fragments, Fv antibody fragments (e.g., V H or V L ), single chain Fv antibody fragments and dsFv antibody fragments.
- the antibody molecules can be fully human antibodies, humanized antibodies, or chimeric antibodies.
- the antibodies that can be used in connection with the present disclosure can include any antibody variable region, mature or unprocessed, linked to any immunoglobulin constant region. Minor variations in the amino acid sequences of antibodies or immunoglobulin molecules are encompassed by the present disclosure, providing that the variations in the amino acid sequence maintain 75% or more, e.g., 80% or more, 90% or more, 95% or more, or 99% or more of the sequence.
- conservative amino acid replacements are contemplated. Conservative replacements are those that take place within a family of amino acids that are related in their side chains. Whether an amino acid change results in a functional peptide can be determined by assaying the specific activity of the polypeptide derivative.
- Antibody fragments comprise a portion of an intact antibody, for example, the antigen binding or variable region of the intact antibody.
- antibody fragments include Fab, Fab', F(ab')2, and Fv fragments; diabodies; linear antibodies (Zapata et al., Protein Eng. 8(10): 1057-1062 (1995)); single-chain antibody molecules; and multispecific antibodies formed from antibody fragments.
- Papain digestion of antibodies produces two identical antigen-binding fragments, called “Fab” fragments, each with a single antigen binding site, and a residual "Fc” fragment, a designation reflecting the ability to crystallize readily.
- Pepsin treatment yields an F(ab')2 fragment that has two antigen-combining sites and is still capable of cross-linking antigen.
- Antibodies that can be used in connection with the present disclosure thus can encompass monoclonal antibodies, polyclonal antibodies, bispecific antibodies, Fab antibody fragments, F(ab)2 antibody fragments, Fv antibody fragments (e.g., VH or VL), single chain Fv antibody fragments and dsFv antibody fragments.
- the antibody molecules can be fully human antibodies, humanized antibodies, or chimeric antibodies. In some embodiments, the antibody molecules are monoclonal, fully human antibodies.
- the antibodies that can be used in connection with the present disclosure can include any antibody variable region, mature or unprocessed, linked to any immunoglobulin constant region. If a light chain variable region is linked to a constant region, it can be a kappa chain constant region.
- a heavy chain variable region is linked to a constant region, it can be a human gamma 1 , gamma 2, gamma 3 or gamma 4 constant region, more preferably, gamma 1 , gamma 2 or gamma 4 and even more preferably gamma 1 or gamma 4.
- the PI4KB Golgi recruitment -modulating agent is an antibody.
- the PI4KB Golgi recruitment -modulating agent is an antibody fragment or binding derivative thereof.
- the antibody fragment or binding derivative thereof can be selected from a Fab fragment, a F(ab') 2 fragment, a scFv, a diabody and a triabody.
- the agent modulates the activity of a target protein following expression, such that the agent is one that changes the activity of the protein encoded by the target gene following expression of the protein from the target gene.
- the PI4KB Golgi recruitment- modulating agent modulates expression of the RNA and/or protein from the gene encoding the target protein, such that it changes the expression of the RNA or protein from the target gene in some manner.
- the agent may change expression of the RNA or protein in a number of different ways.
- expression can be reduced by reducing the total amount of wild type protein made by the endogenous locus, and this can be accomplished either by changing the nature of the protein produced (e.g., via gene mutation to generate a loss of function allele such as a null allele or an allele that encodes a protein reduced function) or by reducing the overall levels of protein produced without changing the nature of the protein itself.
- the PI4KB Golgi recruitment-modulating agent is one that reduces, including inhibits, expression of a functional target protein, e.g., ACBD3 or OSBP. Inhibition of protein expression may be accomplished using any convenient means, and one of ordinary skill in the art will be aware of multiple suitable methods.
- RNAi agent such as an shRNA or siRNA that targets the mRNA of an endogenous gene
- mRNA levels post-transcriptionally e.g., using an RNAi agent such as an shRNA or siRNA that targets the mRNA of an endogenous gene
- one can reduce mRNA levels by blocking transcription e
- any convenient inhibitor of expression can be utilized as an antagonist in the subject methods. Such antagonists can act to inhibit expression at a transcriptional, translational, or post-translational level.
- the inhibitors are nucleic-acid based, including, without limitation, DNA, RNA, chimeric RNA/DNA, protein nucleic acid, and other nucleic acid derivatives.
- the expression inhibitors encompass RNA molecules capable of inhibiting receptor production when introduced into a receptorexpressing cell (termed RNAi), including short hairpin double-stranded RNA (shRNA).
- the expression inhibitors are small interfering RNA (siRNA).
- the expression inhibitors are small interfering microRNA. It will be understood that any sequence capable of reducing the cell surface expression of a receptor, or reducing the expression of a receptor ligand, can be used in practicing the methods of the present disclosure.
- agents that inhibit expression of an endogenous gene include but are not limited to: (a) an RNAi agent such as an shRNA or siRNA that specifically targets mRNA encoded by the endogenous gene; (b) a genome editing agent (e.g., a Zinc finger nuclease, a TALEN, a CRISPR/Cas genome editing agent such as Cas9, Cpf1 , CasX, CasY, and the like) that cleaves the target cell’s genomic DNA at a locus encoding the endogenous gene (e.g., ACBD3 or OSBP) - thus inducing a genome editing event (e.g., null allele, partial loss of function allele) at the locus of the endogenous gene; (c) a modified genome editing agent such as a nuclease dead zinc finger, TALE, or CRISPR/Cas nuclease fused to a transcriptional repressor protein that
- Antisense molecules can be used to down-regulate expression of a target gene in the cell.
- the anti-sense reagent may be antisense oligodeoxynucleotides (ODN), particularly synthetic ODN having chemical modifications from native nucleic acids, or nucleic acid constructs that express such anti-sense molecules as RNA.
- ODN antisense oligodeoxynucleotides
- the antisense sequence is complementary to the mRNA of the targeted protein, and inhibits expression of the targeted protein.
- Antisense molecules inhibit gene expression through various mechanisms, e.g., by reducing the amount of mRNA available for translation, through activation of RNAse H, or steric hindrance.
- One or a combination of antisense molecules may be administered, where a combination may include multiple different sequences.
- Antisense oligonucleotides may be chemically synthesized by methods known in the art (see Wagner etal. (1993), supra, and Milligan etal., supra.) Oligonucleotides may be chemically modified from the native phosphodiester structure, in order to increase their intracellular stability and binding affinity. A number of such modifications have been described in the literature, which alter the chemistry of the backbone, sugars or heterocyclic bases.
- catalytic nucleic acid compounds e.g. ribozymes, anti-sense conjugates, etc.
- Ribozymes may be synthesized in vitro and administered to the patient, or may be encoded on an expression vector, from which the ribozyme is synthesized in the targeted cell (for example, see International patent application WO 9523225, and Beigelman etal. (1995), Nucl. Acids Res. 23:4434-42).
- the transcription level of a protein can be regulated by gene silencing using RNAi agents, e.g., double-strand RNA (Sharp (1999) Genes and Development 13: 139-141).
- RNAi such as double-stranded RNA interference (dsRNAi) or small interfering RNA (siRNA)
- dsRNAi double-stranded RNA interference
- siRNA small interfering RNA
- RNAi agents may be dsRNA or a transcriptional template of the interfering ribonucleic acid that can be used to produce dsRNA in a cell.
- a number of options can be utilized to deliver the dsRNA into a cell or population of cells such as in a cell culture, tissue, organ or embryo. For instance, RNA can be directly introduced intracellularly.
- RNA delivery by microinjection see, e.g., Zernicka-Goetz, et al. (1997) Development 124:1133-1137; and Wianny, et al. (1998) Chromosoma 107: 430-439).
- Other options for cellular delivery include permeabilizing the cell membrane and electroporation in the presence of the dsRNA, liposome-mediated transfection, or transfection using chemicals such as calcium phosphate.
- a number of established gene therapy techniques can also be utilized to introduce the dsRNA into a cell. By introducing a viral construct within a viral particle, for instance, one can achieve efficient introduction of an expression construct into the cell and transcription of the RNA encoded by the construct.
- methods include enhancing expression of target protein, e.g., ACBD3 or OSBP, to increase the activity thereof.
- expression of a target protein may be enhanced using any convenient protocol.
- a vector is employed to introduce a nucleic acid coding sequence for the target protein into the cell, whereby the target protein is expressed in the cell.
- a nucleic acid vector that includes a coding sequence for a target protein, e.g., ACBD3 or OSBP.
- the vector is a nucleic acid vector comprising a coding sequence for ACBD3. In some cases, the vector is a nucleic acid vector comprising a coding sequence for OSBP.
- the vector comprises a coding sequence for the target protein, e.g., ACBD3 for enhancing STING pathway activation or OSBP for reducing STING pathway activation, suitable for use in gene therapy.
- Gene therapy vectors of interest include any kind of particle that comprises a polynucleotide fragment encoding the target protein, operably linked to a regulatory element such as a promoter, which allows the expression of a functional target protein in the targeted cells.
- the target protein sequence used in the gene therapy vector may be derived from the same species as the subject. Any convenient target protein sequences, or fragments or functional equivalents thereof, may be utilized in the subject vectors, including sequences from any convenient animal, such as a primate, ungulate, cat, dog, or other domestic pet or domesticated mammal, rabbit, pig, horse, sheep, cow, or a human.
- gene therapy in humans may be carried out using the human target protein sequence, e.g., human ACBD3 or human OSBP coding sequence.
- Human ACBD3 mRNA coding sequence has been assigned NCBI ref seq number NM_022735 and has the following sequence:
- Human ACBD3 has a sequence encoded by the above coding sequence of:
- Human OSBP mRNA coding sequence has been assigned NCBI ref seq number NM_002556 and has the following sequence:
- gagtgtgggt agaaagtccg gagggcaact tccaatttaa ttctgctctg tccggcgcat
- Human OSBP has a sequence encoded by the above coding sequence of:
- “functional equivalent” refers to a nucleic acid molecule that encodes a polypeptide that has target protein activity.
- the functional equivalent may display 50%, 60%, 70%, 80%, 90%, 95%, 98%, 99%, 100% or more activity compared to a parent target protein sequence.
- Functional equivalents may be artificial or naturally-occurring. For example, naturally-occurring variants of the target protein sequence in a population fall within the scope of functional equivalent. Target protein sequences derived from other species also fall within the scope of the term "functional equivalent.
- the functional equivalent is a nucleic acid with a nucleotide sequence having at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.9% identity to the parent sequence.
- the functional equivalent is a polypeptide with an amino acid sequence having at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.9% identity to a parent sequence.
- sequence identity should be calculated along the entire length of the nucleic acid.
- Functional equivalents may contain one or more, e.g.
- nucleotide insertions, deletions and/or substitutions when compared to a parent sequence.
- the term "functional equivalent” also encompasses nucleic acid sequences that encode a target protein polypeptide with at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.9% sequence identity to the parent amino acid sequence, but that show little homology to the parent nucleic acid sequence because of the degeneracy of the genetic code.
- active fragment refers to a nucleic acid molecule that encodes a polypeptide that has target protein activity or polypeptide that has target protein activity, but which is a fragment of the nucleic acid as set forth in the parent polynucleotide sequence or the amino acid sequence as set forth in parent polypeptide sequence.
- An active fragment may be of any size provided that target protein activity is retained.
- a fragment will have at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 100% identity to the parent sequence along the length of the alignment between the shorter fragment and longer parent sequence.
- Fusion proteins including these fragments can be comprised in the nucleic acid vectors needed to carry out the invention.
- an additional 5, 10, 20, 30, 40, 50 or even 100 amino acid residues from the polypeptide sequence, or from a homologous sequence may be included at either or both the C terminal and/or N terminus without prejudicing the ability of the polypeptide fragment to fold correctly and exhibit biological activity.
- Sequence identity may be calculated by any one of the various methods in the art, including for example BLAST (Altschul S F, Gish W, Miller W, Myers E W, Lipman D J (1990). "Basic local alignment search tool". J Mol Biol 215 (3): 403-410) and PASTA (Lipman, D J; Pearson, W R (1985). "Rapid and sensitive protein similarity searches”. Science 227 (4693): 1435-41 ; http://fasta.bioch.virginia.edu/fasta www2/fasta Iist2.shtml) and variations on these alignment programs.
- the vector may further include one or more regulatory sequences. Any convenient regulatory sequences or promoter sequences may be utilized in the subject vectors, e.g., as described herein.
- the regulatory sequence that is operatively linked to the coding sequence is the cytomegalovirus promoter (CMV), although any other convenient regulatory sequences may be utilized.
- CMV cytomegalovirus promoter
- Viruses of interest include, but are not limited to a retrovirus, an adenovirus, an adeno-associated virus (AAV), a herpes simplex virus and a lentivirus.
- Viral gene therapy vectors are well known in the art, see e.g., Heilbronn & Weger (2010) Handb Exp Pharmacal. 197:143-70.
- Vectors of interest include integrative and non-integrative vectors such as those based on retroviruses, adenoviruses (AdV), adeno-associated viruses (AAV), lentiviruses, pox viruses, alphaviruses, and herpes viruses.
- non-integrative viral vectors such as AAV
- non-integrative vectors do not cause any permanent genetic modification.
- the vectors may be targeted to adult tissues to avoid having the subjects under the effect of constitutive telomerase expression from early stages of development.
- non-integrative vectors effectively incorporate a safety mechanism to avoid over-proliferation of target protein expressing cells. The cells may lose the vector (and, as a consequence, the target protein expression) if they start proliferating quickly.
- Non-integrative vectors of interest include those based on adenoviruses (AdV) such as gutless adenoviruses, adeno-associated viruses (AAV), integrase deficient lentiviruses, pox viruses, alphaviruses, and herpes viruses.
- AdV adenoviruses
- AAV adeno-associated viruses
- the non-integrative vector used in the invention is an adeno-associated virus-based non-integrative vector, similar to natural adeno-associated virus particles.
- Examples of adeno-associated virus- based non integrative vectors include vectors based on any AAV serotype, i.e.
- Vectors of interest include those capable of transducing a broad range of tissues at high efficiency, with poor immunogenicity and an excellent safety profile. In some cases, the vectors transduce post-mitotic cells and can sustain long-term gene expression (up to several years) both in small and large animal models of age-related disorders.
- agents that increase or activate expression of an endogenous gene may also be employed, where such agents include, but are not limited to, CRISPR activation (CRISPRa) agents.
- CRISPRa CRISPR activation
- the agent can include both the protein and guide RNA component.
- the guide nucleic acid e.g., guide RNA
- the CRISPR/Cas protein can be introduced into the cell as a protein or as a nucleic acid (mRNA or DNA) encoding the protein.
- Programmable gene editing agents and their guide nucleic acids include, but are not limited to, CRISPR/Cas RNa-guided proteins such as Cas9, CasX,
- Zinc finger proteins such as Zinc finger nucleases, TALE proteins such as TALENs, CRISPR/Cas guide RNAs, and the like.
- the method may further include contacting a cell with a STING agonist, e.g., a CDN or other STING agonist of interest.
- a STING agonist e.g., a CDN or other STING agonist of interest.
- the CDN of interest can be a CDN that is contacted with a cell in vitro or administered to a subject in vivo.
- aspects of the subject methods include contacting a target cell with the CDN of interest.
- CDNs find use in the subject methods in conjunction with the PI4KB Golgi recruitment modulating agents (e.g., as described herein).
- the CDN is naturally occurring. Naturally occurring CDNs of interest include those involved in intercellular signaling, such as 2’3’-cGAMP. In certain instances, the CDN is one that is implicated in a disease or condition associated with aberrant signaling, such as an autoimmune/inflammatory disease (e.g., as described herein). In some cases, the CDN is involved in intercellular signaling between tumor cells and non-tumor cells where amplification of the signal can provide for anti-tumor immunity. In some cases, the CDN is involved in intercellular signaling between virus-infected and uninfected cells where amplification of the signal can provide for anti-viral immunity.
- Naturally occurring CDNs of interest include those involved in intercellular signaling, such as 2’3’-cGAMP.
- the CDN is one that is implicated in a disease or condition associated with aberrant signaling, such as an autoimmune/inflammatory disease (e.g., as described herein).
- the CDN is involved in intercellular signaling between tumor cells and non-tum
- the CDN of interest is a CDN that is produced endogenously in a cell sample in vitro or in vivo by a cell of a subject.
- the endogenously produced CDN is 2’3’-cGAMP.
- aspects of the subject methods include increasing intercellular 2’3’-cGAMP signaling between cells in vivo, such as between virus-infected and uninfected cells for amplification of anti-viral immunity.
- the endogenous production of a CDN of interest can be triggered or enhanced in a CDN producing cell by administration of an CDN production promoting agent, see e.g., Vance et al. in U.S. Publication No. 2014/0329889.
- the CDN is non-naturally occurring.
- the CDN is a CDN drug that finds use in cancer therapeutic applications.
- a variety of CDNs that are agonists of Stimulator of Interferon Genes (STING) find use in cancer immunotherapy, including synthetic CDNs that are analogues of a naturally occurring CDN such as 2’3’- cGAMP.
- An amplified anti-tumor immune response can occur when a CDN STING agonist is delivered to a tumor microenvironment, leading to immune activation and tumor regression.
- cyclic dinucleotide or “CDN” refers to a compound containing two nucleosides (i.e., a first and second nucleoside), wherein the 2’ or 3’ carbon of each nucleoside is linked to the 5’ carbon of the other nucleoside via a phosphodiester internucleoside linkage. Therefore, a 2’-5’ phosphodiester linkage containing CDN refers to a CDN where the 2’ carbon of at least one of the nucleosides is linked to the 5’ carbon of the other nucleoside.
- 2’-5’ phosphodiester linkage containing CDNs can be used in practicing the subject methods to increase production of a type I interferon in a cell or subject.
- the CDN has two 2’-5’ phosphodiester linkages.
- the CDN has a 2’-5’ phosphodiester linkage and a 3’-5’ phosphodiester linkage.
- the CDN has two 3’-5’ phosphodiester linkages.
- Cyclic-di-nucleotides include those specifically described herein as well as isoforms (e.g., tautomers) of those specifically described herein that can be used in practicing the subject methods.
- a “cyclic-di-nucleotide” also includes all of the stereoisomeric forms of the cyclic-di-nucleotides described herein.
- nucleoside refers to a composition containing a nitrogenous base covalently attached to a sugar (e.g., ribose or deoxyribose) or an analog thereof.
- examples of nucleosides include, but are not limited to, cytidine, uridine, adenosine, guanosine, thymidine and inosine.
- nitrogenous base refers to a nitrogen-containing heterocycle having the chemical properties of a nucleobase.
- Nitrogenous bases of interest include, but are not limited to, pyrimidines (e.g., cytosine, thymine, and uracil) and purines (e.g., adenine and guanine), as well as substituted pyrimidine derivatives and substituted purine derivatives, pyrimidine analogs and purine analogs, and tautomers thereof.
- pyrimidines e.g., cytosine, thymine, and uracil
- purines e.g., adenine and guanine
- the nucleoside contains a deoxyribose sugar.
- Analogs of nucleosides include, but are not limited to dexoyadenosine analogues (e.g., Didanosine and Vidarabine); deoxycytidine analogues (e.g., Cytarabine, Ematricitabine, Lamivudine, and Zalcitabine); deoxyguanosine analogues (Abacavir and Entecavir); (deoxy-) thymidine analogues (e.g., Stavudine, Telbivudine, and Zidovudine); and deoxyuridine alaogues (e.g., Idoxuridine and Trifluridine).
- dexoyadenosine analogues e.g., Didanosine and Vidarabine
- deoxycytidine analogues e.g., Cytarabine, Ematricitabine, Lamivudine
- the CDN can include a guanosine nucleoside. In some cases, the CDN contains two guanosine nucleosides.
- the CDN can include an adenosine nucleoside. In some embodiments, the CDN contains two adenosine nucleosides. In certain cases, the CDN contains an adenosine nucleoside and a guanosine nucleoside.
- CDNs can increase type-1 IFN production in a cell.
- the CDN increases type-1 IFN production through a mechanism that involves stimulator of interferon genes (STING).
- CDNs can be obtained using any suitable method.
- CDNs may be made by chemical synthesis using nucleoside derivatives as starting material.
- CDNs can also be produced via in vitro synthesis, using recombinant purified cGAMP synthase (cGAS) or other recombinant purified CDN synthases such as the bacterial cGAMP synthase from V. cholerae (DncV) or mutant versions of any recombinant purified CDN synthases.
- cGAS recombinant purified cGAMP synthase
- DncV cholerae
- mutant versions of any recombinant purified CDN synthases can be confirmed using any convenient methods, such as NMR analysis.
- CDNs of interest include, but are not limited to, those described by Vance et al. in U.S. Publication No. 2014/0329889; Dubensky et al. in U.S. Publication No. 2015/0056224; Dubensky et al. in U.S. Publication No. 2014/0205653; Dubensky et al. in U.S. Patent No. 9549944; Altman et al. in WO2017027645; and Altman et al.
- the CDN that finds use in the subject methods is one that is described by Vance et al. in U.S. Publication No. 2014/0329889.
- the cyclic-di-nucleotide has one of the following formulae (I) and (II):
- CDNs described herein can also be described by the following nomenclature: cyclic[Xi(a-5’)pX 2 (b-5')p], wherein Xi and X2 are first and second nucleosides, “a” is the designation of the carbon of the first nucleoside (e.g., 2’ or 3’ position) that is linked to the 5’ carbon of the second nucleoside via a phosphodiester bond and “b” is the designation of the carbon of the second nucleoside (e.g., 2’ or 3’ position) that is linked to the 5’ carbon of the first nucleoside by a phosphodiester bond. In some cases, at least one of “a” and “b” is 2’ in the formula. For instance, based on this nomenclature, cyclic[G(2’-5’)pA(3’-5')p] has the following formula:
- the CDN contains a 2’-5’ phosphodiester bond.
- the CDN further contains a 3’-5’ phosphodiester bond (e.g., cyclic[Xi(2’- 5’)pX 2 (3’-5')p] or cyclic[Xi(3’-5’)pX 2 (2’-5')p]).
- the CDN contains two 2’-5’ phosphodiester bonds (cyclic[Xi(2’-5’)pX 2 (2’-5')p]).
- the CDN contains two 3’-5’ phosphodiester bonds (cyclic[Xi(3’-5’)pX 2 (3’-5')p]).
- the cyclic-di-nucleotide is: cyclic[A(2’-5’)pA2’-5')p]; cyclic[T(2’-5’)pT(2’-5')p]; cyclic[G(2’-5’)pG(2’-5')p]; cyclic[C(2’-5’)pC(2’-5')p]; or cyclic[U(2’- 5’)pU(2’-5')p].
- the cyclic-di-nucleotide is: cyclic[A(2’-5’)pA(3’-5')p]; cyclic[T(2’-5’)pT(3’-5')p]; cyclic[G(2’-5’)pG(3’-5')p]; cyclic[C(2’-5’)pC(3’-5')p]; cyclic[U(2’- 5’)pU(3’-5')p]; cyclic[A(2’-5’)pT(3’-5')p]; cyclic[T(2’-5’)pA(3’-5')p]; cyclic[A(2’-5’)pG(3’-5')p]; cyclic[G(2’-5’)pA(3’-5')p]; cyclic[A(2’-5’)pC (3’-5')p]; cyclic[C(2’-5’)pA(
- the cyclic-di-nucleotide has the following formula (cyclic[ or a salt thereof. In certain embodiments, the cyclic-di-nucleotide has the following formula (cyclic[ or a salt thereof. In other embodiments, the cyclic-di-nucleotide has the following formula cyclic[ or a salt thereof.
- the cyclic-di-nucleotide has the following formula cyclic[ or a salt thereof.
- the cyclic-di-nucleotide has the following formula cyclic[G(2’5’)pG(3’5’)p] :
- the cyclic-di-nucleotide has the following formula cyclic[ or a salt thereof.
- the cyclic-di-nucleotide has the following formula cyclic[ or a salt thereof.
- the cyclic-di-nucleotide has one of the following formulae:
- R is any amino acid side chain
- X and Y are as defined above for formula (I)- (II), or a salt thereof.
- CDN CDN’s of interest include, but are not limited to, those described by Dubensky etal. in U.S. Publication No. 2015/0056224.
- the CDN has the structure:
- R3 is a covalent bond to the 5' carbon of (b),
- R4 is a covalent bond to the 2' or 3' carbon of (b),
- R1 is a purine linked through its N9 nitrogen to the ribose ring of (a),
- R5 is a purine linked through its N9 nitrogen to the ribose ring of (b), each of Xi and X 2 are independently O or S,
- the CDN has one of the following formula: c-[G(2',5')pG(3',5')p], c- [A(2',5')pA(3',5')p], c-[G(2',5')pA(3',5')p] or c-[G(2',5')pA(3',5')p] where each p refers to a phosphate, thiophosphate or dithiophosphate internucleotide linkage.
- the CDN is a compound of the formula: where Ri and R 2 are each H, or a pharmaceutically acceptable salt thereof.
- the CDN is a bisphosphorothioate analog of a naturally occurring CDN such as c-di-AMP.
- the CDN is ADU-S100 or 2’3’-c-di-AM(PS) 2 (Rp,Rp), also known as dithio-(Rp, Rp)-[cyclic[A(2’,5’)pA(3’,5’)p]] or (ML RR-S2 CDA), as described by Corrales et al. (“Direct Activation of STING in the Tumor Microenvironment Leads to Potent and Systemic Tumor Regression and Immunity” Cell Reports 11 , 1018-1030, May 19, 2015).
- Embodiments of the invention include administration of other, non-CDN STING agonists.
- Any convenient non-CDN STING Agonist may be employed, wherein examples of such STING agonists include, but are not limited to E7766, PMID: 30405246, etc., as well as those described in Published United States Patent Application Publication Nos.
- aspects of the methods include modulating, e.g., increasing or decreasing, PI4KB Golgi recruitment in a cell to modulate, e.g., enhance or reduce,
- STING pathway activation By increasing or decreasing PI4KB Golgi recruitment, STING pathway activation can be modulated in the cell can be modulated to provide for a desired biological effect.
- PI4KB Golgi recruitment can be modulated by contacting the cell, in vitro or in vivo, with a PI4KB Golgi recruitment-modulating agent (e.g., as described herein).
- the PI4KB Golgi recruitment -modulating agent enhances or increases PI4KB Golgi recruitment.
- examples of such agents include small molecule inhibitors of OSPB, e.g., as described above.
- the PI4KB Golgi recruitment- modulating agent decreases PI4KB Golgi recruitment.
- examples of such agents include PI4KB small molecule inhibitors, e.g., as described above.
- the PI4KB Golgi recruitment-modulating agent is a small molecule and the effective amount which is contacted with the cell or cellular sample, or administered to a subject, will generally contain between from about 1 mg to about 1000 mg of the agent, in some cases, 25 mg or more, such as 50 mg or more, 100 mg or more, 200 mg or more, 300 mg or more, 400 mg or more, 500 mg or more, 600 mg or more, 800 mg or more, or 1000 mg or more.
- the pathway leads, for example, to activation of IRF3 transcription factor, which induces IFN and certain other cytokines and mediators. Accordingly, this pathway and elements thereof may be modulated in embodiments of the invention.
- the pathway leads, for example, to activation of NF-kB, which induces other cytokines and mediators. Accordingly, this pathway and elements thereof may be modulated in embodiments of the invention.
- This pathway leads, for example to activation of STAT6 which induces yet other cytokines and mediators. Accordingly, this pathway and elements thereof may be modulated in embodiments of the invention.
- Embodiments of the invention may be employed to modulate the response to preferentially activate one or another of these “axes”, which may be employed to change the type of immune response induced, as desired.
- STING pathway activation provides an anti-tumor immune response via production of type I interferon (IFN) in a cell.
- aspects of this disclosure include methods of increasing the production of a type I interferon (IFN) in a cell, e.g., in vitro or in vivo.
- increasing type-1 interferon production is meant that the subject methods increase type-1 interferon production in a cell, as compared to a suitable control.
- the magnitude of the increase in type-1 interferon production in a cell relative to what can be achieved with the CDN alone may vary, and in some instances is 10% or more, such as 20% or more, 30% or more, 40% or more, 50% or more, 60% or more, 70% or more, 80% or more, 90% or more, 100% or more, 2-fold or greater, 3-fold or greater, 4-fold or greater, 5-fold or greater, or 10- fold or greater, as compared to a suitable control.
- the increase may result in detectable amounts of interferon production.
- the subject methods provide for increasing the production of a type I interferon (IFN)-stimulated gene in a cell, e.g., in vitro or in vivo.
- IFN-stimulated gene production is meant that the subject methods increase production of an interferon-stimulated gene or gene product in a cell, as compared to a suitable control.
- IFN-stimulated genes of interest include, but are not limited to, CXCL10, IRF7, IFIT3, ISG15 and RANTES.
- the magnitude of the increase in production in a cell relative to what can be achieved with the CDN alone may vary, and in some instances is 10% or more, such as 20% or more, 30% or more, 40% or more, 50% or more, 60% or more, 70% or more, 80% or more, 90% or more, 100% or more, 2-fold or greater, 3-fold or greater, 4-fold or greater, 5- fold or greater, or 10-fold or greater, as compared to a suitable control.
- Type-I interferon production can be measured using any convenient method including, but not limited to, vesicular stomatitis virus (VSV) challenge bioassay, enzyme- linked immunosorbent assay (ELISA) replicon based bioassays or by using a reporter gene (e.g., luciferase) cloned under regulation of a type I interferon signaling pathway.
- VSV vesicular stomatitis virus
- ELISA enzyme- linked immunosorbent assay
- the methods may be used to increase the production of any convenient type I interferon including, but not limited to: IFN-a (alpha), IFN-b (beta), IFN-k (kappa), IFN-d (delta), IFN-e (epsilon), IFN-t (tau), IFN-w (omega), and IFN-z (zeta, also known as limitin).
- the method is for increasing the production of IFN-a. In some embodiments, the method is for increasing the production of IFN-b.
- the methods may also be employed to modulate product of other cytokines downstream of the pathway.
- STING pathway activation increases the expression of costimulatory molecules and other cell surface molecules which induce cell to cell signals that enhance or modulate immune responses.
- an effective amount of the active agent is provided in the target cell or cells.
- effective amount or “efficacious amount” means the amount that, when contacted with the cell, e.g., by being introduced into the cell in vitro, by being administered to a subject, etc., is sufficient to result in the desired outcome, e.g., increased levels of type I interferon in the cell.
- the "effective amount” will vary depending on cell and/or the organism and/or active agent and or the nature of the desired outcome and/or the disease and its severity and the age, weight, etc., of the subject to be treated.
- an effective amount of PI4KB Golgi recruitment-modulating agent is provided to the cells to result in a change in STING pathway activation in the cells.
- an effective amount of PI4KB Golgi recruitment-modulating agent is the amount to result in a 10% increase or more in the amount of STING pathway activation product observed (directly or indirectly) in the cell, such as 20% or more, 30% or more, 40% or more, 50% or more, 60% or more, 70% or more, 80% or more, 90% or more, 100% or more, 2-fold or greater, 3-fold or greater, 4-fold or greater, 5-fold or greater, or 10-fold or greater, relative to a negative control, e.g., a cell not contacted with the PI4KB Golgi recruitment-modulating agent.
- the amount of the STING pathway activation product observed may be measured by any suitable method, directly or indirectly.
- the amount of type I interferon produced by the cell may be assessed after contact with the active agent(s), e.g., 2 hours, 4 hours, 8 hours, 12 hours, 24 hours, 36 hours, 48 hours, 72 hours or more after contact with the active agent(s).
- the protocol may provide for in vitro or in vivo contact of the agent(s) with the target cell, depending on the location of the target cell.
- the target cell is an isolated cell, e.g., a cell in vitro (i.e., in culture), or a cell ex vivo (“ex vivo" being cells or organs are modified outside of the body, where such cells or organs are typically returned to a living body)
- the agent may be introduced directly to the cell under cell culture conditions permissive of viability of the target cell.
- the choice of method is generally dependent on the type of cell being contacted and the nature of the active agent, and the circumstances under which the transformation is taking place (e.g., in vitro, ex vivo, or in vivo).
- a general discussion of these methods can be found in Ausubel, et al, Short Protocols in Molecular Biology, 3rd ed., Wiley & Sons, 1995.
- the active agent may be administered to the organism or subject in a manner such that the agent is able to contact the target cell(s), e.g., via an in vivo protocol.
- in vivo it is meant the agent is administered to a living body of an animal.
- the active agent(s) can be employed to increase the production of type I interferon in vivo.
- the active agent(s) can be administered directly to the individual.
- the agent(s) may be administered by any suitable methods for the administration of peptides, small molecules or nucleic acids to a subject.
- the STING agonists and/or PI4KB Golgi recruitment-modulating agents can be incorporated into a variety of formulations. More particularly, the agent(s) of the present disclosure can be formulated into pharmaceutical compositions by combination with appropriate pharmaceutically acceptable carriers or diluents. Pharmaceutical compositions that can be used in practicing the subject methods are described herein.
- an effective amount of the STING agonist is administered to the subject in conjunction with the PI4KB Golgi recruitment-modulating agent.
- an “effective amount” or a “therapeutically effective amount” of the agent it is meant an amount that is required to reduce the severity, the duration and/or the symptoms of the disease.
- the effective amount of a pharmaceutical composition containing a STING agonist active agent for use in conjunction with the PI4KB Golgi recruitment-modulating agent, as provided herein is between 0.025 mg/kg and 1000 mg/kg body weight of a human subject.
- the pharmaceutical composition is administered to a human subject at an amount of 1000 mg/kg body weight or less, 950 mg/kg body weight or less, 900 mg/kg body weight or less, 850 mg/kg body weight or less, 800 mg/kg body weight or less, 750 mg/kg body weight or less, 700 mg/kg body weight or less, 650 mg/kg body weight or less, 600 mg/kg body weight or less, 550 mg/kg body weight or less, 500 mg/kg body weight or less, 450 mg/kg body weight or less, 400 mg/kg body weight or less, 350 mg/kg body weight or less, 300 mg/kg body weight or less, 250 mg/kg body weight or less, 200 mg/kg body weight or less, 150 mg/kg body weight or less, 100 mg/kg body weight or less, 95 mg/kg body weight or less, 90 mg/kg body weight or less, 85 mg/kg body weight or less, 80 mg/kg body weight or less, 75 mg/kg body weight or less, 70 mg/kg body weight or less, or 65 mg/
- the STING agonist is employed in mitotic or post-mitotic cells in vitro or ex vivo, i.e., to produce modified cells that can be reintroduced into an individual.
- Mitotic and post-mitotic cells of interest in these embodiments include any eukaryotic cell, e.g., pluripotent stem cells, for example, ES cells, iPS cells, and embryonic germ cells; somatic cells, for example, hematopoietic cells, fibroblasts, neurons, muscle cells, bone cells, vascular endothelial cells, gut cells, and the like, and their lineage-restricted progenitors and precursors; and neoplastic, or cancer, cells, i.e., cells demonstrating one or more properties associated with cancer cells, e.g., hyperproliferation, contact inhibition, the ability to invade other tissue, etc.
- eukaryotic cell e.g., pluripotent stem cells, for example, ES cells, iPS cells, and embryo
- the eukaryotic cells are cancer cells.
- the eukaryotic cells are hematopoietic cells, e.g., macrophages, NK cells, etc.
- Cells may be from any mammalian species, e.g., murine, rodent, canine, feline, equine, bovine, ovine, primate, human, etc.
- Cells may be from established cell lines or they may be primary cells, where “primary cells”, “primary cell lines”, and “primary cultures” are used interchangeably herein to refer to cells and cells cultures that have been derived from a subject and allowed to grow in vitro for a limited number of passages, i.e., splittings, of the culture.
- primary cultures are cultures that may have been passaged 0 times, 1 time, 2 times, 4 times, 5 times, 10 times, or 15 times, but not enough times go through the crisis stage.
- the primary cell lines are maintained for fewer than 10 passages in vitro.
- the cells may be harvested from an individual by any convenient method.
- blood cells e.g., leukocytes, e.g., macrophages
- leukocytes e.g., macrophages
- cells from tissues such as skin, muscle, bone marrow, spleen, liver, pancreas, lung, intestine, stomach, etc.
- An appropriate solution may be used for dispersion or suspension of the harvested cells.
- Such solution will generally be a balanced salt solution, e.g., normal saline, PBS, Hank’s balanced salt solution, etc., conveniently supplemented with fetal calf serum or other naturally occurring factors, in conjunction with an acceptable buffer at low concentration, generally from 5-25 mM.
- Convenient buffers include HEPES, phosphate buffers, lactate buffers, etc.
- the cells may be used immediately, or they may be stored, frozen, for long periods of time, being thawed and capable of being reused.
- the cells may be frozen in 10% DMSO, 50% serum, 40% buffered medium, or some other such solution as is commonly used in the art to preserve cells at such freezing temperatures, and thawed in a manner as commonly known in the art for thawing frozen cultured cells.
- the CDN active agent(s) may be produced by eukaryotic cells or by prokaryotic cells, it may be further processed by unfolding, e.g., heat denaturation, DTT reduction, etc. and may be further refolded, using methods known in the art.
- the STING agonist described herein may be administered in combination with the PI4KB Golgi recruitment-modulating agent (e.g., as described herein). “In combination with” refers to uses where, for example, the first compound (e.g., the STING agonist, such as a CDN active agent) is administered during the entire course of administration of the second compound (e.g., PI4KB Golgi recruitment- modulating agent); where the first compound is administered for a period of time that is overlapping with the administration of the second compound, e.g., where administration of the first compound begins before the administration of the second compound and the administration of the first compound ends before the administration of the second compound ends; where the administration of the second compound begins before the administration of the first compound and the administration of the second compound ends before the administration of the first compound ends; where the administration of the first compound begins before administration of the second compound begins and the administration of the second compound ends before the administration of the first compound ends; where the administration of the second compound begins before administration of the first compound ends; where the administration of
- “in combination” can also refer to regimen involving administration of two or more compounds. “In combination with” as used herein also refers to administration of two or more compounds that may be administered in the same or different formulations, by the same of different routes, and in the same or different dosage form type.
- any convenient additional active agents e.g., agents that find use in a combination therapeutic application with a STING agonist of interest, can also be utilized in conjunction with the STING agonist and PI4KB Golgi recruitment-modulating agent in the subject methods.
- the additional active agent is a chemotherapeutic agent or other cancer therapy, an antiviral agent, a cGAS activity modulating agent, agents that increase cytosolic DNA (e.g., agents targeting RNaseH2 or SAMHD1), ionizing radiation, etc.
- the additional cancer therapy comprises radiation therapy, surgery, chemotherapy, or an immunotherapy (for example, without limitation, an immunomodulator, an immune checkpoint inhibitor, a cellular immunotherapy, or a cancer vaccine).
- the one or more additional cancer therapies comprise an inactivated tumor cell that expresses and secretes one or more cytokines or one or more heat shock proteins.
- the cytokine is selected from the group consisting of GM-CSF, CCL20, CCL3, IL-12p70, and FLT-3 ligand.
- the heat shock protein is a gp96- Ig protein.
- the additional active agent is an immune checkpoint inhibitor (e.g., CTLA-4, PD-1 , TIM-3, Vista, BTLA, LAG-3, KIR, or TIGIT pathway antagonists, including, without limitation, PD-1 pathway blocking agents such as anti-PD-1 antibodies PDR001 , nivolumab, pembrolizumab, SHR-1210, REGN2810 (cemiplimab), or pidilizumab, or PD-1 inhibitor AMP-224; PD-L1 inhibitors such as anti-PD-L1 antibodies BMS-936559, MPDL3280A(atezolizumab), MEDI4736 (durvalumab), or avelumab; anti-CTLA-4 antibodies such as ipilimumab, tremelimumab, IBI310, and AGEN1884; Vista inhibitors including anti- Vista antibodies; B7-H3 inhibitors including anti-B7-H3 antibodies; and CD70 inhibitors including anti-CD70
- TLR agonist e.g., CpG or monophosphoryl lipid A
- RIG-1 agonist e.g. 5’pp-dsRNA or 3p-hpRNA
- a vaccine selected to stimulate an immune response to one or more cancer antigens, for example an inactivated or attenuated bacteria which induce innate immunity and is engineered to express cancer antigens (e.g., inactivated or attenuated Listeria monocytogenes); a therapeutic antibody that induces antibody-dependent cellular cytotoxicity; an immunomodulatory cell line; an antigen selected for the purpose of inducing an immune response, an agent which mediate innate immune activation (i) via Toll-like Receptors (TLRs) including, without limitation, TLR agonist (e.g., CpG or monophosphoryl lipid A), (ii) via (NOD)-like receptors (NLRs), (iii) via Retinoic acid inducible gene
- TLR agonist e.g., C
- the immune checkpoint inhibitor is selected from the group consisting of a CTLA-4 pathway antagonist, a PD-1 pathway antagonist, a TIM-3 pathway antagonist, a Vista pathway antagonist, a BTLA pathway antagonist, a LAG-3 pathway antagonist, and a TIGIT pathway antagonist.
- the immune checkpoint inhibitor is an anti-PD-1 antibody, an anti-PD-L1 antibody, an anti-CTLA-4 antibody, an anti- TIM-3 antibody, an anti-Vista antibody, an anti-BTLA antibody, an anti-B7-H3 antibody, an anti-CD70 antibody, an anti-KIR antibody or an anti-LAG-3 antibody.
- the immune checkpoint inhibitor is selected from the group consisting of nivolumab, pembrolizumab, pidilizumab, cemiplimab, SHR-1210, PDR001 , MEDI0680, AMP-224, ipilimumab, tremelimumab, IBI310, AGEN1884, BMS-936559, atezolizumab, durvalumab, and avelumab.
- chemotherapeutic agents for use in combination therapy include, but are not limited to, an indoleamine 2,3-dioxygenase (ID01) inhibitor (e.g., epacadostat and navoximod), daunorubicin, daunomycin, dactinomycin, doxorubicin, epirubicin, idarubicin, esorubicin, bleomycin, mafosfamide, ifosfamide, cytosine arabinoside, bis- chloroethylnitrosurea, lomustine (CCNU), carmustine, busulfan, mitomycin C, actinomycin D, mithramycin, prednisone, hydroxyprogesterone, testosterone, tamoxifen, dacarbazine, procarbazine, hexamethylmelamine, pentamethylmelamine, mitoxantrone, amsacrine, methylcyclohexylnitrosurea, nitrogen mustard
- agents for use in combination therapy of neoplastic disease include, but are not limited to, thalidomide, marimastat, COL-3, BMS-275291 , squalamine, 2-ME, SU6668, neovastat, Medi-522, EMD121974, CAI, celecoxib, interleukin-12, IM862, TNP470, avastin, gleevec, herceptin, and mixtures thereof.
- TLR agonists for use in combination therapy include, but are not limited to, Pam2Cys, Pam3Cys, Complete Freund’s Adjuvant (CFA), monocyte activating lipopeptide-2 (MALP2), lipopeptide derived from Mycoplasma salivarium (FSL-1), Haemophilus inf luenzae type b outer membrane protein complex (Hib-OMPC), Poly l:C, Poly AU, Hiltonol® (poly-ICLC), monophosphoryl lipid A, lipopolysaccharide (LPS), bacterial flagellin, sialyl-Tn, imiquimod, resiquimod, lefitolimod, tilsotolimod, loxoribine, and CpG oligodeoxynucleotides (e.g., agatolimod, and unmethylated CpG dinucleotide).
- CFA CFA
- MALP2 monocyte activating lipopeptide-2
- FSL-1 Mycoplasma saliva
- Additional antiviral agents can also be delivered in conjunction with a CDN of interest in the treatment methods of this disclosure.
- compounds that inhibit inosine monophosphate dehydrogenase (IMPDH) may have the potential to exert direct antiviral activity, and such compounds can be administered in a combination therapy, as described herein.
- Drugs that are effective inhibitors of hepatitis C NS3 protease may be administered in combination with the CDN, as described herein.
- Hepatitis C NS3 protease inhibitors inhibit viral replication.
- Other agents such as inhibitors of HCV NS3 helicase are also attractive drugs for combinational therapy and are contemplated for use in combination therapies described herein.
- Ribozymes such as HeptazymeTM and phosphorothioate oligonucleotides which are complementary to HCV protein sequences and which inhibit the expression of viral core proteins are also suitable for use in combination therapies described herein.
- agents for use in combination therapy of multiple sclerosis include, but are not limited to; glatiramer; corticosteroids; muscle relaxants, such as Tizanidine (Zanaflex) and baclofen (Lioresal); medications to reduce fatigue, such as amantadine (Symmetrel) or modafinil (Provigil); and other medications that may also be used for depression, pain and bladder or bowel control problems that can be associated with MS.
- CDNs of the present disclosure Because of the adjuvant properties of the CDNs of the present disclosure, their use in the subject methods may also combined with other therapeutic modalities including other vaccines, adjuvants, antigen, antibodies, and immune modulators.
- antibodies for use in combination therapy include, but are not limited to, muromonab-CD3, infliximab, omalizumab, daclizumab, rituximab, ibritumomab, tositumomab, cetuximab, trastuzumab, brentuximab vedotin, alemtuzumab, vitaxin, bevacizumab, and abciximab.
- the active agent is a CDN transporter modulatory agent, e.g., as described in PCT application serial nol. PCT/US2019/32663 published as WO 2019/222500; the disclosure of which is herein incorporated by reference (see also Luteijn et al., "
- Membrane transporters that can be targeted to modulate cellular uptake of a CDN of interest according to the subject methods include membrane folate transporters that are capable of transporting CDNs of interest into cells.
- Membrane folate transporters include a class of transporters which can actively transport molecules including folate, folate derivatives and/or antifolates, see e.g., Matherly et al. (“Membrane transport of folates”, Vitam. Horm. 2003;66:403-56).
- Membrane folate transporters of interest include, but are not limited to, the SLC19 family of transporters, reduced folate carrier (RFC), the SLC46 family of transporters including the proton-coupled folate transporters (PCFT).
- RFC transporter is ubiquitously expressed and can transport folate in mammalian cells and tissues.
- the transporter is a member of the SLC19 family of transporters.
- the transporter is RFC transporter.
- the RFC transporter is RFC1 , also known as solute carrier family 19 (folate transporter), member 1 , also known as SLC19A1 , RFC, CHMD, FOLT, IFC1 , REFC or IFC-1 .
- the transporter is a member of the SLC46 family of transporters.
- the transporter is solute carrier family 46, member 1 , also known as SLC46A1 , PCFT, G21 or HCP1 .
- the transporter is solute carrier family 46, member 3, also known as SLC46A3 or FKSG16.
- Exemplary transporters of interest include those described by Hou and Matherly (“Biology of the Major Facilitative Folate Transporters SLC19A1 and SLC46A1”, Curr Top Membr. 2014; 73: 175-204), Zhao and Goldman (Folate and Thiamine Transporters mediated by Facilitative Carriers (SLC19A1-3 and SLC46A1) and Folate Receptors) Mol.
- a CDN transporter-modulating agent is an agent that modulates the transport of the CDN across the membrane of a cell thereby modulating the activity of the CDN of interest in the cell.
- a CDN transporter-modulating agent is an agent that is capable of modulating the action of a target membrane transporter either directly (e.g., via direct binding to produce an enhancing or inhibiting effect) or indirectly (e.g., via modulating expression of a membrane transporter).
- any convenient agents that are capable of modulating the activity of a target membrane transporter can be adapted for use in the subject methods.
- the agent directly binds to the target membrane transporter to modulate its activity.
- the agent acts indirectly, e.g., via modulating expression of the target membrane transporter.
- This disclosure provides a pharmaceutical composition that contains any of the PIK4B Golgi recruitment modulating agents (e.g., as described herein) and/or any of the STING agonists (e.g., as described herein) and a pharmaceutically acceptable carrier.
- the pharmaceutical composition can include a PIK4B Golgi recruitment modulating agent as the only active agent.
- the pharmaceutical composition can include both a PIK4B Golgi recruitment modulating agent and a STING agonist, e.g., CDN.
- the subject pharmaceutical compositions find use in the kits and methods described herein.
- carrier refers to a diluent, adjuvant, excipient, or vehicle with which the agent of interest is administered.
- Such pharmaceutical carriers can be, for example, sterile liquids, such as dimethyl sulfoxide (DMSO) or saline solutions in water and oils, including those of petroleum, animal, vegetable or synthetic origin, such as peanut oil, soybean oil, mineral oil, sesame oil and the like.
- DMSO dimethyl sulfoxide
- saline solutions in water and oils, including those of petroleum, animal, vegetable or synthetic origin, such as peanut oil, soybean oil, mineral oil, sesame oil and the like.
- a saline solution is a preferred carrier when the pharmaceutical composition is administered intravenously.
- Saline solutions and aqueous dextrose and glycerol solutions can also be employed as liquid carriers, particularly for injectable solutions.
- suitable pharmaceutical excipients include starch, glucose, lactose, sucrose, gelatin, malt, rice, flour, chalk, silica gel, sodium stearate, glycerol monostearate, talc, sodium chloride, dried skim milk, glycerol, propylene glycol, water, ethanol and the like.
- the composition if desired, can also contain minor amounts of wetting or emulsifying agents, or pH buffering agents. These compositions can take the form of solutions, suspensions, emulsion, tablets, pills, capsules, powders, sustained-release formulations and the like.
- composition can be formulated as a suppository, with traditional binders and carriers such as triglycerides.
- the inhibitors can be formulated as neutral or salt forms.
- Pharmaceutically acceptable salts include those formed with free amino groups such as those derived from hydrochloric, phosphoric, acetic, oxalic, tartaric acids, etc., and those formed with free carboxyl groups such as those derived from sodium, potassium, ammonium, calcium, ferric hydroxides, isopropylamine, triethylamine, 2-ethylamino ethanol, histidine, procaine, etc. Examples of suitable pharmaceutical carriers are described in "Remington's Pharmaceutical Sciences” by E. W. Martin, hereby incorporated by reference herein in its entirety.
- compositions will contain a therapeutically effective amount of the mitochondrial transport protein (e.g., a Miro protein, a TRAK protein, or Khc) inhibitor, preferably in purified form, together with a suitable amount of carrier so as to provide the form for proper administration to the patient.
- the mitochondrial transport protein e.g., a Miro protein, a TRAK protein, or Khc
- the formulation should suit the mode of administration.
- the pharmaceutical composition can also include any of a variety of stabilizing agents, such as an antioxidant for example.
- the pharmaceutical composition includes a polypeptide
- the polypeptide can be complexed with various well-known compounds that enhance the in vivo stability of the polypeptide, or otherwise enhance its pharmacological properties (e.g., increase the half-life of the polypeptide, reduce its toxicity, enhance solubility or uptake). Examples of such modifications or complexing agents include sulfate, gluconate, citrate and phosphate.
- the polypeptides of a composition can also be complexed with molecules that enhance their in vivo attributes. Such molecules include, for example, carbohydrates, polyamines, amino acids, other peptides or proteins, ions (e.g., sodium, potassium, calcium, magnesium, manganese) and lipids.
- compositions intended for in vivo use may be sterile. To the extent that a given compound must be synthesized prior to use, the resulting product is typically substantially free of any potentially toxic agents, particularly any endotoxins, which may be present during the synthesis or purification process.
- compositions for parental administration are also sterile, substantially isotonic and made under GMP conditions.
- the pharmaceutical composition can be formulated for intravenous, oral, via implant, transmucosal, transdermal, intramuscular, intrathecal, or subcutaneous administration. In some cases, the pharmaceutical composition is formulated for intravenous administration.
- the pharmaceutical composition is formulated for subcutaneous administration.
- the following delivery systems, which employ a number of routinely used pharmaceutical carriers, are only representative of the many embodiments envisioned for administering the instant compositions.
- Injectable drug delivery systems include solutions, suspensions, gels, microspheres and polymeric injectables, and can comprise excipients such as solubility-altering agents (e.g., ethanol, propylene glycol and sucrose) and polymers (e.g., polycaprylactones and PLGAs).
- Implantable systems include rods and discs, and can contain excipients such as PLGA and polycaprylactone. Osteopontin or nucleic acids of the invention can also be administered attached to particles using a gene gun.
- Oral delivery systems include tablets and capsules. These can contain excipients such as binders (e.g., hydroxypropylmethylcellulose, polyvinyl pyrilodone, other cellulosic materials and starch), diluents (e.g., lactose and other sugars, starch, dicalcium phosphate and cellulosic materials), disintegrating agents (e.g., starch polymers and cellulosic materials) and lubricating agents (e.g., stearates and talc).
- excipients such as binders (e.g., hydroxypropylmethylcellulose, polyvinyl pyrilodone, other cellulosic materials and starch), diluents (e.g., lactose and other sugars, starch, dicalcium phosphate and cellulosic materials), disintegrating agents (e.g., starch polymers and cellulosic materials) and lubricating agents (e.
- Transmucosal delivery systems include patches, tablets, suppositories, pessaries, gels and creams, and can contain excipients such as solubilizers and enhancers (e.g., propylene glycol, bile salts and amino acids), and other vehicles (e.g., polyethylene glycol, fatty acid esters and derivatives, and hydrophilic polymers such as hydroxypropylmethylcellulose and hyaluronic acid).
- solubilizers and enhancers e.g., propylene glycol, bile salts and amino acids
- other vehicles e.g., polyethylene glycol, fatty acid esters and derivatives, and hydrophilic polymers such as hydroxypropylmethylcellulose and hyaluronic acid.
- Dermal delivery systems include, for example, aqueous and nonaqueous gels, creams, multiple emulsions, microemulsions, liposomes, ointments, aqueous and nonaqueous solutions, lotions, aerosols, hydrocarbon bases and powders, and can contain excipients such as solubilizers, permeation enhancers (e.g., fatty acids, fatty acid esters, fatty alcohols and amino acids), and hydrophilic polymers (e.g., polycarbophil and polyvinylpyrolidone).
- the pharmaceutically acceptable carrier is a liposome or a transdermal enhancer.
- the pharmaceutical composition containing an active agent can be formulated to cross the blood brain barrier (BBB).
- BBB blood brain barrier
- One strategy for drug delivery through the blood brain barrier (BBB) entails disruption of the BBB, either by osmotic means such as mannitol or leukotrienes, or biochemically by the use of vasoactive substances such as bradykinin.
- a BBB disrupting agent can be co-administered with the therapeutic compositions when the compositions are administered by intravascular injection.
- BBB BBB-mediated endogenous transport systems
- endogenous transport systems including caveoil-1 mediated transcytosis, carrier-mediated transporters such as glucose and amino acid carriers, receptor-mediated transcytosis for insulin or transferrin, and active efflux transporters such as p-glycoprotein.
- Active transport moieties may also be conjugated to the therapeutic compounds for use in the invention to facilitate transport across the endothelial wall of the blood vessel.
- drug delivery of the pharmaceutical composition behind the BBB may be by local delivery, for example by intrathecal delivery, e.g., through an Ommaya reservoir (see, e.g., US Patent Nos.
- the pharmaceutical composition containing the active agent is formulated in a delivery vehicle, e.g., to enhance passive cytosolic transport. Any convenient protocol may be employed to facilitate delivery of the CDN active agent across the plasma membrane of a cell and into the cytosol.
- the STING agonist e.g., CDN, and/or PIK4B Golgi recruitment modulating active agent may be encapsulated in a delivery vehicle comprising liposomes in the pharmaceutical composition.
- a delivery vehicle comprising liposomes in the pharmaceutical composition.
- liposomes may be modified to render their surface more hydrophilic by adding polyethylene glycol ("pegylated") to the bilayer, which increases their circulation time in the bloodstream. These are known as "stealth" liposomes and are especially useful as carriers for hydrophilic (water soluble) molecules.
- nano- or microparticles made from biodegradable materials such as poly(lactic acid), poly(y-glutamic acid), poly(glycolic acid), polylactic-co-glycolic acid, polyethylenimine, or alginate microparticles, and cationic microparticles, including dedrimers, such as cyclodextrins, may be employed as delivery vehicles for the active agents to promote cellular uptake.
- biodegradable materials such as poly(lactic acid), poly(y-glutamic acid), poly(glycolic acid), polylactic-co-glycolic acid, polyethylenimine, or alginate microparticles, and cationic microparticles, including dedrimers, such as cyclodextrins, may be employed as delivery vehicles for the active agents to promote cellular uptake.
- dedrimers such as cyclodextrins
- the delivery vehicle for delivering the active agents can also be targeting delivery vehicles, e.g., a liposome containing one or more targeting moieties or biodistribution modifiers on the surface of the liposome.
- a targeting moiety can be any agent that is capable of specifically binding or interacting with a desired target.
- the specific binding agent can be any molecule that specifically binds to a protein, peptide, biomacromolecule, cell, tissue, etc. that is being targeted (e.g., protein, peptide, biomacromolecule, cell, tissue, etc. wherein the active agent exerts its desired effect).
- the specific binding agent can be, but is not limited to, an antibody against an epitope of a peptidic analyte, or any recognition molecule, such as a member of a specific binding pair.
- suitable specific binding pairs include, but are not limited to: a member of a receptor/ligand pair; a ligand-binding portion of a receptor; a member of an antibody/antigen pair; an antigen-binding fragment of an antibody; a hapten; a member of a lectin/carbohydrate pair; a member of an enzyme/substrate pair; biotin/avidin; biotin/streptavidin; digoxin/antidigoxin; a member of a peptide aptamer binding pair; and the like.
- the specific binding moiety includes an antibody.
- the specific binding moiety is a fragment of an antibody which retains specific binding to antigen, including, but not limited to, Fab, Fv, scFv, and Fd fragments, chimeric antibodies, humanized antibodies, single-chain antibodies, and fusion proteins comprising an antigen-binding portion of an antibody and a non-antibody protein.
- the specific binding moiety may also include Fab', Fv, F(ab')2, and or other antibody fragments that retain specific binding to antigen.
- the targeting moiety is a binding agent that specifically interacts with a molecule expressed on a tumor cell or an immune cell (e.g., CD4, CD8, CD69, CD62L, and the like), such that the targeting delivery vehicle containing the cyclic-di-nucleotide or STING active agents is delivered to the site of a tumor or to specific immune cells.
- a molecule expressed on a tumor cell or an immune cell e.g., CD4, CD8, CD69, CD62L, and the like
- any combinations of the above listed delivery vehicles may be used advantageously to enhance delivery of the active agents to the target cells.
- Components of the pharmaceutical composition can be supplied either separately or mixed together in unit dosage form, for example, as a dry lyophilized powder or water free concentrate. Where the composition is to be administered by infusion, it can be dispensed with an infusion bottle containing sterile pharmaceutical grade water or saline. Where the composition is administered by injection, an ample of sterile water for injection or saline can be provided so that the ingredients may be mixed prior to administration.
- the pharmaceutical composition is supplied as a dry sterilized lyophilized powder that is capable of being reconstituted to the appropriate concentration for administration to a subject.
- the pharmaceutical composition is supplied as a water free concentrate.
- the pharmaceutical composition is supplied as a dry sterile lyophilized powder at a unit dosage of at least 0.5 mg, at least 1 mg, at least 2 mg, at least 3 mg, at least 5 mg, at least 10 mg, at least 15 mg, at least 25 mg, at least 30 mg, at least 35 mg, at least 45 mg, at least 50 mg, at least 60 mg, or at least 75 mg.
- Solutions, suspensions and powders for reconstitutable delivery systems include vehicles such as suspending agents (e.g., gums, xanthans, cellulosics and sugars), humectants (e.g., sorbitol), solubilizers (e.g., ethanol, water, PEG and propylene glycol), surfactants (e.g., sodium lauryl sulfate, Spans, Tweens, and cetyl pyridine), preservatives and antioxidants (e.g., parabens, vitamins E and C, and ascorbic acid), anti-caking agents, coating agents, and chelating agents (e.g., EDTA).
- suspending agents e.g., gums, xanthans, cellulosics and sugars
- humectants e.g., sorbitol
- solubilizers e.g., ethanol, water, PEG and propylene glycol
- the pharmaceutical composition is formulated as a salt form.
- Pharmaceutically acceptable salts include those formed with anions such as those derived from hydrochloric, phosphoric, acetic, oxalic, tartaric acids, etc., and those formed with cations such as those derived from sodium, potassium, ammonium, calcium, ferric hydroxides, isopropylamine, triethylamine, 2-ethylamino ethanol, histidine, procaine, etc.
- the pharmaceutical composition contains a prodrug derivative of any of the CDN active agents provided herein.
- Such prodrugs can be subsequently converted to an active form of the CDN in the body of the subject administered the pharmaceutical composition.
- Kits including a PIK4B Golgi recruitment -modulating agent (e.g., as described herein) and a STING agonist, e.g., CDN active agent, (e.g., as described herein) are provided.
- the kit includes a unit dose of the subject active agents e.g., in an oral or injectable dose.
- the one or more components are present in the same or different containers, as may be convenient or desirable.
- instructions can be included describing the use and attendant benefits of the STING agonist, e.g., CDN, and PIK4B Golgi recruitment-modulating agent in treating a pathological condition of interest. Instructions may be provided in a variety of different formats.
- the instructions may include complete protocols for practicing the subject methods or means for obtaining the same (e.g., a website URL directing the user to a webpage which provides the instructions), where these instructions may be printed on a substrate, where substrate may be one or more of: a package insert, the packaging, reagent containers and the like.
- This disclosure provides methods, compositions and kits that find use in a variety of applications.
- the subject methods find use in a variety of applications where it is desirable to either inhibit or enhance STING pathway activation in a target cell.
- Therapeutic applications of interest include, but are not limited to, cancer immunotherapy, antiviral applications, treatment of autoimmune or inflammatory disease, and other in applications similar to those described herein.
- this disclosure provides for methods and applications involving STING pathway activation in immune cells in vivo, leading to greater activation of the immune response.
- Specific applications of interest include those in which a subject is treated for a disease condition that would benefit from an increase in type I interferon by providing the subject with a therapeutically effective amount of a STING agonist, e.g., CDN active agent.
- a STING agonist e.g., CDN active agent.
- the subject methods can be applied to enhance STING pathway activation for improved cancer immunotherapy.
- the subject methods can also be applied locally or systemically to inhibit or block uptake of a STING agonist, e.g., CDN active agent, by target cells where it is desirable to alleviate the possible toxic effects of such a STING agonist, e.g., a CDN administered for anti-cancer treatment.
- a STING agonist e.g., CDN active agent
- the present invention also provides a method of inhibiting type I interferon production mediated by the cGAS-STING pathway.
- subjects suitable for treatment with a method described herein include individuals having an immunological or inflammatory disease or disorder including, but not limited to a cancer, an autoimmune disease or disorder, an allergic reaction, a chronic infectious disease and an immunodeficiency disease or disorder.
- the disease or disorder can be a type I interferonopathy (e.g., Aicardi-Goutieres Syndrome, Sjogren's syndrome, Singleton-Merten Syndrome, proteasome-associated autoinflammatory syndrome, SAVI (STING-associated vasculopathy with onset in infancy), CANDLE syndrome, chilblain lupus erythematosus, systemic lupus erythematosus, spondyloenchondrodysplasia), rheumatoid arthritis, juvenile rheumatoid arthritis, idiopathic thrombocytopenic purpura, autoimmune myocarditis, thrombotic thrombocytopenic purpura, autoimmune thrombocytopenia, psoriasis, Type 1 diabetes, or Type 2 diabetes.
- type I interferonopathy e.g., Aicardi-Goutieres Syndrome, Sjogren's syndrome, Singleton-Merten Syndrome, proteasome-
- the disease or disorder can be an inflammatory disorder (e.g., atherosclerosis, dermatomyositis, SIRS, sepsis, septic shock, atherosclerosis, celiac disease, interstitial cystitis, transplant rejection, rheumatoid arthritis, juvenile rheumatoid arthritis, inflammatory bowel disease (ulcerative colitis, Crohn’s disease), age-related macular degeneration, IgA nephropathy, glomerulonephritis, vasculitis, polymyositis, or Wegener’s disease).
- the methods find use in inhibiting STING pathway activation in inflammatory diseases. Inappropriate activation of the STING pathway may underlie certain inflammatory diseases, including inflammatory bowel diseases, arthritis and possibly lupus. Inhibitors of PI4KB are effective in ameliorating the pathological manifestations of such diseases.
- subjects suitable for treatment with a method of the present invention where STING pathway activation is enhanced include individuals having a cellular proliferative disease, such as a neoplastic disease (e.g., cancer).
- a cellular proliferative disease such as a neoplastic disease (e.g., cancer).
- Cellular proliferative disease is characterized by the undesired propagation of cells, including, but not limited to, neoplastic disease conditions, e.g., cancer.
- Examples of cellular proliferative disease include, but are not limited to, abnormal stimulation of endothelial cells (e.g., atherosclerosis), solid tumors and tumor metastasis, benign tumors, for example, hemangiomas, acoustic neuromas, neurofibromas, trachomas, and pyogenic granulomas, vascular malfunctions, abnormal wound healing, inflammatory and immune disorders, Bechet's disease, gout or gouty arthritis, abnormal angiogenesis accompanying, for example, rheumatoid arthritis, psoriasis, diabetic retinopathy, other ocular angiogenic diseases such as retinopathy of prematurity (retrolental fibroplastic), macular degeneration, corneal graft rejection, neurovascular glaucoma and Oster Webber syndrome, psoriasis, restenosis, fungal, parasitic and viral infections such cytomegaloviral infections.
- Subjects to be treated according to the methods of the invention include any
- the methods find use in enhancing the effects of STING agonists as cancer immunotherapies.
- examples of such instances include (i) co-administering STING agonists and an OSBP inhibitor into tumors; (ii) administering low doses of STING agonist systemically and OSBP inhibitors intratumorally; (iii) administering STING agonists intratumorally and OSBP inhibitors systemically; (iv) administering low doses of STING agonists and OSBP inhibitors systemically.
- the methods find use in enhancing the immuno-therapeutic effects of chemo- and radiotherapies.
- chemo and radio therapies are known to activate the cGAS-STING pathway and can thereby promote antitumor immune responses.
- Combining OSBP inhibitors with chemo or radiotherapy greatly amplifies the anti-tumor immune responses that accompany radio and chemotherapy.
- the methods find use in protecting specific tissues from STING pathway activation.
- STING pathway agonists such as CDNs, at high concentrations, can cause local tissue damage.
- critical tissues are protected if they are locally treated with a PI4KB inhibitor.
- subjects suitable for treatment with a subject method include individuals who have been clinically diagnosed as infected with a virus.
- the virus is a hepatitis virus (e.g., HAV, HBV, HCV, delta, etc.), particularly HCV, are suitable for treatment with the methods of the instant invention.
- Individuals who are infected with HCV are identified as having HCV RNA in their blood, and/or having anti- HCV antibody in their serum.
- individuals include naive individuals (e.g., individuals not previously treated for HCV, particularly those who have not previously received IFN-a-based or ribavirin-based therapy) and individuals who have failed prior treatment for HCV.
- subjects suitable for treatment with a method of the present invention include individuals having multiple sclerosis.
- Multiple sclerosis refers to an autoimmune neurodegenerative disease, which is marked by inflammation within the central nervous system with lymphocyte attack against myelin produced by oligodendrocytes, plaque formation and demyelization with destruction of the myelin sheath of axons in the brain and spinal cord, leading to significant neurological disability over time.
- an otherwise healthy person presents with the acute or sub-acute onset of neurological symptomatology (attack) manifested by unilateral loss of vision, vertigo, ataxia, dyscoordination, gait difficulties, sensory impairment characterized by paresthesia, dysesthesia, sensory loss, urinary disturbances until incontinence, diplopia, dysarthria or various degrees of motor weakness until paralysis.
- the symptoms may be painless, remain for several days to a few weeks, and then partially or completely resolve.
- a second attack will occur. During this period after the first attack, the patient is defined to suffer from probable MS. Probable MS patients may remain undiagnosed for years.
- the second attack occurs the diagnosis of clinically definite MS (CDMS) is made (Poser criteria 1983; C. M. Poser et al., Ann. Neurol. 1983; 13, 227).
- ACBD3 was identified as a gene involved in STING pathway activation via exogenously provided cyclic dinucleotides (See FIGS. 1A and 1 B). ACBD3 recruits PI4KB to the Golgi, to stimulate PI4P accumulation in the Golgi (See FIGS 2A and 2B). ACBD3 depletion in cells results in impaired STING activation in response to certain cyclic dinucleotides.
- a negative regulator of PI4KB recruitment to the Golgi is the protein OSBP.
- Modulation of ACBD3 and OSBP functions can be used to modulate STING pathway function as a means to either enhance activation of the pathway in the context of immunotherapy, or inhibit pathway activation in the case of pathology resulting from inappropriate STING pathway activation.
- OSBP molecules that inhibit OSBP have been described (itraconazole and OSW-1), including one (itraconazole) that is FDA approved for treating fungal diseases albeit by a different mechanism.
- these inhibitors which are predicted to increase PI4P accumulation in the Golgi, greatly enhance STING pathway activation induced by exogenously supplied cyclic dinucleotides. See FIGS 3A to 3C.
- Findings include:
- ACBD3 increases Pi4P in Golgi ⁇ -> OSBP shuttles PI4P out of Go!gi * OS8P inhibitors increase sensitivity to both CDNs -> boost in vivo response to injected CDNs
- a method of modulating stimulator of interferon genes (STING) pathway activation in a cell comprising: modulating Phosphatidylinositol 4-Kinase Beta (PI4KB) Golgi recruitment to modulate STING pathway activation in the cell.
- STING stimulator of interferon genes
- a method of enhancing STING pathway activation in a cell comprising: contacting the cell with an agent that increases PI4KB Golgi recruitment to enhance
- CDN is cyclic[A(2’5’)pA(3’5’)p], wherein each prefers to a phosphate, thiophosphate or dithiophosphate internucleotide linkage.
- CDN is cyclic[G(2’5’)pA(3’5’)p], wherein each prefers to a phosphate, thiophosphate or dithiophosphate internucleotide linkage.
- a method of reducing STING pathway activation in a cell comprising: contacting the cell with an agent that decreases PI4KB Golgi recruitment to reduce
- the autoimmune or inflammatory disease is selected from Aicardi-Goutieres Syndrome, Sjogren's syndrome, Singleton- Merten Syndrome, proteasome-associated autoinflammatory syndrome, SAVI (STING- associated vasculopathy with onset in infancy), CANDLE syndrome, chilblain lupus erythematosus, systemic lupus erythematosus, spondyloenchondrodysplasia), rheumatoid arthritis, juvenile rheumatoid arthritis, idiopathic thrombocytopenic purpura, autoimmune myocarditis, thrombotic thrombocytopenic purpura, autoimmune thrombocytopenia, psoriasis, Type 1 diabetes and Type 2 diabetes.
- the method comprises inhibiting CDN uptake locally or systemically to alleviate a toxic effect of a STING agonist administered for anti-cancer treatment.
- a composition comprising: a STING agonist; and an agent that increases PI4KB Golgi recruitment. 52. The composition according to clause 51 , wherein the agent inhibits OSBP activity.
- composition according to clause 53 wherein the agent increases ACBD3 activity.
- the STING agonist comprises a CDN.
- composition according to clause 55 wherein the CDN comprises a 2'-5' phosphodiester linkage.
- composition according to clause 56, wherein the CDN comprises a 2’-5’ phosphodiester linkage and a 3’-5’ phosphodiester linkage.
- composition according to clause 58, wherein the CDN has the formula: wherein X and Y are each independently: or a salt thereof.
- composition according to clause 55 wherein the CDN comprises a 2'-5' thiophosphate linkage.
- composition according to clause 55, wherein the CDN is cyclic[G(2’5’)pG(3’5’)p], wherein each prefers to a phosphate, thiophosphate or dithiophosphate internucleotide linkage.
- composition according to clause 55, wherein the CDN is cyclic[A(2’5’)pA(3’5’)p], wherein each prefers to a phosphate, thiophosphate or dithiophosphate internucleotide linkage.
- composition according to clause 55 wherein the CDN is cyclic[G(2’5’)pA(3’5’)p], wherein each prefers to a phosphate, thiophosphate or dithiophosphate internucleotide linkage.
- composition according to clause 55 wherein the CDN is cyclic[A(2’5’)pG(3’5’)p], wherein each prefers to a phosphate, thiophosphate or dithiophosphate internucleotide linkage.
- a kit comprising: a first composition comprising a STING agonist; and a second composition comprising an agent that increases PI4KB Golgi recruitment.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Immunology (AREA)
- Animal Behavior & Ethology (AREA)
- Pharmacology & Pharmacy (AREA)
- General Health & Medical Sciences (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Medicinal Chemistry (AREA)
- Chemical & Material Sciences (AREA)
- Epidemiology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Engineering & Computer Science (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Organic Chemistry (AREA)
- Molecular Biology (AREA)
- Transplantation (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
Abstract
Methods of modulating stimulator of interferon genes (STING) pathway activation are provided. Aspects of the methods include modulating Phosphatidylinositol 4-Kinase Beta (PI4KB) Golgi recruitment, e.g., via modulation of acyl-coenzyme A binding domain containing 3 (ACBD3) and/or oxysterol-binding protein (OSBP) activity, to modulate STING pathway activation. Also provided are compositions and kits for use in practicing the subject methods. The methods and compositions find use in a variety of applications, including therapeutic applications, such as methods of treating cancer or an inflammatory disease.
Description
METHODS OF MODULATING STING PATHWAY ACTIVATION
GOVERNMENT RIGHTS
This invention was made with Government support under contract AM 13041 awarded by the National Institutes of Health. The Government has certain rights in the invention.
CROSS-REFERENCE TO RELATED APPLICATION
Pursuant to 35 U.S.C. §119(e), this application claims priority to the filing date of United States Provisional Patent Application Serial No. 62/958,598, filed January 8, 2020, the disclosure of which application is incorporated herein by reference.
INTRODUCTION
The innate immune system, once activated, is directly protective to the host and also initiates broader immune responses mediated by T cells, B cells and NK cells. The accumulation of DNA in the cytosol of infected, cancerous or mutant cells can trigger an innate immune response via the cGAS/STING pathway. The response is initiated by the binding of cytosolic DNA to the cytosolic enzyme cGAMP synthase (cGAS), leading to the synthesis of the second messenger 2’3’- cyclic GMP-AMP (2’3’-cGAMP). 2’3’-cGAMP activates the protein ‘stimulator of interferon genes’ (STING), which in turn activates the transcription factors IRF3 and NF-KB, and consequently the production of cytokines, including type I interferons, that support a broader immune response.
The cGAS/STING pathway senses cytosolic DNA originating from viruses and bacteria. STING is also activated by cytosolic self-DNA, which accumulates in cells in certain autoinflammatory disorders, including Aicardi-Goutieres Syndrome and systemic lupus erythematosus. Furthermore, cytosolic DNA accumulates in cells subjected to DNA damage, as occurs in tumor cells, resulting in activation of the cGAS/STING pathway and the initiation of an anti-tumor immune response.
The natural anti-tumor immune response can be weak. An amplified anti-tumor immune response can occur when STING agonists, such as cyclic dinucleotides (CDNs), are introduced into the tumor microenvironment, leading to immune activation and tumor regression.
SUMMARY
Methods of modulating stimulator of interferon genes (STING) pathway activation are provided. Aspects of the methods include modulating Phosphatidylinositol 4-Kinase Beta
(PI4KB) recruitment to the Golgi, e.g., via modulation of acyl-coenzyme A binding domain containing 3 (ACBD3) and/or oxysterol-binding protein (OSBP) activity, to modulate STING pathway activation. Also provided are compositions and kits for use in practicing the subject methods. The methods and compositions find use in a variety of applications, including therapeutic applications, such as methods of treating cancer or an inflammatory disease.
BRIEF DESCRIPTION OF THE FIGURES
FIGS. 1 A to 3C provide experimental details as reported in the experimental section, below.
DEFINITIONS
The following definitions are set forth to illustrate and define the meaning and scope of the terms used in the description.
Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs. Singleton, et al., DICTIONARY OF MICROBIOLOGY AND MOLECULAR BIOLOGY, 2D ED., John Wiley and Sons, New York (1994), and Hale & Markham, THE HARPER COLLINS DICTIONARY OF BIOLOGY, Harper Perennial, N.Y. (1991 ) provide one of skill with the general meaning of many of the terms used herein. Still, certain terms are defined below for the sake of clarity and ease of reference.
The term "administration" or “administering” as used herein with regard to a human, mammal, mammalian subject, animal, veterinary subject, placebo subject, research subject, experimental subject, cell, tissue, organ, or biological fluid, refers without limitation to contact of an exogenous ligand, reagent, placebo, small molecule, pharmaceutical agent, therapeutic agent, diagnostic agent, or composition to the subject, cell, tissue, organ, or biological fluid, and the like. "Administration" can refer, e.g., to therapeutic, pharmacokinetic, diagnostic, research, placebo, and experimental methods. Treatment of a cell encompasses contact of a reagent to the cell, as well as contact of a reagent to a fluid, where the fluid is in contact with the cell. "Administration" also encompasses in vitro and ex vivo treatments, e.g., of a cell, by a reagent, diagnostic, binding composition, or by another cell. By "administered together" it is not meant to be implied that two or more agents be administered as a single composition. Although administration as a single composition is contemplated by the present disclosure, such agents may be delivered to a single subject as separate administrations, which may be at the same or different time, and which may be by the same route or different routes of administration.
The term "affinity" refers to the equilibrium constant for the reversible binding of two agents; “affinity” can be expressed as a dissociation constant (Kd).
The term “binding” refers to a direct association between two molecules, due to, for example, covalent, electrostatic, hydrophobic, and ionic and/or hydrogen-bond interactions, including interactions such as salt bridges and water bridges.
The terms “cell uptake” and “cellular uptake” are used interchangeably herein and refer to the movement of a compound from the extracellular environment or matrix and into a cell, e.g., to the cytoplasm of a cell.
"Fv" is the minimum antibody fragment which contains a complete antigen- recognition and -binding site. This region consists of a dimer of one heavy- and one light- chain variable domain in tight, non-covalent association. It is in this configuration that the three CDRs of each variable domain interact to define an antigen-binding site on the surface of the VH-VL dimer. Collectively, the six CDRs confer antigen-binding specificity to the antibody. However, even a single variable domain (or half of an Fv comprising only three CDRs specific for an antigen) has the ability to recognize and bind antigen, although at a lower affinity than the entire binding site.
The “Fab” fragment also contains the constant domain of the light chain and the first constant domain (CH1) of the heavy chain. Fab fragments differ from Fab' fragments by the addition of a few residues at the carboxyl terminus of the heavy chain CH1 domain including one or more cysteines from the antibody hinge region. Fab'-SH is the designation herein for Fab' in which the cysteine residue(s) of the constant domains bear a free thiol group. F(ab')2 antibody fragments originally were produced as pairs of Fab' fragments which have hinge cysteines between them. Other chemical couplings of antibody fragments are also known.
The "light chains" of antibodies (immunoglobulins) from any vertebrate species can be assigned to one of two clearly distinct types, called kappa and lambda, based on the amino acid sequences of their constant domains. Depending on the amino acid sequence of the constant domain of their heavy chains, immunoglobulins can be assigned to different classes. There are five major classes of immunoglobulins: IgA, IgD, IgE, IgG, and IgM, and several of these can be further divided into subclasses (isotypes), e.g., lgG1 , lgG2, lgG3, lgG4, IgA, and lgA2.
"Single-chain Fv" or "sFv" antibody fragments comprise the VH and VL domains of antibody, wherein these domains are present in a single polypeptide chain. In some embodiments, the Fv polypeptide further comprises a polypeptide linker between the VH and VL domains, which enables the sFv to form the desired structure for antigen binding. For a review of sFv, see Pluckthun in The Pharmacology of Monoclonal Antibodies, vol. 113, Rosenburg and Moore eds., Springer-Verlag, New York, pp. 269-315 (1994).
The terms "subject", “individual” and "patient" are used interchangeably and refer to a member or members of any mammalian or non-mammalian species that may have a need for the pharmaceutical methods, compositions and treatments described herein. Subjects and patients thus include, without limitation, primate (including humans), canine, feline, ungulate (e.g., equine, bovine, swine (e.g., pig)), avian, and other subjects. Humans and non-human animals having commercial importance (e.g., livestock and domesticated animals) are of particular interest.
"Mammal" means a member or members of any mammalian species, and includes, by way of example, canines; felines; equines; bovines; ovines; rodentia, etc. and primates, particularly humans. Non-human animal models, particularly mammals, e.g., primate, murine, lagomorpha, etc. may be used for experimental investigations.
"Treating" or "treatment" of a condition or disease includes: (1) preventing at least one symptom of the conditions, i.e., causing a clinical symptom to not significantly develop in a mammal that may be exposed to or predisposed to the disease but does not yet experience or display symptoms of the disease, (2) inhibiting the disease, i.e., arresting or reducing the development of the disease or its symptoms, or (3) relieving the disease, i.e., causing regression of the disease or its clinical symptoms. As used herein, the term “treating” is thus used to refer to both prevention of disease, and treatment of pre-existing conditions. For example, where the cyclic-di-nucleotide active agent is administered, the prevention of cellular proliferation can be accomplished by administration of the subject compounds prior to development of overt disease, e.g., to prevent the regrowth of tumors, prevent metastatic growth, etc. Alternatively, the compounds are used to treat ongoing disease, by stabilizing or improving the clinical symptoms of the patient.
Other definitions of terms may appear throughout the specification.
DETAILED DESCRIPTION
Methods of modulating stimulator of interferon genes (STING) pathway activation are provided. Aspects of the methods include modulating Phosphatidylinositol 4-Kinase Beta (PI4KB) recruitment to the Golgi, e.g., via modulation of acyl-coenzyme A binding domain containing 3 (ACBD3) and/or oxysterol-binding protein (OSBP) activity, to modulate STING pathway activation. Also provided are compositions and kits for use in practicing the subject methods. The methods and compositions find use in a variety of applications, including therapeutic applications, such as methods of treating cancer or an inflammatory disease.
Before the present invention is described in greater detail, it is to be understood that this invention is not limited to particular embodiments described, as such may, of course,
vary. It is also to be understood that the terminology used herein is for the purpose of describing particular embodiments only, and is not intended to be limiting, since the scope of the present invention will be limited only by the appended claims.
Where a range of values is provided, it is understood that each intervening value, to the tenth of the unit of the lower limit unless the context clearly dictates otherwise, between the upper and lower limit of that range and any other stated or intervening value in that stated range, is encompassed within the invention. The upper and lower limits of these smaller ranges may independently be included in the smaller ranges and are also encompassed within the invention, subject to any specifically excluded limit in the stated range. Where the stated range includes one or both of the limits, ranges excluding either or both of those included limits are also included in the invention.
Certain ranges are presented herein with numerical values being preceded by the term "about." The term "about" is used herein to provide literal support for the exact number that it precedes, as well as a number that is near to or approximately the number that the term precedes. In determining whether a number is near to or approximately a specifically recited number, the near or approximating unrecited number may be a number which, in the context in which it is presented, provides the substantial equivalent of the specifically recited number.
Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs. Although any methods and materials similar or equivalent to those described herein can also be used in the practice or testing of the present invention, representative illustrative methods and materials are now described.
All publications and patents cited in this specification are herein incorporated by reference as if each individual publication or patent were specifically and individually indicated to be incorporated by reference and are incorporated herein by reference to disclose and describe the methods and/or materials in connection with which the publications are cited. The citation of any publication is for its disclosure prior to the filing date and should not be construed as an admission that the present invention is not entitled to antedate such publication by virtue of prior invention. Further, the dates of publication provided may be different from the actual publication dates which may need to be independently confirmed.
It is noted that, as used herein and in the appended claims, the singular forms “a”, “an”, and “the” include plural referents unless the context clearly dictates otherwise. It is further noted that the claims may be drafted to exclude any optional element. As such, this statement is intended to serve as antecedent basis for use of such exclusive terminology as
“solely,” “only” and the like in connection with the recitation of claim elements, or use of a “negative” limitation.
As will be apparent to those of skill in the art upon reading this disclosure, each of the individual embodiments described and illustrated herein has discrete components and features which may be readily separated from or combined with the features of any of the other several embodiments without departing from the scope or spirit of the present invention. Any recited method can be carried out in the order of events recited or in any other order which is logically possible.
While the apparatus and method has or will be described for the sake of grammatical fluidity with functional explanations, it is to be expressly understood that the claims, unless expressly formulated under 35 U.S.C. §112, are not to be construed as necessarily limited in any way by the construction of "means" or "steps" limitations, but are to be accorded the full scope of the meaning and equivalents of the definition provided by the claims under the judicial doctrine of equivalents, and in the case where the claims are expressly formulated under 35 U.S.C. §112 are to be accorded full statutory equivalents under 35 U.S.C. §112.
Methods of Modulating STING Pathway Activation
As summarized above, methods of modulating STING pathway activation in a cell are provided. By modulating STING pathway activation is meant altering STING pathway activation, e.g., by increasing STING pathway activation or decreasing STING pathway activation, or by altering the specific outcomes of STING pathway activation with respect to which cytokines or mediators that are produced. As such, embodiments of the invention include methods of increasing STING pathway activation in a cell. The magnitude of increase in such embodiments relative to a suitable control (e.g., where a PI4KB Golgi recruitment modulating agent, such as described below, is not employed) may vary, where in some instances the magnitude is 2-fold or more, such as 5-fold or more, including 10-fold or more. Other embodiments of the invention include methods of decreasing STING pathway activation in a cell. The magnitude of decrease in such embodiments relative to a suitable control may vary, where in some instances the magnitude is 2-fold or more, such as 5-fold or more, including 10-fold or more.
Aspects of the methods include modulating Phosphatidylinositol 4-Kinase Beta (PI4KB) recruitment to the Golgi in a cell (i.e., PI4KB Golgi recruitment), e.g., via modulation of acyl-coenzyme A binding domain containing 3 (ACBD3) and/or oxysterol-binding protein (OSBP) activity, to modulate STING pathway activation. Phosphatidylinositol 4-kinase beta (PI4KB) is a soluble protein shuttling between the cytoplasm and the nucleus, and can be recruited to the membranes of the Golgi system via protein-protein interactions, e.g. with small GTP binding proteins Arf1 and Rab11 , or a Golgi adaptor protein ACBD3. By
modulating PI4KB recruitment to the Golgi is meant altering or changing recruitment of PI4KB to the Golgi apparatus. In some instances, the methods include increasing PI4KB Golgi recruitment in a cell. The magnitude of increase in such embodiments relative to a suitable control may vary, where in some instances the magnitude is 2-fold or more, such as 5-fold or more, including 10-fold or more. Other embodiments of the invention include decreasing PI4KB Golgi recruitment in a cell. The magnitude of decrease in such embodiments relative to a suitable control may vary, where in some instances the magnitude is 2-fold or more, such as 5-fold or more, including 10-fold or more.
In those embodiments that increase PI4KB Golgi recruitment in a cell, e.g., where STING pathway activation is desired, the methods may include increasing ACBD3 activity and/or decreasing OSBP activity. As such, the methods may include increasing ACBD3 activity in the cell. The magnitude of increase in such embodiments relative to a suitable control may vary, where in some instances the magnitude is 2-fold or more, such as 5-fold or more, including 10-fold or more. Alternatively, the methods may include decreasing OSBP activity in the cell. The magnitude of decrease in such embodiments relative to a suitable control may vary, where in some instances the magnitude is 2-fold or more, such as 5-fold or more, including 10-fold or more. In some instances, the methods include both increasing ACBD3 activity in the cell and decreasing OSBP activity in the cell.
In those embodiments that decrease PI4KB Golgi recruitment in a cell, e.g., where inhibition of STING pathway activation is desired, the methods may include decreasing ACBD3 activity and/or increasing OSBP activity. As such, the methods may include decreasing ACBD3 activity in the cell. The magnitude of decrease in such embodiments relative to a suitable control may vary, where in some instances the magnitude is 2-fold or more, such as 5-fold or more, including 10-fold or more. Alternatively, the methods may include increasing OSBP activity in the cell. The magnitude of increase in such embodiments relative to a suitable control may vary, where in some instances the magnitude is 2-fold or more, such as 5-fold or more, including 10-fold or more. In some instances, the methods include both decreasing ACBD3 activity in the cell and increasing OSBP activity in the cell.
In some instances, modulating STING pathway activation means increasing or enhancing the activity of a STING agonist, e.g., cyclic dinucleotide (CDN) or other STING agonist (e.g., amidobenzimidazole STING receptor agonists, such as described in Ramanjulu et al., "Design of amidobenzimidazole STING receptor agonists with systemic activity," Nature (2018) 564: 439-443), in a cell, in vitro or in vivo. When STING pathway activation is increased, one or more activities of a STING agonist, e.g., CDN or other STING agonist, of interest can also be increased or enhanced. In certain instances, activities of a STING agonist that are increased or enhanced include, but are not limited to, production of type I interferon (IFN), e.g., to provide an anti-tumor immune response or an immune
response against a pathogen, and intercellular 2’3’-cGAMP signaling, e.g., between virus- infected cells and uninfected cells or between tumor cells and non-tumor cells. In certain cases, the parameter of interest, e.g., production of a type I interferon in a cell, is increased or enhanced by 10% or more, such as 20% or more, 30% or more, 40% or more, 50% or more, 60% or more, 70% or more, 80% or more, 90% or more, 100% or more, 2-fold or more, 3-fold or more, or even more, e.g., relative to a suitable control.
Modulating STING pathway activation is meant to encompass enhancing the treatment of a pathologic or disease condition in which a STING agonist, e.g., CDN, finds use, e.g., relative to treatment in the absence of a STING pathway activation modulating agent. Pathologic or disease conditions of interest are described herein and include, but are not limited to, cellular proliferative disease, cancer, autoimmune or inflammatory disease, viral infection (e.g., hepatitis virus), infections with intracellular bacteria and parasites. Enhancing the treatment of a pathologic or disease condition may include amelioration of the symptoms of a particular condition, arresting or reducing the development of the disease or its symptoms, and/or stabilizing or improving the clinical symptoms of the patient. Modulating STING pathway activation is also meant to encompass treatment of a pathologic or disease condition with reduced amounts of a STING agonist as compared to what would otherwise be required in the absence of STING pathway activation in accordance with the present invention. As such, modulating STING pathway activation is also meant to encompass treatment of a pathologic or disease condition with effective amount of a CDN that is reduced relative to the amount of the CDN that would otherwise be utilized as effective in the absence of the STING pathway activation modulating agent. Modulating STING pathway activation is also meant to encompass treatment of a pathologic or disease condition without administration of a STING agonist, such as a CDN, e.g., where there is intrinsic but weak activation of the pathway due to, e.g. dysregulated DNA replication, for example in cancer cells, or e.g., in certain infections, such that STING pathway modulation in accordance with embodiments of the invention enhances those responses sufficiently to induce an anti-tumor or anti-pathogen response without applying a STING agonist.
In certain instances, modulating the STING pathway activation means decreasing or inhibiting the activity of a CDN in a cell, in vitro or in vivo. When STING pathway activation is decreased, one or more activities of a CDN of interest can also be decreased or inhibited. Modulating the activity of a CDN in a cell is meant to encompass ameliorating undesirable side effects of a CDN therapy for a pathologic or disease condition, e.g., relative to CDN therapy in the absence of the PI4KB Golgi recruitment modulating agent. In certain instances, activities of a CDN that are decreased or inhibited include, but are not limited to, intercellular 2’3’-cGAMP signaling and cell toxicity. In certain cases, the parameter of interest is decreased or inhibited by 10% or more, such as 20% or more, 30% or more, 40% or more,
50% or more, 60% or more, 70% or more, 80% or more, 90% or more, 100% or more, 2-fold or more, 3-fold or more, or even more, e.g., relative to a suitable control.
PI4KB Golgi recruitment-modulating agents
As summarized above, aspects of the subject methods include use of agents that modulate PI4KB Golgi recruitment, as described above. Aspects of the subject methods include contacting a cell with a PI4KB Golgi recruitment-modulating agent to modulate PI4KB Golgi recruitment in a cell thereby modulating STING pathway activation and, in some instances, the activity of the CDN of interest in the cell. A PI4KB Golgi recruitment - modulating agent is an agent that is capable of modulating the PI4KB Golgi recruitment either directly (e.g., via direct binding to produce an enhancing or inhibiting effect) or indirectly (e.g., via modulating expression of an activity of interest, e.g., ACDB3 and/or OSBP). Any convenient agent that is capable of modulating the activity of a target protein can be adapted for use in the subject methods. In some instances, the agent directly binds to a target protein, e.g., ACDB3, OSBP, etc., to modulate its activity. In certain instances, the agent acts indirectly, e.g., via modulating expression of the target protein.
PI4KB Golgi recruitment-modulating agents of interest include, but are not limited to, small molecule, nucleic acid, e.g., RNA or DNA, and peptide, e.g., protein, agents. PI4KB Golgi recruitment-modulating agents include small molecule compounds that selectively inhibit the activity of the target protein, e.g., ACDB3 or OSBP, of interest. PI4KB Golgi recruitment-modulating agents include small molecules that selectively enhance the activity of the target protein. Small molecule compounds that specifically and directly bind to the target protein are of interest. Naturally occurring or synthetic small molecule compounds of interest include numerous chemical classes, such as organic molecules, e.g., small organic compounds having a molecular weight of more than 50 and less than about 2,500 daltons. The compounds can include functional groups for structural interaction with proteins, particularly hydrogen bonding, and typically include at least an amine, carbonyl, hydroxyl or carboxyl group, preferably at least two of the functional chemical groups. The candidate agents may include cyclical carbon or heterocyclic structures and/or aromatic or polyaromatic structures substituted with one or more of the above functional groups.
For enhancing STING pathway activation, in some instances a small molecule inhibitor of OSBP is employed. Any convenient small molecule inhibitor of OSBP may be employed, where examples of such inhibitors include, but are not limited to: 25- hydroxycholesterol [250HC], T-00127-HEV2, AN-12-H5, itraconazole [ITZ], OSW-1 , Osw-1 analogs and conjugates, e.g., as described in published PCT application Publication No. WO2012159027A2, the disclosure of which is herein incorporated by reference, TTP-8307, and the like.
For reducing STING pathway activation, in some instances a small molecule inhibitor of ACBD3 or PI4KB is employed. Any convenient small molecule inhibitor of ACBD3 may be employed. Any convenient small molecule inhibitor of PI4KB may be employed, where examples of such inhibitors include, but are not limited to: MI356, Compound 10, PIK93, UCB9608, those compounds described in published PCT application Publication Nos. WO2019141694A1 , WO2017055305A1 , WO2017097871 A1 , WO2015193167A1 (the disclosures of which are herein incorporated by reference, those compounds described in Chinese Patent No. CN102453712B and European Patent No. EP2319926B1 (the disclosures of which are herein incorporated by reference, those compounds described in Rutaganira et al., "Design and Structural Characterization of Potent and Selective Inhibitors of Phosphatidylinositol 4 Kinase IIIb," J. Med. Chem. (2016) 59: 1830-1839, and the like.
PI4KB Golgi recruitment-modulating agents are also found among biomolecules including proteins, peptides, saccharides, fatty acids, steroids, purines, pyrimidines, derivatives, structural analogs or combinations thereof. Such molecules may be identified using any convenient methods. In some cases, useful PI4KB Golgi recruitment -modulating agents exhibit an affinity (Kd) for a target protein, such as ACBD3 or OSBP, that is sufficient to provide for the desired modulation of PI4KB Golgi recruitment. The affinity of the PI4KB Golgi recruitment -modulating agent can be at least 1 -fold greater, at least 2-fold greater, at least 3-fold greater, at least 4-fold greater, at least 5-fold greater, at least 6-fold greater, at least 7-fold greater, at least 8-fold greater, at least 9-fold greater, at least 10-fold greater, at least 20-fold greater, at least 30-fold greater, at least 40-fold greater, at least 50-fold greater, at least 60-fold greater, at least 70-fold greater, at least 80-fold greater, at least 90-fold greater, at least 100-fold greater, or at least 1000-fold greater, or more, than the affinity of the agent for unrelated protein. In some cases, the affinity of a PI4KB Golgi recruitment - modulating agents to a target protein, e.g., ACBD3 or OSBP, can be, for example, from about 100 nanomolar (nM) to about 1 nM, from about 100 nanomolar (nM) to about 0.1 nM, from about 100 nM to about 1 picomolar (pM), or from about 100 nM to about 1 femtomolar (fM), or from about 10 nanomolar (nM) to about 0.1 nM. In some embodiments, the affinity between the agent and a target protein is characterized by a Kd (dissociation constant) of 10 6 M or less, such as 107 M or less, including 108 M or less, e.g., 109 M or less, 1010 M or less, 1011 M or less, 1012 M or less, 1013 M or less, 1014 M or less, including 1015 M or less.
PI4KB Golgi recruitment-modulating agents include antibodies that specifically bind to a target protein. In some cases, the antibody specifically binds an epitope of the target protein that provides for inhibition of the function of the target protein. In certain cases, the antibody specifically binds a distinct epitope of the target protein that provides for the desired modulation of STING pathway activation in a cell.
Antibodies that can be used as PI4KB Golgi recruitment-modulating agents in connection with the present disclosure can encompass, but are not limited to, monoclonal antibodies, polyclonal antibodies, bispecific antibodies, Fab antibody fragments, F(ab)2 antibody fragments, Fv antibody fragments (e.g., VH or VL), single chain Fv antibody fragments and dsFv antibody fragments.
Furthermore, the antibody molecules can be fully human antibodies, humanized antibodies, or chimeric antibodies. The antibodies that can be used in connection with the present disclosure can include any antibody variable region, mature or unprocessed, linked to any immunoglobulin constant region. Minor variations in the amino acid sequences of antibodies or immunoglobulin molecules are encompassed by the present disclosure, providing that the variations in the amino acid sequence maintain 75% or more, e.g., 80% or more, 90% or more, 95% or more, or 99% or more of the sequence. In particular, conservative amino acid replacements are contemplated. Conservative replacements are those that take place within a family of amino acids that are related in their side chains. Whether an amino acid change results in a functional peptide can be determined by assaying the specific activity of the polypeptide derivative.
"Antibody fragments" comprise a portion of an intact antibody, for example, the antigen binding or variable region of the intact antibody. Examples of antibody fragments include Fab, Fab', F(ab')2, and Fv fragments; diabodies; linear antibodies (Zapata et al., Protein Eng. 8(10): 1057-1062 (1995)); single-chain antibody molecules; and multispecific antibodies formed from antibody fragments. Papain digestion of antibodies produces two identical antigen-binding fragments, called "Fab" fragments, each with a single antigen binding site, and a residual "Fc" fragment, a designation reflecting the ability to crystallize readily. Pepsin treatment yields an F(ab')2 fragment that has two antigen-combining sites and is still capable of cross-linking antigen.
Antibodies that can be used in connection with the present disclosure thus can encompass monoclonal antibodies, polyclonal antibodies, bispecific antibodies, Fab antibody fragments, F(ab)2 antibody fragments, Fv antibody fragments (e.g., VH or VL), single chain Fv antibody fragments and dsFv antibody fragments. Furthermore, the antibody molecules can be fully human antibodies, humanized antibodies, or chimeric antibodies. In some embodiments, the antibody molecules are monoclonal, fully human antibodies. The antibodies that can be used in connection with the present disclosure can include any antibody variable region, mature or unprocessed, linked to any immunoglobulin constant region. If a light chain variable region is linked to a constant region, it can be a kappa chain constant region. If a heavy chain variable region is linked to a constant region, it can be a human gamma 1 , gamma 2, gamma 3 or gamma 4 constant region, more preferably, gamma 1 , gamma 2 or gamma 4 and even more preferably gamma 1 or gamma 4. In some
cases, the PI4KB Golgi recruitment -modulating agent is an antibody. In certain cases, the PI4KB Golgi recruitment -modulating agent is an antibody fragment or binding derivative thereof. The antibody fragment or binding derivative thereof can be selected from a Fab fragment, a F(ab')2 fragment, a scFv, a diabody and a triabody.
Depending on the particular embodiments being practiced, a variety of different types of PI4KB Golgi recruitment-modulating agents may be employed. In some instances, the agent modulates the activity of a target protein following expression, such that the agent is one that changes the activity of the protein encoded by the target gene following expression of the protein from the target gene. In other embodiments, the PI4KB Golgi recruitment- modulating agent modulates expression of the RNA and/or protein from the gene encoding the target protein, such that it changes the expression of the RNA or protein from the target gene in some manner. In these instances, the agent may change expression of the RNA or protein in a number of different ways. As would be readily understood by one of ordinary skill in the art, one can reduce expression (protein production) of an endogenous gene at the DNA, RNA, or protein level. For example, expression can be reduced by reducing the total amount of wild type protein made by the endogenous locus, and this can be accomplished either by changing the nature of the protein produced (e.g., via gene mutation to generate a loss of function allele such as a null allele or an allele that encodes a protein reduced function) or by reducing the overall levels of protein produced without changing the nature of the protein itself.
In certain embodiments, the PI4KB Golgi recruitment-modulating agent is one that reduces, including inhibits, expression of a functional target protein, e.g., ACBD3 or OSBP. Inhibition of protein expression may be accomplished using any convenient means, and one of ordinary skill in the art will be aware of multiple suitable methods. For example, in order to reduce/inhibit expression, one can reduce protein levels post-translationally; one can block production of protein by blocking/reducing translation of mRNA (e.g., using an RNAi agent such as an shRNA or siRNA that targets the mRNA of an endogenous gene); one can reduce mRNA levels post-transcriptionally (e.g., using an RNAi agent such as an shRNA or siRNA that targets the mRNA of an endogenous gene); one can reduce mRNA levels by blocking transcription (e.g., using gene editing tools to either alter a promoter and/or enhancer sequence or to modulate transcription, or by using modified gene editing tools, e.g., CRISPRi, that can modify transcription without cutting the target DNA). Additionally, one can alter the nature of the protein made from an endogenous locus by inducing (e.g., using gene editing technology) a loss of function mutation, which can range from an allele with reduced wild type activity to a dead protein or no protein (e.g., catalytically inactive mutant, a frameshift allele, a gene knockout, etc.). Moreover, one can reduce mRNA levels
via gene editing methods that result in low net transcript levels (e.g., frameshift mutations can trigger nonsense mediated mRNA decay).
Any convenient inhibitor of expression can be utilized as an antagonist in the subject methods. Such antagonists can act to inhibit expression at a transcriptional, translational, or post-translational level. In some embodiments, the inhibitors are nucleic-acid based, including, without limitation, DNA, RNA, chimeric RNA/DNA, protein nucleic acid, and other nucleic acid derivatives. In some embodiments, the expression inhibitors encompass RNA molecules capable of inhibiting receptor production when introduced into a receptorexpressing cell (termed RNAi), including short hairpin double-stranded RNA (shRNA). In some instances, the expression inhibitors are small interfering RNA (siRNA). In some instances, the expression inhibitors are small interfering microRNA. It will be understood that any sequence capable of reducing the cell surface expression of a receptor, or reducing the expression of a receptor ligand, can be used in practicing the methods of the present disclosure.
Examples of agents that inhibit expression of an endogenous gene (.g., as described herein) include but are not limited to: (a) an RNAi agent such as an shRNA or siRNA that specifically targets mRNA encoded by the endogenous gene; (b) a genome editing agent (e.g., a Zinc finger nuclease, a TALEN, a CRISPR/Cas genome editing agent such as Cas9, Cpf1 , CasX, CasY, and the like) that cleaves the target cell’s genomic DNA at a locus encoding the endogenous gene (e.g., ACBD3 or OSBP) - thus inducing a genome editing event (e.g., null allele, partial loss of function allele) at the locus of the endogenous gene; (c) a modified genome editing agent such as a nuclease dead zinc finger, TALE, or CRISPR/Cas nuclease fused to a transcriptional repressor protein that modulates (e.g. reduces) transcription at the locus encoding the target protein encoding endogenous gene (e.g., ACBD3 or OSBP) (see, e.g., Qi et al„ Cell. 2013 Feb 28;152(5):1173-83’; Gilbert et al, Cell. 2014 Oct 23;159(3):647-61 ; Larson et al., Nat Protoc. 2013 Nov;8(11):2180-96).
Antisense molecules can be used to down-regulate expression of a target gene in the cell. The anti-sense reagent may be antisense oligodeoxynucleotides (ODN), particularly synthetic ODN having chemical modifications from native nucleic acids, or nucleic acid constructs that express such anti-sense molecules as RNA. The antisense sequence is complementary to the mRNA of the targeted protein, and inhibits expression of the targeted protein. Antisense molecules inhibit gene expression through various mechanisms, e.g., by reducing the amount of mRNA available for translation, through activation of RNAse H, or steric hindrance. One or a combination of antisense molecules may be administered, where a combination may include multiple different sequences.
Antisense oligonucleotides may be chemically synthesized by methods known in the art (see Wagner etal. (1993), supra, and Milligan etal., supra.) Oligonucleotides may be
chemically modified from the native phosphodiester structure, in order to increase their intracellular stability and binding affinity. A number of such modifications have been described in the literature, which alter the chemistry of the backbone, sugars or heterocyclic bases.
As an alternative to anti-sense inhibitors, catalytic nucleic acid compounds, e.g. ribozymes, anti-sense conjugates, etc. may be used to inhibit gene expression. Ribozymes may be synthesized in vitro and administered to the patient, or may be encoded on an expression vector, from which the ribozyme is synthesized in the targeted cell (for example, see International patent application WO 9523225, and Beigelman etal. (1995), Nucl. Acids Res. 23:4434-42). In addition, the transcription level of a protein can be regulated by gene silencing using RNAi agents, e.g., double-strand RNA (Sharp (1999) Genes and Development 13: 139-141). RNAi, such as double-stranded RNA interference (dsRNAi) or small interfering RNA (siRNA), has been extensively documented in the nematode C. elegans (Fire, A., et al, Nature, 391 , 806-811 , 1998) and routinely used to “knock down” genes in various systems. RNAi agents may be dsRNA or a transcriptional template of the interfering ribonucleic acid that can be used to produce dsRNA in a cell. A number of options can be utilized to deliver the dsRNA into a cell or population of cells such as in a cell culture, tissue, organ or embryo. For instance, RNA can be directly introduced intracellularly. Various physical methods are generally utilized in such instances, such as administration by microinjection (see, e.g., Zernicka-Goetz, et al. (1997) Development 124:1133-1137; and Wianny, et al. (1998) Chromosoma 107: 430-439). Other options for cellular delivery include permeabilizing the cell membrane and electroporation in the presence of the dsRNA, liposome-mediated transfection, or transfection using chemicals such as calcium phosphate. A number of established gene therapy techniques can also be utilized to introduce the dsRNA into a cell. By introducing a viral construct within a viral particle, for instance, one can achieve efficient introduction of an expression construct into the cell and transcription of the RNA encoded by the construct.
In some instances, methods include enhancing expression of target protein, e.g., ACBD3 or OSBP, to increase the activity thereof. Expression of a target protein may be enhanced using any convenient protocol. In some instances, a vector is employed to introduce a nucleic acid coding sequence for the target protein into the cell, whereby the target protein is expressed in the cell. Accordingly, one aspect of the invention is a nucleic acid vector that includes a coding sequence for a target protein, e.g., ACBD3 or OSBP. Application of the subject vector to a subject, e.g. using any convenient method such as a gene therapy method, may result in expression of one or more coding sequences of interest in cells of the subject, to produce a biologically active product that may modulate a biological activity of the cell and thereby modulating STING pathway activation. In some cases, the
vector is a nucleic acid vector comprising a coding sequence for ACBD3. In some cases, the vector is a nucleic acid vector comprising a coding sequence for OSBP.
In some instances, the vector comprises a coding sequence for the target protein, e.g., ACBD3 for enhancing STING pathway activation or OSBP for reducing STING pathway activation, suitable for use in gene therapy. Gene therapy vectors of interest include any kind of particle that comprises a polynucleotide fragment encoding the target protein, operably linked to a regulatory element such as a promoter, which allows the expression of a functional target protein in the targeted cells.
The target protein sequence used in the gene therapy vector may be derived from the same species as the subject. Any convenient target protein sequences, or fragments or functional equivalents thereof, may be utilized in the subject vectors, including sequences from any convenient animal, such as a primate, ungulate, cat, dog, or other domestic pet or domesticated mammal, rabbit, pig, horse, sheep, cow, or a human. For example, gene therapy in humans may be carried out using the human target protein sequence, e.g., human ACBD3 or human OSBP coding sequence.
Human ACBD3 mRNA coding sequence has been assigned NCBI ref seq number NM_022735 and has the following sequence:
1 agaggtcagc aggaagtcga tacgtggctg ccgtctgtcc ccgctgagga ggtgcagcag
61 ccggagatgg cggcggtgct gaacgcagag cgactcgagg tgtccgtcga cggcctcacg
121 ctcagcccgg acccggagga gcggcctggg gcggagggcg ccccgctgct gccgccaccg
181 ctgccaccgc cctcgccacc tggatccggt cgcggcccgg gcgcctcagg ggagcagccc
241 gagcccgggg aggcggcggc tgggggcgcg gcggaggagg cgcggcggct ggagcagcgc
301 tggggtttcg gcctggagga gttgtacggc ctggcactgc gcttcttcaa agaaaaagat
361 ggcaaagcat ttcatccaac ttatgaagaa aaattgaagc ttgtggcact gcataagcaa
421 gttcttatgg gcccatataa tccagacact tgtcctgagg ttggattctt tgatgtgttg
481 gggaatgaca ggaggagaga atgggcagcc ctgggaaaca tgtctaaaga ggatgccatg
541 gtggagtttg tcaagctctt aaataggtgt tgccatctct tttcaacata tgttgcgtcc
601 cacaaaatag agaaggaaga gcaagaaaaa aaaaggaagg aggaagagga gcgaaggcgg
661 cgtgaagagg aagaaagaga acgtctgcaa aaggaggaag agaaacgtag gagagaagaa
721 gaggaaaggc ttcgacggga ggaagaggaa aggagacgga tagaagaaga aaggcttcgg
781 ttggagcagc aaaagcagca gataatggca gctttaaact cccagactgc cgtgcagttc
841 cagcagtatg cagcccaaca gtatccaggg aactacgaac agcagcaaat tctcatccgc
901 cagttgcagg agcaacacta tcagcagtac atgcagcagt tgtatcaagt ccagcttgca
961 cagcaacagg cagcattaca gaaacaacag gaagtagtag tggctgggtc ttccttgcct
1021 acatcatcaa aagtgaatgc aactgtacca agtaatatga tgtcagttaa tggacaggcc
1081 aaaacacaca ctgacagctc cgaaaaagaa ctggaaccag aagctgcaga agaagccctg
1141 gagaatggac caaaagaatc tcttccagta atagcagctc catccatgtg gacacgacct
1201 cagatcaaag acttcaaaga gaagattcag caggatgcag attccgtgat tacagtgggc
1261 cgaggagaag tggtcactgt tcgagtaccc acccatgaag aaggatcata tctcttttgg
1321 gaatttgcca cagacaatta tgacattggg tttggggtgt attttgaatg gacagactct
1381 ccaaacactg ctgtcagcgt gcatgtcagt gagtccagcg atgacgacga ggaggaagaa
1441 gaaaacatcg gttgtgaaga gaaagccaaa aagaatgcca acaagccttt gctggatgag
1501 attgtgcctg tgtaccgacg ggactgtcat gaggaggtgt atgctggcag ccatcaatat
1561 ccagggagag gagtctatct cctcaagttt gacaactcct actctttgtg gcggtcaaaa
1621 tcagtctact acagagtcta ttatactaga taaaaatgtt gttacaaagt ctggagtcta
1681 gggttgggca gaagatgaca tttaatttgg aaatttcttt ttacttttgt ggagcattag
1741 agtcacagtt taccttattg atattggtct gatggtttgt gaactcttgc tgggaatcaa
1801 aatttccttg agactcttta gcattcatac tttggggtta aaggagattc ctcagactca
1861 tccagccctt gggtgctgac cagcagagtc actagtggat gctgaagtta catgagctac
1921 atgttaaata tttaaagtct ccaaaataaa acaccccaac gttgacctta cccggctgat
1981 ggttagcccc ttgctgcctg ctccatgtgt cttatgagag cccgtagtta cagtgtcctc 2041 taatttgaaa tccataagtt aacaagtcta tatcaggtgc agctggcttt gattaaaggc 2101 catttttaaa acttaaaaac tcaacacctc acagattata atagaaaaag aaatggcctc 2161 agtttgatct cgttcagaat gacccagatt gtttctgctt tgggtgcagc tgtttagttc 2221 agagttatat tacagagaat tattttctga gataatctta aactagaatg ttcaaaacta 2281 attgataatt gaagtatcaa gatacgtaga acacctcaga gatttttctt caggaacttc 2341 cacaaacttt gaatccttgt atctttattt ggtattcata ctactagtag caaaatacag 2401 gttttttgtt ttgttttgtt ttgttttggc ttcatagagt atctcaaatt gaaacttttc 2461 tgcacaaaga ataaaattaa ggattttata aactcaaatt ggcacctact gaattaaaat 2521 acataaaatc atttaaatat aattcagcat atgggaagta acattgcact aatatggaaa 2581 tcactgccag agacagtcta ttttctttta atttgttact acttagtcac aaaccccaca 2641 ttattccagt ttggaattac ttattaagga gaattggaaa tacatatgcc catgcttaaa 2701 ttttatagct ttaatttgtg ttatttcttt attgacggga agaggtacat ctttttttcc 2761 ttactgaaaa caaatatgga ttaattgcct caaatttgta taagtgattg gctagtgatt 2821 cttgttttca gaagggagag tggtatagat agaaaatgac aaagatggca atatacactt 2881 aatgttgtta ttgtatgttg ttactgaagt acttagattt ttaaaatttc aaatcctaaa 2941 tcacttcttg taggagggtt ttcattaact gcagtatata cagttcacta catatgggtt 3001 gtttgagttt tttgtgtgct gtatttcttt ctgtttttta atacctggtt ttgtacatat 3061 ctaactctgt tctcttttgg ttgttcagaa actggatttt ttttttctta agcagtgctt 3121 aatttgtgtt ttttaatttt gattcagaag tagtcccagc tcataggtgt tcatactgtt 3181 acatccagaa catttgtcag gctctctgtc agctttcatg tacatatggt atagaaacca 3241 tggagttagg cacttcctgg attttttttt tatgagaaaa atactgtatt taaaatgtaa 3301 aataaacttt taaaaagcag gcactaatat atatttcttc cagcctttga ttacaaattt 3361 gtccttgcac atgttaagat gaattatctc ctaaaaatat cattgttctt gggagcagtg 3421 tatgttactt tacatagcag cggttcctgt catgtgttca tgtcagaata tttttggttt 3481 taaactttct tattgccttt ggctgttgat tagtacagta caagtgcgat ttcaaaaaga 3541 tcttgaaagt aatatattta atcaattaaa atgtttatct gtaa (SEQ ID NO:01)
Human ACBD3 has a sequence encoded by the above coding sequence of:
MAAVLNAERLEVSVDGLTLSPDPEERPGAEGAPLLPPPLPPPSP PGSGRGPGASGEQPEPGEAAAGGAAEEARRLEQRWGFGLEELYGLALRFFKEKDGKAF HPTYEEKLKLVALHKQVLMGPYNPDTCPEVGFFDVLGNDRRREWAALGNMSKEDAMVE FVKLLNRCCHLFSTYVASHKIEKEEQEKKRKEEEERRRREEEERERLQKEEEKRRREE EERLRREEEERRRIEEERLRLEQQKQQIMAALNSQTAVQFQQYAAQQYPGNYEQQQIL IRQLQEQHYQQYMQQLYQVQLAQQQAALQKQQEVWAGSSLPTSSKVNATVPSNMMSV NGQAKTHTDSSEKELEPEAAEEALENGPKESLPVIAAPSMWTRPQIKDFKEKIQQDAD SVITVGRGEVVTVRVPTHEEGSYLFWEFATDNYDIGFGVYFEWTDSPNTAVSVHVSES SDDDEEEEENIGCEEKAKKNANKPLLDEIVPVYRRDCHEEVYAGSHQYPGRGVYLLKF DNSYSLWRSKSVYYRVYYTR (SEQ ID NO:02)
Human OSBP mRNA coding sequence has been assigned NCBI ref seq number NM_002556 and has the following sequence:
1 ggggacgctg cgcggcggtg gctgatgcgg tagccgtgtg gggcgctccg ggcggcgacg 61 gcggctctcg taggcggttc cggtcttgta tctccaggcg gcggcggctc atggcggcga 121 cggagctgag aggagtggtg gggccaggcc cggcagccat tgcagcactt ggcggcggcg 181 gcgccggtcc cccagtggtg ggaggaggcg gcggccgcgg agatgcgggg ccaggctccg 241 gggccgcgtc agggacggtg gtcgcggcgg cggcgggagg cccgggcccg ggggccgggg 301 gagtggcggc ggctggcccg gcccctgcgc cgccgactgg gggctcgggc ggctcgggcg 361 ctgggggttc gggctcggct cgagagggct ggctcttcaa atggaccaat tatatcaaag 421 gctaccagcg gcgatggttc gtgctgagca acgggctcct gagctactac agatcaaagg 481 cagaaatgag acatacctgc cgtggtacca tcaacctcgc cacagccaac atcaccgtgg 541 aggactcctg caacttcatc atttccaatg ggggtgctca gacctaccat ctgaaagcta 601 gttcagaagt tgagcggcag cgctgggtga cggccctgga actggccaag gccaaagctg 661 tgaagatgct ggcagagtca gatgaatcag gagatgaaga gtctgtctca caaactgaca 721 agactgagct gcagaatacc cttcggaccc tctctagcaa agtagaggac ttgagcacgt 781 gcaatgactt gatagctaag catggcacag ctctgcagcg ttctctcagt gagctggagt 841 ccctgaagtt gcctgctgag agcaatgaaa agatcaaaca ggtcaacgaa cgagccacac 901 tctttaggat aacatccaat gccatgatca acgcctgcag agatttcctc atgttagccc
961 agacccatag taaaaaatgg caaaagtcac tacagtatga aagagaccag cgtatccgac
1021 tggaagaaac cctcgagcag ctggcgaagc agcataatca cctggagagg gccttccgag
1081 gagccacggt gctgccggca aacactcctg gcaatgtggg ttctggtaaa gatcagtgct
1141 gctctggcaa aggggacatg agcgatgaag atgatgagaa tgaatttttt gatgcacctg
1201 agatcatcac catgcctgaa aatttgggcc acaaacgtac tggcagcaat atcagtggag
1261 ccagcagtga catcagcctt gatgaacagt acaagcatca gctggaggag accaaaaagg
1321 aaaagagaac cagaatacca tacaagccaa actatagcct caatttatgg agcatcatga
1381 agaactgcat tggaaaagaa ctctctaaga tccccatgcc ggtaaacttt aatgagccct
1441 tgtccatgct tcagcgcctt actgaagatc tggaatacca tgagctgtta gaccgagctg
1501 caaaatgtga gaattctcta gaacagctct gttatgttgc agctttcacc gtgtcctcct
1561 actccactac tgtcttccgc accagtaagc cattcaaccc actgcttggg gagacctttg
1621 agctggaccg attagaggag aatgggtacc gatccctctg tgaacaggtg agtcatcatc
1681 cccctgctgc tgcgcaccat gctgagtcca aaaatggctg gacattgcgt caggaaatca
1741 aaatcaccag caagtttcga ggcaaatacc tctccattat gcccctcggt accattcatt
1801 gtattttcca tgcaactggg caccactaca cttggaagaa agttaccaca actgtacaca
1861 acattattgt gggcaagttg tggatagatc agtctggcga aattgatatt gtgaatcaca
1921 agacaggaga caagtgtaat cttaaatttg ttccttatag ctacttctct cgggatgtag
1981 caagaaaggt gacgggggaa gtgacagatc catcaggaaa agtccacttt gctcttctgg
2041 ggacgtggga tgagaaaatg gaatgtttca aagtacagcc agtcattggg gaaaatgggg
2101 gtgatgctcg acagagaggc catgaagcag aggaaagcag ggtcatgctg tggaaaagga
2161 atcctttacc gaagaatgca gaaaacatgt actacttctc agagcttgct ctgactctca
2221 atgcttggga aagtggcact gcccccacag acagccggtt acgacctgac cagagactga
2281 tggaaaatgg acgctgggat gaagcaaatg cggagaagca gcgcctggag gaaaaacaaa
2341 gactttccag aaagaagaga gaagcggaag ctatgaaagc cacagaggat ggcacaccat
2401 atgatcccta taaggcactg tggtttgagc ccctgttacc aaggagttaa
2461 cccatattta taggggagaa tactgggagt gtaaagaaaa acaggactgg agctcatgcc
2521 cggacatttt ctgaaacggc agtaacaaaa aagaggagca tataatggag aagaggacag
2581 aggatgtgtg ggaaagctgg aagttgtgac tctcttacca agtgctttcc tcaagtttgt
2641 ctctcttgac caatcatttt ttccaaatca atcaccagaa ggagacacca gtggtggtga
2701 ttggctggtt gccttagctg attgaaactg aaatcgacat aggagatact atgtctgtaa
2761 gggagaggtt tagtggccga aggttagtgt tattccacat ccacgaagtc aagtattctt
2821 ggctcttctt tctccctctg cccccattta agacaatgtc actcaccctc cccttgtagt
2881 atcctgctca gccaagatct gcctaagatt atgattcagg ggcattttgg tgctgttaaa
2941 agcaagagcc gaatttagaa gttcccttaa aaagaaacac ataagactta ccaatggagg
3001 cattgtgaat ggttgcagtg gagcttaggt ataacatcat caagtgtgtt cacacgcggg
3061 gtcggtttaa tggagtgtcc acgcggagat aactgcgata ttggaacacc tgtgagagag
3121 attgttctat agggctggaa tattcagagt tacattcttg gaagtttctg tttttacttg
3181 catcaaacac ccctctgttg ttctccatca tctttaatag caactggaga ccactttggt
3241 cattggtaag ggggtgcatt ctcctcacaa aggggtttta tggacttcct caggcggaga
3301 gcttctgaga acacaggcag gatggaaaaa gactactagc cacttttgct ttcccaaccc
3361 cccttaatgc catccttcat tgtctttctg gcttctcttc ttctggcaca gtaccatttt
3421 gggtctgtgc cccagtgtgg agcaaaacat tgcctgtccc attctgatat acttcagaat
3481 ttgagagcag aagttaatgt ggaacaaaag ttttcaccat ctctcaagcc ccaaggactg
3541 gagccacctc tggaataatg tgttaaatat ctgtatatta tatatatgta gagaaaaatc
3601 taattttttg gtttgatttc cttcccatta agaatcttgt tttttgatac ccttgtctcc
3661 ctgagactct ttcttggaca cgtgttgatg tggatggcac tcctgctctc catcttttat
3721 gggcagagag atttcaaaac ctgagcagga tcatgtctgg cagttactaa acagggactt
3781 tgtccatggt ttgtatcatg gggtgcctac tgctgtctaa actctgctct cctaattagc
3841 tgactcttga aaatgaaatc ctaacctctt tcctgcctct tttctttctc ttttcaggaa
3901 gagtgtgggt agaaagtccg gagggcaact tccaatttaa ttctgctctg tccggcgcat
3961 aggctgaatt ccaaaagaac tttcttccta ggatgtgggg cttaaagcac cgtcatgtgg
4021 ggtggatcag ataattgctc ctgtggggcc ctggcttcct tctctgtttg tgcagtattt
4081 gtttttgttg tcttgttgag aaatatcccc tgtgcaaccc acccttggtt gaggatcaca
4141 aattgaggtg ccttccttgt atgctttttg ttagtatttt ttgtttttgt tccttaactg
4201 ctgagcctca gccagcgtgg gtcctggggg aaataccatt ccaaaggaag ccatccctat
4261 ggggaaattg gttttactgg gtaaattaat acttttattt cttcccctat cccttccttc
4321 ctagttgtga taaacatggg agaggagtga ctttgactgc tggggaattt cctcctaaga
4381 accttattcc caaaataagc cagggattat gtcaaggctt ctttcaagga ggctcataaa
4441 agcagtgacc tcatccgggg ctttggatag agtgagaatt ccccaactaa attggacttc
4501 tctgctttat ccccttctct tccttcacca tctgcactac atttctggct gatcccaatc
4561 agattcccgc taatggaaga agtttagaat ctttcaggtg gaataaagtc acatgaaaac
4621 aaaacacaac tatatatatt ttcagttttt ttgccttatt gatttttttc caaaaaaaaa 4681 aaactactaa attaaataat tttttaaaag tea (SEQ ID NO:03)
Human OSBP has a sequence encoded by the above coding sequence of:
MAATELRGVVGPGPAAIAALGGGGAGPPWGGGGGRGDAGPGSG AASGTWAAAAGGPGPGAGGVAAAGPAPAPPTGGSGGSGAGGSGSAREGWLFKWTNYI KGYQRRWFVLSNGLLSYYRSKAEMRHTCRGTINLATANITVEDSCNFIISNGGAQTYH LKASSEVERQRWVTALELAKAKAVKMLAESDESGDEESVSQTDKTELQNTLRTLSSKV EDLSTCNDLIAKHGTALQRSLSELESLKLPAESNEKIKQVNERATLFRITSNAMINAC RDFLMLAQTHSKKWQKSLQYERDQRIRLEETLEQLAKQHNHLERAFRGATVLPANTPG NVGSGKDQCCSGKGDMSDEDDENEFFDAPEIITMPENLGHKRTGSNISGASSDISLDE QYKHQLEETKKEKRTRIPYKPNYSLNLWSIMKNCIGKELSKIPMPVNFNEPLSMLQRL TEDLEYHELLDRAAKCENSLEQLCYVAAFTVSSYSTTVFRTSKPFNPLLGETFELDRL EENGYRSLCEQVSHHPPAAAHHAESKNGWTLRQEIKITSKFRGKYLSIMPLGTIHCIF HATGHHYTWKKVTTTVHNIIVGKLWIDQSGEIDIVNHKTGDKCNLKFVPYSYFSRDVA RKVTGEVTDPSGKVHFALLGTWDEKMECFKVQPVIGENGGDARQRGHEAEESRVMLWK RNPLPKNAENMYYFSELALTLNAWESGTAPTDSRLRPDQRLMENGRWDEANAEKQRLE EKQRLSRKKREAEAMKATEDGTPYDPYKALWFERKKDPVTKELTHIYRGEYWECKEKQ DWSSCPDIF (SEQ ID NO:04)
As used herein, "functional equivalent" refers to a nucleic acid molecule that encodes a polypeptide that has target protein activity. The functional equivalent may display 50%, 60%, 70%, 80%, 90%, 95%, 98%, 99%, 100% or more activity compared to a parent target protein sequence. Functional equivalents may be artificial or naturally-occurring. For example, naturally-occurring variants of the target protein sequence in a population fall within the scope of functional equivalent. Target protein sequences derived from other species also fall within the scope of the term "functional equivalent. In one embodiment, the functional equivalent is a nucleic acid with a nucleotide sequence having at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.9% identity to the parent sequence. In a further embodiment, the functional equivalent is a polypeptide with an amino acid sequence having at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.9% identity to a parent sequence. In the case of functional equivalents, sequence identity should be calculated along the entire length of the nucleic acid. Functional equivalents may contain one or more, e.g. 2, 3, 4, 5, 10, 15, 20, 30 or more, nucleotide insertions, deletions and/or substitutions when compared to a parent sequence. The term "functional equivalent" also encompasses nucleic acid sequences that encode a target protein polypeptide with at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 99.9% sequence identity to the parent amino acid sequence, but that show little homology to the parent nucleic acid sequence because of the degeneracy of the genetic code.
As used herein, the term "active fragment" refers to a nucleic acid molecule that encodes a polypeptide that has target protein activity or polypeptide that has target protein activity, but which is a fragment of the nucleic acid as set forth in the parent polynucleotide sequence or the amino acid sequence as set forth in parent polypeptide sequence. An active
fragment may be of any size provided that target protein activity is retained. A fragment will have at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, 100% identity to the parent sequence along the length of the alignment between the shorter fragment and longer parent sequence.
Fusion proteins including these fragments can be comprised in the nucleic acid vectors needed to carry out the invention. For example, an additional 5, 10, 20, 30, 40, 50 or even 100 amino acid residues from the polypeptide sequence, or from a homologous sequence, may be included at either or both the C terminal and/or N terminus without prejudicing the ability of the polypeptide fragment to fold correctly and exhibit biological activity. Sequence identity may be calculated by any one of the various methods in the art, including for example BLAST (Altschul S F, Gish W, Miller W, Myers E W, Lipman D J (1990). "Basic local alignment search tool". J Mol Biol 215 (3): 403-410) and PASTA (Lipman, D J; Pearson, W R (1985). "Rapid and sensitive protein similarity searches". Science 227 (4693): 1435-41 ; http://fasta.bioch.virginia.edu/fasta www2/fasta Iist2.shtml) and variations on these alignment programs.
The vector may further include one or more regulatory sequences. Any convenient regulatory sequences or promoter sequences may be utilized in the subject vectors, e.g., as described herein. In some embodiments, the regulatory sequence that is operatively linked to the coding sequence is the cytomegalovirus promoter (CMV), although any other convenient regulatory sequences may be utilized.
Any convenient viruses may be utilized in delivering the vector of interest to the subject. Viruses of interest include, but are not limited to a retrovirus, an adenovirus, an adeno-associated virus (AAV), a herpes simplex virus and a lentivirus. Viral gene therapy vectors are well known in the art, see e.g., Heilbronn & Weger (2010) Handb Exp Pharmacal. 197:143-70. Vectors of interest include integrative and non-integrative vectors such as those based on retroviruses, adenoviruses (AdV), adeno-associated viruses (AAV), lentiviruses, pox viruses, alphaviruses, and herpes viruses.
In some cases, non-integrative viral vectors, such as AAV, may be utilized. In one aspect, non-integrative vectors do not cause any permanent genetic modification. The vectors may be targeted to adult tissues to avoid having the subjects under the effect of constitutive telomerase expression from early stages of development. In some instances, non-integrative vectors effectively incorporate a safety mechanism to avoid over-proliferation of target protein expressing cells. The cells may lose the vector (and, as a consequence, the target protein expression) if they start proliferating quickly.
Non-integrative vectors of interest include those based on adenoviruses (AdV) such as gutless adenoviruses, adeno-associated viruses (AAV), integrase deficient lentiviruses, pox viruses, alphaviruses, and herpes viruses. In certain embodiments, the non-integrative
vector used in the invention is an adeno-associated virus-based non-integrative vector, similar to natural adeno-associated virus particles. Examples of adeno-associated virus- based non integrative vectors include vectors based on any AAV serotype, i.e. AAVI, AAV2, AAV3, AAV4, AAV5, AAV6, AAV7, AAV8, AAV9, AAVIO, AAVI I and pseudotyped AAV. Vectors of interest include those capable of transducing a broad range of tissues at high efficiency, with poor immunogenicity and an excellent safety profile. In some cases, the vectors transduce post-mitotic cells and can sustain long-term gene expression (up to several years) both in small and large animal models of age-related disorders.
Examples of agents that increase or activate expression of an endogenous gene (e.g., as described herein) may also be employed, where such agents include, but are not limited to, CRISPR activation (CRISPRa) agents. When the agent is a CRISPR/Cas editing agent, the agent can include both the protein and guide RNA component. The guide nucleic acid (e.g., guide RNA) can be introduced into the cell as an RNA or as a DNA encoding the RNA (e.g., encoded by a DNA vector - on a plasmid, virus, and the like). The CRISPR/Cas protein can be introduced into the cell as a protein or as a nucleic acid (mRNA or DNA) encoding the protein. Programmable gene editing agents and their guide nucleic acids include, but are not limited to, CRISPR/Cas RNa-guided proteins such as Cas9, CasX,
CasY, and Cpf1 , Zinc finger proteins such as Zinc finger nucleases, TALE proteins such as TALENs, CRISPR/Cas guide RNAs, and the like.
STING Agonists
In embodiments of the invention where STING pathway activation is enhanced, the method may further include contacting a cell with a STING agonist, e.g., a CDN or other STING agonist of interest. Where the STING agonist is a CDN, the CDN of interest can be a CDN that is contacted with a cell in vitro or administered to a subject in vivo. As such, aspects of the subject methods include contacting a target cell with the CDN of interest. A variety of CDNs find use in the subject methods in conjunction with the PI4KB Golgi recruitment modulating agents (e.g., as described herein).
In some cases, the CDN is naturally occurring. Naturally occurring CDNs of interest include those involved in intercellular signaling, such as 2’3’-cGAMP. In certain instances, the CDN is one that is implicated in a disease or condition associated with aberrant signaling, such as an autoimmune/inflammatory disease (e.g., as described herein). In some cases, the CDN is involved in intercellular signaling between tumor cells and non-tumor cells where amplification of the signal can provide for anti-tumor immunity. In some cases, the CDN is involved in intercellular signaling between virus-infected and uninfected cells where amplification of the signal can provide for anti-viral immunity. In some cases, the CDN of interest is a CDN that is produced endogenously in a cell sample in vitro or in vivo by a cell
of a subject. In some instances, the endogenously produced CDN is 2’3’-cGAMP. As such, aspects of the subject methods include increasing intercellular 2’3’-cGAMP signaling between cells in vivo, such as between virus-infected and uninfected cells for amplification of anti-viral immunity. In some cases, the endogenous production of a CDN of interest can be triggered or enhanced in a CDN producing cell by administration of an CDN production promoting agent, see e.g., Vance et al. in U.S. Publication No. 2014/0329889.
In certain instances, the CDN is non-naturally occurring. In some cases, the CDN is a CDN drug that finds use in cancer therapeutic applications. A variety of CDNs that are agonists of Stimulator of Interferon Genes (STING) find use in cancer immunotherapy, including synthetic CDNs that are analogues of a naturally occurring CDN such as 2’3’- cGAMP. An amplified anti-tumor immune response can occur when a CDN STING agonist is delivered to a tumor microenvironment, leading to immune activation and tumor regression.
As used herein, “cyclic dinucleotide” or “CDN” refers to a compound containing two nucleosides (i.e., a first and second nucleoside), wherein the 2’ or 3’ carbon of each nucleoside is linked to the 5’ carbon of the other nucleoside via a phosphodiester internucleoside linkage. Therefore, a 2’-5’ phosphodiester linkage containing CDN refers to a CDN where the 2’ carbon of at least one of the nucleosides is linked to the 5’ carbon of the other nucleoside. As discussed herein, 2’-5’ phosphodiester linkage containing CDNs can be used in practicing the subject methods to increase production of a type I interferon in a cell or subject. In certain embodiments, the CDN has two 2’-5’ phosphodiester linkages. In some embodiments, the CDN has a 2’-5’ phosphodiester linkage and a 3’-5’ phosphodiester linkage. In certain embodiments, the CDN has two 3’-5’ phosphodiester linkages.
Cyclic-di-nucleotides include those specifically described herein as well as isoforms (e.g., tautomers) of those specifically described herein that can be used in practicing the subject methods. A “cyclic-di-nucleotide” also includes all of the stereoisomeric forms of the cyclic-di-nucleotides described herein.
The term “nucleoside” refers to a composition containing a nitrogenous base covalently attached to a sugar (e.g., ribose or deoxyribose) or an analog thereof. Examples of nucleosides include, but are not limited to, cytidine, uridine, adenosine, guanosine, thymidine and inosine. The term “nitrogenous base” refers to a nitrogen-containing heterocycle having the chemical properties of a nucleobase. Nitrogenous bases of interest include, but are not limited to, pyrimidines (e.g., cytosine, thymine, and uracil) and purines (e.g., adenine and guanine), as well as substituted pyrimidine derivatives and substituted purine derivatives, pyrimidine analogs and purine analogs, and tautomers thereof.
In some embodiments, the nucleoside contains a deoxyribose sugar. Analogs of nucleosides include, but are not limited to dexoyadenosine analogues (e.g., Didanosine and Vidarabine); deoxycytidine analogues (e.g., Cytarabine, Ematricitabine, Lamivudine, and
Zalcitabine); deoxyguanosine analogues (Abacavir and Entecavir); (deoxy-) thymidine analogues (e.g., Stavudine, Telbivudine, and Zidovudine); and deoxyuridine alaogues (e.g., Idoxuridine and Trifluridine).
The CDN can include a guanosine nucleoside. In some cases, the CDN contains two guanosine nucleosides. The CDN can include an adenosine nucleoside. In some embodiments, the CDN contains two adenosine nucleosides. In certain cases, the CDN contains an adenosine nucleoside and a guanosine nucleoside.
While not being bound by any particular theory of operation, CDNs can increase type-1 IFN production in a cell. In certain embodiments, the CDN increases type-1 IFN production through a mechanism that involves stimulator of interferon genes (STING). CDNs can be obtained using any suitable method. For example, CDNs may be made by chemical synthesis using nucleoside derivatives as starting material. CDNs can also be produced via in vitro synthesis, using recombinant purified cGAMP synthase (cGAS) or other recombinant purified CDN synthases such as the bacterial cGAMP synthase from V. cholerae (DncV) or mutant versions of any recombinant purified CDN synthases. Moreover, the structures of such cyclic-di-nucleotides can be confirmed using any convenient methods, such as NMR analysis.
Any convenient CDNs may be utilized in the subject methods, compositions and kits. CDN’s of interest include, but are not limited to, those described by Vance et al. in U.S. Publication No. 2014/0329889; Dubensky et al. in U.S. Publication No. 2015/0056224; Dubensky et al. in U.S. Publication No. 2014/0205653; Dubensky et al. in U.S. Patent No. 9549944; Altman et al. in WO2017027645; and Altman et al. in WO2017027646, US20060040887, US20080286296, US20120041057, US20160362441 , US20180002369, US20180064745, US2018186828, US2018237468, US2018273578, US20190055277, US2019183917, US2019185509, US2019185510, US2019248828, US9718848, W02005030186, WO2014179335, WO2015074145, WO2017011444, WO2017075477, WO2017123657, WO2017123669, WO2017161349 WO2018009466, US20180092937, WO2018065360, WO2018045204, WO2018098203, WO2018009648, WO2018009652, WO2018100558, WO2018138684, WO2018138685, WO2018156625, WO2018198076, WO2018198084, WO2018208667, WO2019023459, WO2019043634, WO2019046496, WO2019046498, WO2019046500, WO2019046511 , WO2019051488, WO2019051489, WO2019074887, WO2019079261 , WO2019092660, WO2019118839, WO2019125974, WO2019175776, WO2019180683, WO2019185477, WO2019185476, WO2019193533, WO2019193542, WO2019193543, and WO2019211799, the disclosures of which are herein incorporated by reference in their entirety.
In some cases, the CDN that finds use in the subject methods is one that is described by Vance et al. in U.S. Publication No. 2014/0329889. In certain embodiments, the cyclic-di-nucleotide has one of the following formulae (I) and (II):
(I) (II) wherein X and Y are each independently a nitrogenous base or an analog thereof, or a salt thereof. In certain embodiments of formulae (l)-(ll), X and Y are each independently selected from the following:
CDNs described herein can also be described by the following nomenclature: cyclic[Xi(a-5’)pX2(b-5')p], wherein Xi and X2 are first and second nucleosides, “a” is the designation of the carbon of the first nucleoside (e.g., 2’ or 3’ position) that is linked to the 5’ carbon of the second nucleoside via a phosphodiester bond and “b” is the designation of the carbon of the second nucleoside (e.g., 2’ or 3’ position) that is linked to the 5’ carbon of the first nucleoside by a phosphodiester bond. In some cases, at least one of “a” and “b” is 2’ in the formula. For instance, based on this nomenclature, cyclic[G(2’-5’)pA(3’-5')p] has the following formula:
In certain embodiments, the CDN contains a 2’-5’ phosphodiester bond. In particular embodiments, the CDN further contains a 3’-5’ phosphodiester bond (e.g., cyclic[Xi(2’- 5’)pX2(3’-5')p] or cyclic[Xi(3’-5’)pX2(2’-5')p]). In some instances, the CDN contains two 2’-5’ phosphodiester bonds (cyclic[Xi(2’-5’)pX2(2’-5')p]). In some instances, the CDN contains two 3’-5’ phosphodiester bonds (cyclic[Xi(3’-5’)pX2(3’-5')p]).
In certain embodiments, the cyclic-di-nucleotide is: cyclic[A(2’-5’)pA2’-5')p]; cyclic[T(2’-5’)pT(2’-5')p]; cyclic[G(2’-5’)pG(2’-5')p]; cyclic[C(2’-5’)pC(2’-5')p]; or cyclic[U(2’- 5’)pU(2’-5')p]. In certain embodiments, the cyclic-di-nucleotide is: cyclic[A(2’-5’)pA(3’-5')p]; cyclic[T(2’-5’)pT(3’-5')p]; cyclic[G(2’-5’)pG(3’-5')p]; cyclic[C(2’-5’)pC(3’-5')p]; cyclic[U(2’- 5’)pU(3’-5')p]; cyclic[A(2’-5’)pT(3’-5')p]; cyclic[T(2’-5’)pA(3’-5')p]; cyclic[A(2’-5’)pG(3’-5')p]; cyclic[G(2’-5’)pA(3’-5')p]; cyclic[A(2’-5’)pC (3’-5')p]; cyclic[C(2’-5’)pA(3’-5')p]; cyclic[A(2’- 5’)pU(3’-5')p]; cyclic[U(2’-5’)pA(3’-5')p]; cyclic[T(2’-5’)pG(3’-5')p]; cyclic[G(2’-5’)pT(3’-5')p]; cyclic[T2’-5’)pC(3’-5')p]; cyclic[C(2’-5’)pT(3’-5')p]; cyclic[T(2’-5’)pU(3’-5')p]; cyclic[U(2’-
5’)pT(3’-5')p]; cyclic[G(2’-5’)pC(3’-5')p]; cyclic[C2’-5’)pG(3’-5')p]; cyclic[G(2’-5’)pU(3’-5')p]; cyclic[U(2’-5’)pG(3’-5')p]; cyclic[C(2’-5’)pU(3’-5')p]; or cyclic[U(2’-5’)pC(3’-5')p].
In certain embodiments, the cyclic-di-nucleotide has the following formula (cyclic[
or a salt thereof.
In certain embodiments, the cyclic-di-nucleotide has the following formula (cyclic[
or a salt thereof. In other embodiments, the cyclic-di-nucleotide has the following formula cyclic[
or a salt thereof.
In yet other embodiments, the cyclic-di-nucleotide has the following formula cyclic[G(2’5’)pG(3’5’)p] :
In certain embodiments, the cyclic-di-nucleotide has the following formula cyclic[
or a salt thereof.
In certain embodiments, the cyclic-di-nucleotide has the following formula cyclic[
or a salt thereof.
wherein R is any amino acid side chain, and X and Y are as defined above for formula (I)- (II), or a salt thereof.
CDN’s of interest include, but are not limited to, those described by Dubensky etal. in U.S. Publication No. 2015/0056224. In certain embodiments, the CDN has the structure:
R3 is a covalent bond to the 5' carbon of (b),
R4 is a covalent bond to the 2' or 3' carbon of (b),
R1 is a purine linked through its N9 nitrogen to the ribose ring of (a),
R5 is a purine linked through its N9 nitrogen to the ribose ring of (b), each of Xi and X2are independently O or S,
R2 is H or an optionally substituted straight chain alkyl of from 1 to 18 carbons and from 0 to 3 heteroatoms, an optionally substituted alkenyl of from 1-9 carbons, an optionally substituted alkynyl of from 1-9 carbons, or an optionally substituted aryl, wherein substitution(s), when present, may be independently selected from the group consisting of Ci-6 alkyl straight or branched chain, benzyl, halogen, trihalomethyl, Ci-6alkoxy, — N02, — NH2, — OH, =0, — COOR' where R' is H or lower alkyl, — CH2OH, and — CONH2, and the 2 ' or 3' carbon of (b) which is not in a covalent bond with (a) is — O — R6, wherein R6 is H or an optionally substituted straight chain alkyl of from 1 to 18 carbons and from 0 to 3 heteroatoms, an optionally substituted alkenyl of from 1-9 carbons, an optionally substituted alkynyl of from 1-9 carbons, or an optionally substituted aryl, wherein substitution(s), when present, may be independently selected from the group consisting of Ci-6 alkyl straight or branched chain, benzyl, halogen, trihalomethyl, Ci-6 alkoxy, — N02, — NH2, — OH, =0, — COOR' where R' is H or lower alkyl, — CH2OH, and — CONH2, or a prodrug or pharmaceutically acceptable salt thereof.
In certain cases, the CDN has one of the following formula: c-[G(2',5')pG(3',5')p], c- [A(2',5')pA(3',5')p], c-[G(2',5')pA(3',5')p] or c-[G(2',5')pA(3',5')p] where each p refers to a phosphate, thiophosphate or dithiophosphate internucleotide linkage. In certain instances, the CDN is a compound of the formula:
where Ri and R2 are each H, or a pharmaceutically acceptable salt thereof.
In certain cases, the CDN is a bisphosphorothioate analog of a naturally occurring CDN such as c-di-AMP. In some cases, the CDN is ADU-S100 or 2’3’-c-di-AM(PS)2(Rp,Rp), also known as dithio-(Rp, Rp)-[cyclic[A(2’,5’)pA(3’,5’)p]] or (ML RR-S2 CDA), as described by Corrales et al. (“Direct Activation of STING in the Tumor Microenvironment Leads to Potent and Systemic Tumor Regression and Immunity” Cell Reports 11 , 1018-1030, May 19, 2015).
Embodiments of the invention include administration of other, non-CDN STING agonists. Any convenient non-CDN STING Agonist may be employed, wherein examples of such STING agonists include, but are not limited to E7766, PMID: 30405246, etc., as well as those described in Published United States Patent Application Publication Nos. US20190359608, US20190337918, US20190300513, US20190359608, W02007070598, WO2017004499, WO2017011622, WO2017011920, WO2017175147, WO2017175156, WO2018234805, WO2018234807, WO2018234808, WO2018013887, WO2018013908, WO2019027858, WO2019195063, WO2019069269, WO2019069270, WO2019069275, WO2019165032, WO2019219820, WO2019243823, WO2019243825, the disclosures of which are herein incorporated by reference.
Methods
As summarized above, aspects of the methods include modulating, e.g., increasing or decreasing, PI4KB Golgi recruitment in a cell to modulate, e.g., enhance or reduce,
STING pathway activation. By increasing or decreasing PI4KB Golgi recruitment, STING pathway activation can be modulated in the cell can be modulated to provide for a desired biological effect. PI4KB Golgi recruitment can be modulated by contacting the cell, in vitro or in vivo, with a PI4KB Golgi recruitment-modulating agent (e.g., as described herein).
In some cases, the PI4KB Golgi recruitment -modulating agent enhances or increases PI4KB Golgi recruitment. Examples of such agents include small molecule inhibitors of OSPB, e.g., as described above. In some cases, the PI4KB Golgi recruitment- modulating agent decreases PI4KB Golgi recruitment. Examples of such agents include PI4KB small molecule inhibitors, e.g., as described above.
In certain instances, the PI4KB Golgi recruitment-modulating agent is a small molecule and the effective amount which is contacted with the cell or cellular sample, or administered to a subject, will generally contain between from about 1 mg to about 1000 mg of the agent, in some cases, 25 mg or more, such as 50 mg or more, 100 mg or more, 200 mg or more, 300 mg or more, 400 mg or more, 500 mg or more, 600 mg or more, 800 mg or more, or 1000 mg or more.
Any convenient activities of STING pathway activation can be targeted for modulation according to the subject methods in a variety of applications. The pathway leads, for
example, to activation of IRF3 transcription factor, which induces IFN and certain other cytokines and mediators. Accordingly, this pathway and elements thereof may be modulated in embodiments of the invention. The pathway leads, for example, to activation of NF-kB, which induces other cytokines and mediators. Accordingly, this pathway and elements thereof may be modulated in embodiments of the invention. This pathway leads, for example to activation of STAT6 which induces yet other cytokines and mediators. Accordingly, this pathway and elements thereof may be modulated in embodiments of the invention. Embodiments of the invention may be employed to modulate the response to preferentially activate one or another of these “axes”, which may be employed to change the type of immune response induced, as desired.
In some cases, STING pathway activation provides an anti-tumor immune response via production of type I interferon (IFN) in a cell. As such, aspects of this disclosure include methods of increasing the production of a type I interferon (IFN) in a cell, e.g., in vitro or in vivo. By increasing type-1 interferon production is meant that the subject methods increase type-1 interferon production in a cell, as compared to a suitable control. The magnitude of the increase in type-1 interferon production in a cell relative to what can be achieved with the CDN alone may vary, and in some instances is 10% or more, such as 20% or more, 30% or more, 40% or more, 50% or more, 60% or more, 70% or more, 80% or more, 90% or more, 100% or more, 2-fold or greater, 3-fold or greater, 4-fold or greater, 5-fold or greater, or 10- fold or greater, as compared to a suitable control. In those embodiments where, prior to practice of the subject methods, interferon production is not-detectable, the increase may result in detectable amounts of interferon production.
In some instances, the subject methods provide for increasing the production of a type I interferon (IFN)-stimulated gene in a cell, e.g., in vitro or in vivo. By increasing interferon-stimulated gene production is meant that the subject methods increase production of an interferon-stimulated gene or gene product in a cell, as compared to a suitable control. IFN-stimulated genes of interest include, but are not limited to, CXCL10, IRF7, IFIT3, ISG15 and RANTES. The magnitude of the increase in production in a cell relative to what can be achieved with the CDN alone may vary, and in some instances is 10% or more, such as 20% or more, 30% or more, 40% or more, 50% or more, 60% or more, 70% or more, 80% or more, 90% or more, 100% or more, 2-fold or greater, 3-fold or greater, 4-fold or greater, 5- fold or greater, or 10-fold or greater, as compared to a suitable control.
Type-I interferon production can be measured using any convenient method including, but not limited to, vesicular stomatitis virus (VSV) challenge bioassay, enzyme- linked immunosorbent assay (ELISA) replicon based bioassays or by using a reporter gene (e.g., luciferase) cloned under regulation of a type I interferon signaling pathway. See, e.g.,
Meager J. Immunol. Methods 261 :21-36 (2002); Vrolijk et al. C.J. Virol. Methods 110:201- 209 (2003); and Francois et al. Antimicrob Agents Chemother 49(9) :3770-3775 (2005).
The methods may be used to increase the production of any convenient type I interferon including, but not limited to: IFN-a (alpha), IFN-b (beta), IFN-k (kappa), IFN-d (delta), IFN-e (epsilon), IFN-t (tau), IFN-w (omega), and IFN-z (zeta, also known as limitin).
In some embodiments, the method is for increasing the production of IFN-a. In some embodiments, the method is for increasing the production of IFN-b.
The methods may also be employed to modulate product of other cytokines downstream of the pathway. For example, STING pathway activation increases the expression of costimulatory molecules and other cell surface molecules which induce cell to cell signals that enhance or modulate immune responses.
In practicing certain embodiments of the methods provided herein, an effective amount of the active agent (such as described above), is provided in the target cell or cells. As used herein "effective amount" or "efficacious amount" means the amount that, when contacted with the cell, e.g., by being introduced into the cell in vitro, by being administered to a subject, etc., is sufficient to result in the desired outcome, e.g., increased levels of type I interferon in the cell. The "effective amount" will vary depending on cell and/or the organism and/or active agent and or the nature of the desired outcome and/or the disease and its severity and the age, weight, etc., of the subject to be treated.
In some instances, an effective amount of PI4KB Golgi recruitment-modulating agent is provided to the cells to result in a change in STING pathway activation in the cells. In some cases, an effective amount of PI4KB Golgi recruitment-modulating agent is the amount to result in a 10% increase or more in the amount of STING pathway activation product observed (directly or indirectly) in the cell, such as 20% or more, 30% or more, 40% or more, 50% or more, 60% or more, 70% or more, 80% or more, 90% or more, 100% or more, 2-fold or greater, 3-fold or greater, 4-fold or greater, 5-fold or greater, or 10-fold or greater, relative to a negative control, e.g., a cell not contacted with the PI4KB Golgi recruitment-modulating agent. The amount of the STING pathway activation product observed may be measured by any suitable method, directly or indirectly. For example, the amount of type I interferon produced by the cell may be assessed after contact with the active agent(s), e.g., 2 hours, 4 hours, 8 hours, 12 hours, 24 hours, 36 hours, 48 hours, 72 hours or more after contact with the active agent(s).
Contact of the cell with the agent(s) may occur using any convenient protocol. The protocol may provide for in vitro or in vivo contact of the agent(s) with the target cell, depending on the location of the target cell. For example, where the target cell is an isolated cell, e.g., a cell in vitro (i.e., in culture), or a cell ex vivo (“ex vivo" being cells or organs are modified outside of the body, where such cells or organs are typically returned to a living
body), the agent may be introduced directly to the cell under cell culture conditions permissive of viability of the target cell. The choice of method is generally dependent on the type of cell being contacted and the nature of the active agent, and the circumstances under which the transformation is taking place (e.g., in vitro, ex vivo, or in vivo). A general discussion of these methods can be found in Ausubel, et al, Short Protocols in Molecular Biology, 3rd ed., Wiley & Sons, 1995. As another example, where the target cell or cells are part of a multicellular organism, the active agent may be administered to the organism or subject in a manner such that the agent is able to contact the target cell(s), e.g., via an in vivo protocol. By "in vivo,” it is meant the agent is administered to a living body of an animal.
The active agent(s) can be employed to increase the production of type I interferon in vivo. In these in vivo embodiments, the active agent(s) can be administered directly to the individual. The agent(s) may be administered by any suitable methods for the administration of peptides, small molecules or nucleic acids to a subject. The STING agonists and/or PI4KB Golgi recruitment-modulating agents can be incorporated into a variety of formulations. More particularly, the agent(s) of the present disclosure can be formulated into pharmaceutical compositions by combination with appropriate pharmaceutically acceptable carriers or diluents. Pharmaceutical compositions that can be used in practicing the subject methods are described herein.
In some instances, an effective amount of the STING agonist is administered to the subject in conjunction with the PI4KB Golgi recruitment-modulating agent. By an “effective amount” or a “therapeutically effective amount” of the agent it is meant an amount that is required to reduce the severity, the duration and/or the symptoms of the disease. In some embodiments, the effective amount of a pharmaceutical composition containing a STING agonist active agent for use in conjunction with the PI4KB Golgi recruitment-modulating agent, as provided herein, is between 0.025 mg/kg and 1000 mg/kg body weight of a human subject. In certain embodiments, the pharmaceutical composition is administered to a human subject at an amount of 1000 mg/kg body weight or less, 950 mg/kg body weight or less, 900 mg/kg body weight or less, 850 mg/kg body weight or less, 800 mg/kg body weight or less, 750 mg/kg body weight or less, 700 mg/kg body weight or less, 650 mg/kg body weight or less, 600 mg/kg body weight or less, 550 mg/kg body weight or less, 500 mg/kg body weight or less, 450 mg/kg body weight or less, 400 mg/kg body weight or less, 350 mg/kg body weight or less, 300 mg/kg body weight or less, 250 mg/kg body weight or less, 200 mg/kg body weight or less, 150 mg/kg body weight or less, 100 mg/kg body weight or less, 95 mg/kg body weight or less, 90 mg/kg body weight or less, 85 mg/kg body weight or less, 80 mg/kg body weight or less, 75 mg/kg body weight or less, 70 mg/kg body weight or less, or 65 mg/kg body weight or less.
In some embodiments, the STING agonist is employed in mitotic or post-mitotic cells in vitro or ex vivo, i.e., to produce modified cells that can be reintroduced into an individual. Mitotic and post-mitotic cells of interest in these embodiments include any eukaryotic cell, e.g., pluripotent stem cells, for example, ES cells, iPS cells, and embryonic germ cells; somatic cells, for example, hematopoietic cells, fibroblasts, neurons, muscle cells, bone cells, vascular endothelial cells, gut cells, and the like, and their lineage-restricted progenitors and precursors; and neoplastic, or cancer, cells, i.e., cells demonstrating one or more properties associated with cancer cells, e.g., hyperproliferation, contact inhibition, the ability to invade other tissue, etc. In certain embodiments, the eukaryotic cells are cancer cells. In certain embodiments, the eukaryotic cells are hematopoietic cells, e.g., macrophages, NK cells, etc. Cells may be from any mammalian species, e.g., murine, rodent, canine, feline, equine, bovine, ovine, primate, human, etc. Cells may be from established cell lines or they may be primary cells, where “primary cells”, “primary cell lines”, and “primary cultures” are used interchangeably herein to refer to cells and cells cultures that have been derived from a subject and allowed to grow in vitro for a limited number of passages, i.e., splittings, of the culture. For example, primary cultures are cultures that may have been passaged 0 times, 1 time, 2 times, 4 times, 5 times, 10 times, or 15 times, but not enough times go through the crisis stage. In some cases, the primary cell lines are maintained for fewer than 10 passages in vitro.
If the cells are primary cells, they may be harvested from an individual by any convenient method. For example, blood cells, e.g., leukocytes, e.g., macrophages, may be harvested by apheresis, leukocytapheresis, density gradient separation, etc., while cells from tissues such as skin, muscle, bone marrow, spleen, liver, pancreas, lung, intestine, stomach, etc. may be harvested by biopsy. An appropriate solution may be used for dispersion or suspension of the harvested cells. Such solution will generally be a balanced salt solution, e.g., normal saline, PBS, Hank’s balanced salt solution, etc., conveniently supplemented with fetal calf serum or other naturally occurring factors, in conjunction with an acceptable buffer at low concentration, generally from 5-25 mM. Convenient buffers include HEPES, phosphate buffers, lactate buffers, etc. The cells may be used immediately, or they may be stored, frozen, for long periods of time, being thawed and capable of being reused. In such cases, the cells may be frozen in 10% DMSO, 50% serum, 40% buffered medium, or some other such solution as is commonly used in the art to preserve cells at such freezing temperatures, and thawed in a manner as commonly known in the art for thawing frozen cultured cells. The CDN active agent(s) may be produced by eukaryotic cells or by prokaryotic cells, it may be further processed by unfolding, e.g., heat denaturation, DTT reduction, etc. and may be further refolded, using methods known in the art.
Combination Therapy
For use in the subject methods, the STING agonist described herein may be administered in combination with the PI4KB Golgi recruitment-modulating agent (e.g., as described herein). “In combination with” refers to uses where, for example, the first compound (e.g., the STING agonist, such as a CDN active agent) is administered during the entire course of administration of the second compound (e.g., PI4KB Golgi recruitment- modulating agent); where the first compound is administered for a period of time that is overlapping with the administration of the second compound, e.g., where administration of the first compound begins before the administration of the second compound and the administration of the first compound ends before the administration of the second compound ends; where the administration of the second compound begins before the administration of the first compound and the administration of the second compound ends before the administration of the first compound ends; where the administration of the first compound begins before administration of the second compound begins and the administration of the second compound ends before the administration of the first compound ends; where the administration of the second compound begins before administration of the first compound begins and the administration of the first compound ends before the administration of the second compound ends. As such, “in combination” can also refer to regimen involving administration of two or more compounds. “In combination with” as used herein also refers to administration of two or more compounds that may be administered in the same or different formulations, by the same of different routes, and in the same or different dosage form type.
Any convenient additional active agents, e.g., agents that find use in a combination therapeutic application with a STING agonist of interest, can also be utilized in conjunction with the STING agonist and PI4KB Golgi recruitment-modulating agent in the subject methods. In some cases, the additional active agent is a chemotherapeutic agent or other cancer therapy, an antiviral agent, a cGAS activity modulating agent, agents that increase cytosolic DNA (e.g., agents targeting RNaseH2 or SAMHD1), ionizing radiation, etc. In some embodiments, the additional cancer therapy comprises radiation therapy, surgery, chemotherapy, or an immunotherapy (for example, without limitation, an immunomodulator, an immune checkpoint inhibitor, a cellular immunotherapy, or a cancer vaccine). In some embodiments, the one or more additional cancer therapies comprise an inactivated tumor cell that expresses and secretes one or more cytokines or one or more heat shock proteins. In some embodiments, the cytokine is selected from the group consisting of GM-CSF, CCL20, CCL3, IL-12p70, and FLT-3 ligand. In some embodiments the heat shock protein is a gp96- Ig protein. In some cases, the additional active agent is an immune checkpoint inhibitor (e.g., CTLA-4, PD-1 , TIM-3, Vista, BTLA, LAG-3, KIR, or TIGIT pathway antagonists, including, without limitation, PD-1 pathway blocking agents such as anti-PD-1 antibodies
PDR001 , nivolumab, pembrolizumab, SHR-1210, REGN2810 (cemiplimab), or pidilizumab, or PD-1 inhibitor AMP-224; PD-L1 inhibitors such as anti-PD-L1 antibodies BMS-936559, MPDL3280A(atezolizumab), MEDI4736 (durvalumab), or avelumab; anti-CTLA-4 antibodies such as ipilimumab, tremelimumab, IBI310, and AGEN1884; Vista inhibitors including anti- Vista antibodies; B7-H3 inhibitors including anti-B7-H3 antibodies; and CD70 inhibitors including anti-CD70 antibodies); Co-stimulatory checkpoint receptor agonist (e.g., CD40 agonists, including an anti-CD40 antibody; CD137 agonists, including an anti-CD137 antibody; GITR agonists, including an anti-GITR antibody; 0X40 agonists, including an anti- 0X40 antibody); an immune activating cytokine (e.g. IL-2, IL-12, IL-15); a TLR agonist (e.g., CpG or monophosphoryl lipid A); a RIG-1 agonist (e.g. 5’pp-dsRNA or 3p-hpRNA); a vaccine selected to stimulate an immune response to one or more cancer antigens, for example an inactivated or attenuated bacteria which induce innate immunity and is engineered to express cancer antigens (e.g., inactivated or attenuated Listeria monocytogenes); a therapeutic antibody that induces antibody-dependent cellular cytotoxicity; an immunomodulatory cell line; an antigen selected for the purpose of inducing an immune response, an agent which mediate innate immune activation (i) via Toll-like Receptors (TLRs) including, without limitation, TLR agonist (e.g., CpG or monophosphoryl lipid A), (ii) via (NOD)-like receptors (NLRs), (iii) via Retinoic acid inducible gene-based (RIG)-l-like receptors (RLRs), (iv) via C-type lectin receptors (CLRs), or (v) via pathogen-associated molecular patterns ("PAMPs"); a chemotherapeutic agent, etc.
In some embodiments, the immune checkpoint inhibitor is selected from the group consisting of a CTLA-4 pathway antagonist, a PD-1 pathway antagonist, a TIM-3 pathway antagonist, a Vista pathway antagonist, a BTLA pathway antagonist, a LAG-3 pathway antagonist, and a TIGIT pathway antagonist. In some embodiments, the immune checkpoint inhibitor is an anti-PD-1 antibody, an anti-PD-L1 antibody, an anti-CTLA-4 antibody, an anti- TIM-3 antibody, an anti-Vista antibody, an anti-BTLA antibody, an anti-B7-H3 antibody, an anti-CD70 antibody, an anti-KIR antibody or an anti-LAG-3 antibody. In some embodiments, the immune checkpoint inhibitor is selected from the group consisting of nivolumab, pembrolizumab, pidilizumab, cemiplimab, SHR-1210, PDR001 , MEDI0680, AMP-224, ipilimumab, tremelimumab, IBI310, AGEN1884, BMS-936559, atezolizumab, durvalumab, and avelumab.
Examples of chemotherapeutic agents for use in combination therapy include, but are not limited to, an indoleamine 2,3-dioxygenase (ID01) inhibitor (e.g., epacadostat and navoximod), daunorubicin, daunomycin, dactinomycin, doxorubicin, epirubicin, idarubicin, esorubicin, bleomycin, mafosfamide, ifosfamide, cytosine arabinoside, bis- chloroethylnitrosurea, lomustine (CCNU), carmustine, busulfan, mitomycin C, actinomycin D, mithramycin, prednisone, hydroxyprogesterone, testosterone, tamoxifen, dacarbazine,
procarbazine, hexamethylmelamine, pentamethylmelamine, mitoxantrone, amsacrine, methylcyclohexylnitrosurea, nitrogen mustards (e.g. mechlorethamine, melphalan, cyclophosphamide, chlorambucil, uramustine, ifosfamide, bendamustine), prednimustine, estramustine phosphate, 6-mercaptopurine, 6-thioguanine, cytarabine, 5-azacytidine, hydroxyurea, deoxycoformycin, 4-hydroxyperoxycyclophosphor- amide, 5-fluorouracil (5- FU), 5-fluorodeoxyuridine (5-FUdR), methotrexate (MTX), colchicine, taxanes (e.g., taxol, docetaxel, cabazitaxel, larotaxel), vincristine, vinblastine, anhydrovinblastine, etoposide (VP- 16), trimetrexate, irinotecan, topotecan, gemcitabine, decitabine, teniposide, cisplatin, carboplatin, diethylstilbestrol (DES), abiraterone acetate, altretamine, auristatin, bexarotene, bicalutamide, cachectin, cemadotin, cryptophycin, dolastatin, abemaciclib, acalabrutinib, afatinib, alectinib, axitinib, binimetinib, bosutinib, brigatinib, cabozantinib, ceritinib, cobimetinib, copanlisib, crizotinib, dabrafenib, dasatinib, encorafenib, entrectinib, erdafitinib, erlotinib, everolimus, gefitinib, ibrutinib, imatinib, lapatinib, lenvatinib, midostaurin, neratinib, nilotinib, osimertinib, palbociclib, pazopanib, ponatinib, regorafenib, ribociclib, ruxolitinib, sorafenib, sunitinib, temsirolimus, trametinib, vandetanib, vatalanib, vemurafenib, finasteride, flutamide, enasidenib, lenalidomide, liarozole, lonidamine, niraparib, olaparib, enzalutamide, mivobulin isethionate, abexinostat, belinostat, chidamide, entinostat, givinostat, panobinostat, quisinostat, resminostat, romidepsin, vorinostat, rhizoxin, rucaparib, sertenef, streptozocin, nilutamide, onapristone, sotrastaurin, tasonermin, tretinoin, venetoclax, vindesine sulfate, vinflunine, 3',4'-didehydro-4'-deoxy-8'-norvin-caleukoblastine, BMS 184476, 2,3,4,5,6-pentafluoro-N-(3-fluoro-4-methoxyphenyl)benzene sulfonamide, and N,N- dimethyl-L-valyl-L-valyl-N-methyl-L-valyl-L-proly-1 -Lproline-t-butylamide. Examples of additional agents for use in combination therapy of neoplastic disease include, but are not limited to, thalidomide, marimastat, COL-3, BMS-275291 , squalamine, 2-ME, SU6668, neovastat, Medi-522, EMD121974, CAI, celecoxib, interleukin-12, IM862, TNP470, avastin, gleevec, herceptin, and mixtures thereof.
Examples of TLR agonists for use in combination therapy include, but are not limited to, Pam2Cys, Pam3Cys, Complete Freund’s Adjuvant (CFA), monocyte activating lipopeptide-2 (MALP2), lipopeptide derived from Mycoplasma salivarium (FSL-1), Haemophilus inf luenzae type b outer membrane protein complex (Hib-OMPC), Poly l:C, Poly AU, Hiltonol® (poly-ICLC), monophosphoryl lipid A, lipopolysaccharide (LPS), bacterial flagellin, sialyl-Tn, imiquimod, resiquimod, lefitolimod, tilsotolimod, loxoribine, and CpG oligodeoxynucleotides (e.g., agatolimod, and unmethylated CpG dinucleotide).
Additional antiviral agents can also be delivered in conjunction with a CDN of interest in the treatment methods of this disclosure. For example, compounds that inhibit inosine monophosphate dehydrogenase (IMPDH) may have the potential to exert direct antiviral activity, and such compounds can be administered in a combination therapy, as described
herein. Drugs that are effective inhibitors of hepatitis C NS3 protease may be administered in combination with the CDN, as described herein. Hepatitis C NS3 protease inhibitors inhibit viral replication. Other agents such as inhibitors of HCV NS3 helicase are also attractive drugs for combinational therapy and are contemplated for use in combination therapies described herein. Ribozymes such as HeptazymeTM and phosphorothioate oligonucleotides which are complementary to HCV protein sequences and which inhibit the expression of viral core proteins are also suitable for use in combination therapies described herein.
Examples of additional agents for use in combination therapy of multiple sclerosis include, but are not limited to; glatiramer; corticosteroids; muscle relaxants, such as Tizanidine (Zanaflex) and baclofen (Lioresal); medications to reduce fatigue, such as amantadine (Symmetrel) or modafinil (Provigil); and other medications that may also be used for depression, pain and bladder or bowel control problems that can be associated with MS.
Because of the adjuvant properties of the CDNs of the present disclosure, their use in the subject methods may also combined with other therapeutic modalities including other vaccines, adjuvants, antigen, antibodies, and immune modulators.
Examples of antibodies for use in combination therapy include, but are not limited to, muromonab-CD3, infliximab, omalizumab, daclizumab, rituximab, ibritumomab, tositumomab, cetuximab, trastuzumab, brentuximab vedotin, alemtuzumab, vitaxin, bevacizumab, and abciximab.
In some instances, the active agent is a CDN transporter modulatory agent, e.g., as described in PCT application serial nol. PCT/US2019/32663 published as WO 2019/222500; the disclosure of which is herein incorporated by reference (see also Luteijn et al., "
SLC19A1 transports immunoreactive cyclic dinucleotides," Nature (2019) 573:434-438). Membrane transporters that can be targeted to modulate cellular uptake of a CDN of interest according to the subject methods include membrane folate transporters that are capable of transporting CDNs of interest into cells. Membrane folate transporters include a class of transporters which can actively transport molecules including folate, folate derivatives and/or antifolates, see e.g., Matherly et al. (“Membrane transport of folates”, Vitam. Horm. 2003;66:403-56). Membrane folate transporters of interest include, but are not limited to, the SLC19 family of transporters, reduced folate carrier (RFC), the SLC46 family of transporters including the proton-coupled folate transporters (PCFT). RFC transporter is ubiquitously expressed and can transport folate in mammalian cells and tissues. In some instances of the method, the transporter is a member of the SLC19 family of transporters. In some instances of the method, the transporter is RFC transporter. In certain cases, the RFC transporter is RFC1 , also known as solute carrier family 19 (folate transporter), member 1 , also known as SLC19A1 , RFC, CHMD, FOLT, IFC1 , REFC or IFC-1 . In some instances of the method, the
transporter is a member of the SLC46 family of transporters. In certain cases, the transporter is solute carrier family 46, member 1 , also known as SLC46A1 , PCFT, G21 or HCP1 . In certain cases, the transporter is solute carrier family 46, member 3, also known as SLC46A3 or FKSG16. Exemplary transporters of interest include those described by Hou and Matherly (“Biology of the Major Facilitative Folate Transporters SLC19A1 and SLC46A1”, Curr Top Membr. 2014; 73: 175-204), Zhao and Goldman (Folate and Thiamine Transporters mediated by Facilitative Carriers (SLC19A1-3 and SLC46A1) and Folate Receptors) Mol. Aspects Med. 2013; 34) and Hamblett et al. (“SLC46A3 Is Required to Transport Catabolites of Noncleavable Antibody Maytansine Conjugates from the Lysosome to the Cytoplasm”, Cancer Res. 2015 Dec 15;75(24):5329-40). A CDN transporter-modulating agent is an agent that modulates the transport of the CDN across the membrane of a cell thereby modulating the activity of the CDN of interest in the cell. A CDN transporter-modulating agent is an agent that is capable of modulating the action of a target membrane transporter either directly (e.g., via direct binding to produce an enhancing or inhibiting effect) or indirectly (e.g., via modulating expression of a membrane transporter). Any convenient agents that are capable of modulating the activity of a target membrane transporter can be adapted for use in the subject methods. In some instances, the agent directly binds to the target membrane transporter to modulate its activity. In certain instances, the agent acts indirectly, e.g., via modulating expression of the target membrane transporter.
This disclosure provides a pharmaceutical composition that contains any of the PIK4B Golgi recruitment modulating agents (e.g., as described herein) and/or any of the STING agonists (e.g., as described herein) and a pharmaceutically acceptable carrier. The pharmaceutical composition can include a PIK4B Golgi recruitment modulating agent as the only active agent. The pharmaceutical composition can include both a PIK4B Golgi recruitment modulating agent and a STING agonist, e.g., CDN. The subject pharmaceutical compositions find use in the kits and methods described herein.
The term "pharmaceutically acceptable" means approved by a regulatory agency of the Federal or a state government or listed in the U.S. Pharmacopeia or other generally recognized foreign pharmacopeia for use in animals, and more particularly in humans. The term "carrier" refers to a diluent, adjuvant, excipient, or vehicle with which the agent of interest is administered. Such pharmaceutical carriers can be, for example, sterile liquids, such as dimethyl sulfoxide (DMSO) or saline solutions in water and oils, including those of petroleum, animal, vegetable or synthetic origin, such as peanut oil, soybean oil, mineral oil, sesame oil and the like. A saline solution is a preferred carrier when the pharmaceutical composition is administered intravenously. Saline solutions and aqueous dextrose and
glycerol solutions can also be employed as liquid carriers, particularly for injectable solutions. Suitable pharmaceutical excipients include starch, glucose, lactose, sucrose, gelatin, malt, rice, flour, chalk, silica gel, sodium stearate, glycerol monostearate, talc, sodium chloride, dried skim milk, glycerol, propylene glycol, water, ethanol and the like. The composition, if desired, can also contain minor amounts of wetting or emulsifying agents, or pH buffering agents. These compositions can take the form of solutions, suspensions, emulsion, tablets, pills, capsules, powders, sustained-release formulations and the like. The composition can be formulated as a suppository, with traditional binders and carriers such as triglycerides. The inhibitors can be formulated as neutral or salt forms. Pharmaceutically acceptable salts include those formed with free amino groups such as those derived from hydrochloric, phosphoric, acetic, oxalic, tartaric acids, etc., and those formed with free carboxyl groups such as those derived from sodium, potassium, ammonium, calcium, ferric hydroxides, isopropylamine, triethylamine, 2-ethylamino ethanol, histidine, procaine, etc. Examples of suitable pharmaceutical carriers are described in "Remington's Pharmaceutical Sciences" by E. W. Martin, hereby incorporated by reference herein in its entirety. Such compositions will contain a therapeutically effective amount of the mitochondrial transport protein (e.g., a Miro protein, a TRAK protein, or Khc) inhibitor, preferably in purified form, together with a suitable amount of carrier so as to provide the form for proper administration to the patient. The formulation should suit the mode of administration.
The pharmaceutical composition can also include any of a variety of stabilizing agents, such as an antioxidant for example. When the pharmaceutical composition includes a polypeptide, the polypeptide can be complexed with various well-known compounds that enhance the in vivo stability of the polypeptide, or otherwise enhance its pharmacological properties (e.g., increase the half-life of the polypeptide, reduce its toxicity, enhance solubility or uptake). Examples of such modifications or complexing agents include sulfate, gluconate, citrate and phosphate. The polypeptides of a composition can also be complexed with molecules that enhance their in vivo attributes. Such molecules include, for example, carbohydrates, polyamines, amino acids, other peptides or proteins, ions (e.g., sodium, potassium, calcium, magnesium, manganese) and lipids.
Further guidance regarding formulations that are suitable for various types of administration can be found in Remington's Pharmaceutical Sciences, Mace Publishing Company, Philadelphia, Pa., 17th ed. (1985). For a brief review of methods for drug delivery, see, Langer, Science 249:1527-1533 (1990).
The components used to formulate the pharmaceutical compositions are preferably of high purity and are substantially free of potentially harmful contaminants (e.g., at least National Food (NF) grade, generally at least analytical grade, and more typically at least pharmaceutical grade). Moreover, compositions intended for in vivo use may be sterile. To
the extent that a given compound must be synthesized prior to use, the resulting product is typically substantially free of any potentially toxic agents, particularly any endotoxins, which may be present during the synthesis or purification process. Compositions for parental administration are also sterile, substantially isotonic and made under GMP conditions.
The pharmaceutical composition can be formulated for intravenous, oral, via implant, transmucosal, transdermal, intramuscular, intrathecal, or subcutaneous administration. In some cases, the pharmaceutical composition is formulated for intravenous administration.
In other cases, the pharmaceutical composition is formulated for subcutaneous administration. The following delivery systems, which employ a number of routinely used pharmaceutical carriers, are only representative of the many embodiments envisioned for administering the instant compositions.
Injectable drug delivery systems include solutions, suspensions, gels, microspheres and polymeric injectables, and can comprise excipients such as solubility-altering agents (e.g., ethanol, propylene glycol and sucrose) and polymers (e.g., polycaprylactones and PLGAs). Implantable systems include rods and discs, and can contain excipients such as PLGA and polycaprylactone. Osteopontin or nucleic acids of the invention can also be administered attached to particles using a gene gun.
Oral delivery systems include tablets and capsules. These can contain excipients such as binders (e.g., hydroxypropylmethylcellulose, polyvinyl pyrilodone, other cellulosic materials and starch), diluents (e.g., lactose and other sugars, starch, dicalcium phosphate and cellulosic materials), disintegrating agents (e.g., starch polymers and cellulosic materials) and lubricating agents (e.g., stearates and talc).
Transmucosal delivery systems include patches, tablets, suppositories, pessaries, gels and creams, and can contain excipients such as solubilizers and enhancers (e.g., propylene glycol, bile salts and amino acids), and other vehicles (e.g., polyethylene glycol, fatty acid esters and derivatives, and hydrophilic polymers such as hydroxypropylmethylcellulose and hyaluronic acid).
Dermal delivery systems include, for example, aqueous and nonaqueous gels, creams, multiple emulsions, microemulsions, liposomes, ointments, aqueous and nonaqueous solutions, lotions, aerosols, hydrocarbon bases and powders, and can contain excipients such as solubilizers, permeation enhancers (e.g., fatty acids, fatty acid esters, fatty alcohols and amino acids), and hydrophilic polymers (e.g., polycarbophil and polyvinylpyrolidone). In one embodiment, the pharmaceutically acceptable carrier is a liposome or a transdermal enhancer.
The pharmaceutical composition containing an active agent can be formulated to cross the blood brain barrier (BBB). One strategy for drug delivery through the blood brain barrier (BBB) entails disruption of the BBB, either by osmotic means such as mannitol or
leukotrienes, or biochemically by the use of vasoactive substances such as bradykinin. A BBB disrupting agent can be co-administered with the therapeutic compositions when the compositions are administered by intravascular injection. Other strategies to go through the BBB may entail the use of endogenous transport systems, including caveoil-1 mediated transcytosis, carrier-mediated transporters such as glucose and amino acid carriers, receptor-mediated transcytosis for insulin or transferrin, and active efflux transporters such as p-glycoprotein. Active transport moieties may also be conjugated to the therapeutic compounds for use in the invention to facilitate transport across the endothelial wall of the blood vessel. Alternatively, drug delivery of the pharmaceutical composition behind the BBB may be by local delivery, for example by intrathecal delivery, e.g., through an Ommaya reservoir (see, e.g., US Patent Nos. 5,222,982 and 5385582, incorporated herein by reference); by bolus injection, e.g., by a syringe, e.g., intravitreally or intracranially; by continuous infusion, e.g., by cannulation, e.g., with convection (see, e.g., US Application No. 20070254842, incorporated here by reference); or by implanting a device upon which the inhibitor pharmaceutical composition has been reversibly affixed (see e.g., US Application Nos. 20080081064 and 20090196903, incorporated herein by reference).
In certain embodiments, the pharmaceutical composition containing the active agent is formulated in a delivery vehicle, e.g., to enhance passive cytosolic transport. Any convenient protocol may be employed to facilitate delivery of the CDN active agent across the plasma membrane of a cell and into the cytosol.
In some instances, the STING agonist, e.g., CDN, and/or PIK4B Golgi recruitment modulating active agent may be encapsulated in a delivery vehicle comprising liposomes in the pharmaceutical composition. Methods of using liposomes for drug delivery and other therapeutic uses are known in the art. See, e.g., US Pat. Nos. 8329213, US6465008, US5013556, US Application No. 20070110798, and Andrews et al., Mol Pharm 2012 9:1118, which are incorporated herein by reference. Liposomes may be modified to render their surface more hydrophilic by adding polyethylene glycol ("pegylated") to the bilayer, which increases their circulation time in the bloodstream. These are known as "stealth" liposomes and are especially useful as carriers for hydrophilic (water soluble) molecules.
In certain embodiments, nano- or microparticles made from biodegradable materials such as poly(lactic acid), poly(y-glutamic acid), poly(glycolic acid), polylactic-co-glycolic acid, polyethylenimine, or alginate microparticles, and cationic microparticles, including dedrimers, such as cyclodextrins, may be employed as delivery vehicles for the active agents to promote cellular uptake. See, e.g., US Pat. No. 8187571 , Krishnamachari et al., Adv Drug Deliv Rev 2009 61 :205, Garzon et al., 2005 Vaccine 23:1384, incorporated herein by reference.
In certain embodiments, the delivery vehicle for delivering the active agents can also be targeting delivery vehicles, e.g., a liposome containing one or more targeting moieties or biodistribution modifiers on the surface of the liposome. A targeting moiety can be any agent that is capable of specifically binding or interacting with a desired target. The specific binding agent can be any molecule that specifically binds to a protein, peptide, biomacromolecule, cell, tissue, etc. that is being targeted (e.g., protein, peptide, biomacromolecule, cell, tissue, etc. wherein the active agent exerts its desired effect). Depending on the nature of the target site, the specific binding agent can be, but is not limited to, an antibody against an epitope of a peptidic analyte, or any recognition molecule, such as a member of a specific binding pair. For example, suitable specific binding pairs include, but are not limited to: a member of a receptor/ligand pair; a ligand-binding portion of a receptor; a member of an antibody/antigen pair; an antigen-binding fragment of an antibody; a hapten; a member of a lectin/carbohydrate pair; a member of an enzyme/substrate pair; biotin/avidin; biotin/streptavidin; digoxin/antidigoxin; a member of a peptide aptamer binding pair; and the like. In certain embodiments, the specific binding moiety includes an antibody. In some cases, the specific binding moiety is a fragment of an antibody which retains specific binding to antigen, including, but not limited to, Fab, Fv, scFv, and Fd fragments, chimeric antibodies, humanized antibodies, single-chain antibodies, and fusion proteins comprising an antigen-binding portion of an antibody and a non-antibody protein. The specific binding moiety may also include Fab', Fv, F(ab')2, and or other antibody fragments that retain specific binding to antigen. In certain embodiments, the targeting moiety is a binding agent that specifically interacts with a molecule expressed on a tumor cell or an immune cell (e.g., CD4, CD8, CD69, CD62L, and the like), such that the targeting delivery vehicle containing the cyclic-di-nucleotide or STING active agents is delivered to the site of a tumor or to specific immune cells.
Where desired, any combinations of the above listed delivery vehicles may be used advantageously to enhance delivery of the active agents to the target cells.
Components of the pharmaceutical composition can be supplied either separately or mixed together in unit dosage form, for example, as a dry lyophilized powder or water free concentrate. Where the composition is to be administered by infusion, it can be dispensed with an infusion bottle containing sterile pharmaceutical grade water or saline. Where the composition is administered by injection, an ample of sterile water for injection or saline can be provided so that the ingredients may be mixed prior to administration.
In some embodiments, the pharmaceutical composition is supplied as a dry sterilized lyophilized powder that is capable of being reconstituted to the appropriate concentration for administration to a subject. In some embodiments, the pharmaceutical composition is supplied as a water free concentrate. In some embodiments, the pharmaceutical
composition is supplied as a dry sterile lyophilized powder at a unit dosage of at least 0.5 mg, at least 1 mg, at least 2 mg, at least 3 mg, at least 5 mg, at least 10 mg, at least 15 mg, at least 25 mg, at least 30 mg, at least 35 mg, at least 45 mg, at least 50 mg, at least 60 mg, or at least 75 mg.
Solutions, suspensions and powders for reconstitutable delivery systems include vehicles such as suspending agents (e.g., gums, xanthans, cellulosics and sugars), humectants (e.g., sorbitol), solubilizers (e.g., ethanol, water, PEG and propylene glycol), surfactants (e.g., sodium lauryl sulfate, Spans, Tweens, and cetyl pyridine), preservatives and antioxidants (e.g., parabens, vitamins E and C, and ascorbic acid), anti-caking agents, coating agents, and chelating agents (e.g., EDTA).
In some embodiments, the pharmaceutical composition is formulated as a salt form. Pharmaceutically acceptable salts include those formed with anions such as those derived from hydrochloric, phosphoric, acetic, oxalic, tartaric acids, etc., and those formed with cations such as those derived from sodium, potassium, ammonium, calcium, ferric hydroxides, isopropylamine, triethylamine, 2-ethylamino ethanol, histidine, procaine, etc.
In certain embodiments, the pharmaceutical composition contains a prodrug derivative of any of the CDN active agents provided herein. Such prodrugs can be subsequently converted to an active form of the CDN in the body of the subject administered the pharmaceutical composition.
Kits
Kits including a PIK4B Golgi recruitment -modulating agent (e.g., as described herein) and a STING agonist, e.g., CDN active agent, (e.g., as described herein) are provided. In some cases, the kit includes a unit dose of the subject active agents e.g., in an oral or injectable dose.
In the subject kits, the one or more components are present in the same or different containers, as may be convenient or desirable. In addition to the containers containing the components of the kits (e.g., unit doses) instructions can be included describing the use and attendant benefits of the STING agonist, e.g., CDN, and PIK4B Golgi recruitment-modulating agent in treating a pathological condition of interest. Instructions may be provided in a variety of different formats. In certain embodiments, the instructions may include complete protocols for practicing the subject methods or means for obtaining the same (e.g., a website URL directing the user to a webpage which provides the instructions), where these instructions may be printed on a substrate, where substrate may be one or more of: a package insert, the packaging, reagent containers and the like.
Utility
This disclosure provides methods, compositions and kits that find use in a variety of applications. The subject methods find use in a variety of applications where it is desirable to either inhibit or enhance STING pathway activation in a target cell. Therapeutic applications of interest include, but are not limited to, cancer immunotherapy, antiviral applications, treatment of autoimmune or inflammatory disease, and other in applications similar to those described herein. In some cases, this disclosure provides for methods and applications involving STING pathway activation in immune cells in vivo, leading to greater activation of the immune response.
Specific applications of interest include those in which a subject is treated for a disease condition that would benefit from an increase in type I interferon by providing the subject with a therapeutically effective amount of a STING agonist, e.g., CDN active agent.
In some instances, it may be desirable to increase a type I interferon or STING mediated response in a healthy individual, e.g., for the prevention of a disease or condition. The subject methods can be applied to enhance STING pathway activation for improved cancer immunotherapy. In anti-cancer therapy, the subject methods can also be applied locally or systemically to inhibit or block uptake of a STING agonist, e.g., CDN active agent, by target cells where it is desirable to alleviate the possible toxic effects of such a STING agonist, e.g., a CDN administered for anti-cancer treatment.
The present invention also provides a method of inhibiting type I interferon production mediated by the cGAS-STING pathway. In some embodiments, subjects suitable for treatment with a method described herein include individuals having an immunological or inflammatory disease or disorder including, but not limited to a cancer, an autoimmune disease or disorder, an allergic reaction, a chronic infectious disease and an immunodeficiency disease or disorder. The subject methods can be applied with the purpose of inhibiting CDN uptake and signaling in autoimmune/inflammatory diseases linked to aberrant CDN signaling, In some embodiments, the disease or disorder can be a type I interferonopathy (e.g., Aicardi-Goutieres Syndrome, Sjogren's syndrome, Singleton-Merten Syndrome, proteasome-associated autoinflammatory syndrome, SAVI (STING-associated vasculopathy with onset in infancy), CANDLE syndrome, chilblain lupus erythematosus, systemic lupus erythematosus, spondyloenchondrodysplasia), rheumatoid arthritis, juvenile rheumatoid arthritis, idiopathic thrombocytopenic purpura, autoimmune myocarditis, thrombotic thrombocytopenic purpura, autoimmune thrombocytopenia, psoriasis, Type 1 diabetes, or Type 2 diabetes. In other embodiments, the disease or disorder can be an inflammatory disorder (e.g., atherosclerosis, dermatomyositis, SIRS, sepsis, septic shock, atherosclerosis, celiac disease, interstitial cystitis, transplant rejection, rheumatoid arthritis, juvenile rheumatoid arthritis, inflammatory bowel disease (ulcerative colitis, Crohn’s
disease), age-related macular degeneration, IgA nephropathy, glomerulonephritis, vasculitis, polymyositis, or Wegener’s disease). In some instances, the methods find use in inhibiting STING pathway activation in inflammatory diseases. Inappropriate activation of the STING pathway may underlie certain inflammatory diseases, including inflammatory bowel diseases, arthritis and possibly lupus. Inhibitors of PI4KB are effective in ameliorating the pathological manifestations of such diseases.
In some embodiments, subjects suitable for treatment with a method of the present invention where STING pathway activation is enhanced include individuals having a cellular proliferative disease, such as a neoplastic disease (e.g., cancer). Cellular proliferative disease is characterized by the undesired propagation of cells, including, but not limited to, neoplastic disease conditions, e.g., cancer. Examples of cellular proliferative disease include, but are not limited to, abnormal stimulation of endothelial cells (e.g., atherosclerosis), solid tumors and tumor metastasis, benign tumors, for example, hemangiomas, acoustic neuromas, neurofibromas, trachomas, and pyogenic granulomas, vascular malfunctions, abnormal wound healing, inflammatory and immune disorders, Bechet's disease, gout or gouty arthritis, abnormal angiogenesis accompanying, for example, rheumatoid arthritis, psoriasis, diabetic retinopathy, other ocular angiogenic diseases such as retinopathy of prematurity (retrolental fibroplastic), macular degeneration, corneal graft rejection, neurovascular glaucoma and Oster Webber syndrome, psoriasis, restenosis, fungal, parasitic and viral infections such cytomegaloviral infections. Subjects to be treated according to the methods of the invention include any individual having any of the above-mentioned disorders.
In some instances, the methods find use in enhancing the effects of STING agonists as cancer immunotherapies. Examples of such instances include (i) co-administering STING agonists and an OSBP inhibitor into tumors; (ii) administering low doses of STING agonist systemically and OSBP inhibitors intratumorally; (iii) administering STING agonists intratumorally and OSBP inhibitors systemically; (iv) administering low doses of STING agonists and OSBP inhibitors systemically.
In some instances, the methods find use in enhancing the immuno-therapeutic effects of chemo- and radiotherapies. In addition to killing tumor cells, chemo and radio therapies are known to activate the cGAS-STING pathway and can thereby promote antitumor immune responses. Combining OSBP inhibitors with chemo or radiotherapy greatly amplifies the anti-tumor immune responses that accompany radio and chemotherapy.
In some instances, the methods find use in protecting specific tissues from STING pathway activation. STING pathway agonists such as CDNs, at high concentrations, can cause local tissue damage. In the context of systemic treatments with STING agonists (or
systemic effects that result when STING agonists migrate out of a locally treated tumor), critical tissues are protected if they are locally treated with a PI4KB inhibitor.
The subject methods can be applied with the purpose of increasing intercellular 2’3’- cGAMP signaling between virus-infected and uninfected cells for amplification of anti-viral immunity. In some embodiments, subjects suitable for treatment with a subject method include individuals who have been clinically diagnosed as infected with a virus. In some embodiments, the virus is a hepatitis virus (e.g., HAV, HBV, HCV, delta, etc.), particularly HCV, are suitable for treatment with the methods of the instant invention. Individuals who are infected with HCV are identified as having HCV RNA in their blood, and/or having anti- HCV antibody in their serum. Such individuals include naive individuals (e.g., individuals not previously treated for HCV, particularly those who have not previously received IFN-a-based or ribavirin-based therapy) and individuals who have failed prior treatment for HCV.
In certain embodiments, subjects suitable for treatment with a method of the present invention include individuals having multiple sclerosis. Multiple sclerosis refers to an autoimmune neurodegenerative disease, which is marked by inflammation within the central nervous system with lymphocyte attack against myelin produced by oligodendrocytes, plaque formation and demyelization with destruction of the myelin sheath of axons in the brain and spinal cord, leading to significant neurological disability over time. Typically, at onset an otherwise healthy person presents with the acute or sub-acute onset of neurological symptomatology (attack) manifested by unilateral loss of vision, vertigo, ataxia, dyscoordination, gait difficulties, sensory impairment characterized by paresthesia, dysesthesia, sensory loss, urinary disturbances until incontinence, diplopia, dysarthria or various degrees of motor weakness until paralysis. The symptoms may be painless, remain for several days to a few weeks, and then partially or completely resolve. After a period of remission, a second attack will occur. During this period after the first attack, the patient is defined to suffer from probable MS. Probable MS patients may remain undiagnosed for years. When the second attack occurs the diagnosis of clinically definite MS (CDMS) is made (Poser criteria 1983; C. M. Poser et al., Ann. Neurol. 1983; 13, 227).
The following examples are offered by way of illustration and not by way of limitation.
EXAMPLES
Using a genetic screen, ACBD3 was identified as a gene involved in STING pathway activation via exogenously provided cyclic dinucleotides (See FIGS. 1A and 1 B). ACBD3 recruits PI4KB to the Golgi, to stimulate PI4P accumulation in the Golgi (See FIGS 2A and 2B). ACBD3 depletion in cells results in impaired STING activation in response to certain
cyclic dinucleotides. A negative regulator of PI4KB recruitment to the Golgi is the protein OSBP. Modulation of ACBD3 and OSBP functions can be used to modulate STING pathway function as a means to either enhance activation of the pathway in the context of immunotherapy, or inhibit pathway activation in the case of pathology resulting from inappropriate STING pathway activation. As a proof of principle, molecules that inhibit OSBP have been described (itraconazole and OSW-1), including one (itraconazole) that is FDA approved for treating fungal diseases albeit by a different mechanism. We have shown that these inhibitors, which are predicted to increase PI4P accumulation in the Golgi, greatly enhance STING pathway activation induced by exogenously supplied cyclic dinucleotides. See FIGS 3A to 3C. Conversely, we find that genetic depletion of PI4KB depresses STING signaling in cells induced by STING agonists, indicating the utility of PI4KB inhibitors for treating inflammatory diseases that result from inappropriate STING pathway activation. Further details are provided in Appendix A of priority provisional application serial no. the disclosure of which is herein incorporated by references.
Findings include:
ACBD3 knockdown:
• Decreased response to c-di-AMP * synthetic and bacteria! CDNs
• Slightly increased response to cGAMP
• differential STING regulation depending on CDNs
• ACBD3 does not affect CDN uptake
• ACBD3 and STING colocaiize and interact upon stimulation with CDNs
ACBD3 increases Pi4P in Golgi <-> OSBP shuttles PI4P out of Go!gi * OS8P inhibitors increase sensitivity to both CDNs -> boost in vivo response to injected CDNs
Notwithstanding the appended claims, the disclosure is also defined by the following clauses:
1 . A method of modulating stimulator of interferon genes (STING) pathway activation in a cell, the method comprising: modulating Phosphatidylinositol 4-Kinase Beta (PI4KB) Golgi recruitment to modulate STING pathway activation in the cell.
2. The method according to clause 1 , wherein the method comprises increasing PI4KB Golgi recruitment to enhance STING pathway activation in the cell.
3. The method according to clause 2, wherein the method comprises inhibiting Oxysterol-binding protein (OSBP) activity in the cell.
4. The method according to clauses 2 or 3, wherein the method comprises increasing acyl-coenzyme A binding domain containing 3 (ACBD3) activity in the cell.
5. The method according to any of clauses 2 to 4, wherein the method further comprises contacting the cell with a STING agonist.
6. The method according to clause 5, wherein the STING agonist comprises a cyclic dinucleotide (CDN).
7. The method according to clause 6, wherein the method results in increasing STING- dependent type I interferon production in the cell.
8. The method according to clause 7, wherein the type I interferon is interferon alpha or interferon beta.
9. The method according to clause 1 , wherein the method comprises decreasing PI4KB Golgi recruitment to reduce STING pathway activation in the cell.
10. The method according to clause 9, wherein the method comprises increasing OSBP activity in the cell.
11 . The method according to clauses 9 or 10, wherein the method comprises inhibiting ACBD3 activity in the cell.
12. The method according to any one of clauses 1 to 11 , wherein the cell is in vitro.
13. The method according to any one of clauses 1 to 11 , wherein the cell is in vivo.
14. A method of enhancing STING pathway activation in a cell, the method comprising: contacting the cell with an agent that increases PI4KB Golgi recruitment to enhance
STING pathway activation in the cell.
15. The method according to clause 14, wherein the agent inhibits OSBP activity in the cell.
16. The method according to clauses 14 or 15, wherein the agent increases ACBD3 activity in the cell.
17. The method according to any of clauses 14 to 16, wherein the agent is selected from the group consisting of a small molecule, a nucleic acid and a polypeptide.
18. The method according to any of clauses 14 to 17, wherein the method further comprises contacting the cell with a STING agonist.
19. The method according to clause 18, wherein the sting agonist comprises a CDN.
20. The method according to clause 19, wherein the CDN comprises a 2'-5' phosphodiester linkage.
21 . The method according to clause 20, wherein the CDN comprises two 2’-5’ phosphodiester linkages.
22. The method according to clause 20, wherein the CDN comprises a 2’-5’ phosphodiester linkage and a 3’-5’ phosphodiester linkage.
23. The method according to clause 22, wherein the CDN has the formula:
wherein X and Y are each independently:
or a salt thereof. 24. The method according to clause 19, wherein the CDN comprises a 2'-5' thiophosphate linkage.
25. The method according to clause 24, wherein the CDN comprises two 2’-5’ thiophosphate linkages.
26. The method according to clause 19, wherein the CDN is cyclic[G(2’5’)pG(3’5’)p], wherein each prefers to a phosphate, thiophosphate or dithiophosphate internucleotide linkage.
27. The method according to clause 19, wherein the CDN is cyclic[A(2’5’)pA(3’5’)p], wherein each prefers to a phosphate, thiophosphate or dithiophosphate internucleotide linkage. 28. The method according to clause 19, wherein the CDN is cyclic[G(2’5’)pA(3’5’)p], wherein each prefers to a phosphate, thiophosphate or dithiophosphate internucleotide linkage.
29. The method according to clause 19, wherein the CDN is cyclic[A(2’5’)pG(3’5’)p], wherein each prefers to a phosphate, thiophosphate or dithiophosphate internucleotide linkage.
30. The method according to any of clauses 14 to 29, wherein the method results in increasing STING-dependent type I interferon production in the cell.
31 . The method according to clause 30, wherein the type I interferon is interferon alpha or interferon beta.
32. The method according to any of clauses 14 to 31 , wherein the contacting comprises administration of the agent that increases PI4KB Golgi recruitment to a subject.
33. The method according to clause 32, wherein the subject has a viral infection.
34. The method according to clause 32, wherein the subject has a bacterial infection.
35. The method according to clause 32, wherein the subject has neoplastic disease.
36. The method according to clause 35, wherein the method further comprises administering immunotherapy to the subject.
37. The method according to clause 35, wherein the method further comprises administering chemotherapy to the subject.
38. The method according to clause 35, wherein the method further comprises administering radiotherapy to the subject.
39. The method according to any of clauses 32 to 38, wherein the subject is mammal.
40. The method according to clause 39, wherein the mammal is a human.
41 . A method of reducing STING pathway activation in a cell, the method comprising: contacting the cell with an agent that decreases PI4KB Golgi recruitment to reduce
STING pathway activation in the cell.
42. The method according to clause 41 , wherein the agent increases OSBP activity in the cell.
43. The method according to clauses 41 or 42, wherein the agent decreases ACBD3 activity in the cell.
44. The method according to any of clauses 41 to 43, wherein the agent is selected from the group consisting of a small molecule, a nucleic acid and a polypeptide.
45. The method according to any of clauses 41 to 44, wherein the contacting comprises administration of the agent that decreases PI4KB Golgi recruitment to a subject.
46. The method according to clause 45, wherein the subject has an autoimmune or inflammatory disease linked to aberrant 2’3’-cGAMP signaling.
47. The method according to clause 46, wherein the autoimmune or inflammatory disease is selected from Aicardi-Goutieres Syndrome, Sjogren's syndrome, Singleton- Merten Syndrome, proteasome-associated autoinflammatory syndrome, SAVI (STING- associated vasculopathy with onset in infancy), CANDLE syndrome, chilblain lupus erythematosus, systemic lupus erythematosus, spondyloenchondrodysplasia), rheumatoid arthritis, juvenile rheumatoid arthritis, idiopathic thrombocytopenic purpura, autoimmune myocarditis, thrombotic thrombocytopenic purpura, autoimmune thrombocytopenia, psoriasis, Type 1 diabetes and Type 2 diabetes.
48. The method according to clause 45, wherein the method comprises inhibiting CDN uptake locally or systemically to alleviate a toxic effect of a STING agonist administered for anti-cancer treatment.
49. The method according to any one of clauses 45 to 48, wherein the subject is mammal.
50. The method according to clause 49, wherein the mammal is a human.
51 . A composition comprising: a STING agonist; and an agent that increases PI4KB Golgi recruitment. 52. The composition according to clause 51 , wherein the agent inhibits OSBP activity.
53. The composition according to clause 51 , wherein the agent increases ACBD3 activity.
54. The composition according to any of clauses 51 to 53 wherein the agent is selected from the group consisting of a small molecule, a nucleic acid and a polypeptide. 55. The composition according to any of clauses 51 to 54, wherein the STING agonist comprises a CDN.
56. The composition according to clause 55, wherein the CDN comprises a 2'-5' phosphodiester linkage.
57. The composition according to clause 56, wherein the CDN comprises two 2’-5’ phosphodiester linkages.
58. The composition according to clause 56, wherein the CDN comprises a 2’-5’ phosphodiester linkage and a 3’-5’ phosphodiester linkage.
59. The composition according to clause 58, wherein the CDN has the formula:
wherein X and Y are each independently:
or a salt thereof.
60. The composition according to clause 55, wherein the CDN comprises a 2'-5' thiophosphate linkage.
61 . The composition according to clause 60, wherein the CDN comprises two 2’-5’ thiophosphate linkages.
62. The composition according to clause 55, wherein the CDN is cyclic[G(2’5’)pG(3’5’)p], wherein each prefers to a phosphate, thiophosphate or dithiophosphate internucleotide linkage.
63. The composition according to clause 55, wherein the CDN is cyclic[A(2’5’)pA(3’5’)p], wherein each prefers to a phosphate, thiophosphate or dithiophosphate internucleotide linkage.
64. The composition according to clause 55, wherein the CDN is cyclic[G(2’5’)pA(3’5’)p], wherein each prefers to a phosphate, thiophosphate or dithiophosphate internucleotide linkage.
65. The composition according to clause 55, wherein the CDN is cyclic[A(2’5’)pG(3’5’)p], wherein each prefers to a phosphate, thiophosphate or dithiophosphate internucleotide linkage.
66. A kit comprising: a first composition comprising a STING agonist; and a second composition comprising an agent that increases PI4KB Golgi recruitment.
67. The kit according to clause 66, wherein the agent inhibits OSBP activity.
68. The kit according to clause 66, wherein the agent increases ACBD3 activity.
69. The kit according to any of clauses 66 to 68, wherein the agent is selected from the group consisting of a small molecule, a nucleic acid and a polypeptide.
70. The kit according to any of clauses 66 to 69, wherein the STING agonist comprises a CDN.
71 . The kit according to clause 70, wherein the CDN comprises a 2'-5' phosphodiester linkage.
72. The kit according to clause 71 , wherein the CDN comprises two 2’-5’ phosphodiester linkages.
73. The kit according to clause 71 , wherein the CDN comprises a 2’-5’ phosphodiester linkage and a 3’-5’ phosphodiester linkage. 74. The kit according to clause 73, wherein the CDN has the formula:
wherein X and Y are each independently:
or a salt thereof. 75. The kit according to clause 70, wherein the CDN comprises a 2'-5' thiophosphate linkage.
76. The kit according to clause 75, wherein the CDN comprises two 2’-5’ thiophosphate linkages.
77. The kit according to clause 70, wherein the CDN is cyclic[G(2’5’)pG(3’5’)p], wherein each prefers to a phosphate, thiophosphate or dithiophosphate internucleotide linkage.
78. The kit according to clause 70, wherein the CDN is cyclic[A(2’5’)pA(3’5’)p], wherein each prefers to a phosphate, thiophosphate or dithiophosphate internucleotide linkage.
79. The kit according to clause 70, wherein the CDN is cyclic[G(2’5’)pA(3’5’)p], wherein each prefers to a phosphate, thiophosphate or dithiophosphate internucleotide linkage. 80. The kit according to clause 67, wherein the CDN is cyclic[A(2’5’)pG(3’5’)p], wherein each prefers to a phosphate, thiophosphate or dithiophosphate internucleotide linkage.
Although the foregoing invention has been described in some detail by way of illustration and example for purposes of clarity of understanding, it is readily apparent to
those of ordinary skill in the art in light of the teachings of this invention that certain changes and modifications may be made thereto without departing from the spirit or scope of the appended claims.
Accordingly, the preceding merely illustrates the principles of the invention. It will be appreciated that those skilled in the art will be able to devise various arrangements which, although not explicitly described or shown herein, embody the principles of the invention and are included within its spirit and scope. Furthermore, all examples and conditional language recited herein are principally intended to aid the reader in understanding the principles of the invention and the concepts contributed by the inventors to furthering the art, and are to be construed as being without limitation to such specifically recited examples and conditions. Moreover, all statements herein reciting principles, aspects, and embodiments of the invention as well as specific examples thereof, are intended to encompass both structural and functional equivalents thereof. Additionally, it is intended that such equivalents include both currently known equivalents and equivalents developed in the future, i.e., any elements developed that perform the same function, regardless of structure. Moreover, nothing disclosed herein is intended to be dedicated to the public regardless of whether such disclosure is explicitly recited in the claims.
The scope of the present invention, therefore, is not intended to be limited to the exemplary embodiments shown and described herein. Rather, the scope and spirit of present invention is embodied by the appended claims. In the claims, 35 U.S.C. §112(f) or 35 U.S.C. §112(6) is expressly defined as being invoked for a limitation in the claim only when the exact phrase "means for" or the exact phrase "step for" is recited at the beginning of such limitation in the claim; if such exact phrase is not used in a limitation in the claim, then 35 U.S.C. § 112 (f) or 35 U.S.C. §112(6) is not invoked.
Claims
1 . A method of modulating stimulator of interferon genes (STING) pathway activation in a cell, the method comprising: modulating Phosphatidylinositol 4-Kinase Beta (PI4KB) Golgi recruitment to modulate STING pathway activation in the cell.
2. The method according to claim 1 , wherein the method comprises increasing PI4KB Golgi recruitment to enhance STING pathway activation in the cell.
3. The method according to claim 2, wherein the method comprises increasing acyl- coenzyme A binding domain containing 3 (ACBD3) activity in the cell.
4. The method according to any of claims 2 to 3, wherein the method further comprises contacting the cell with a STING agonist.
5. The method according to claim 4, wherein the STING agonist comprises a cyclic dinucleotide (CDN).
6. The method according to claim 5, wherein the method results in increasing STING- dependent type I interferon production in the cell.
7. The method according to claim 6, wherein the type I interferon is interferon alpha or interferon beta.
8. The method according to claim 1 , wherein the method comprises decreasing PI4KB Golgi recruitment to reduce STING pathway activation in the cell.
9. The method according to claim 9, wherein the method comprises inhibiting ACBD3 activity in the cell.
10. The method according to any one of claims 1 to 9, wherein the cell is in vitro.
11 The method according to any one of claims 1 to 9, wherein the cell is in vivo.
12. A method of enhancing STING pathway activation in a cell, the method comprising:
contacting the cell with an agent that increases PI4KB Golgi recruitment to enhance STING pathway activation in the cell.
13. The method according to claim 12, wherein the agent increases ACBD3 activity in the cell.
14. The method according to any of claims 12 to 13, wherein the method further comprises contacting the cell with a STING agonist.
15. A composition comprising: a STING agonist; and an agent that increases PI4KB Golgi recruitment.
Applications Claiming Priority (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US202062958598P | 2020-01-08 | 2020-01-08 | |
US62/958,598 | 2020-01-08 |
Publications (1)
Publication Number | Publication Date |
---|---|
WO2021141862A1 true WO2021141862A1 (en) | 2021-07-15 |
Family
ID=76787541
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/US2021/012094 WO2021141862A1 (en) | 2020-01-08 | 2021-01-04 | Methods of modulating sting pathway activation |
Country Status (1)
Country | Link |
---|---|
WO (1) | WO2021141862A1 (en) |
-
2021
- 2021-01-04 WO PCT/US2021/012094 patent/WO2021141862A1/en active Application Filing
Non-Patent Citations (3)
Title |
---|
BARNETT ET AL.: "Phosphoinositide Interactions Position cGAS at the Plasma Membrane to Ensure Efficient Distinction between Self- and Viral DNA", CELL, vol. 176, no. 6, 7 March 2019 (2019-03-07), pages 1432 - 1446, XP055840650 * |
KLIMA ET AL.: "Structural insights and in vitro reconstitution of membrane targeting and activation of human P14KB by the ACBD3 protein", SCIENTIFIC REPORTS, vol. 6, no. 1, July 2016 (2016-07-01), pages 23641, XP055840655 * |
WEIXEL ET AL.: "Distinct Golgi Populations of Phosphatidylinositol 4-Phosphate Regulated by Phosphatidylinositol 4-Kinases", J. BIOL. CHEM, vol. 280, no. 11, 18 March 2005 (2005-03-18), pages 10501 - 10508, XP055840653 * |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US11873319B2 (en) | Cyclic di-nucleotide induction of type I interferon | |
US11660341B2 (en) | mRNA combination therapy for the treatment of cancer | |
JP7145761B2 (en) | Cellular Immunotherapy Compositions and Methods | |
US20190351040A1 (en) | Rna cancer vaccines | |
US9186373B2 (en) | SiRNA against Cbl-b and optionally IL-2 and IL-12 for use in the treatment of cancer | |
KR20190020299A (en) | Combinations of mRNAs Encoding Immunomodulating Polypeptides and Their Uses | |
US20160215042A1 (en) | Methods for modulating immune responses during chronic immune conditions by targeting metallothioneins | |
EP3368689A2 (en) | Compositions and methods for evaluating and modulating immune responses by use of immune cell gene signatures | |
WO2017143449A1 (en) | Smc combination therapy for the treatment of cancer | |
KR20130132788A (en) | Therapeutic use of a tlr agonist and combination therapy | |
JP2020516305A (en) | Immunomodulatory polynucleotides and uses thereof | |
WO2014169255A1 (en) | Methods and compositions of treating autoimmune diseases | |
JP2022512922A (en) | Chimeric antigen receptor memory-like (CARML) NK cells and their production and usage | |
US20240226168A1 (en) | Engineered nk cells and uses thereof | |
US20210275547A1 (en) | Methods of Modulating Activity of a Cyclic Dinucleotide (CDN) with a CDN Transporter-Modulating Agent | |
JP2022023136A (en) | Methods of T cell expansion and activation | |
TW202214296A (en) | N ucleic acid lipid particle vaccine | |
WO2021141862A1 (en) | Methods of modulating sting pathway activation | |
JP2020515625A (en) | Compositions and methods for differential induction of cell death and interferon expression | |
CN110891603A (en) | Compositions and methods for treating enteroviral infections | |
WO2024204685A1 (en) | Pharmaceutical composition for treating and/or preventing cancer | |
WO2023172989A2 (en) | Epo receptor agonists and antagonists | |
AU2023232105A1 (en) | Epo receptor agonists and antagonists | |
Ausejo-Mauleón | TIM-3 blockade as a therapeutic approach for diffuse intrinsic pontine glioma | |
WO2024196937A1 (en) | Cancer therapy with il-2 peg conjugates |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 21738593 Country of ref document: EP Kind code of ref document: A1 |
|
NENP | Non-entry into the national phase |
Ref country code: DE |
|
122 | Ep: pct application non-entry in european phase |
Ref document number: 21738593 Country of ref document: EP Kind code of ref document: A1 |