US20050232919A1 - Monoclonal antibodies that specifically block biological activity of a tumor antigen - Google Patents
Monoclonal antibodies that specifically block biological activity of a tumor antigen Download PDFInfo
- Publication number
- US20050232919A1 US20050232919A1 US11/056,776 US5677605A US2005232919A1 US 20050232919 A1 US20050232919 A1 US 20050232919A1 US 5677605 A US5677605 A US 5677605A US 2005232919 A1 US2005232919 A1 US 2005232919A1
- Authority
- US
- United States
- Prior art keywords
- antibody
- cell
- acid sequence
- seq
- amino acid
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Abandoned
Links
- 206010028980 Neoplasm Diseases 0.000 title claims abstract description 72
- 230000004071 biological effect Effects 0.000 title claims abstract description 21
- 239000000427 antigen Substances 0.000 title description 33
- 108091007433 antigens Proteins 0.000 title description 33
- 102000036639 antigens Human genes 0.000 title description 33
- 210000004027 cell Anatomy 0.000 claims abstract description 312
- 102000010451 Folate receptor alpha Human genes 0.000 claims abstract description 204
- 108050001931 Folate receptor alpha Proteins 0.000 claims abstract description 204
- 238000000034 method Methods 0.000 claims abstract description 135
- 201000011510 cancer Diseases 0.000 claims abstract description 45
- 230000014509 gene expression Effects 0.000 claims abstract description 36
- 206010033128 Ovarian cancer Diseases 0.000 claims abstract description 30
- 206010061535 Ovarian neoplasm Diseases 0.000 claims abstract description 19
- 210000004072 lung Anatomy 0.000 claims abstract description 18
- 230000002611 ovarian Effects 0.000 claims abstract description 17
- 210000000481 breast Anatomy 0.000 claims abstract description 16
- 230000002357 endometrial effect Effects 0.000 claims abstract description 14
- 206010009944 Colon cancer Diseases 0.000 claims abstract description 13
- 206010006187 Breast cancer Diseases 0.000 claims abstract description 11
- 206010038389 Renal cancer Diseases 0.000 claims abstract description 11
- 208000003174 Brain Neoplasms Diseases 0.000 claims abstract description 10
- 208000026310 Breast neoplasm Diseases 0.000 claims abstract description 10
- 208000001333 Colorectal Neoplasms Diseases 0.000 claims abstract description 10
- 206010014733 Endometrial cancer Diseases 0.000 claims abstract description 10
- 206010014759 Endometrial neoplasm Diseases 0.000 claims abstract description 10
- 208000008839 Kidney Neoplasms Diseases 0.000 claims abstract description 10
- 206010058467 Lung neoplasm malignant Diseases 0.000 claims abstract description 9
- 201000010982 kidney cancer Diseases 0.000 claims abstract description 9
- 201000005202 lung cancer Diseases 0.000 claims abstract description 9
- 208000020816 lung neoplasm Diseases 0.000 claims abstract description 9
- 125000003275 alpha amino acid group Chemical group 0.000 claims description 74
- 108090000623 proteins and genes Proteins 0.000 claims description 70
- 241000282414 Homo sapiens Species 0.000 claims description 63
- 230000027455 binding Effects 0.000 claims description 58
- 150000007523 nucleic acids Chemical group 0.000 claims description 51
- 230000033607 mismatch repair Effects 0.000 claims description 38
- 108091033319 polynucleotide Proteins 0.000 claims description 28
- 102000040430 polynucleotide Human genes 0.000 claims description 28
- 239000002157 polynucleotide Substances 0.000 claims description 28
- 239000013598 vector Substances 0.000 claims description 24
- 239000008194 pharmaceutical composition Substances 0.000 claims description 23
- 239000000203 mixture Substances 0.000 claims description 22
- 210000000628 antibody-producing cell Anatomy 0.000 claims description 20
- 229940127089 cytotoxic agent Drugs 0.000 claims description 20
- 239000004052 folic acid antagonist Substances 0.000 claims description 19
- 108091028043 Nucleic acid sequence Proteins 0.000 claims description 17
- 230000003432 anti-folate effect Effects 0.000 claims description 17
- 229940127074 antifolate Drugs 0.000 claims description 17
- 230000010056 antibody-dependent cellular cytotoxicity Effects 0.000 claims description 16
- 150000001875 compounds Chemical class 0.000 claims description 15
- 239000002254 cytotoxic agent Substances 0.000 claims description 15
- 238000000338 in vitro Methods 0.000 claims description 14
- 231100000599 cytotoxic agent Toxicity 0.000 claims description 13
- 238000001727 in vivo Methods 0.000 claims description 10
- 238000012258 culturing Methods 0.000 claims description 9
- 230000002401 inhibitory effect Effects 0.000 claims description 9
- 201000009030 Carcinoma Diseases 0.000 claims description 8
- 210000004556 brain Anatomy 0.000 claims description 8
- 230000012010 growth Effects 0.000 claims description 7
- 230000002068 genetic effect Effects 0.000 claims description 5
- 239000003112 inhibitor Substances 0.000 claims description 3
- 239000012634 fragment Substances 0.000 abstract description 20
- 238000011282 treatment Methods 0.000 abstract description 19
- 229940014144 folate Drugs 0.000 abstract description 9
- 239000011724 folic acid Substances 0.000 abstract description 9
- 102000005962 receptors Human genes 0.000 abstract description 6
- 108020003175 receptors Proteins 0.000 abstract description 6
- 108010021625 Immunoglobulin Fragments Proteins 0.000 abstract description 5
- 102000008394 Immunoglobulin Fragments Human genes 0.000 abstract description 5
- 235000018102 proteins Nutrition 0.000 description 39
- 102000004169 proteins and genes Human genes 0.000 description 39
- 102000039446 nucleic acids Human genes 0.000 description 35
- 108020004707 nucleic acids Proteins 0.000 description 35
- 210000001519 tissue Anatomy 0.000 description 34
- 108700028369 Alleles Proteins 0.000 description 27
- 210000004379 membrane Anatomy 0.000 description 27
- 239000012528 membrane Substances 0.000 description 27
- 241001465754 Metazoa Species 0.000 description 25
- 210000004881 tumor cell Anatomy 0.000 description 20
- 238000003556 assay Methods 0.000 description 18
- 210000004408 hybridoma Anatomy 0.000 description 18
- 239000002953 phosphate buffered saline Substances 0.000 description 18
- 238000002965 ELISA Methods 0.000 description 17
- 230000000694 effects Effects 0.000 description 17
- 241000699666 Mus <mouse, genus> Species 0.000 description 16
- 206010035226 Plasma cell myeloma Diseases 0.000 description 16
- 238000010790 dilution Methods 0.000 description 16
- 239000012895 dilution Substances 0.000 description 16
- 201000000050 myeloid neoplasm Diseases 0.000 description 16
- 108020004414 DNA Proteins 0.000 description 15
- 108700005091 Immunoglobulin Genes Proteins 0.000 description 15
- 229940024606 amino acid Drugs 0.000 description 14
- 150000001413 amino acids Chemical class 0.000 description 14
- 239000002609 medium Substances 0.000 description 14
- 230000035772 mutation Effects 0.000 description 14
- 238000002360 preparation method Methods 0.000 description 14
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 13
- 108060003951 Immunoglobulin Proteins 0.000 description 13
- 102000018358 immunoglobulin Human genes 0.000 description 13
- 239000000047 product Substances 0.000 description 13
- 108010047041 Complementarity Determining Regions Proteins 0.000 description 12
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 12
- 239000000499 gel Substances 0.000 description 12
- 241000588724 Escherichia coli Species 0.000 description 11
- 210000003819 peripheral blood mononuclear cell Anatomy 0.000 description 11
- 108090000765 processed proteins & peptides Proteins 0.000 description 11
- 230000009257 reactivity Effects 0.000 description 11
- 230000004614 tumor growth Effects 0.000 description 11
- 210000003292 kidney cell Anatomy 0.000 description 10
- 102000004196 processed proteins & peptides Human genes 0.000 description 10
- 239000000243 solution Substances 0.000 description 10
- 238000001890 transfection Methods 0.000 description 10
- 229920002684 Sepharose Polymers 0.000 description 9
- 238000002347 injection Methods 0.000 description 9
- 239000007924 injection Substances 0.000 description 9
- 229920001184 polypeptide Polymers 0.000 description 9
- 241000894007 species Species 0.000 description 9
- 241001529936 Murinae Species 0.000 description 8
- 108010029485 Protein Isoforms Proteins 0.000 description 8
- 102000001708 Protein Isoforms Human genes 0.000 description 8
- 230000002159 abnormal effect Effects 0.000 description 8
- 239000002671 adjuvant Substances 0.000 description 8
- 239000013604 expression vector Substances 0.000 description 8
- 230000005764 inhibitory process Effects 0.000 description 8
- 210000004962 mammalian cell Anatomy 0.000 description 8
- 101150061338 mmr gene Proteins 0.000 description 8
- 241000282412 Homo Species 0.000 description 7
- 241000124008 Mammalia Species 0.000 description 7
- 239000000872 buffer Substances 0.000 description 7
- 239000003795 chemical substances by application Substances 0.000 description 7
- 230000002950 deficient Effects 0.000 description 7
- 239000003814 drug Substances 0.000 description 7
- 230000003053 immunization Effects 0.000 description 7
- 230000001939 inductive effect Effects 0.000 description 7
- -1 inositol phospholipids Chemical class 0.000 description 7
- 238000004519 manufacturing process Methods 0.000 description 7
- 239000013642 negative control Substances 0.000 description 7
- 239000002773 nucleotide Substances 0.000 description 7
- 125000003729 nucleotide group Chemical group 0.000 description 7
- 239000013612 plasmid Substances 0.000 description 7
- 238000012216 screening Methods 0.000 description 7
- 210000004988 splenocyte Anatomy 0.000 description 7
- 238000001262 western blot Methods 0.000 description 7
- HFEKDTCAMMOLQP-RRKCRQDMSA-N 5-fluorodeoxyuridine monophosphate Chemical compound O1[C@H](COP(O)(O)=O)[C@@H](O)C[C@@H]1N1C(=O)NC(=O)C(F)=C1 HFEKDTCAMMOLQP-RRKCRQDMSA-N 0.000 description 6
- CSCPPACGZOOCGX-UHFFFAOYSA-N Acetone Chemical compound CC(C)=O CSCPPACGZOOCGX-UHFFFAOYSA-N 0.000 description 6
- GHASVSINZRGABV-UHFFFAOYSA-N Fluorouracil Chemical compound FC1=CNC(=O)NC1=O GHASVSINZRGABV-UHFFFAOYSA-N 0.000 description 6
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 6
- 235000014680 Saccharomyces cerevisiae Nutrition 0.000 description 6
- 230000001594 aberrant effect Effects 0.000 description 6
- 238000001042 affinity chromatography Methods 0.000 description 6
- 230000000295 complement effect Effects 0.000 description 6
- 239000003636 conditioned culture medium Substances 0.000 description 6
- 230000003247 decreasing effect Effects 0.000 description 6
- 229940079593 drug Drugs 0.000 description 6
- 239000012636 effector Substances 0.000 description 6
- 229960002949 fluorouracil Drugs 0.000 description 6
- 235000019152 folic acid Nutrition 0.000 description 6
- 230000004927 fusion Effects 0.000 description 6
- 239000001963 growth medium Substances 0.000 description 6
- 230000001404 mediated effect Effects 0.000 description 6
- 239000000523 sample Substances 0.000 description 6
- 239000011780 sodium chloride Substances 0.000 description 6
- 238000010186 staining Methods 0.000 description 6
- LWIHDJKSTIGBAC-UHFFFAOYSA-K tripotassium phosphate Chemical compound [K+].[K+].[K+].[O-]P([O-])([O-])=O LWIHDJKSTIGBAC-UHFFFAOYSA-K 0.000 description 6
- 241000283707 Capra Species 0.000 description 5
- 102000053602 DNA Human genes 0.000 description 5
- 229920002307 Dextran Polymers 0.000 description 5
- 108010001336 Horseradish Peroxidase Proteins 0.000 description 5
- 241000701044 Human gammaherpesvirus 4 Species 0.000 description 5
- 241000283984 Rodentia Species 0.000 description 5
- 239000002246 antineoplastic agent Substances 0.000 description 5
- 230000000903 blocking effect Effects 0.000 description 5
- 239000003153 chemical reaction reagent Substances 0.000 description 5
- 239000002299 complementary DNA Substances 0.000 description 5
- 239000012228 culture supernatant Substances 0.000 description 5
- 230000009089 cytolysis Effects 0.000 description 5
- 238000012217 deletion Methods 0.000 description 5
- 230000037430 deletion Effects 0.000 description 5
- LOKCTEFSRHRXRJ-UHFFFAOYSA-I dipotassium trisodium dihydrogen phosphate hydrogen phosphate dichloride Chemical compound P(=O)(O)(O)[O-].[K+].P(=O)(O)([O-])[O-].[Na+].[Na+].[Cl-].[K+].[Cl-].[Na+] LOKCTEFSRHRXRJ-UHFFFAOYSA-I 0.000 description 5
- 238000010494 dissociation reaction Methods 0.000 description 5
- 230000005593 dissociations Effects 0.000 description 5
- 238000005516 engineering process Methods 0.000 description 5
- 210000000981 epithelium Anatomy 0.000 description 5
- 238000002474 experimental method Methods 0.000 description 5
- 210000002950 fibroblast Anatomy 0.000 description 5
- 102000006815 folate receptor Human genes 0.000 description 5
- 108020005243 folate receptor Proteins 0.000 description 5
- OVBPIULPVIDEAO-LBPRGKRZSA-N folic acid Chemical compound C=1N=C2NC(N)=NC(=O)C2=NC=1CNC1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 OVBPIULPVIDEAO-LBPRGKRZSA-N 0.000 description 5
- VVIAGPKUTFNRDU-ABLWVSNPSA-N folinic acid Chemical compound C1NC=2NC(N)=NC(=O)C=2N(C=O)C1CNC1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 VVIAGPKUTFNRDU-ABLWVSNPSA-N 0.000 description 5
- 238000002649 immunization Methods 0.000 description 5
- 230000016784 immunoglobulin production Effects 0.000 description 5
- 230000002441 reversible effect Effects 0.000 description 5
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 5
- 238000012360 testing method Methods 0.000 description 5
- 230000001225 therapeutic effect Effects 0.000 description 5
- 230000009261 transgenic effect Effects 0.000 description 5
- 238000005406 washing Methods 0.000 description 5
- VVIAGPKUTFNRDU-UHFFFAOYSA-N 6S-folinic acid Natural products C1NC=2NC(N)=NC(=O)C=2N(C=O)C1CNC1=CC=C(C(=O)NC(CCC(O)=O)C(O)=O)C=C1 VVIAGPKUTFNRDU-UHFFFAOYSA-N 0.000 description 4
- 241000894006 Bacteria Species 0.000 description 4
- AOJJSUZBOXZQNB-TZSSRYMLSA-N Doxorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 AOJJSUZBOXZQNB-TZSSRYMLSA-N 0.000 description 4
- 241000196324 Embryophyta Species 0.000 description 4
- 102000004190 Enzymes Human genes 0.000 description 4
- 108090000790 Enzymes Proteins 0.000 description 4
- 101710088172 HTH-type transcriptional regulator RipA Proteins 0.000 description 4
- 101000738901 Homo sapiens PMS1 protein homolog 1 Proteins 0.000 description 4
- ZDXPYRJPNDTMRX-VKHMYHEASA-N L-glutamine Chemical compound OC(=O)[C@@H](N)CCC(N)=O ZDXPYRJPNDTMRX-VKHMYHEASA-N 0.000 description 4
- 229930182816 L-glutamine Natural products 0.000 description 4
- 238000010240 RT-PCR analysis Methods 0.000 description 4
- 108020004511 Recombinant DNA Proteins 0.000 description 4
- 239000013504 Triton X-100 Substances 0.000 description 4
- 229920004890 Triton X-100 Polymers 0.000 description 4
- 125000000539 amino acid group Chemical group 0.000 description 4
- 238000011091 antibody purification Methods 0.000 description 4
- 210000003719 b-lymphocyte Anatomy 0.000 description 4
- 230000008901 benefit Effects 0.000 description 4
- 238000006243 chemical reaction Methods 0.000 description 4
- 230000000973 chemotherapeutic effect Effects 0.000 description 4
- 210000004978 chinese hamster ovary cell Anatomy 0.000 description 4
- 238000010367 cloning Methods 0.000 description 4
- 230000003013 cytotoxicity Effects 0.000 description 4
- 231100000135 cytotoxicity Toxicity 0.000 description 4
- 238000011161 development Methods 0.000 description 4
- 230000018109 developmental process Effects 0.000 description 4
- 239000000539 dimer Substances 0.000 description 4
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 4
- 239000003937 drug carrier Substances 0.000 description 4
- 210000003527 eukaryotic cell Anatomy 0.000 description 4
- 239000000284 extract Substances 0.000 description 4
- 235000008191 folinic acid Nutrition 0.000 description 4
- 239000011672 folinic acid Substances 0.000 description 4
- 230000002163 immunogen Effects 0.000 description 4
- 210000003734 kidney Anatomy 0.000 description 4
- 229960001691 leucovorin Drugs 0.000 description 4
- 210000005229 liver cell Anatomy 0.000 description 4
- 239000000178 monomer Substances 0.000 description 4
- 230000001613 neoplastic effect Effects 0.000 description 4
- XHWRWCSCBDLOLM-UHFFFAOYSA-N nolatrexed Chemical compound CC1=CC=C2NC(N)=NC(=O)C2=C1SC1=CC=NC=C1 XHWRWCSCBDLOLM-UHFFFAOYSA-N 0.000 description 4
- 210000003101 oviduct Anatomy 0.000 description 4
- 239000013641 positive control Substances 0.000 description 4
- 230000008569 process Effects 0.000 description 4
- 238000000746 purification Methods 0.000 description 4
- 238000010814 radioimmunoprecipitation assay Methods 0.000 description 4
- 239000011347 resin Substances 0.000 description 4
- 229920005989 resin Polymers 0.000 description 4
- 230000004044 response Effects 0.000 description 4
- 230000002269 spontaneous effect Effects 0.000 description 4
- 238000006467 substitution reaction Methods 0.000 description 4
- 238000013519 translation Methods 0.000 description 4
- IOOMXAQUNPWDLL-UHFFFAOYSA-N 2-[6-(diethylamino)-3-(diethyliminiumyl)-3h-xanthen-9-yl]-5-sulfobenzene-1-sulfonate Chemical compound C=12C=CC(=[N+](CC)CC)C=C2OC2=CC(N(CC)CC)=CC=C2C=1C1=CC=C(S(O)(=O)=O)C=C1S([O-])(=O)=O IOOMXAQUNPWDLL-UHFFFAOYSA-N 0.000 description 3
- 241000238631 Hexapoda Species 0.000 description 3
- 101001134036 Homo sapiens DNA mismatch repair protein Msh2 Proteins 0.000 description 3
- 108010074346 Mismatch Repair Endonuclease PMS2 Proteins 0.000 description 3
- 102000008071 Mismatch Repair Endonuclease PMS2 Human genes 0.000 description 3
- 102100037482 PMS1 protein homolog 1 Human genes 0.000 description 3
- 239000002033 PVDF binder Substances 0.000 description 3
- 102000002508 Peptide Elongation Factors Human genes 0.000 description 3
- 108010068204 Peptide Elongation Factors Proteins 0.000 description 3
- 102000003992 Peroxidases Human genes 0.000 description 3
- 239000012980 RPMI-1640 medium Substances 0.000 description 3
- 101001039269 Rattus norvegicus Glycine N-methyltransferase Proteins 0.000 description 3
- HEMHJVSKTPXQMS-UHFFFAOYSA-M Sodium hydroxide Chemical compound [OH-].[Na+] HEMHJVSKTPXQMS-UHFFFAOYSA-M 0.000 description 3
- 241000700605 Viruses Species 0.000 description 3
- 108010084455 Zeocin Proteins 0.000 description 3
- 238000007792 addition Methods 0.000 description 3
- 239000012491 analyte Substances 0.000 description 3
- 238000004458 analytical method Methods 0.000 description 3
- 238000013459 approach Methods 0.000 description 3
- 239000012472 biological sample Substances 0.000 description 3
- 230000015572 biosynthetic process Effects 0.000 description 3
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 description 3
- 238000005277 cation exchange chromatography Methods 0.000 description 3
- 238000012512 characterization method Methods 0.000 description 3
- 239000013000 chemical inhibitor Substances 0.000 description 3
- 238000012790 confirmation Methods 0.000 description 3
- 210000000805 cytoplasm Anatomy 0.000 description 3
- 201000010099 disease Diseases 0.000 description 3
- 238000011156 evaluation Methods 0.000 description 3
- 238000001914 filtration Methods 0.000 description 3
- 230000001900 immune effect Effects 0.000 description 3
- 239000012642 immune effector Substances 0.000 description 3
- 229940121354 immunomodulator Drugs 0.000 description 3
- 238000011534 incubation Methods 0.000 description 3
- 238000001802 infusion Methods 0.000 description 3
- 230000002147 killing effect Effects 0.000 description 3
- 239000003446 ligand Substances 0.000 description 3
- 230000000670 limiting effect Effects 0.000 description 3
- 239000006166 lysate Substances 0.000 description 3
- 239000000463 material Substances 0.000 description 3
- 238000005259 measurement Methods 0.000 description 3
- 235000013336 milk Nutrition 0.000 description 3
- 239000008267 milk Substances 0.000 description 3
- 210000004080 milk Anatomy 0.000 description 3
- 229920001542 oligosaccharide Polymers 0.000 description 3
- 150000002482 oligosaccharides Chemical class 0.000 description 3
- 238000011275 oncology therapy Methods 0.000 description 3
- 210000001672 ovary Anatomy 0.000 description 3
- WBXPDJSOTKVWSJ-ZDUSSCGKSA-N pemetrexed Chemical compound C=1NC=2NC(N)=NC(=O)C=2C=1CCC1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 WBXPDJSOTKVWSJ-ZDUSSCGKSA-N 0.000 description 3
- 108040007629 peroxidase activity proteins Proteins 0.000 description 3
- CWCMIVBLVUHDHK-ZSNHEYEWSA-N phleomycin D1 Chemical compound N([C@H](C(=O)N[C@H](C)[C@@H](O)[C@H](C)C(=O)N[C@@H]([C@H](O)C)C(=O)NCCC=1SC[C@@H](N=1)C=1SC=C(N=1)C(=O)NCCCCNC(N)=N)[C@@H](O[C@H]1[C@H]([C@@H](O)[C@H](O)[C@H](CO)O1)O[C@@H]1[C@H]([C@@H](OC(N)=O)[C@H](O)[C@@H](CO)O1)O)C=1N=CNC=1)C(=O)C1=NC([C@H](CC(N)=O)NC[C@H](N)C(N)=O)=NC(N)=C1C CWCMIVBLVUHDHK-ZSNHEYEWSA-N 0.000 description 3
- 230000008488 polyadenylation Effects 0.000 description 3
- 229920001223 polyethylene glycol Polymers 0.000 description 3
- 229920002981 polyvinylidene fluoride Polymers 0.000 description 3
- 229910000160 potassium phosphate Inorganic materials 0.000 description 3
- 235000011009 potassium phosphates Nutrition 0.000 description 3
- 230000001105 regulatory effect Effects 0.000 description 3
- 239000012679 serum free medium Substances 0.000 description 3
- 238000001542 size-exclusion chromatography Methods 0.000 description 3
- 239000000758 substrate Substances 0.000 description 3
- 239000006228 supernatant Substances 0.000 description 3
- 238000002198 surface plasmon resonance spectroscopy Methods 0.000 description 3
- 239000003053 toxin Substances 0.000 description 3
- 231100000765 toxin Toxicity 0.000 description 3
- 108700012359 toxins Proteins 0.000 description 3
- YBJHBAHKTGYVGT-ZKWXMUAHSA-N (+)-Biotin Chemical group N1C(=O)N[C@@H]2[C@H](CCCCC(=O)O)SC[C@@H]21 YBJHBAHKTGYVGT-ZKWXMUAHSA-N 0.000 description 2
- QAPSNMNOIOSXSQ-YNEHKIRRSA-N 1-[(2r,4s,5r)-4-[tert-butyl(dimethyl)silyl]oxy-5-(hydroxymethyl)oxolan-2-yl]-5-methylpyrimidine-2,4-dione Chemical compound O=C1NC(=O)C(C)=CN1[C@@H]1O[C@H](CO)[C@@H](O[Si](C)(C)C(C)(C)C)C1 QAPSNMNOIOSXSQ-YNEHKIRRSA-N 0.000 description 2
- PNDPGZBMCMUPRI-HVTJNCQCSA-N 10043-66-0 Chemical compound [131I][131I] PNDPGZBMCMUPRI-HVTJNCQCSA-N 0.000 description 2
- WUAPFZMCVAUBPE-NJFSPNSNSA-N 188Re Chemical compound [188Re] WUAPFZMCVAUBPE-NJFSPNSNSA-N 0.000 description 2
- HZAXFHJVJLSVMW-UHFFFAOYSA-N 2-Aminoethan-1-ol Chemical compound NCCO HZAXFHJVJLSVMW-UHFFFAOYSA-N 0.000 description 2
- FPQQSJJWHUJYPU-UHFFFAOYSA-N 3-(dimethylamino)propyliminomethylidene-ethylazanium;chloride Chemical compound Cl.CCN=C=NCCCN(C)C FPQQSJJWHUJYPU-UHFFFAOYSA-N 0.000 description 2
- 229920001817 Agar Polymers 0.000 description 2
- 206010003445 Ascites Diseases 0.000 description 2
- IJGRMHOSHXDMSA-UHFFFAOYSA-N Atomic nitrogen Chemical compound N#N IJGRMHOSHXDMSA-UHFFFAOYSA-N 0.000 description 2
- ZOXJGFHDIHLPTG-BJUDXGSMSA-N Boron-10 Chemical compound [10B] ZOXJGFHDIHLPTG-BJUDXGSMSA-N 0.000 description 2
- WKBOTKDWSSQWDR-OIOBTWANSA-N Bromine-77 Chemical compound [77Br] WKBOTKDWSSQWDR-OIOBTWANSA-N 0.000 description 2
- CURLTUGMZLYLDI-UHFFFAOYSA-N Carbon dioxide Chemical compound O=C=O CURLTUGMZLYLDI-UHFFFAOYSA-N 0.000 description 2
- 241000282693 Cercopithecidae Species 0.000 description 2
- 241000282552 Chlorocebus aethiops Species 0.000 description 2
- 208000006332 Choriocarcinoma Diseases 0.000 description 2
- 108091026890 Coding region Proteins 0.000 description 2
- 241000699800 Cricetinae Species 0.000 description 2
- 241000699802 Cricetulus griseus Species 0.000 description 2
- 102100034157 DNA mismatch repair protein Msh2 Human genes 0.000 description 2
- 230000004543 DNA replication Effects 0.000 description 2
- 101710146739 Enterotoxin Proteins 0.000 description 2
- 241000282326 Felis catus Species 0.000 description 2
- 102000010449 Folate receptor beta Human genes 0.000 description 2
- 108050001930 Folate receptor beta Proteins 0.000 description 2
- WSFSSNUMVMOOMR-UHFFFAOYSA-N Formaldehyde Chemical compound O=C WSFSSNUMVMOOMR-UHFFFAOYSA-N 0.000 description 2
- WZUVPPKBWHMQCE-UHFFFAOYSA-N Haematoxylin Chemical compound C12=CC(O)=C(O)C=C2CC2(O)C1C1=CC=C(O)C(O)=C1OC2 WZUVPPKBWHMQCE-UHFFFAOYSA-N 0.000 description 2
- NTYJJOPFIAHURM-UHFFFAOYSA-N Histamine Chemical compound NCCC1=CN=CN1 NTYJJOPFIAHURM-UHFFFAOYSA-N 0.000 description 2
- 101000738911 Homo sapiens Mismatch repair endonuclease PMS2 Proteins 0.000 description 2
- 108010054477 Immunoglobulin Fab Fragments Proteins 0.000 description 2
- 102000001706 Immunoglobulin Fab Fragments Human genes 0.000 description 2
- 102000006496 Immunoglobulin Heavy Chains Human genes 0.000 description 2
- 108010019476 Immunoglobulin Heavy Chains Proteins 0.000 description 2
- 102000013463 Immunoglobulin Light Chains Human genes 0.000 description 2
- 108010065825 Immunoglobulin Light Chains Proteins 0.000 description 2
- ZCYVEMRRCGMTRW-AHCXROLUSA-N Iodine-123 Chemical compound [123I] ZCYVEMRRCGMTRW-AHCXROLUSA-N 0.000 description 2
- 229910015837 MSH2 Inorganic materials 0.000 description 2
- 241000282567 Macaca fascicularis Species 0.000 description 2
- 241000699670 Mus sp. Species 0.000 description 2
- 108010026664 MutL Protein Homolog 1 Proteins 0.000 description 2
- 102000013609 MutL Protein Homolog 1 Human genes 0.000 description 2
- 229910019142 PO4 Inorganic materials 0.000 description 2
- 239000002202 Polyethylene glycol Substances 0.000 description 2
- 241000288906 Primates Species 0.000 description 2
- 241000589516 Pseudomonas Species 0.000 description 2
- 239000012083 RIPA buffer Substances 0.000 description 2
- 241000700157 Rattus norvegicus Species 0.000 description 2
- 208000006265 Renal cell carcinoma Diseases 0.000 description 2
- 108010039491 Ricin Proteins 0.000 description 2
- 241000235347 Schizosaccharomyces pombe Species 0.000 description 2
- PXIPVTKHYLBLMZ-UHFFFAOYSA-N Sodium azide Chemical compound [Na+].[N-]=[N+]=[N-] PXIPVTKHYLBLMZ-UHFFFAOYSA-N 0.000 description 2
- UIIMBOGNXHQVGW-UHFFFAOYSA-M Sodium bicarbonate Chemical compound [Na+].OC([O-])=O UIIMBOGNXHQVGW-UHFFFAOYSA-M 0.000 description 2
- 241000256251 Spodoptera frugiperda Species 0.000 description 2
- IQFYYKKMVGJFEH-XLPZGREQSA-N Thymidine Chemical compound O=C1NC(=O)C(C)=CN1[C@@H]1O[C@H](CO)[C@@H](O)C1 IQFYYKKMVGJFEH-XLPZGREQSA-N 0.000 description 2
- VWQVUPCCIRVNHF-OUBTZVSYSA-N Yttrium-90 Chemical compound [90Y] VWQVUPCCIRVNHF-OUBTZVSYSA-N 0.000 description 2
- 229910052768 actinide Inorganic materials 0.000 description 2
- 150000001255 actinides Chemical class 0.000 description 2
- 229940009456 adriamycin Drugs 0.000 description 2
- 239000008272 agar Substances 0.000 description 2
- 238000005349 anion exchange Methods 0.000 description 2
- 238000005571 anion exchange chromatography Methods 0.000 description 2
- 238000009175 antibody therapy Methods 0.000 description 2
- 210000004507 artificial chromosome Anatomy 0.000 description 2
- RYXHOMYVWAEKHL-OUBTZVSYSA-N astatine-211 Chemical compound [211At] RYXHOMYVWAEKHL-OUBTZVSYSA-N 0.000 description 2
- OWMVSZAMULFTJU-UHFFFAOYSA-N bis-tris Chemical compound OCCN(CCO)C(CO)(CO)CO OWMVSZAMULFTJU-UHFFFAOYSA-N 0.000 description 2
- JCXGWMGPZLAOME-AKLPVKDBSA-N bismuth-212 Chemical compound [212Bi] JCXGWMGPZLAOME-AKLPVKDBSA-N 0.000 description 2
- 229930189065 blasticidin Natural products 0.000 description 2
- 230000037396 body weight Effects 0.000 description 2
- HXCHCVDVKSCDHU-LULTVBGHSA-N calicheamicin Chemical compound C1[C@H](OC)[C@@H](NCC)CO[C@H]1O[C@H]1[C@H](O[C@@H]2C\3=C(NC(=O)OC)C(=O)C[C@](C/3=C/CSSSC)(O)C#C\C=C/C#C2)O[C@H](C)[C@@H](NO[C@@H]2O[C@H](C)[C@@H](SC(=O)C=3C(=C(OC)C(O[C@H]4[C@@H]([C@H](OC)[C@@H](O)[C@H](C)O4)O)=C(I)C=3C)OC)[C@@H](O)C2)[C@@H]1O HXCHCVDVKSCDHU-LULTVBGHSA-N 0.000 description 2
- 229930195731 calicheamicin Natural products 0.000 description 2
- 230000005907 cancer growth Effects 0.000 description 2
- 230000001413 cellular effect Effects 0.000 description 2
- 208000019065 cervical carcinoma Diseases 0.000 description 2
- 238000004587 chromatography analysis Methods 0.000 description 2
- 208000029742 colonic neoplasm Diseases 0.000 description 2
- 230000008878 coupling Effects 0.000 description 2
- 238000010168 coupling process Methods 0.000 description 2
- 238000005859 coupling reaction Methods 0.000 description 2
- 238000009826 distribution Methods 0.000 description 2
- 238000010828 elution Methods 0.000 description 2
- 230000002708 enhancing effect Effects 0.000 description 2
- 239000000147 enterotoxin Substances 0.000 description 2
- 231100000655 enterotoxin Toxicity 0.000 description 2
- 239000012530 fluid Substances 0.000 description 2
- 238000002523 gelfiltration Methods 0.000 description 2
- PCHJSUWPFVWCPO-UHFFFAOYSA-N gold Chemical compound [Au] PCHJSUWPFVWCPO-UHFFFAOYSA-N 0.000 description 2
- 239000010931 gold Substances 0.000 description 2
- 229910052737 gold Inorganic materials 0.000 description 2
- 239000000017 hydrogel Substances 0.000 description 2
- FDGQSTZJBFJUBT-UHFFFAOYSA-N hypoxanthine Chemical compound O=C1NC=NC2=C1NC=N2 FDGQSTZJBFJUBT-UHFFFAOYSA-N 0.000 description 2
- 238000003364 immunohistochemistry Methods 0.000 description 2
- 229940055742 indium-111 Drugs 0.000 description 2
- APFVFJFRJDLVQX-AHCXROLUSA-N indium-111 Chemical compound [111In] APFVFJFRJDLVQX-AHCXROLUSA-N 0.000 description 2
- 208000015181 infectious disease Diseases 0.000 description 2
- 230000003993 interaction Effects 0.000 description 2
- XMBWDFGMSWQBCA-YPZZEJLDSA-N iodane Chemical compound [125IH] XMBWDFGMSWQBCA-YPZZEJLDSA-N 0.000 description 2
- 229940044173 iodine-125 Drugs 0.000 description 2
- 238000002955 isolation Methods 0.000 description 2
- WABPQHHGFIMREM-BKFZFHPZSA-N lead-212 Chemical compound [212Pb] WABPQHHGFIMREM-BKFZFHPZSA-N 0.000 description 2
- 210000005265 lung cell Anatomy 0.000 description 2
- 239000000693 micelle Substances 0.000 description 2
- 229940126619 mouse monoclonal antibody Drugs 0.000 description 2
- 231100000350 mutagenesis Toxicity 0.000 description 2
- 210000003098 myoblast Anatomy 0.000 description 2
- 230000017066 negative regulation of growth Effects 0.000 description 2
- 231100001221 nontumorigenic Toxicity 0.000 description 2
- 238000010899 nucleation Methods 0.000 description 2
- 239000003921 oil Substances 0.000 description 2
- 230000003287 optical effect Effects 0.000 description 2
- 210000000496 pancreas Anatomy 0.000 description 2
- 210000003200 peritoneal cavity Anatomy 0.000 description 2
- 125000001997 phenyl group Chemical group [H]C1=C([H])C([H])=C(*)C([H])=C1[H] 0.000 description 2
- NBIIXXVUZAFLBC-UHFFFAOYSA-K phosphate Chemical compound [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 description 2
- 239000010452 phosphate Substances 0.000 description 2
- 229920000642 polymer Polymers 0.000 description 2
- 230000035755 proliferation Effects 0.000 description 2
- 230000002285 radioactive effect Effects 0.000 description 2
- 230000007115 recruitment Effects 0.000 description 2
- 230000009467 reduction Effects 0.000 description 2
- 201000010174 renal carcinoma Diseases 0.000 description 2
- 230000010076 replication Effects 0.000 description 2
- WUAPFZMCVAUBPE-IGMARMGPSA-N rhenium-186 Chemical compound [186Re] WUAPFZMCVAUBPE-IGMARMGPSA-N 0.000 description 2
- 239000012146 running buffer Substances 0.000 description 2
- 150000003839 salts Chemical class 0.000 description 2
- 239000012723 sample buffer Substances 0.000 description 2
- SIXSYDAISGFNSX-NJFSPNSNSA-N scandium-47 Chemical compound [47Sc] SIXSYDAISGFNSX-NJFSPNSNSA-N 0.000 description 2
- 238000007423 screening assay Methods 0.000 description 2
- 230000028327 secretion Effects 0.000 description 2
- 238000002864 sequence alignment Methods 0.000 description 2
- 238000012163 sequencing technique Methods 0.000 description 2
- 210000000717 sertoli cell Anatomy 0.000 description 2
- 210000002966 serum Anatomy 0.000 description 2
- 238000002741 site-directed mutagenesis Methods 0.000 description 2
- DAEPDZWVDSPTHF-UHFFFAOYSA-M sodium pyruvate Chemical compound [Na+].CC(=O)C([O-])=O DAEPDZWVDSPTHF-UHFFFAOYSA-M 0.000 description 2
- 239000003381 stabilizer Substances 0.000 description 2
- 150000003431 steroids Chemical class 0.000 description 2
- UCSJYZPVAKXKNQ-HZYVHMACSA-N streptomycin Chemical compound CN[C@H]1[C@H](O)[C@@H](O)[C@H](CO)O[C@H]1O[C@@H]1[C@](C=O)(O)[C@H](C)O[C@H]1O[C@@H]1[C@@H](NC(N)=N)[C@H](O)[C@@H](NC(N)=N)[C@H](O)[C@H]1O UCSJYZPVAKXKNQ-HZYVHMACSA-N 0.000 description 2
- 239000000126 substance Substances 0.000 description 2
- 239000000725 suspension Substances 0.000 description 2
- 208000024891 symptom Diseases 0.000 description 2
- YNJBWRMUSHSURL-UHFFFAOYSA-N trichloroacetic acid Chemical compound OC(=O)C(Cl)(Cl)Cl YNJBWRMUSHSURL-UHFFFAOYSA-N 0.000 description 2
- 230000004565 tumor cell growth Effects 0.000 description 2
- 238000013060 ultrafiltration and diafiltration Methods 0.000 description 2
- 239000003981 vehicle Substances 0.000 description 2
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 2
- 210000005253 yeast cell Anatomy 0.000 description 2
- ASWBNKHCZGQVJV-UHFFFAOYSA-N (3-hexadecanoyloxy-2-hydroxypropyl) 2-(trimethylazaniumyl)ethyl phosphate Chemical compound CCCCCCCCCCCCCCCC(=O)OCC(O)COP([O-])(=O)OCC[N+](C)(C)C ASWBNKHCZGQVJV-UHFFFAOYSA-N 0.000 description 1
- OOIBFPKQHULHSQ-UHFFFAOYSA-N (3-hydroxy-1-adamantyl) 2-methylprop-2-enoate Chemical compound C1C(C2)CC3CC2(O)CC1(OC(=O)C(=C)C)C3 OOIBFPKQHULHSQ-UHFFFAOYSA-N 0.000 description 1
- 102000040650 (ribonucleotides)n+m Human genes 0.000 description 1
- QWENRTYMTSOGBR-UHFFFAOYSA-N 1H-1,2,3-Triazole Chemical compound C=1C=NNN=1 QWENRTYMTSOGBR-UHFFFAOYSA-N 0.000 description 1
- UFBJCMHMOXMLKC-UHFFFAOYSA-N 2,4-dinitrophenol Chemical compound OC1=CC=C([N+]([O-])=O)C=C1[N+]([O-])=O UFBJCMHMOXMLKC-UHFFFAOYSA-N 0.000 description 1
- PJKVJJYMWOCLIJ-UHFFFAOYSA-N 2-amino-6-methyl-5-pyridin-4-ylsulfanyl-1h-quinazolin-4-one;hydron;dichloride Chemical compound Cl.Cl.CC1=CC=C2NC(N)=NC(=O)C2=C1SC1=CC=NC=C1 PJKVJJYMWOCLIJ-UHFFFAOYSA-N 0.000 description 1
- IVLXQGJVBGMLRR-UHFFFAOYSA-N 2-aminoacetic acid;hydron;chloride Chemical compound Cl.NCC(O)=O IVLXQGJVBGMLRR-UHFFFAOYSA-N 0.000 description 1
- NKDFYOWSKOHCCO-YPVLXUMRSA-N 20-hydroxyecdysone Chemical compound C1[C@@H](O)[C@@H](O)C[C@]2(C)[C@@H](CC[C@@]3([C@@H]([C@@](C)(O)[C@H](O)CCC(C)(O)C)CC[C@]33O)C)C3=CC(=O)[C@@H]21 NKDFYOWSKOHCCO-YPVLXUMRSA-N 0.000 description 1
- UMCMPZBLKLEWAF-BCTGSCMUSA-N 3-[(3-cholamidopropyl)dimethylammonio]propane-1-sulfonate Chemical compound C([C@H]1C[C@H]2O)[C@H](O)CC[C@]1(C)[C@@H]1[C@@H]2[C@@H]2CC[C@H]([C@@H](CCC(=O)NCCC[N+](C)(C)CCCS([O-])(=O)=O)C)[C@@]2(C)[C@@H](O)C1 UMCMPZBLKLEWAF-BCTGSCMUSA-N 0.000 description 1
- QFVHZQCOUORWEI-UHFFFAOYSA-N 4-[(4-anilino-5-sulfonaphthalen-1-yl)diazenyl]-5-hydroxynaphthalene-2,7-disulfonic acid Chemical compound C=12C(O)=CC(S(O)(=O)=O)=CC2=CC(S(O)(=O)=O)=CC=1N=NC(C1=CC=CC(=C11)S(O)(=O)=O)=CC=C1NC1=CC=CC=C1 QFVHZQCOUORWEI-UHFFFAOYSA-N 0.000 description 1
- TVZGACDUOSZQKY-LBPRGKRZSA-N 4-aminofolic acid Chemical compound C1=NC2=NC(N)=NC(N)=C2N=C1CNC1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 TVZGACDUOSZQKY-LBPRGKRZSA-N 0.000 description 1
- UZOVYGYOLBIAJR-UHFFFAOYSA-N 4-isocyanato-4'-methyldiphenylmethane Chemical compound C1=CC(C)=CC=C1CC1=CC=C(N=C=O)C=C1 UZOVYGYOLBIAJR-UHFFFAOYSA-N 0.000 description 1
- 229920000936 Agarose Polymers 0.000 description 1
- 229920000856 Amylose Polymers 0.000 description 1
- 238000000035 BCA protein assay Methods 0.000 description 1
- DWRXFEITVBNRMK-UHFFFAOYSA-N Beta-D-1-Arabinofuranosylthymine Natural products O=C1NC(=O)C(C)=CN1C1C(O)C(O)C(CO)O1 DWRXFEITVBNRMK-UHFFFAOYSA-N 0.000 description 1
- OYPRJOBELJOOCE-UHFFFAOYSA-N Calcium Chemical compound [Ca] OYPRJOBELJOOCE-UHFFFAOYSA-N 0.000 description 1
- UXVMQQNJUSDDNG-UHFFFAOYSA-L Calcium chloride Chemical compound [Cl-].[Cl-].[Ca+2] UXVMQQNJUSDDNG-UHFFFAOYSA-L 0.000 description 1
- KRKNYBCHXYNGOX-UHFFFAOYSA-K Citrate Chemical compound [O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O KRKNYBCHXYNGOX-UHFFFAOYSA-K 0.000 description 1
- 108020004705 Codon Proteins 0.000 description 1
- 108020004635 Complementary DNA Proteins 0.000 description 1
- 241000186216 Corynebacterium Species 0.000 description 1
- 102100028849 DNA mismatch repair protein Mlh3 Human genes 0.000 description 1
- 230000033616 DNA repair Effects 0.000 description 1
- 108010014303 DNA-directed DNA polymerase Proteins 0.000 description 1
- 102000016928 DNA-directed DNA polymerase Human genes 0.000 description 1
- BWGNESOTFCXPMA-UHFFFAOYSA-N Dihydrogen disulfide Chemical compound SS BWGNESOTFCXPMA-UHFFFAOYSA-N 0.000 description 1
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 1
- 108010008655 Epstein-Barr Virus Nuclear Antigens Proteins 0.000 description 1
- 241000588722 Escherichia Species 0.000 description 1
- 208000013452 Fallopian tube neoplasm Diseases 0.000 description 1
- 238000012413 Fluorescence activated cell sorting analysis Methods 0.000 description 1
- 102000010453 Folate receptor gamma Human genes 0.000 description 1
- 108050001933 Folate receptor gamma Proteins 0.000 description 1
- 102000002702 GPI-Linked Proteins Human genes 0.000 description 1
- 108010043685 GPI-Linked Proteins Proteins 0.000 description 1
- 108010010803 Gelatin Proteins 0.000 description 1
- 102000003886 Glycoproteins Human genes 0.000 description 1
- 108090000288 Glycoproteins Proteins 0.000 description 1
- SQUHHTBVTRBESD-UHFFFAOYSA-N Hexa-Ac-myo-Inositol Natural products CC(=O)OC1C(OC(C)=O)C(OC(C)=O)C(OC(C)=O)C(OC(C)=O)C1OC(C)=O SQUHHTBVTRBESD-UHFFFAOYSA-N 0.000 description 1
- 101000577853 Homo sapiens DNA mismatch repair protein Mlh1 Proteins 0.000 description 1
- 101000577867 Homo sapiens DNA mismatch repair protein Mlh3 Proteins 0.000 description 1
- 101001002193 Homo sapiens Putative postmeiotic segregation increased 2-like protein 1 Proteins 0.000 description 1
- 101001002182 Homo sapiens Putative postmeiotic segregation increased 2-like protein 3 Proteins 0.000 description 1
- 206010020751 Hypersensitivity Diseases 0.000 description 1
- UGQMRVRMYYASKQ-UHFFFAOYSA-N Hypoxanthine nucleoside Natural products OC1C(O)C(CO)OC1N1C(NC=NC2=O)=C2N=C1 UGQMRVRMYYASKQ-UHFFFAOYSA-N 0.000 description 1
- 108010009817 Immunoglobulin Constant Regions Proteins 0.000 description 1
- 102000009786 Immunoglobulin Constant Regions Human genes 0.000 description 1
- 108010067060 Immunoglobulin Variable Region Proteins 0.000 description 1
- 102000017727 Immunoglobulin Variable Region Human genes 0.000 description 1
- GUBGYTABKSRVRQ-QKKXKWKRSA-N Lactose Natural products OC[C@H]1O[C@@H](O[C@H]2[C@H](O)[C@@H](O)C(O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@H]1O GUBGYTABKSRVRQ-QKKXKWKRSA-N 0.000 description 1
- 108091026898 Leader sequence (mRNA) Proteins 0.000 description 1
- 206010025323 Lymphomas Diseases 0.000 description 1
- 229910015834 MSH1 Inorganic materials 0.000 description 1
- FYYHWMGAXLPEAU-UHFFFAOYSA-N Magnesium Chemical compound [Mg] FYYHWMGAXLPEAU-UHFFFAOYSA-N 0.000 description 1
- 206010027476 Metastases Diseases 0.000 description 1
- AFVFQIVMOAPDHO-UHFFFAOYSA-N Methanesulfonic acid Chemical compound CS(O)(=O)=O AFVFQIVMOAPDHO-UHFFFAOYSA-N 0.000 description 1
- 102100037480 Mismatch repair endonuclease PMS2 Human genes 0.000 description 1
- 108010085220 Multiprotein Complexes Proteins 0.000 description 1
- 102000007474 Multiprotein Complexes Human genes 0.000 description 1
- 241000699660 Mus musculus Species 0.000 description 1
- 101100464533 Mus musculus Pms2 gene Proteins 0.000 description 1
- NQTADLQHYWFPDB-UHFFFAOYSA-N N-Hydroxysuccinimide Chemical compound ON1C(=O)CCC1=O NQTADLQHYWFPDB-UHFFFAOYSA-N 0.000 description 1
- 108020004485 Nonsense Codon Proteins 0.000 description 1
- 108091034117 Oligonucleotide Proteins 0.000 description 1
- 108700005081 Overlapping Genes Proteins 0.000 description 1
- 229930012538 Paclitaxel Natural products 0.000 description 1
- 241001494479 Pecora Species 0.000 description 1
- 229930182555 Penicillin Natural products 0.000 description 1
- JGSARLDLIJGVTE-MBNYWOFBSA-N Penicillin G Chemical compound N([C@H]1[C@H]2SC([C@@H](N2C1=O)C(O)=O)(C)C)C(=O)CC1=CC=CC=C1 JGSARLDLIJGVTE-MBNYWOFBSA-N 0.000 description 1
- 102000000447 Peptide-N4-(N-acetyl-beta-glucosaminyl) Asparagine Amidase Human genes 0.000 description 1
- 108010055817 Peptide-N4-(N-acetyl-beta-glucosaminyl) Asparagine Amidase Proteins 0.000 description 1
- 241000276498 Pollachius virens Species 0.000 description 1
- 229920002535 Polyethylene Glycol 1500 Polymers 0.000 description 1
- 229920001213 Polysorbate 20 Polymers 0.000 description 1
- 102100020953 Putative postmeiotic segregation increased 2-like protein 1 Human genes 0.000 description 1
- 102100020956 Putative postmeiotic segregation increased 2-like protein 3 Human genes 0.000 description 1
- RWRDLPDLKQPQOW-UHFFFAOYSA-N Pyrrolidine Chemical compound C1CCNC1 RWRDLPDLKQPQOW-UHFFFAOYSA-N 0.000 description 1
- 239000012564 Q sepharose fast flow resin Substances 0.000 description 1
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 1
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 1
- VMHLLURERBWHNL-UHFFFAOYSA-M Sodium acetate Chemical compound [Na+].CC([O-])=O VMHLLURERBWHNL-UHFFFAOYSA-M 0.000 description 1
- 229920002472 Starch Polymers 0.000 description 1
- 239000006180 TBST buffer Substances 0.000 description 1
- 108091036066 Three prime untranslated region Proteins 0.000 description 1
- IVTVGDXNLFLDRM-HNNXBMFYSA-N Tomudex Chemical compound C=1C=C2NC(C)=NC(=O)C2=CC=1CN(C)C1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)S1 IVTVGDXNLFLDRM-HNNXBMFYSA-N 0.000 description 1
- 108700019146 Transgenes Proteins 0.000 description 1
- 239000007983 Tris buffer Substances 0.000 description 1
- 241000251539 Vertebrata <Metazoa> Species 0.000 description 1
- JLCPHMBAVCMARE-UHFFFAOYSA-N [3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-hydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methyl [5-(6-aminopurin-9-yl)-2-(hydroxymethyl)oxolan-3-yl] hydrogen phosphate Polymers Cc1cn(C2CC(OP(O)(=O)OCC3OC(CC3OP(O)(=O)OCC3OC(CC3O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c3nc(N)[nH]c4=O)C(COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3CO)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cc(C)c(=O)[nH]c3=O)n3cc(C)c(=O)[nH]c3=O)n3ccc(N)nc3=O)n3cc(C)c(=O)[nH]c3=O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)O2)c(=O)[nH]c1=O JLCPHMBAVCMARE-UHFFFAOYSA-N 0.000 description 1
- 238000010521 absorption reaction Methods 0.000 description 1
- 238000009825 accumulation Methods 0.000 description 1
- 230000009471 action Effects 0.000 description 1
- 239000013543 active substance Substances 0.000 description 1
- 230000001919 adrenal effect Effects 0.000 description 1
- 239000011543 agarose gel Substances 0.000 description 1
- 238000000246 agarose gel electrophoresis Methods 0.000 description 1
- 230000002776 aggregation Effects 0.000 description 1
- 238000004220 aggregation Methods 0.000 description 1
- 150000001298 alcohols Chemical class 0.000 description 1
- 229940110282 alimta Drugs 0.000 description 1
- 239000013566 allergen Substances 0.000 description 1
- 208000026935 allergic disease Diseases 0.000 description 1
- 230000007815 allergy Effects 0.000 description 1
- WNROFYMDJYEPJX-UHFFFAOYSA-K aluminium hydroxide Chemical compound [OH-].[OH-].[OH-].[Al+3] WNROFYMDJYEPJX-UHFFFAOYSA-K 0.000 description 1
- 150000001412 amines Chemical class 0.000 description 1
- 229960003896 aminopterin Drugs 0.000 description 1
- 230000003321 amplification Effects 0.000 description 1
- 210000004102 animal cell Anatomy 0.000 description 1
- 230000000692 anti-sense effect Effects 0.000 description 1
- 239000007864 aqueous solution Substances 0.000 description 1
- 239000007900 aqueous suspension Substances 0.000 description 1
- PYMYPHUHKUWMLA-WDCZJNDASA-N arabinose Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)C=O PYMYPHUHKUWMLA-WDCZJNDASA-N 0.000 description 1
- PYMYPHUHKUWMLA-UHFFFAOYSA-N arabinose Natural products OCC(O)C(O)C(O)C=O PYMYPHUHKUWMLA-UHFFFAOYSA-N 0.000 description 1
- 239000013584 assay control Substances 0.000 description 1
- 238000011888 autopsy Methods 0.000 description 1
- 239000012752 auxiliary agent Substances 0.000 description 1
- 125000000043 benzamido group Chemical group [H]N([*])C(=O)C1=C([H])C([H])=C([H])C([H])=C1[H] 0.000 description 1
- SRBFZHDQGSBBOR-UHFFFAOYSA-N beta-D-Pyranose-Lyxose Natural products OC1COC(O)C(O)C1O SRBFZHDQGSBBOR-UHFFFAOYSA-N 0.000 description 1
- IQFYYKKMVGJFEH-UHFFFAOYSA-N beta-L-thymidine Natural products O=C1NC(=O)C(C)=CN1C1OC(CO)C(O)C1 IQFYYKKMVGJFEH-UHFFFAOYSA-N 0.000 description 1
- 230000008033 biological extinction Effects 0.000 description 1
- 238000001574 biopsy Methods 0.000 description 1
- 229960002685 biotin Drugs 0.000 description 1
- 235000020958 biotin Nutrition 0.000 description 1
- 239000011616 biotin Substances 0.000 description 1
- 210000004369 blood Anatomy 0.000 description 1
- 239000008280 blood Substances 0.000 description 1
- 210000000601 blood cell Anatomy 0.000 description 1
- 210000001772 blood platelet Anatomy 0.000 description 1
- 210000004204 blood vessel Anatomy 0.000 description 1
- 210000001185 bone marrow Anatomy 0.000 description 1
- 239000011575 calcium Substances 0.000 description 1
- 229910052791 calcium Inorganic materials 0.000 description 1
- 239000001110 calcium chloride Substances 0.000 description 1
- 229910001628 calcium chloride Inorganic materials 0.000 description 1
- 208000035269 cancer or benign tumor Diseases 0.000 description 1
- 239000002775 capsule Substances 0.000 description 1
- 150000001720 carbohydrates Chemical class 0.000 description 1
- 235000014633 carbohydrates Nutrition 0.000 description 1
- 235000011089 carbon dioxide Nutrition 0.000 description 1
- 239000005018 casein Substances 0.000 description 1
- BECPQYXYKAMYBN-UHFFFAOYSA-N casein, tech. Chemical compound NCCCCC(C(O)=O)N=C(O)C(CC(O)=O)N=C(O)C(CCC(O)=N)N=C(O)C(CC(C)C)N=C(O)C(CCC(O)=O)N=C(O)C(CC(O)=O)N=C(O)C(CCC(O)=O)N=C(O)C(C(C)O)N=C(O)C(CCC(O)=N)N=C(O)C(CCC(O)=N)N=C(O)C(CCC(O)=N)N=C(O)C(CCC(O)=O)N=C(O)C(CCC(O)=O)N=C(O)C(COP(O)(O)=O)N=C(O)C(CCC(O)=N)N=C(O)C(N)CC1=CC=CC=C1 BECPQYXYKAMYBN-UHFFFAOYSA-N 0.000 description 1
- 235000021240 caseins Nutrition 0.000 description 1
- 238000005341 cation exchange Methods 0.000 description 1
- 230000025084 cell cycle arrest Effects 0.000 description 1
- 230000030833 cell death Effects 0.000 description 1
- 230000024245 cell differentiation Effects 0.000 description 1
- 230000007910 cell fusion Effects 0.000 description 1
- 230000010261 cell growth Effects 0.000 description 1
- 230000006037 cell lysis Effects 0.000 description 1
- 238000005119 centrifugation Methods 0.000 description 1
- 210000001638 cerebellum Anatomy 0.000 description 1
- 210000004720 cerebrum Anatomy 0.000 description 1
- 210000003679 cervix uteri Anatomy 0.000 description 1
- 230000008859 change Effects 0.000 description 1
- 239000002962 chemical mutagen Substances 0.000 description 1
- 238000002512 chemotherapy Methods 0.000 description 1
- DQLATGHUWYMOKM-UHFFFAOYSA-L cisplatin Chemical compound N[Pt](N)(Cl)Cl DQLATGHUWYMOKM-UHFFFAOYSA-L 0.000 description 1
- 229960004316 cisplatin Drugs 0.000 description 1
- 210000001072 colon Anatomy 0.000 description 1
- 238000004040 coloring Methods 0.000 description 1
- 238000004440 column chromatography Methods 0.000 description 1
- 238000002648 combination therapy Methods 0.000 description 1
- 238000013329 compounding Methods 0.000 description 1
- 230000001143 conditioned effect Effects 0.000 description 1
- 230000021615 conjugation Effects 0.000 description 1
- 230000030944 contact inhibition Effects 0.000 description 1
- 239000000356 contaminant Substances 0.000 description 1
- 238000001816 cooling Methods 0.000 description 1
- 210000004395 cytoplasmic granule Anatomy 0.000 description 1
- 231100000433 cytotoxic Toxicity 0.000 description 1
- 230000001472 cytotoxic effect Effects 0.000 description 1
- 230000006378 damage Effects 0.000 description 1
- 238000007405 data analysis Methods 0.000 description 1
- 230000034994 death Effects 0.000 description 1
- 230000006735 deficit Effects 0.000 description 1
- 230000007850 degeneration Effects 0.000 description 1
- 230000002939 deleterious effect Effects 0.000 description 1
- 238000010217 densitometric analysis Methods 0.000 description 1
- 230000001419 dependent effect Effects 0.000 description 1
- 238000001514 detection method Methods 0.000 description 1
- 239000003599 detergent Substances 0.000 description 1
- 238000000502 dialysis Methods 0.000 description 1
- 235000014113 dietary fatty acids Nutrition 0.000 description 1
- UANBXQTVHOIGGQ-LMOVPXPDSA-N diethyl (2s)-2-[[4-[2-(2-amino-4-oxo-1,7-dihydropyrrolo[2,3-d]pyrimidin-5-yl)ethyl]benzoyl]amino]pentanedioate;4-methylbenzenesulfonic acid Chemical compound CC1=CC=C(S(O)(=O)=O)C=C1.C1=CC(C(=O)N[C@@H](CCC(=O)OCC)C(=O)OCC)=CC=C1CCC1=CNC2=C1C(=O)N=C(N)N2 UANBXQTVHOIGGQ-LMOVPXPDSA-N 0.000 description 1
- 208000035475 disorder Diseases 0.000 description 1
- 239000002552 dosage form Substances 0.000 description 1
- 229940000406 drug candidate Drugs 0.000 description 1
- 230000005684 electric field Effects 0.000 description 1
- 238000001962 electrophoresis Methods 0.000 description 1
- 238000004520 electroporation Methods 0.000 description 1
- 230000008030 elimination Effects 0.000 description 1
- 238000003379 elimination reaction Methods 0.000 description 1
- 239000003995 emulsifying agent Substances 0.000 description 1
- 239000000839 emulsion Substances 0.000 description 1
- 201000003914 endometrial carcinoma Diseases 0.000 description 1
- 210000004696 endometrium Anatomy 0.000 description 1
- 208000023965 endometrium neoplasm Diseases 0.000 description 1
- 210000003038 endothelium Anatomy 0.000 description 1
- 230000002255 enzymatic effect Effects 0.000 description 1
- 210000002919 epithelial cell Anatomy 0.000 description 1
- 210000003238 esophagus Anatomy 0.000 description 1
- 239000003797 essential amino acid Substances 0.000 description 1
- 235000020776 essential amino acid Nutrition 0.000 description 1
- 235000019441 ethanol Nutrition 0.000 description 1
- 230000001747 exhibiting effect Effects 0.000 description 1
- 239000013613 expression plasmid Substances 0.000 description 1
- 239000000194 fatty acid Substances 0.000 description 1
- 229930195729 fatty acid Natural products 0.000 description 1
- 230000001605 fetal effect Effects 0.000 description 1
- 150000002224 folic acids Chemical class 0.000 description 1
- 238000009472 formulation Methods 0.000 description 1
- 230000037433 frameshift Effects 0.000 description 1
- 230000033581 fucosylation Effects 0.000 description 1
- 108010074605 gamma-Globulins Proteins 0.000 description 1
- 210000001035 gastrointestinal tract Anatomy 0.000 description 1
- 229920000159 gelatin Polymers 0.000 description 1
- 235000019322 gelatine Nutrition 0.000 description 1
- 235000011852 gelatine desserts Nutrition 0.000 description 1
- 238000001415 gene therapy Methods 0.000 description 1
- 230000004077 genetic alteration Effects 0.000 description 1
- 231100000118 genetic alteration Toxicity 0.000 description 1
- 229960002989 glutamic acid Drugs 0.000 description 1
- 210000003714 granulocyte Anatomy 0.000 description 1
- 230000005484 gravity Effects 0.000 description 1
- 230000009036 growth inhibition Effects 0.000 description 1
- 230000036541 health Effects 0.000 description 1
- 238000010438 heat treatment Methods 0.000 description 1
- 238000004128 high performance liquid chromatography Methods 0.000 description 1
- 229960001340 histamine Drugs 0.000 description 1
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 1
- 102000049917 human MLH1 Human genes 0.000 description 1
- 102000057079 human MSH2 Human genes 0.000 description 1
- 102000050010 human PMS1 Human genes 0.000 description 1
- 102000050929 human PMS2 Human genes 0.000 description 1
- 238000013415 human tumor xenograft model Methods 0.000 description 1
- 239000000413 hydrolysate Substances 0.000 description 1
- 230000002209 hydrophobic effect Effects 0.000 description 1
- 229920003063 hydroxymethyl cellulose Polymers 0.000 description 1
- 229940031574 hydroxymethyl cellulose Drugs 0.000 description 1
- 206010020718 hyperplasia Diseases 0.000 description 1
- 230000028993 immune response Effects 0.000 description 1
- 229940127121 immunoconjugate Drugs 0.000 description 1
- 230000005847 immunogenicity Effects 0.000 description 1
- 229940072221 immunoglobulins Drugs 0.000 description 1
- 230000002055 immunohistochemical effect Effects 0.000 description 1
- 238000013388 immunohistochemistry analysis Methods 0.000 description 1
- 239000012535 impurity Substances 0.000 description 1
- 230000006698 induction Effects 0.000 description 1
- 229910052500 inorganic mineral Inorganic materials 0.000 description 1
- 229960000367 inositol Drugs 0.000 description 1
- 238000003780 insertion Methods 0.000 description 1
- 230000037431 insertion Effects 0.000 description 1
- 239000002198 insoluble material Substances 0.000 description 1
- 238000007917 intracranial administration Methods 0.000 description 1
- 238000007918 intramuscular administration Methods 0.000 description 1
- 238000007919 intrasynovial administration Methods 0.000 description 1
- 238000007913 intrathecal administration Methods 0.000 description 1
- 238000001990 intravenous administration Methods 0.000 description 1
- 238000005342 ion exchange Methods 0.000 description 1
- 108010045069 keyhole-limpet hemocyanin Proteins 0.000 description 1
- 210000000231 kidney cortex Anatomy 0.000 description 1
- 238000003367 kinetic assay Methods 0.000 description 1
- 239000008101 lactose Substances 0.000 description 1
- 210000002429 large intestine Anatomy 0.000 description 1
- 208000032839 leukemia Diseases 0.000 description 1
- 150000002632 lipids Chemical class 0.000 description 1
- 239000007788 liquid Substances 0.000 description 1
- 210000004185 liver Anatomy 0.000 description 1
- 244000144972 livestock Species 0.000 description 1
- 239000000314 lubricant Substances 0.000 description 1
- 208000037841 lung tumor Diseases 0.000 description 1
- 210000001165 lymph node Anatomy 0.000 description 1
- 210000004698 lymphocyte Anatomy 0.000 description 1
- 239000011777 magnesium Substances 0.000 description 1
- 229910052749 magnesium Inorganic materials 0.000 description 1
- 238000012423 maintenance Methods 0.000 description 1
- 230000036210 malignancy Effects 0.000 description 1
- 210000005075 mammary gland Anatomy 0.000 description 1
- 230000010534 mechanism of action Effects 0.000 description 1
- 201000001441 melanoma Diseases 0.000 description 1
- 108020004999 messenger RNA Proteins 0.000 description 1
- 230000009401 metastasis Effects 0.000 description 1
- MBABOKRGFJTBAE-UHFFFAOYSA-N methyl methanesulfonate Chemical compound COS(C)(=O)=O MBABOKRGFJTBAE-UHFFFAOYSA-N 0.000 description 1
- 235000010755 mineral Nutrition 0.000 description 1
- 239000011707 mineral Substances 0.000 description 1
- 208000022499 mismatch repair cancer syndrome Diseases 0.000 description 1
- 238000010369 molecular cloning Methods 0.000 description 1
- 210000001616 monocyte Anatomy 0.000 description 1
- 101150093855 msh1 gene Proteins 0.000 description 1
- 210000003205 muscle Anatomy 0.000 description 1
- 238000002703 mutagenesis Methods 0.000 description 1
- 230000007935 neutral effect Effects 0.000 description 1
- 229910052757 nitrogen Inorganic materials 0.000 description 1
- 230000037434 nonsense mutation Effects 0.000 description 1
- 230000009871 nonspecific binding Effects 0.000 description 1
- 231100000252 nontoxic Toxicity 0.000 description 1
- 230000003000 nontoxic effect Effects 0.000 description 1
- 238000003199 nucleic acid amplification method Methods 0.000 description 1
- 238000011580 nude mouse model Methods 0.000 description 1
- 235000015097 nutrients Nutrition 0.000 description 1
- 235000019198 oils Nutrition 0.000 description 1
- 229960003104 ornithine Drugs 0.000 description 1
- 230000003204 osmotic effect Effects 0.000 description 1
- 238000004806 packaging method and process Methods 0.000 description 1
- 229960001592 paclitaxel Drugs 0.000 description 1
- 238000007427 paired t-test Methods 0.000 description 1
- 210000002741 palatine tonsil Anatomy 0.000 description 1
- 230000000849 parathyroid Effects 0.000 description 1
- 229960005079 pemetrexed Drugs 0.000 description 1
- 229940049954 penicillin Drugs 0.000 description 1
- 210000000578 peripheral nerve Anatomy 0.000 description 1
- 210000004303 peritoneum Anatomy 0.000 description 1
- 239000000546 pharmaceutical excipient Substances 0.000 description 1
- 230000001817 pituitary effect Effects 0.000 description 1
- 210000002826 placenta Anatomy 0.000 description 1
- 230000036470 plasma concentration Effects 0.000 description 1
- 210000004043 pneumocyte Anatomy 0.000 description 1
- 229920001983 poloxamer Polymers 0.000 description 1
- 238000002264 polyacrylamide gel electrophoresis Methods 0.000 description 1
- 229920000447 polyanionic polymer Polymers 0.000 description 1
- 229920002704 polyhistidine Polymers 0.000 description 1
- 229920005862 polyol Polymers 0.000 description 1
- 150000003077 polyols Chemical class 0.000 description 1
- 239000000256 polyoxyethylene sorbitan monolaurate Substances 0.000 description 1
- 235000010486 polyoxyethylene sorbitan monolaurate Nutrition 0.000 description 1
- 239000003755 preservative agent Substances 0.000 description 1
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 1
- 210000001236 prokaryotic cell Anatomy 0.000 description 1
- 230000001915 proofreading effect Effects 0.000 description 1
- 230000000644 propagated effect Effects 0.000 description 1
- 210000002307 prostate Anatomy 0.000 description 1
- 238000002731 protein assay Methods 0.000 description 1
- 239000011546 protein dye Substances 0.000 description 1
- 230000006337 proteolytic cleavage Effects 0.000 description 1
- 210000000512 proximal kidney tubule Anatomy 0.000 description 1
- 229960004432 raltitrexed Drugs 0.000 description 1
- 230000008929 regeneration Effects 0.000 description 1
- 238000011069 regeneration method Methods 0.000 description 1
- 210000003705 ribosome Anatomy 0.000 description 1
- 210000003079 salivary gland Anatomy 0.000 description 1
- 239000012266 salt solution Substances 0.000 description 1
- CDAISMWEOUEBRE-UHFFFAOYSA-N scyllo-inosotol Natural products OC1C(O)C(O)C(O)C(O)C1O CDAISMWEOUEBRE-UHFFFAOYSA-N 0.000 description 1
- 238000000926 separation method Methods 0.000 description 1
- 230000019491 signal transduction Effects 0.000 description 1
- 235000020183 skimmed milk Nutrition 0.000 description 1
- 210000003491 skin Anatomy 0.000 description 1
- 210000000813 small intestine Anatomy 0.000 description 1
- 235000017557 sodium bicarbonate Nutrition 0.000 description 1
- 229910000030 sodium bicarbonate Inorganic materials 0.000 description 1
- 229940054269 sodium pyruvate Drugs 0.000 description 1
- 239000002904 solvent Substances 0.000 description 1
- 210000000278 spinal cord Anatomy 0.000 description 1
- 210000000952 spleen Anatomy 0.000 description 1
- 206010041823 squamous cell carcinoma Diseases 0.000 description 1
- 238000010561 standard procedure Methods 0.000 description 1
- 239000008107 starch Substances 0.000 description 1
- 235000019698 starch Nutrition 0.000 description 1
- 210000002784 stomach Anatomy 0.000 description 1
- 229960005322 streptomycin Drugs 0.000 description 1
- 238000007920 subcutaneous administration Methods 0.000 description 1
- 125000001424 substituent group Chemical group 0.000 description 1
- 230000001629 suppression Effects 0.000 description 1
- 239000004094 surface-active agent Substances 0.000 description 1
- 230000004083 survival effect Effects 0.000 description 1
- 239000003826 tablet Substances 0.000 description 1
- RCINICONZNJXQF-MZXODVADSA-N taxol Chemical compound O([C@@H]1[C@@]2(C[C@@H](C(C)=C(C2(C)C)[C@H](C([C@]2(C)[C@@H](O)C[C@H]3OC[C@]3([C@H]21)OC(C)=O)=O)OC(=O)C)OC(=O)[C@H](O)[C@@H](NC(=O)C=1C=CC=CC=1)C=1C=CC=CC=1)O)C(=O)C1=CC=CC=C1 RCINICONZNJXQF-MZXODVADSA-N 0.000 description 1
- 210000001550 testis Anatomy 0.000 description 1
- VUYXVWGKCKTUMF-UHFFFAOYSA-N tetratriacontaethylene glycol monomethyl ether Chemical compound COCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCO VUYXVWGKCKTUMF-UHFFFAOYSA-N 0.000 description 1
- 229940124597 therapeutic agent Drugs 0.000 description 1
- 229940126622 therapeutic monoclonal antibody Drugs 0.000 description 1
- 238000002560 therapeutic procedure Methods 0.000 description 1
- 229940104230 thymidine Drugs 0.000 description 1
- 210000001541 thymus gland Anatomy 0.000 description 1
- 210000001685 thyroid gland Anatomy 0.000 description 1
- 230000009258 tissue cross reactivity Effects 0.000 description 1
- 231100000041 toxicology testing Toxicity 0.000 description 1
- 238000013518 transcription Methods 0.000 description 1
- 230000035897 transcription Effects 0.000 description 1
- 238000010361 transduction Methods 0.000 description 1
- 230000026683 transduction Effects 0.000 description 1
- 239000012096 transfection reagent Substances 0.000 description 1
- 230000001960 triggered effect Effects 0.000 description 1
- LENZDBCJOHFCAS-UHFFFAOYSA-N tris Chemical compound OCC(N)(CO)CO LENZDBCJOHFCAS-UHFFFAOYSA-N 0.000 description 1
- GPRLSGONYQIRFK-MNYXATJNSA-N triton Chemical compound [3H+] GPRLSGONYQIRFK-MNYXATJNSA-N 0.000 description 1
- 210000005239 tubule Anatomy 0.000 description 1
- 230000005909 tumor killing Effects 0.000 description 1
- 208000025421 tumor of uterus Diseases 0.000 description 1
- 238000013414 tumor xenograft model Methods 0.000 description 1
- 238000000108 ultra-filtration Methods 0.000 description 1
- 238000011144 upstream manufacturing Methods 0.000 description 1
- 210000000626 ureter Anatomy 0.000 description 1
- 210000003932 urinary bladder Anatomy 0.000 description 1
- 206010046766 uterine cancer Diseases 0.000 description 1
- 210000004291 uterus Anatomy 0.000 description 1
- 108700026220 vif Genes Proteins 0.000 description 1
- 229920002554 vinyl polymer Polymers 0.000 description 1
- 230000004584 weight gain Effects 0.000 description 1
- 235000019786 weight gain Nutrition 0.000 description 1
- 230000036642 wellbeing Effects 0.000 description 1
- 239000000080 wetting agent Substances 0.000 description 1
Images
Classifications
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/574—Immunoassay; Biospecific binding assay; Materials therefor for cancer
- G01N33/57484—Immunoassay; Biospecific binding assay; Materials therefor for cancer involving compounds serving as markers for tumor, cancer, neoplasia, e.g. cellular determinants, receptors, heat shock/stress proteins, A-protein, oligosaccharides, metabolites
- G01N33/57492—Immunoassay; Biospecific binding assay; Materials therefor for cancer involving compounds serving as markers for tumor, cancer, neoplasia, e.g. cellular determinants, receptors, heat shock/stress proteins, A-protein, oligosaccharides, metabolites involving compounds localized on the membrane of tumor or cancer cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K49/00—Preparations for testing in vivo
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
- A61P35/02—Antineoplastic agents specific for leukemia
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/30—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/30—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
- C07K16/3069—Reproductive system, e.g. ovaria, uterus, testes, prostate
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/574—Immunoassay; Biospecific binding assay; Materials therefor for cancer
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/51—Complete heavy chain or Fd fragment, i.e. VH + CH1
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/515—Complete light chain, i.e. VL + CL
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
- C07K2317/732—Antibody-dependent cellular cytotoxicity [ADCC]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
- G01N2333/435—Assays involving biological materials from specific organisms or of a specific nature from animals; from humans
- G01N2333/705—Assays involving receptors, cell surface antigens or cell surface determinants
Definitions
- This invention relates to purified novel monoclonal antibodies that specifically bind to the alpha-folate receptor (“FR- ⁇ ”) and compositions thereof.
- the antibodies of the invention block the biological activity of FR- ⁇ .
- the antibodies and compositions of the invention are useful in the treatment of certain cancers, particularly cancers that have increased cell surface expression of the alpha-folate receptor, such as ovarian, breast, renal, colorectal, lung, endometrial, or brain cancer.
- the invention also relates to hybridoma cells expressing the monoclonal antibodies, antibody derivatives, such as chimeric and humanized monoclonal antibodies, antibody fragments, mammalian cells expressing the monoclonal antibodies, derivatives and fragments, compositions of purified antibodies of the invention, and methods of detecting and treating cancer using the antibodies, derivatives, fragments, and compositions of the invention.
- antibody derivatives such as chimeric and humanized monoclonal antibodies, antibody fragments, mammalian cells expressing the monoclonal antibodies, derivatives and fragments, compositions of purified antibodies of the invention.
- ⁇ There are three major isoforms of the human membrane folate binding protein, ⁇ , ⁇ , and ⁇ .
- the ⁇ and ⁇ isoforms have about 70% amino acid sequence homology, and differ dramatically in their stereospecificity for some folates. Both isoforms are expressed in fetal and adult tissue, although normal tissue generally expresses low to moderate amounts of FR- ⁇ . FR- ⁇ , however, is expressed in normal epithelial cells, and is frequently strikingly elevated in a variety of carcinomas (Ross et al. (1994) Cancer 73(9):2432-2443; Rettig et al. (1988) Proc. Natl. Acad. Sci. USA 85:3110-3114; Campbell et al. (1991) Cancer Res.
- FR- ⁇ is overexpressed in greater than 90% of ovarian carcinomas (Sudimack and Lee (2000) Adv. Drug Deliv. Rev. 41(2):147-62).
- FR- ⁇ generally attaches to the cell surface membrane via a GPI anchor.
- GPI anchors contain oligosaccharides and inositol phospholipids.
- MOv18 which recognizes a 38 kDa protein on the surface of choriocarcinoma cells.
- MOv18 is a murine, IgG1, kappa antibody and mediates specific cell lysis of the ovarian carcinoma cell line, IGROV1.
- Alberti et al. ((1990) Biochem. Biophys. Res. Commun. 171(3):1051-1055) showed that the antigen recognized by MOv18 was a GPI-linked protein.
- U.S. Pat. No. 5,952,484 describes a humanized antibody that binds to a 38 kDa protein (FR- ⁇ ).
- the antibody was named LK26.
- the original mouse monoclonal antibody was described by Rettig in European Patent Application No. 86104170.5 (published as EP0197435 and issued in the U.S. as U.S. Pat. No. 4,851,332).
- Ovarian cancer is a major cause of death due to gynecological malignancy. Although chemotherapy is the recommended treatment and has enjoyed some success, the 5-year survival rate is still less than 40%.
- a difficult problem in antibody therapy in cancer is that often the target of the antibody is expressed by normal tissues as well as cancerous tissues. Thus, the antibodies that are used to kill cancer cells also have a deleterious effect on normal cells. Finding unique targets or targets that are preferentially expressed in cancer tissues has proven difficult in many cancers. Identification of preferentially expressed targets and the ability to block the biological activity of such targets may be an effective treatment for cancer. As such, more effective antibody therapies for ovarian and other FR- ⁇ -bearing cancers that avoids or minimizes reactivity with normal tissues are needed.
- the invention provides antibodies that specifically bind to FR- ⁇ .
- the antibodies of the invention preferably block a biological activity of FR- ⁇ .
- the invention provides antibody-producing cells and compositions of antibodies that specifically bind to FR- ⁇ wherein the cells and compositions are substantially free of FR- ⁇ binding competitors.
- antibody-producing cells that produce antibodies comprising substantially only antibody of the invention are provided.
- the antibodies of the invention bind FR- ⁇ with a binding affinity of at least about 1 ⁇ 10 ⁇ 7 M, at least about 1 ⁇ 10 ⁇ 8 M, at least about 1 ⁇ 10 ⁇ 9 M, and most preferably at least about 1 ⁇ 10 ⁇ 10 M.
- FR- ⁇ tumors that overexpress FR- ⁇ tend to favor the formation of multimeric forms of FR- ⁇ , for example tetramers.
- FR- ⁇ the formation of the multimeric form of FR- ⁇ is driven by a mass effect due to the accumulation of larger amounts of FR- ⁇ on the surface of tumor cells.
- other researchers only found higher molecular weight species of FR- ⁇ in gel filtration assays which represented FR- ⁇ inserted into Triton X-100 micelles via their hydrophobic tails (Holm et al. (1997) Biosci. Reports 17(4):415-427).
- the invention provides antibodies that specifically bind to the multimeric form of FR- ⁇ and not the monomeric form.
- the antibodies of the invention (a) bind to an epitope of FR- ⁇ other than the epitope bound by antibody LK26; (b) bind FR- ⁇ with greater affinity than antibody LK26; (c) out-compete antibody LK26 for binding to the multimeric form of FR- ⁇ and thereby block the biological activity of FR- ⁇ ; and/or (d) are purified relative to LK26.
- the antibodies of the invention recognize a disulfide-dependent epitope.
- Some embodiments of the invention relate to antibodies comprising a heavy chain comprising an amino acid sequence of SEQ ID NO:5.
- the heavy chain comprises an amino acid sequence of SEQ ID NO:6.
- the antibodies of the invention comprise a light chain comprising the amino acid sequence of SEQ ID NO:2. In some embodiments of the invention, the antibodies comprise a light chain comprising the amino acid sequence of SEQ ID NO:3.
- the invention further provides antibodies comprising a heavy chain comprising an amino acid of SEQ ID NO:5 or SEQ ID NO:6 and a light chain comprising an amino acid sequence of SEQ ID NO:2 or SEQ ID NO:3.
- the antibodies of the invention preferably comprise a heavy chain comprising an amino acid sequence of SEQ ID NO:5 and a light chain comprising an amino acid sequence of SEQ ID NO:2 and more preferably comprise a heavy chain comprising an amino acid sequence of SEQ ID NO:6 and a light chain comprising an amino acid sequence of SEQ ID NO:3.
- the heavy chain of the antibody is encoded by a nucleic acid comprising the nucleotide sequence of SEQ ID NO:7.
- the light chain of the antibody is encoded by a nucleic acid comprising the nucleotide sequence of SEQ ID NO:8.
- the antibodies of the invention may be chimeric antibodies, including, but not limited to human-mouse chimeric antibodies.
- the antibodies of the invention may also be humanized antibodies.
- the invention also provides: cells, including hybridoma cells, that express the antibodies of the invention; polynucleotides that encode the antibodies of the invention; vectors comprising the polynucleotides that encode the antibodies of the invention; and expression cells comprising the vectors of the invention.
- the invention also provides methods of producing an antibody that specifically binds to FR- ⁇ .
- the method comprises the step of culturing the antibody-producing cells of the invention.
- the cells of the invention may be insect cells or animal cells, preferably, mammalian cells.
- the invention further provides methods of inhibiting the growth of dysplastic cells associated with increased expression of FR- ⁇ comprising administering to a patient with such dysplastic cells a composition comprising an antibody of the invention.
- the antibody preferably blocks a biological activity of FR- ⁇ .
- the methods may be used for various dysplastic conditions, such as, but not limited to ovarian, breast, renal, colorectal, lung, endometrial, or brain cancer.
- the patients are human patients.
- the antibodies are conjugated to cytotoxic agents such as, but not limited to radionuclides, toxins, and chemotherapeutic agents.
- the antibodies are co-administered with an antifolate agent.
- the antifolate agent and antibody of the invention may be administered at the same time or simultaneously (that is, together), or in any order.
- the invention also provides methods for decreasing the growth of cancer cells using monoclonal antibodies that specifically bind to FR- ⁇ , preferably mammalian FR- ⁇ .
- the methods of the invention may be used to modulate the growth of cancer cells and the progression of cancer in mammals, including humans.
- the cancer cells that may be inhibited include all cancer cells that have an increased expression of FR- ⁇ in relation to normal human tissues, such as but not limited to ovarian, breast, renal, colorectal, lung, endometrial, or brain cancer cells.
- compositions of antibodies of the invention are substantially pure.
- substantially pure compositions of antibodies of the invention preferably comprise at least about 90%, more preferably at least about 95%, even more preferably at least about 99%, and most preferably about 100% by weight of antibodies of the invention.
- FIG. 1 shows a western blot of tumor cells showing the tetrameric and monomeric forms of FR- ⁇ .
- FIG. 2 shows a western blot of Escherichia coli -expressed FR- ⁇ .
- FIG. 3 shows a western blot of FR- ⁇ solubilized in the presence or absence of Triton X-100.
- FIG. 4 illustrates a screening method for identifying antibody-producing cells of the invention.
- FIG. 5A illustrates a sequence alignment of light chain of an anti-FR- ⁇ antibody of the invention having an amino acid sequence of SEQ ID NO:3 and the light chain of an aberrant translation product having an amino acid sequence of SEQ ID NO: 24.
- FIG. 5B illustrates a sequence alignment of the nucleic acid sequence of a light chain of an anti-FR- ⁇ antibody of the invention having a sequence of SEQ ID NO:8 and a nucleic acid sequence encoding the aberrant translation product having a sequence of SEQ ID NO:25.
- epitope refers to the portion of an antigen to which a monoclonal antibody specifically binds.
- formational epitope refers to a discontinuous epitope formed by a spatial relationship between amino acids of an antigen other than an unbroken series of amino acids.
- multimeric refers to a grouping of two or more identical or nearly identical units.
- tetrameric refers to a grouping of four, identical or nearly identical units.
- the term “monomeric” refers to a single unit of a mature protein that assembles in groups with other units.
- the term “inhibition of growth of dysplastic cells in vitro” means a decrease in the number of tumor cells, in culture, by at least about 5%, preferably about 10%, more preferably about 20%, more preferably about 30%, more preferably about 40%, more preferably about 50%, more preferably about 60%, more preferably about 70%, more preferably about 80%, more preferably about 90%, more preferably about 95%, more preferably about 99%, and most preferably 100%.
- In vitro inhibition of tumor cell growth may be measured by assays known in the art, such as the GEO cell soft agar assay.
- the term “inhibition of growth of dysplastic cells in vivo” means a decrease in the number of tumor cells, in an animal, by at least about 5%, preferably about 10%, more preferably about 20%, more preferably about 30%, more preferably about 40%, more preferably about 50%, more preferably about 60%, more preferably about 70%, more preferably about 80%, more preferably about 90%, more preferably about 95%, more preferably about 99%, and most preferably 100%.
- In vivo modulation of tumor cell growth may be measured by assays known in the art, for example but not limited to using the Response Evaluation Criteria in Solid Tumors (RECIST) parameters (available online through the National Cancer Institute Cancer Therapy Evaluation Program).
- RECIST Response Evaluation Criteria in Solid Tumors
- Dysplastic cells refer to cells that exhibit abnormal growth properties, such as but not limited to growth in soft agar, lack of contact inhibition, failure to undergo cell cycle arrest in the absence of serum, and formation of tumors when injected into immune-compromised mice.
- Dysplastic cells include, but are not limited to tumors, hyperplasia, and the like.
- preventing refers to decreasing the probability that an organism contracts or develops an abnormal condition.
- treating refers to having a therapeutic effect and at least partially alleviating or abrogating an abnormal condition in the organism. Treating includes inhibition of tumor growth, maintenance of inhibited tumor growth, and induction of remission.
- a therapeutic effect refers to the inhibition of an abnormal condition.
- a therapeutic effect relieves to some extent one or more of the symptoms of the abnormal condition.
- a therapeutic effect can refer to one or more of the following: (a) an increase or decrease in the proliferation, growth, and/or differentiation of cells; (b) inhibition (i.e., slowing or stopping) of growth of tumor cells in vivo (c) promotion of cell death; (d) inhibition of degeneration; (e) relieving to some extent one or more of the symptoms associated with the abnormal condition; and (f) enhancing the function of a population of cells.
- the monoclonal antibodies and derivatives thereof described herein effectuate the therapeutic effect alone or in combination with conjugates or additional components of the compositions of the invention.
- the term “inhibits the progression of cancer” refers to an activity of a treatment that slows the modulation of neoplastic disease toward end-stage cancer in relation to the modulation toward end-stage disease of untreated cancer cells.
- FR- ⁇ blocks a biological activity of FR- ⁇ refers to the ability of the antibodies (or fragments thereof) of the invention to prevent folate binding to FR- ⁇ , to prevent the uptake of folate by cells, or to inhibit signal transduction in the cell triggered by folate.
- the term “about” refers to an approximation of a stated value within an acceptable range. Preferably the range is +/ ⁇ 5% of the stated value.
- neoplastic disease refers to a condition marked by abnormal proliferation of cells of a tissue.
- wild-type refers to a native sequence, for example, a native nucleic acid sequence encoding or amino acid sequence of a heavy or light chain of the antibodies of the invention.
- wild-type sequences of the invention include the sequences of SEQ ID NOs: 1-8.
- FR- ⁇ binding competitors refers to aberrant transcripts of the nucleic acids encoding antibodies of the invention and aberrant translation products of the antibodies of the invention that do not have the biological properties of the anti-FR- ⁇ antibodies of the invention (e.g., antigen binding affinity, ability to block a biological activity of FR- ⁇ ).
- an aberrant transcript may contain a deletion, a frameshift, a nonsense mutation, or a missense mutation.
- An example of an aberrant translation product is an alternative splice variant.
- FR- ⁇ binding competitor is an antibody comprising a light chain having an amino acid sequence of SEQ ID NO:24: MGWSCIILFLVATATGVHSDIQLTQSPSSLSASVGDRVTITCSVSSSISS NNLHWYQQKPAASSQRTSPPTTANSGVVTRTCTRSAKGPRWKSNELWLHH LSSSSRHLMSS.
- the light chain of such an FR- ⁇ binding competitor may be encoded by a nucleic acid having a nucleic acid sequence of SEQ ID NO:25: ATGGGATGGAGCTGTATCATCCTCTTCTTGGTAGCAACAGCTACAGGTGT CCACTCCGACATCCAGCTGACCCAGAGCCCAAGCAGCCTGAGCGCCAGCG TGGGTGACAGAGTGACCATCACCTGTAGTGTCAGCTCAAGTATAAGTTCC AACAACTTGCACTGGTACCAGCAGAAGCCCGCAGCCTCCAGCCAGAGGAC ATCGCCACCTACTACTGCCAACAGTGGAGTAGTTACCCGTACATGTACAC GTTCGGCCAAGGGACCAAGGTGGAAATCAAACGAACTGTGGCTGCACCAT CTGTCTTCATCTTCCCGCCATCTGATGAGCAGTTGAAATCTGGAACTGCC TCTGTTGTGCCTGCTGAATAACTTCTATCCCAGAGAGGCCAAAGTACA GTGGAAGGTGGATAACGCCCTCCAATCGGGTAACTCCCAGG
- purified means a condition of being sufficiently separated from other proteins or nucleic acids with which it would naturally be associated, so as to exist in “substantially pure” form. “Purified” is not meant to exclude artificial or synthetic mixtures with other compounds or materials, or the presence of impurities that do not interfere with the fundamental activity, and that may be present, for example, due to incomplete purification, addition of stabilizers, or compounding into, for example, immunogenic preparations or pharmaceutically acceptable preparations.
- a “purified” antibody preferably means an anitbody substantially free of FR- ⁇ binding competitors.
- substantially pure means comprising at least about 50-60% by weight of a given material (e.g., nucleic acid, protein, etc.).
- the preparation comprises at least about 75% by weight, and most preferably about 90-95% by weight of the given compound. Purity is measured by methods appropriate for the given material (e.g., chromatographic methods, agarose or polyacrylamide gel electrophoresis, HPLC analysis, and the like).
- the phrase “substantially free of FR- ⁇ binding competitors” refers to a condition of having less than about 50%, more preferably less than about 40%, more preferably less than about 30%, more preferably less than about 20%, more preferably less than about 10%, more preferably less than about 5%, more preferably less than about 1%, more preferably less than about 0.5%, and most preferably about 0% by weight of FR- ⁇ binding competitors.
- the antibodies of the invention specifically bind folate receptor-alpha (FR- ⁇ ). In some embodiments, the antibodies of the invention specifically bind a monomeric form of FR- ⁇ . In some embodiments, the antibodies of the invention specifically bind a multimeric form of FR- ⁇ (e.g., a tetrameric form) and not the monomeric form of FR- ⁇ . Preferred antibodies of the invention block a biological activity of FR- ⁇ . In preferred embodiments, the antibodies block a biological activity of FR- ⁇ on FR- ⁇ -bearing cells. Antibodies of the invention preferably induce antibody-dependent cellular cytotoxicity (ADCC) of FR- ⁇ -bearing cells. Examples of FR- ⁇ -bearing cells include but are not limited to ovarian, lung, breast, brain, renal, colorectal, and endometrial cancer cells.
- ADCC antibody-dependent cellular cytotoxicity
- antibodies, and antibodies suitable for use in the method of the invention include, for example, fully human antibodies, human antibody homologs, humanized antibody homologs, chimeric antibody homologs, Fab, Fab′, F(ab′) 2 and F(v) antibody fragments, single chain antibodies, and monomers or dimers of antibody heavy or light chains or mixtures thereof.
- Antibodies of the invention are preferably monoclonal antibodies.
- the antibodies of the invention may include intact immunoglobulins of any isotype including types IgA, IgG, IgE, IgD, IgM (as well as subtypes thereof).
- the antibodies preferably include intact IgG and more preferably IgG1.
- the light chains of the immunoglobulin may be kappa or lambda. The light chains are preferably kappa.
- the antibodies of the invention include portions of intact antibodies that retain antigen-binding specificity, for example, Fab fragments, Fab′ fragments, F(ab′) 2 fragments, F(v) fragments, heavy chain monomers or dimers, light chain monomers or dimers, dimers consisting of one heavy and one light chain, and the like.
- antigen binding fragments, as well as full-length dimeric or trimeric polypeptides derived from the above-described antibodies are themselves useful.
- a “chimeric antibody” is an antibody produced by recombinant DNA technology in which all or part of the hinge and constant regions of an immunoglobulin light chain, heavy chain, or both, have been substituted for the corresponding regions from another animal's immunoglobulin light chain or heavy chain. In this way, the antigen-binding portion of the parent monoclonal antibody is grafted onto the backbone of another species' antibody.
- One approach described in EP 0239400 to Winter et al. describes the substitution of one species' complementarity determining regions (CDRs) for those of another species, such as substituting the CDRs from human heavy and light chain immunoglobulin variable region domains with CDRs from mouse variable region domains.
- HSA human anti-rodent antibody
- HAMA human anti-mouse antibody
- Humanized antibodies are produced by recombinant DNA technology, in which at least one of the amino acids of a human immunoglobulin light or heavy chain that is not required for antigen binding has been substituted for the corresponding amino acid from a nonhuman mammalian immunoglobulin light or heavy chain.
- the immunoglobulin is a mouse monoclonal antibody
- at least one amino acid that is not required for antigen binding is substituted using the amino acid that is present on a corresponding human antibody in that position.
- the “humanization” of the monoclonal antibody inhibits human immunological reactivity against the foreign immunoglobulin molecule.
- a method of performing complementarity determining region (CDR) grafting may be performed by sequencing the mouse heavy and light chains of the antibody of interest that binds to the target antigen (e.g., FR- ⁇ ) and genetically engineering the CDR DNA sequences and imposing these amino acid sequences to corresponding human V regions by site directed mutagenesis.
- Human constant region gene segments of the desired isotype are added, and the “humanized” heavy and light chain genes are co-expressed in mammalian cells to produce soluble humanized antibody.
- a typical expression cell is a Chinese Hamster Ovary (CHO) cell. Suitable methods for creating the chimeric antibodies may be found, for example, in Jones et al.
- Single chain antibodies refer to antibodies formed by recombinant DNA techniques in which immunoglobulin heavy and light chain fragments are linked to the Fv region via an engineered span of amino acids.
- Various methods of generating single chain antibodies are known, including those described in U.S. Pat. No. 4,694,778; Bird (1988) Science 242:423-442; Huston et al. (1988) Proc. Natl. Acad. Sci. USA 85:5879-5883; Ward et al. (1989) Nature 334:54454; Skerra et al. (1988) Science 242:1038-1041.
- the antibodies of the invention may be used alone or as immunoconjugates with a cytotoxic agent.
- the agent is a chemotherapeutic agent.
- the agent is a radioisotope, including, but not limited to Lead-212, Bismuth-212, Astatine-211, Iodine-131, Scandium-47, Rhenium-186, Rhenium-188, Yttrium-90, Iodine-123, Iodine-125, Bromine-77, Indium-111, and fissionable nuclides such as Boron-10 or an Actinide.
- the agent is a toxin or cytotoxic drug, including but not limited to ricin, modified Pseudomonas enterotoxin A, calicheamicin, adriamycin, 5-fluorouracil, and the like. Methods of conjugation of antibodies and antibody fragments to such agents are known in the literature.
- the antibodies of the invention include derivatives that are modified, e.g., by the covalent attachment of any type of molecule to the antibody such that covalent attachment does not prevent the antibody from binding to its epitope.
- suitable derivatives include, but are not limited to fucosylated antibodies and fragments, glycosylated antibodies and fragments, acetylated antibodies and fragments, pegylated antibodies and fragments, phosphorylated antibodies and fragments, and amidated antibodies and fragments.
- the antibodies and derivatives thereof of the invention may themselves by derivatized by known protecting/blocking groups, proteolytic cleavage, linkage to a cellular ligand or other proteins, and the like.
- at least one heavy chain of the antibody is fucosylated.
- the fucosylation is N-linked.
- at least one heavy chain of the antibody comprises a fucosylated, N-linked oligosaccharide.
- the antibodies of the invention include variants having single or multiple amino acid substitutions, deletions, additions, or replacements that retain the biological properties (e.g., block a biological activity of FR- ⁇ , binding affinity) of the antibodies of the invention.
- the skilled person can produce variants having single or multiple amino acid substitutions, deletions, additions or replacements.
- variants may include, inter alia: (a) variants in which one or more amino acid residues are substituted with conservative or nonconservative amino acids, (b) variants in which one or more amino acids are added to or deleted from the polypeptide, (c) variants in which one or more amino acids include a substituent group, and (d) variants in which the polypeptide is fused with another peptide or polypeptide such as a fusion partner, a protein tag or other chemical moiety, that may confer useful properties to the polypeptide, such as, for example, an epitope for an antibody, a polyhistidine sequence, a biotin moiety and the like.
- Antibodies of the invention may include variants in which amino acid residues from one species are substituted for the corresponding residue in another species, either at the conserved or nonconserved positions. In another embodiment, amino acid residues at nonconserved positions are substituted with conservative or nonconservative residues.
- the techniques for obtaining these variants, including genetic (suppressions, deletions, mutations, etc.), chemical, and enzymatic techniques, are known to the person having ordinary skill in the art.
- Antibodies of the invention also include antibody fragments.
- a “fragment” refers to polypeptide sequences which are preferably at least about 40, more preferably at least to about 50, more preferably at least about 60, more preferably at least about 70, more preferably at least about 80, more preferably at least about 90, and more preferably at least about 100 amino acids in length, and which retain some biological activity or immunological activity of the full-length sequence, for example, the ability to block a biological activity of FR- ⁇ and/or FR- ⁇ binding affinity.
- the invention also encompasses fully human antibodies such as those derived from peripheral blood mononuclear cells of ovarian, breast, renal, colorectal, lung, endometrial, or brain cancer patients. Such cells may be fused with myeloma cells, for example, to form hybridoma cells producing fully human antibodies against FR- ⁇ .
- the antibody comprises a light chain comprising an amino acid sequence of SEQ ID NO:1: DIQLTQSPSSLSASVGDRVTITCSVSSSISSNNLHWYQQKPGKAPKPWIY GTSNPASGVPSRFSGSGSGTDYTFTISSLQPEDIATYYCQQWSSYPYMYT FGQGTKVEIK.
- the antibody of the invention comprises a light chain comprising an amino acid sequence of SEQ ID NO:2: DIQLTQSPSSLSASVGDRVTITCSVSSSISSNNLHWYQQKPGKAPKPWIY GTSNPASGVPSRFSGSGSGTDYTFTISSLQPEDIATYYCQQWSSYPYMYT FGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQ WKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVT HQGLSSPVTKSFNRGEC.
- the antibody of the invention comprises a light chain comprising an amino acid sequence of SEQ ID NO:3: MGWSCIILFLVATATGVHS DIQLTQSPSSLSASVGDRVTITCSVSSSISS NNLHWYQQKPGKAPKPWIYGTSNPASGVPSRFSGSGSGTDYTFTISSLQP EDIATYYCQQWSSYPYMYTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSG TASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSST LTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
- antibodies comprising a heavy chain comprising an amino acid sequence of SEQ ID NO:4: EVQLVESGGGVVQPGRSLRLSCSASGFTFSGYGLSWVRQAPGKGLEWVAM ISSGGSYTYYADSVKGRFAISRDNAKNTLFLQMDSLRPEDTGVYFCARHG DDPAWFAYWGQGTPVTVSS.
- the antibodies of the invention comprise a heavy chain comprising an amino acid sequence of SEQ ID NO:5: EVQLVESGGGVVQPGRSLRLSCSASGFTFSGYGLSWVRQAPGKGLEWVAM ISSGGSYTYYADSVKGRFAISRDNAKNTLFLQMDSLRPEDTGVYFCARHG DDPAWFAYWGQGTPVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKD YFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTY ICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKPK DTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNS TYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQV YTLPPSRDELTKNQVSLTCLVK
- the heavy chain of the antibody comprises an amino acid sequence of SEQ ID NO:6: MGWSCIILFLVATATGVHS EVQLVESGGGVVQPGRSLRLSCSASGFTFSG YGLSWVRQAPGKGLEWVAMISSGGSYTYYADSVKGRFAISRDNAKNTLFL QMDSLRPEDTGVYFCARHGDDPAWFAYWGQGTPVTVSSASTKGPSVFPLA PSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGL YSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPC PAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYV DGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALP APIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTC
- the antibody comprises a heavy chain comprising an amino acid sequence of SEQ ID NO:4, 5, or 6 and a light chain comprising an amino acid sequence of SEQ ID NO:1, 2, or 3.
- the antibody comprises a heavy chain comprising an amino acid sequence of SEQ ID NO:5 and a light chain comprising an amino acid sequence of SEQ ID NO:2.
- the antibody comprises a heavy chain comprising an amino acid sequence SEQ ID NO:6 and a light chain comprising an amino acid sequence of SEQ ID NO:3.
- the antibodies of the invention are preferably nontoxic as demonstrated, for example, in in vivo toxicology studies.
- the antibodies and derivatives thereof of the invention have binding affinities that include a dissociation constant (K d ) of less than 1 ⁇ 10 ⁇ 2 .
- K d dissociation constant
- the K d is less than 1 ⁇ 10 ⁇ 3 .
- the K d is less than 1 ⁇ 10 ⁇ 4 .
- the K d is less than 1 ⁇ 10 ⁇ 5 .
- the K d is less than 1 ⁇ 10 ⁇ 6 .
- the K d is less than 1 ⁇ 10 ⁇ 7 .
- the K d is less than 1 ⁇ 10 ⁇ 8 .
- the K d is less than 1 ⁇ 10 ⁇ 9 .
- the K d is less than 1 ⁇ 10 ⁇ 10 . In still other embodiments, the K d is less than 1 ⁇ 10 ⁇ 11 . In some embodiments, the K d is less than 1 ⁇ 10 ⁇ 12 . In other embodiments, the K d is less than 1 ⁇ 10 ⁇ 13 . In other embodiments, the K d is less than 1 ⁇ 10 ⁇ 14 . In still other embodiments, the K d is less than 1 ⁇ 10 ⁇ 15 .
- the antibodies of some embodiments of the invention are particularly useful in binding the multimeric form of FR- ⁇ due to an increased avidity of the antibody as both “arms” of the antibody (Fab fragments) bind to separate FR- ⁇ molecules that make up the multimer. This leads to a decrease in the dissociation (K d ) of the antibody and an overall increase in the observed affinity (K D ).
- nucleic acids encoding the heavy chain and/or light chain of the anti-FR- ⁇ antibodies of the invention.
- Nucleic acid or a “nucleic acid molecule” as used herein refers to any DNA or RNA molecule, either single- or double-stranded and, if single-stranded, the molecule of its complementary sequence in either linear or circular form.
- nucleic acid molecules a sequence or structure of a particular nucleic acid molecule may be described herein according to the normal convention of providing the sequence in the 5′ to 3′ direction.
- nucleic acids are “isolated.” This term, when applied to DNA, refers to a DNA molecule that is separated from sequences with which it is immediately contiguous in the naturally occurring genome of the organism in which it originated.
- an “isolated nucleic acid” may comprise a DNA molecule inserted into a vector, such as a plasmid or virus vector, or integrated into the genomic DNA of a prokaryotic or eukaryotic cell or host organism.
- RNA the term “isolated nucleic acid” refers primarily to an RNA molecule encoded by an isolated DNA molecule as defined above.
- the term may refer to an RNA molecule that has been sufficiently separated from other nucleic acids with which it would be associated in its natural state (i.e., in cells or tissues).
- An isolated nucleic acid (either DNA or RNA) may further represent a molecule produced directly by biological or synthetic means and separated from other components present during its production.
- Nucleic acids of the invention include nucleic acids having at least 80%, more preferably at least about 90%, more preferably at least about 95%, and most preferably at least about 98% homology to nucleic acids of the invention.
- the terms “percent similarity”, “percent identity” and “percent homology” when referring to a particular sequence are used as set forth in the University of Wisconsin GCG software program.
- Nucleic acids of the invention also include complementary nucleic acids. In some instances, the sequences will be fully complementary (no mismatches) when aligned. In other instances, there may be up to about a 20% mismatch in the sequences.
- Nucleic acids of the invention also include fragments of the nucleic acids of the invention.
- a “fragment” refers to a nucleic acid sequence that is preferably at least about 10 nucleic acids in length, more preferably about 40 nucleic acids, and most preferably about 100 nucleic acids in length.
- a “fragment” can also mean a stretch of at least about 100 consecutive nucleotides that contains one or more deletions, insertions, or substitutions.
- a “fragment” can also mean the whole coding sequence of a gene and may include 5′ and 3′ untranslated regions.
- the encoded antibody light chain preferably comprises an amino acid sequence of SEQ ID NO:1, 2, or 3.
- the encoded antibody heavy chain preferably comprises an amino acid sequence of SEQ ID NO:4, 5, or 6.
- the heavy chain of the antibody is encoded by a nucleic acid comprising the nucleotide sequence of SEQ ID NO:7: ATG GGATGGAGCTGTATCATCCTCTTCTTGGTAGCAACAGCTACAGGTGT CCACTCCGAGGTCCAACTGGTGGAGAGCGGTGGAGGTGTTGTGCAACCTG GCCGGTCCCTGCGCCTGTCCTGCTCCGCATCTGGCTTCACCTTCAGCGGC TATGGGTTGTCTTGGGTGAGACAGGCACCTGGAAAAGGTCTTGAGTGGGT TGCAATGATTAGTAGTGGTGGTAGTTATACCTACTATGCAGACAGTGTGA AGGGTAGATTTGCAATATCGCGAGACAACGCCAAGAACACATTGTTCCTG CAAATGGACAGCCTGAGACCCGAAGACACCGGGGTC
- the light chain of the anti-folate receptor- ⁇ antibody is encoded by a nucleic acid sequence of SEQ ID NO:8: ATGGGATGGAGCTGTATCATCCTCTTCTTGGTAGCAACAGCTACAGGTGT CCACTCCGACATCCAGCTGACCCAGAGCCCAAGCAGCCTGAGCGCCAGCG TGGGTGACAGAGTGACCATCACCTGTAGTGTCAGCTCAAGTATAAGTTCC AACAACTTGCACTGGTACCAGCAGAAGCCAGGTAAGGCTCCAAAGCCATG GATCTACGGCACATCCAACCTGGCTTCTGGTGTGCCAAGCAGATTCAGCG GTAGCGGTAGCGGTACCGACTACACCTTCACCATCAGCAGCCTCCAGCCA GAGGACATCGCCACCTACTACTGCCAACAGTGGAGTAGTTACCCGTACAT GTACACGTTCGGCCAAGGGACCAAGGTGGAAATCAAACGAACTGTGGCTG CACCATCTGTCTTCATCTTCCCGCCATCTGATGAGCAG
- nucleic acids encoding both a heavy chain and a light chain of an antibody of the invention.
- a nucleic acid of the invention may comprise a nucleic acid sequence encoding an amino acid sequence of SEQ ID NO:1, 2, or 3 and a nucleic acid sequence encoding an amino acid sequence of SEQ ID NO:4, 5, or 6.
- Nucleic acids of the invention can be cloned into a vector.
- a “vector” is a replicon, such as a plasmid, cosmid, bacmid, phage, artificial chromosome (BAC, YAC) or virus, into which another genetic sequence or element (either DNA or RNA) may be inserted so as to bring about the replication of the attached sequence or element.
- a “replicon” is any genetic element, for example, a plasmid, cosmid, bacmid, phage, artificial chromosome (BAC, YAC) or virus, that is capable of replication largely under its own control.
- a replicon may be either RNA or DNA and may be single or double stranded.
- the expression vector contains a constitutively active promoter segment (such as but not limited to CMV, SV40, Elongation Factor or LTR sequences) or an inducible promoter sequence such as the steroid inducible pIND vector (Invitrogen), where the expression of the nucleic acid can be regulated.
- a constitutively active promoter segment such as but not limited to CMV, SV40, Elongation Factor or LTR sequences
- an inducible promoter sequence such as the steroid inducible pIND vector (Invitrogen)
- Expression vectors of the invention may further comprise regulatory sequences, for example, an internal ribosomal entry site.
- the expression vector can be introduced into a cell by transfection, for example.
- the invention also provides methods of producing monoclonal antibodies that specifically bind FR- ⁇ .
- Antibodies of the invention may be produced in vivo or in vitro.
- One strategy for generating antibodies against FR- ⁇ involves immunizing animals with FR- ⁇ .
- animals are immunized with the monomeric or multimeric form of FR- ⁇ . Animals so immunized will produce antibodies against the protein.
- Standard methods are known for creating monoclonal antibodies including, but are not limited to, the hybridoma technique (see Kohler & Milstein, (1975) Nature 256:495-497); the trioma technique; the human B-cell hybridoma technique (see Kozbor et al. (1983) Immunol.
- FR- ⁇ may be purified from cells or from recombinant systems using a variety of well-known techniques for isolating and purifying proteins.
- FR- ⁇ may be isolated based on the apparent molecular weight of the protein by running the protein on an SDS-PAGE gel and blotting the proteins onto a membrane. Thereafter, the appropriate size band corresponding to FR- ⁇ may be cut from the membrane and used as an immunogen in animals directly, or by first extracting or eluting the protein from the membrane.
- the protein may be isolated by size-exclusion chromatography alone or in combination with other means of isolation and purification.
- the invention also provides methods of producing monoclonal antibodies that specifically bind to the multimeric form of FR- ⁇ .
- Multimeric, for example tetrameric, FR- ⁇ may be purified from cells or from recombinant systems using a variety of well-known techniques for isolating and purifying proteins.
- multimeric FR- ⁇ may be isolated based on the apparent molecular weight of the protein by running the protein on an SDS-PAGE gel and blotting the proteins onto a membrane. Thereafter, the appropriate size band corresponding to the multimeric form of FR- ⁇ may be cut from the membrane and used as an immunogen in animals directly, or by first extracting or eluting the protein from the membrane.
- the protein may be isolated by size-exclusion chromatography alone or in combination with other means of isolation and purification.
- animals are generally immunized with FR- ⁇ or an immunogenic portion of FR- ⁇ .
- the antigen is generally combined with an adjuvant to promote immunogenicity.
- Adjuvants vary according to the species used for immunization.
- adjuvants include, but are not limited to: Freund's complete adjuvant (“FCA”), Freund's incomplete adjuvant (“FIA”), mineral gels (e.g., aluminum hydroxide), surface active substances (e.g., lysolecithin, pluronic polyols, polyanions), peptides, oil emulsions, keyhole limpet hemocyanin (“KLH”), dinitrophenol (“DNP”), and potentially useful human adjuvants such as Bacille Calmette-Guerin (“BCG”) and corynebacterium parvum.
- FCA Freund's complete adjuvant
- FFA Freund's incomplete adjuvant
- mineral gels e.g., aluminum hydroxide
- surface active substances e.g., lysolecithin, pluronic polyols, polyanions
- peptides e.g., oil emulsions
- KLH keyhole limpet hemocyanin
- DNP dinitrophenol
- BCG
- Immunization may be accomplished using well-known procedures.
- the dose and immunization regimen will depend on the species of mammal immunized, its immune status, body weight, and/or calculated surface area, etc.
- blood serum is sampled from the immunized mammals and assayed for anti-FR- ⁇ antibodies using appropriate screening assays as described below, for example.
- a common method for producing humanized antibodies is to graft CDR sequences from a MAb (produced by immunizing a rodent host) onto a human Ig backbone, and transfection of the chimeric genes into Chinese Hamster Ovary (CHO) cells which in turn produce a functional Ab that is secreted by the CHO cells (Shields, R. L., et al. (1995) Anti-IgE monoclonal antibodies that inhibit allergen-specific histamine release. Int Arch. Allergy Immunol. 107:412-413).
- the methods described within this application are also useful for generating genetic alterations within Ig genes or chimeric Igs transfected within host cells such as rodent cell lines, plants, yeast and prokaryotes (Frigerio L, et al. (2000) Assembly, secretion, and vacuolar delivery of a hybrid immunoglobulin in plants. Plant Physiol. 123:1483-1494).
- Splenocytes from immunized animals may be immortalized by fusing the splenocytes (containing the antibody-producing B cells) with an immortal cell line such as a myeloma line.
- myeloma cell line is from the same species as the splenocyte donor.
- the immortal cell line is sensitive to culture medium containing hypoxanthine, aminopterin and thymidine (“HAT medium”).
- HAT medium hypoxanthine, aminopterin and thymidine
- the myeloma cells are negative for Epstein-Barr virus (EBV) infection.
- EBV Epstein-Barr virus
- the myeloma cells are HAT-sensitive, EBV negative and Ig expression negative. Any suitable myeloma may be used.
- Murine hybridomas may be generated using mouse myeloma cell lines (e.g., the P3-NS1/1-Ag4-1, P3-x63-Ag8.653 or Sp2/O-Ag14 myeloma lines). These murine myeloma lines are available from the ATCC. These myeloma cells are fused to the donor splenocytes polyethylene glycol (“PEG”), preferably 1500 molecular weight polyethylene glycol (“PEG 1500”). Hybridoma cells resulting from the fusion are selected in HAT medium which kills unfused and unproductively fused myeloma cells. Unfused splenocytes die over a short period of time in culture. In some embodiments, the myeloma cells do not express immunoglobulin genes.
- PEG polyethylene glycol
- PEG 1500 1500 molecular weight polyethylene glycol
- HAT medium kills unfused and unproductively fused myeloma cells. Unf
- Hybridomas producing a desired antibody which are detected by screening assays such as those described below may be used to produce antibodies in culture or in animals.
- the hybridoma cells may be cultured in a nutrient medium under conditions and for a time sufficient to allow the hybridoma cells to secrete the monoclonal antibodies into the culture medium. These techniques and culture media are well known by those skilled in the art.
- the hybridoma cells may be injected into the peritoneum of an unimmunized animal. The cells proliferate in the peritoneal cavity and secrete the antibody, which accumulates as ascites fluid. The ascites fluid may be withdrawn from the peritoneal cavity with a syringe as a rich source of the monoclonal antibody.
- Antibodies against FR- ⁇ may also be prepared in vitro using a variety of techniques known in the art. For example, but not by way of limitation, fully human monoclonal antibodies against FR- ⁇ may be prepared by using in vitro-primed human splenocytes (Boerner et al. (1991) J. Immunol. 147:86-95).
- the antibodies of the invention may be prepared by “repertoire cloning” (Persson et al. (1991) Proc. Nat. Acad. Sci. USA 88:2432-2436; and Huang and Stollar (1991) J. Immunol. Methods 141:227-236).
- U.S. Pat. No. 5,798,230 describes preparation of human monoclonal antibodies from human B antibody-producing B cells that are immortalized by infection with an Epstein-Barr virus that expresses Epstein-Barr virus nuclear antigen 2 (EBNA2).
- EBNA2 Epstein-Barr virus nuclear antigen 2
- antibodies against FR- ⁇ are formed by in vitro immunization of peripheral blood mononuclear cells (“PBMCs”). This may be accomplished by any means known in the art, such as, for example, using methods described in the literature (Zafiropoulos et al. (1997) J. Immunological Methods 200:181-190).
- PBMCs peripheral blood mononuclear cells
- Methods for producing antibody-producing cells of the invention also include methods for developing hypermutable antibody-producing cells by taking advantage of the conserved mismatch repair (MMR) process of host cells.
- MMR conserved mismatch repair
- Blocking MMR in antibody-producing cells such as but not limited to: hybridomas; mammalian cells transfected with genes encoding for Ig light and heavy chains; mammalian cells transfected with genes encoding for single chain antibodies; eukaryotic cells transfected with Ig genes, can enhance the rate of mutation within these cells leading to clones that have enhanced antibody production, cells containing genetically altered antibodies with enhanced biochemical properties such as increased antigen binding, cells that produce antibodies comprising substantially only the antibody of the invention, and/or cells that are substantially free of FR- ⁇ binding competitors.
- the process of MMR also called mismatch proofreading, is carried out by protein complexes in cells ranging from bacteria to mammalian cells.
- a MMR gene is a gene that encodes for one of the proteins of such a mismatch repair complex.
- a MMR complex is believed to detect distortions of the DNA helix resulting from non-complementary pairing of nucleotide bases.
- the non-complementary base on the newer DNA strand is excised, and the excised base is replaced with the appropriate base, which is complementary to the older DNA strand. In this way, cells eliminate many mutations that occur as a result of mistakes in DNA replication.
- Dominant negative alleles cause a MMR defective phenotype even in the presence of a wild-type allele in the same cell.
- An example of a dominant negative allele of a MMR gene is the human gene hPMS2 -134, which carries a truncating mutation at codon 134. The mutation causes the product of this gene to abnormally terminate at the position of the 134th amino acid, resulting in a shortened polypeptide containing the N-terminal 133 amino acids. Such a mutation causes an increase in the rate of mutations, which accumulate in cells after DNA replication. Expression of a dominant negative allele of a mismatch repair gene results in impairment of mismatch repair activity, even in the presence of the wild-type allele.
- Dominant negative alleles of a MMR gene can be obtained from the cells of humans, animals, yeast, bacteria, or other organisms. Such alleles can be identified by screening cells for defective MMR activity. Cells from animals or humans with cancer can be screened for defective mismatch repair. Cells from colon cancer patients may be particularly useful. Genomic DNA, cDNA, or mRNA from any cell encoding a MMR protein can be analyzed for variations from the wild type sequence. Dominant negative alleles of a MMR gene can also be created artificially, for example, by producing variants of the hPMS2-134 allele or other MMR genes. Various techniques of site-directed mutagenesis can be used.
- mismatch repair proteins and nucleic acid sequences include mouse PMS2 (SEQ ID NOs:9 and 10), human PMS2 (SEQ ID NOs:11 and 12), human PMS1 (SEQ ID NOs:13 and 14), human MSH2 (SEQ ID NOs: 15 and 16), human MLH1 (SEQ ID NOs:17 and 18), and human PMS2-134 (SEQ ID NOs:19 and 20).
- a cell into which a dominant negative allele of a mismatch repair gene has been introduced will become hypermutable.
- the degree of elevation of the spontaneous mutation rate can be at least 2-fold, 5-fold, 10-fold, 20-fold, 50-fold, 100-fold, 200-fold, 500-fold, or 1000-fold that of the normal cell or animal.
- chemical mutagens such as but limited to methane sulfonate, dimethyl sulfonate, 06-methyl benzadine, MNU, ENU, etc. can be used in MMR defective cells to increase the rates an additional 10 to 100 fold that of the MMR deficiency itself.
- a polynucleotide encoding a dominant negative form of a MMR protein is introduced into a cell.
- the cell produces anti-FR- ⁇ antibodies.
- the cells produce an antibody comprising a heavy chain comprising an amino acid sequence of SEQ ID NO:4, 5, or 6 and a light chain comprising an amino acid sequence of SEQ ID NO:1, 2, or 3.
- the cells comprise a nucleic acid comprising a nucleotide sequence of SEQ ID NO:7 and/or a nucleotide sequence of SEQ ID NO:8.
- the dominant negative MMR gene can be any dominant negative allele encoding a protein which is part of a MMR complex, for example, PMS2, PMS1, MLH1, or MSH2.
- the dominant negative allele can be naturally occurring or made in the laboratory.
- the polynucleotide can be in the form of genomic DNA, cDNA, RNA, or a chemically synthesized polynucleotide.
- the polynucleotide can be cloned into an expression vector containing a constitutively active promoter segment (such as but not limited to CMV, SV40, Elongation Factor or LTR sequences) or an inducible promoter sequence such as the steroid inducible pIND vector (Invitrogen), where the expression of the dominant negative MMR gene can be regulated.
- a constitutively active promoter segment such as but not limited to CMV, SV40, Elongation Factor or LTR sequences
- an inducible promoter sequence such as the steroid inducible pIND vector (Invitrogen)
- the polynucleotide can be introduced into the cell by transfection.
- an immunoglobulin (Ig) gene a set of Ig genes or a chimeric gene containing whole or parts of an Ig gene can be transfected into MMR-deficient cell hosts, the cell is grown and screened for clones with new phenotypes and/or genotypes.
- MMR-defective cells may be of human, primates, mammals, rodent, plant, yeast or of the prokaryotic kingdom.
- the gene encoding the Ig of the cell with the new phenotype or genotype may be isolated from the respective clone and introduced into genetically stable cells (i.e., cells with normal MMR) to provide clones that consistently produce the Ig.
- the method of isolating the Ig gene may be any method known in the art.
- Introduction of the isolated polynucleotide encoding the Ig may also be performed using any method known in the art, including, but not limited to transfection of an expression vector containing the polynucleotide encoding the Ig.
- transfecting an Ig gene a set of Ig genes or a chimeric gene containing whole or parts of an Ig gene into an MMR-deficient host cell, such Ig genes may be transfected simultaneously with a gene encoding a dominant negative mismatch repair gene into a genetically stable cell to render the cell hypermutable.
- Transfection is any process whereby a polynucleotide is introduced into a cell.
- the process of transfection can be carried out in a living animal, e.g., using a vector for gene therapy, or it can be carried out in vitro, e.g., using a suspension of one or more isolated cells in culture.
- the cell can be any type of eukaryotic cell, including, for example, cells isolated from humans or other primates, mammals or other vertebrates, invertebrates, and single celled organisms such as protozoa, yeast, or bacteria.
- transfection will be carried out using a suspension of cells, or a single cell, but other methods can also be applied as long as a sufficient fraction of the treated cells or tissue incorporates the polynucleotide so as to allow transfected cells to be grown and utilized.
- the protein product of the polynucleotide may be transiently or stably expressed in the cell.
- Techniques for transfection are well known. Available techniques for introducing polynucleotides include but are not limited to electroporation, transduction, cell fusion, the use of calcium chloride, and packaging of the polynucleotide together with lipid for fusion with the cells of interest.
- the organism can then be genetically stabilized.
- Cells expressing the dominant negative alleles can be “cured” in that the dominant negative allele can be turned off, if inducible, eliminated from the cell, and the like such that the cells become genetically stable and no longer accumulate mutations at the abnormally high rate.
- Cells that produce substantially only anti-FR- ⁇ antibodies of the invention or cells that are substantially free of FR- ⁇ binding competitors are selected for cloning and expansion according to the methods for determining antibody specificity described herein. An example of such a method is illustrated in FIG. 4 .
- Nucleic acids encoding antibodies of the invention may be recombinantly expressed.
- the expression cells of the invention include any insect expression cell line known, such as for example, Spodoptera frugiperda cells.
- the expression cell lines may also be yeast cell lines, such as, for example, Saccharomyces cerevisiae and Schizosaccharomyces pombe cells.
- the expression cells may also be mammalian cells such as, for example, hybridoma cells (e.g., NS0 cells), Chinese hamster ovary cells, baby hamster kidney cells, human embryonic kidney line 293, normal dog kidney cell lines, normal cat kidney cell lines, monkey kidney cells, African green monkey kidney cells, COS cells, and non-tumorigenic mouse myoblast G8 cells, fibroblast cell lines, myeloma cell lines, mouse NIH/3T3 cells, LMTK31 cells, mouse sertoli cells, human cervical carcinoma cells, buffalo rat liver cells, human lung cells, human liver cells, mouse mammary tumor cells, TRI cells, MRC 5 cells, and FS4 cells.
- Nucleic acids of the invention may be introduced into cell by transfection, for example. Recombinantly expressed antibodies may be recovered from the growth medium of the cells, for example.
- the procedure for in vitro immunization is supplemented with directed evolution of the hybridoma cells in which a dominant negative allele of a mismatch repair gene such as PMS1, PMS2, PMS2-134, PMSR2, PMSR3, MLH1, MLH2, MLH3, MLH4, MLH5, MLH6, PMSL9, MSH1, and MSH2 is introduced into the hybridoma cells after fusion of the splenocytes, or to the myeloma cells before fusion. Cells containing the dominant negative mutant will become hypermutable and accumulate mutations at a higher rate than untransfected control cells.
- a dominant negative allele of a mismatch repair gene such as PMS1, PMS2, PMS2-134, PMSR2, PMSR3, MLH1, MLH2, MLH3, MLH4, MLH5, MLH6, PMSL9, MSH1, and MSH2
- a pool of the mutating cells may be screened, for example, for clones that are substantially free of FR- ⁇ binding competitors, clones that produce higher affinity antibodies, clones that produce higher titers of antibodies, or clones that simply grow faster or better under certain conditions.
- the technique for generating hypermutable cells using dominant negative alleles of mismatch repair genes is described, for example, in U.S. Pat. No. 6,808,894.
- mismatch repair may be inhibited using the chemical inhibitors of mismatch repair described by Nicolaides et al. in WO 02/054856 “Chemical Inhibitors of Mismatch Repair” published Jul. 18, 2002.
- the technique for enhancing antibodies using the dominant negative alleles of mismatch repair genes or chemical inhibitors of mismatch repair may be applied to mammalian expression cells expressing cloned immunoglobulin genes as well.
- Cells expressing the dominant negative alleles can be “cured” in that the dominant negative allele can be turned off if inducible, inactivated, eliminated from the cell, and the like, such that the cells become genetically stable once more and no longer accumulate mutations at the abnormally high rate.
- Screening for antibodies that specifically bind to FR- ⁇ may be accomplished using an enzyme-linked immunosorbent assay (ELISA) in which microtiter plates are coated with FR- ⁇ .
- ELISA enzyme-linked immunosorbent assay
- antibodies that bind FR- ⁇ from positively reacting clones can be further screened for reactivity in an ELISA-based assay to other folate receptor isoforms, for example, FR- ⁇ and/or FR- ⁇ , using microtiter plates coated with the other folate receptor isoform(s).
- Clones that produce antibodies that are reactive to another isoform of folate receptor are eliminated, and clones that produce antibodies that are reactive to FR- ⁇ only may be selected for further expansion and development.
- Confirmation of reactivity of the antibodies to FR- ⁇ may be accomplished, for example, using a Western Blot assay in which protein from ovarian, breast, renal, colorectal, lung, endometrial, or brain cancer cells and purified FR- ⁇ and other folate receptor isoforms are run on an SDS-PAGE gel, and subsequently are blotted onto a membrane. The membrane may then be probed with the putative anti-FR- ⁇ antibodies. Reactivity with FR- ⁇ and not another folate receptor isoform confirms specificity of reactivity for FR- ⁇ .
- the binding affinity of anti-FR- ⁇ antibodies is determined.
- Antibodies of the invention preferably have a binding affinity to FR- ⁇ of at least about 1 ⁇ 10 ⁇ 7 M, more preferably at least about 1 ⁇ 10 ⁇ 8 M, more preferably at least about 1 ⁇ 10 ⁇ 9 M, and most preferably at least about 1 ⁇ 10 ⁇ 10 M.
- Preferred antibody-producing cells of the invention produce substantially only antibodies having a binding affinity to FR- ⁇ of at least about 1 ⁇ 10 ⁇ 7 M, more preferably at least about 1 ⁇ 10 ⁇ 8 M, more preferably at least about 1 ⁇ 10 ⁇ 9 M, and most preferably at least about 1 ⁇ 10 ⁇ 10 M.
- compositions of the invention comprise substantially only antibodies having a binding affinity to FR- ⁇ of at least about 1 ⁇ 10 ⁇ 7 M, more preferably at least about 1 ⁇ 10 ⁇ 8 M, more preferably at least about 1 ⁇ 10 ⁇ 9 M, and most preferably at least about 1 ⁇ 10 ⁇ 10 M.
- antibodies that bind the multimeric form of FR- ⁇ from positively reacting clones can be further screened for reactivity in an ELISA-based assay to the monomeric form of FR- ⁇ using microtiter plates coated with the monomeric form of FR- ⁇ . Clones that produce antibodies that are reactive to the monomeric form of FR- ⁇ are eliminated, and clones that produce antibodies that are reactive to the multimeric form only may be selected for further expansion and development.
- Confirmation of reactivity of the antibodies to the multimeric form of FR- ⁇ may be accomplished, for example, using a Western Blot assay in which protein from ovarian, breast, renal, colorectal, lung, endometrial, or brain cancer cells and purified multimeric and monomeric FR- ⁇ are run on an SDS-PAGE gel under reducing and non-reducing conditions, and subsequently are blotted onto a membrane. The membrane may then be probed with the putative anti-multimeric FR- ⁇ antibodies. Reactivity with the appropriately sized multimeric form of FR- ⁇ under non-reducing conditions and not the 38 kDa form of FR- ⁇ (under reducing or non-reducing conditions) confirms specificity of reactivity for the multimeric form of FR- ⁇ .
- the antibodies of the invention preferably induce antibody-dependent cellular cytotoxicity (ADCC) in FR- ⁇ bearing cells.
- ADCC assays are known in the art.
- the method of the invention enabled successful production of an optimized, humanized anti-FR- ⁇ antibody with acceptable antigen binding activity (low nanomolar dissociation constant) and production rates (>10 pg/cell/day).
- Antibody-producing cells of the invention include any insect expression cell line known, such as for example, Spodoptera frugiperda cells.
- the expression cell lines may also be yeast cell lines, such as, for example, Saccharomyces cerevisiae and Schizosaccharomyces pombe cells.
- the expression cells may also be mammalian cells such as, for example, hybridoma cells (e.g., NS0 cells), Chinese hamster ovary cells, baby hamster kidney cells, human embryonic kidney line 293, normal dog kidney cell lines, normal cat kidney cell lines, monkey kidney cells, African green monkey kidney cells, COS cells, and non-tumorigenic mouse myoblast G8 cells, fibroblast cell lines, myeloma cell lines, mouse NIH/3T3 cells, LMTK31 cells, mouse sertoli cells, human cervical carcinoma cells, buffalo rat liver cells, human lung cells, human liver cells, mouse mammary tumor cells, TRI cells, MRC 5 cells, and FS4 cells.
- hybridoma cells e.g., NS0 cells
- Chinese hamster ovary cells e.g., Chinese hamster ovary cells
- baby hamster kidney cells e.g., human embryonic kidney line 293, normal dog kidney cell lines, normal cat kidney cell lines, monkey kidney cells, African green
- the antibody-producing cells of the invention produce antibodies that specifically bind to FR- ⁇ .
- the cells preferably are substantially free of FR- ⁇ binding competitors.
- the antibody-producing cells comprise less than about 10%, preferably less than about 5%, more preferably less than about 1%, more preferably less than about 0.5%, more preferably less than about 0.1%, and most preferably 0% by weight FR- ⁇ binding competitors.
- the antibodies produced by the antibody-producing cells are substantially free of FR- ⁇ binding competitors.
- antibodies produced by the antibody-producing cells comprise less than about 10%, preferably less than about 5%, more preferably less than about 1%, more preferably less than about 0.5%, more preferably less than about 0.1%, and most preferably 0% by weight FR- ⁇ binding competitors.
- Preferred antibody-producing cells of the invention produce substantially only antibodies having a binding affinity to FR- ⁇ of at least about 1 ⁇ 10 ⁇ 7 M, more preferably at least about 1 ⁇ 10 ⁇ 8 M, more preferably at least about 1 ⁇ 10 ⁇ 9 M, and most preferably at least about 1 ⁇ 10 ⁇ 10 M.
- methods for antibody purification include filtration, affinity column chromatography, cation exchange chromatography, anion exchange chromatography, and concentration.
- the filtration step preferably comprises ultrafiltration, and more preferably ultrafiltration and diafiltration. Filtration is preferably performed at least about 5-50 times, more preferably 10 to 30 times, and most preferably 14 to 27 times.
- Affinity column chromatography may be performed using, for example, PROSEP Affinity Chromatography (Millipore, Billerica, Mass.).
- the affinity chromatography step comprises PROSEP-VA column chromatography. Eluate may be washed in a solvent detergent.
- Cation exchange chromatography may include, for example, SP-Sepharose Cation Exchange Chromatography.
- Anion exchange chromatography may include, for example but not limited to, Q-Sepharose Fast Flow Anion Exchange.
- the anion exchange step is preferably non-binding, thereby allowing removal of contaminants including DNA and BSA.
- the antibody product is preferably nanofiltered, for example, using a Pall DV 20 Nanofilter.
- the antibody product may be concentrated, for example, using ultrafiltration and diafiltration.
- the method may further comprise a step of size exclusion chromatography to remove aggregates.
- compositions of anti-FR- ⁇ antibodies of the invention may be used to inhibit or reduce growth of tumor cells in a patient.
- the compositions of antibodies preferably are substantially free of FR- ⁇ binding competitors.
- the pharmaceutical composition is formulated for administration by injection or infusion.
- compositions of the invention may further comprise a chemotherapeutic or cytotoxic agent.
- the antibody is conjugated to the chemotherapeutic or cytotoxic agent.
- Suitable chemotherapeutic or cytotoxic agents include but are not limited to a radioisotope, including, but not limited to Lead-212, Bismuth-212, Astatine-211, Iodine-131, Scandium-47, Rhenium-186, Rhenium-188, Yttrium-90, Iodine-123, Iodine-125, Bromine-77, Indium-111, and fissionable nuclides such as Boron-10 or an Actinide.
- the agent is a toxin or cytotoxic drug, including but not limited to ricin, modified Pseudomonas enterotoxin A, calicheamicin, adriamycin, 5-fluorouracil, and the like.
- Pharmaceutical compositions of the invention may comprise an antifolate compound including but not limited to 5-fluoro-2′-deoxy-uridine-5′-monophosphate (FdUMP), 5-fluorouracil, leucovorin, ZD1649, MTA, GW1843U89, ZD9331, AG337, and PT523.
- compositions of the invention may be formulated with a pharmaceutically acceptable carrier or medium.
- suitable pharmaceutically acceptable carriers include water, PBS, salt solution (such as Ringer's solution), alcohols, oils, gelatins, and carbohydrates, such as lactose, amylose, or starch, fatty acid esters, hydroxymethylcellulose, and polyvinyl pyrolidine.
- Such preparations can be sterilized, and if desired, mixed with auxiliary agents such as lubricants, preservatives, stabilizers, wetting agents, emulsifiers, salts for influencing osmotic pressure, buffers, and coloring.
- Pharmaceutical carriers suitable for use in the present invention are known in the art and are described, for example, in Pharmaceutical Sciences (17 th Ed., Mack Pub. Co., Easton, Pa.).
- kits for inhibiting or reducing growth of tumor cells in a patient. Also provided are kits for identifying the presence of dysplastic cells in vitro or in vivo.
- kits of the invention comprise antibody or an antibody composition of the invention and instructions for using the kit in a method for inhibiting or reducing growth of tumor cells in the patient or in a method for identifying the presence of dysplastic cells, for example, in a biological sample.
- the kit may comprise at least one chemotherapeutic or cytotoxic reagent.
- the kit may comprise an antifolate compound.
- the kit may comprise at least one diagnostic reagent.
- An example of a diagnostic reagent is a detectable label, for example but not limited to a radioactive, fluorescent, or chromophoric agent (e.g., 111 In-DOTA).
- the detectable label may comprise an enzyme.
- the kit may comprise instructions and/or means for administering the antibody or antibody composition, for example, by injection.
- the methods of the invention include methods of detecting dysplastic or cancer cells presenting FR- ⁇ on the surface, including but not limited to ovarian, breast, lung, endometrial, renal, colorectal, or brain carcinoma cells.
- the method may be performed in vitro on a biological sample or in vivo.
- Methods of detecting dysplastic cells according to the invention comprise contacting anti-FR- ⁇ antibody of the invention with a biological sample or administering anti-FR- ⁇ antibody of the invention to a patient, wherein the antibody is labeled with a detectable label, for example but not limited to a radioactive, fluorescent, or chromophoric agent (e.g., 111 In-DOTA), and determining binding of the antibody to cells.
- the detectable label may be an enzyme.
- the methods of the invention are suitable for use in humans and non-human animals identified as having a neoplastic condition associated with an increased expression of FR- ⁇ .
- Non-human animals which benefit from the invention include pets, exotic (e.g., zoo animals), and domestic livestock.
- the non-human animals are mammals.
- the invention is suitable for use in a human or animal patient that is identified as having a dysplastic disorder that is marked by increased expression of FR- ⁇ in the neoplasm in relation to normal tissues.
- the method of the invention may be applied to effect treatment of the condition.
- Tumors that may be treated include, but are not limited to ovarian, breast, renal, colorectal, lung, endometrial, brain, fallopian tube, or uterine tumors, and certain leukemia cells.
- the tumor is cisplatin-resistant.
- the antibodies and derivatives thereof for use in the invention may be administered orally in any acceptable dosage form such as capsules, tablets, aqueous suspensions, solutions or the like.
- the antibodies and derivatives thereof may also be administered parenterally including but not limited to: subcutaneous, intravenous, intramuscular, intra-articular, intra-synovial, intrasternal, intranasal, topically, intrathecal, intrahepatic, intralesional, and intracranial injection or infusion techniques.
- the antibodies will be intravenously or intraperitoneally, for example, by injection.
- the antibodies and derivatives of the invention may be administered alone or with a pharmaceutically acceptable carrier, including acceptable adjuvants, vehicles and excipients, for example, phosphate buffered saline.
- a pharmaceutically acceptable carrier including acceptable adjuvants, vehicles and excipients, for example, phosphate buffered saline.
- the antibodies and derivatives of the invention may also be administered with one or more antifolate compounds that are used to treat cancer.
- the antifolate compounds include, but are not limited to 5-fluoro-2′-deoxy-uridine-5′-monophosphate (FdUMP); 5-fluorouracil (5-FU); L-5-formyltetrahydrofolate (“leucovorin”); N-[5-(N-(3,4-dihydro-2-methyl-4-oxoquinazolin-6-yl-methyl)-amino)-2-thenyl)]-L-glutamic acid (“ZD1649”; also known as “Tomudex”) (Jackman et al.(1991) Cancer Res.
- FdUMP 5-fluorouracil
- leucovorin L-5-formyltetrahydrofolate
- ZD1649 N-[5-(N-(3,4-dihydro-2-methyl-4-oxoquinazolin-6-yl
- the antifolate compounds may be administered before, after, or simultaneously with the anti-FR- ⁇ antibodies of the invention.
- the amounts of antifolate compounds to be administered may be the dosages currently used, or may be increased or decreased, as can readily be determined by a physician based on achieving decreased tumor growth or tumor elimination without causing any untoward effects on the patient.
- the effective dosage will depend on a variety of factors. It is well within the purview of a skilled physician to adjust the dosage for a given patient according to various parameters such as body weight, the goal of treatment, the highest tolerated dose, the specific formulation used, the route of administration and the like. Generally, dosage levels of between about 5.88 mg/m 2 and about 294.12 mg/m 2 (i.e., 10 to 500 mg antibody) per day of the antibody or derivative thereof are suitable. In some embodiments, the dose will be about 29.41 mg/m 2 to about 176.47 mg/m 2 (i.e., 50 to 300 mg antibody) per day of the antibody or derivative thereof.
- the dose will be about 58.82 mg/m 2 to about 147.06 mg/m 2 (i.e., 100 to 250 mg antibody) per day. In still other embodiments, the dose will be about 88.24 mg/m 2 to about 117.65 mg/m 2 (i.e., 150 to 200 mg antibody) per day. Dosing may be as a bolus or an infusion. Dosages may be given once a day or multiple times in a day. Further, dosages may be given multiple times of a period of time. In some embodiments, the doses are given every 1-14 days. In some embodiments, the antibodies or derivatives thereof are given as a dose of about 10 to 500 mg i.p. In other embodiments, the antibodies of derivatives thereof are provided at about 50 to 300 mg i.v. In still other embodiments, the antibodies or derivatives thereof are provided such that a plasma level of at least about 1 ug/ml is maintained.
- Effective treatment may be assessed in a variety of ways.
- effective treatment is determined by a slowed progression of tumor growth.
- effective treatment is marked by shrinkage of the tumor (i.e., decrease in the size of the tumor determined, for example, using Response Evaluation Criteria in Solid Tumors (RECIST) available online through the National Cancer Institute Cancer Therapy Evaluation Program).
- effective treatment is marked by inhibition of metastasis of the tumor.
- effective therapy is measured by increased well-being of the patient including such signs as weight gain, regained strength, decreased pain, thriving, and subjective indications from the patient of better health.
- Murine antibody LK26 was raised against choriocarcinoma cell line Lu-75(c). LK26 was humanized by CDR grafting, yielding an IgG (IgG1/ ⁇ subtype) expressed in NS0 cell lines, according to the method of U.S. Pat. No. 6,124,106.
- the NS0 cell line was transfected with a hPMS2-134 expression plasmid.
- the MMR gene was cloned into the pEF expression vector, which contains the elongation factor promoter upstream of the cloning site followed by a mammalian polyadenylation signal. This vector also contains the NEOr gene that allows for selection of cells retaining this plasmid.
- telomeres were transfected with 1 ⁇ g of each vector using polyliposomes following the manufacturer's protocol (Life Technologies). Cells were then selected in 0.5 mg/ml of G418 for 10 days and G418 resistant cells were pooled together to analyze for gene expression.
- the pEF construct contains an intron that separates the exon 1 of the EF gene from exon 2, which is juxtaposed to the 5′ end of the polylinker cloning site. This allows for a rapid reverse transcriptase polymerase chain reaction (RT-PCR) screen for cells expressing the spliced products. Cells were isolated and their RNA extracted using the trizol method as previously described (Nicolaides N. C., Kinzler, K. W., and Vogelstein, 8. (1995) Analysis of the 5′ region of PMS2 reveals heterogeneous transcripts and a novel overlapping gene. Genomics 29:329-334).
- Heavy chain RNA was reverse transcribed using a forward primer (5′-GATCGGATCCACCATGGGATGGAGCTGTATCATCC-3′ (SEQ ID NO:21)) and reverse primer (5′-CTGATCTAGATCATTTCCCGGGAGACAGGGAGAGGCTCTTCTGCGTGTA-3′ (SEQ ID NO:22)).
- Light chain RNA was reverse transcribed using a forward primer of SEQ ID NO:21 and a reverse primer (5′-CTGATCTAGATTAACACTCTCCCCTGTTGAAGCTCTT-3′ (SEQ ID NO:23)). PCR reactions were carried out with high fidelity HERCULASE DNA polymerase (STRATAGENE, La Jolla, Calif.).
- Vector pEF4 (INVITROGEN) is a 5.8 kb vector carrying the zeocin resistance gene for selection of stable transfectants in eukaryotic cells.
- the cDNA insert is cloned downstream of hEF-intron 1, and its transcription is controlled by the human EFIalpha promoter. Downstream of the cDNA insert is the BGH polyadenylation signal allowing for efficient polyadenylation of the transcript.
- Vector pEF6 (INVITROGEN) is similar to pEF4 but carries the blasticidin resistance gene instead of the zeocin resistance gene. The sequence of both strands of the cDNA inserts was verified.
- CHO-KL ATCC CCL-611 cells.
- CHO-K1 cells were transfected with 0.5 micrograms of each plasmid using FUGENE transfection reagent (Roche) according to the manufacturer's instructions.
- Cells were maintained in RPMI1640/10%FBS/2 mM L-glutamine.
- Stable cell lines were selected with Zeocin (200 micrograms/milliliter) and Blasticidin (5 micrograms/milliliter). Expression of antibody was verified by anti-human IgG ELISA.
- Stably transfected pools of cells were single cell cloned by limited dilution and high expressor cell lines were selected. High titers were verified in secondary and tertiary screens.
- the cell line was adapted to serum-free medium (CHO-S-SFMII followed by EX-CELL 302). Antibody production was verified by ELISA.
- the cell line also was adapted to protein-free CHO media (CD94111; Irvine Scientific) plus 8 mM L-glutamine with a soy hydrolysate pulse at day 2. Cells were stored for use in liquid nitrogen. The cells were stable for at least 13 passages in the absence of selection media as determined by FACS analysis. Cell secretion was stable for at least 20 passages as determined by ELISA. Large scale antibody production is possible. For example, antibody was produced in a bioreactor on a scale of 15 L, 70 L, and 340 L.
- FIG. 4 outlines the screening procedure to identify clones that produce high affinity MAbs.
- the assay employs the use of a plate Enzyme Linked Immunosorbant Assay (ELISA) to screen for clones that produce high-affinity MAbs.
- ELISA Enzyme Linked Immunosorbant Assay
- 96-well plates containing single immunoglobulin-producing cells are grown in growth medium plus 0.5 mg/ml G418 to ensure clones retain the expression vector. Plates are screened using an hIgG plate ELISA, whereby a 96 well plate is coated with FR- ⁇ . Alternatively, the plate is coated with a specific antibody against the anti-FR- ⁇ antibody. As another alternative in cases in which the immunoglobulin-producing cell is non-human, the plate may be coated with anti-human IgG1 antibody. Plates are washed 3 times in calcium and magnesium free phosphate buffered saline solution (PBS ⁇ / ⁇ ) and blocked in 100 ⁇ ls of PBS ⁇ / ⁇ with 5% dry milk for 1 hour at room temperature.
- PBS ⁇ / ⁇ calcium and magnesium free phosphate buffered saline solution
- Wells are rinsed and incubated with 100 ⁇ ls of a PBS solution containing a 1:5 dilution of conditioned medium from each cell clone for 2 hours. Plates are then washed 3 times with PBS ⁇ / ⁇ and incubated for 1 hour at room temperature with 50 ⁇ ls of a PBS ⁇ / ⁇ solution containing 1:3000 dilution of a sheep anti-mouse horse radish peroxidase (HRP) conjugated secondary antibody such as anti-human IgG antibody. Plates are then washed 3 times with PBS ⁇ / ⁇ and incubated with 50 ⁇ ls of TMB-HRP substrate (BioRad) for 15 minutes at room temperature to detect amount of antibody produced by each clone.
- HRP horse radish peroxidase
- ELISAs are also performed on conditioned (CM) from the same clones to measure total Ig production within the conditioned medium of each well. Clones that produce an increased ELISA signal and have increased antibody levels are then further analyzed for variants that are substantially free of FR- ⁇ binding competitors.
- Clones that produce higher OD values as determined by ELISA are further analyzed at the genetic level to confirm the absence of FR- ⁇ binding competitors hence yielding a stronger ELISA signal. Briefly, 100,000 cells are harvested and extracted for RNA using the Triazol method as described above. RNAs are reverse transcribed using Superscript II as suggested by the manufacturer (Life Technology) and PCR amplified for the antigen binding sites contained within the variable light and heavy chains.
- PCR reactions using degenerate oligonucleotides are carried out at 94° C. for 30 sec, 52° C. for 1 mm, and 72° C. for 1 min for 35 cycles. Products are analyzed on agarose gels. Products of the expected molecular weights are purified from the gels by Gene Clean (Bio 101), cloned into T-tailed vectors, and sequenced to identify the sequence of the variable light and heavy chains. Once the wild type sequence has been determined, nondegenerate primers are made for RT-PCR amplification of positive clones. Both the light and heavy chains are amplified, gel purified and sequenced using the corresponding sense and antisense primers. The sequencing of RT-PCR products gives representative sequence data of the endogenous immunoglobulin gene and not due to PCR-induced mutations. Sequences from clones are then compared to the wild type sequence.
- the methods of the invention yielded an anti-FR- ⁇ antibody comprising a heavy chain comprising an amino acid sequence of SEQ ID NO:5 and a light chain comprising an amino acid sequence of SEQ ID NO:2.
- the molar extinction coefficient ( ⁇ ) of the antibody was determined to be 43,320 by measurement of the asorbance at 280 nm of 7.41 mg.ml solution of antibody in 20 mM potassium phosphate, 150 mM NaCl at pH 7.2.
- Mr 135 kD A single major band of Mr 135 kD was observed upon separation of the antibody in SDS-PAGE under nonreducing conditions. Two bands of Mr ⁇ 55kD and Mr ⁇ 25kD were observed upon reduction. Purity was ascertained by densitometric analysis of colloidal Coomassie blue-stained gels and found to be greater than about 99.5% under reducing conditions and greater than about 99% under nonreducing conditions.
- K D Kinetic and steady-state binding constants between the antibody of the invention and purified FR- ⁇ were determined by surface plasmon resonance spectroscopy.
- On-rate (k a ) was determined to be (2.25 ⁇ 0.02 ) M ⁇ 1 s ⁇ 1
- off-rate (kd) was determined to be (5.02 ⁇ 0.08) s ⁇ 1 .
- K D steady state dissociation constant
- SK-Ov-3 and IGROV tumor cells were grown in nude mice and excised. Tumor tissues were lysed in RIPA buffer with 15-20 strokes in a 2 ml Dounce tissue homogenizer. Insoluble material was removed by centrifugation and the total protein of the supernate was determined using a BioRad protein Assay. In different experiments, either 5 ug or 20 ug of protein was run on a 4-12% Bis-Tris gel (MES) under non-reducing conditions. The electrophoresed protein was transferred to a PVDF membrane. The membrane was blocked in Blotto (5% milk, 0.05% TBS-T).
- MES Bis-Tris gel
- JAR cells were propagated in RPMI1640 medium containing 10% FBS, L-glutamine, sodium pyruvate, non-essential amino acids and penicillin/streptomycin. The medium was removed from the cells and RIPA buffer was added directly to the culture plates to lyse the cells for JAR cell extract controls. Samples were separated on a 4-12% NuPAGE gel (MES) and transferred to a PVDF membrane. After overnight blocking in TBST+5% milk, the membrane was probed with 1:1000 dilution of mAb LK26 for 1 hr followed by a 1:10000 dilution of secondary antibody (goat ⁇ -mouse Ig conjugated to horseradish peroxidase) for 1 hr.
- MES 4-12% NuPAGE gel
- the samples were loaded on a 4-12% Bis-Tris gel in MES running buffer. Following electrophoresis, the protein was transferred to a PVDF membrane. The membrane containing the transferred protein was blocked for 48 hrs at room temperature in Blotto (5% skim milk, 1 ⁇ TBS, 0.05% Tween-20). The membrane was developed by incubating the membrane with a primary antibody (1 ug/ml LK26 antibody) followed by washing, then incubation with a secondary antibody (HRP-conjugated goat ⁇ -mouse IgG in Blotto). Following another washing step, the membrane was developed using a Super Signal West Pico ECL reagent and exposed for 1 minute. The results are shown in FIG.
- the mAb-producing cells expressing the hPMS-134 will be subcloned by liming dilution and seeded in a flat-bottom 96-well plate. Seeding density will be determined empirically in order to obtain 40 single-cell colonies per plate to approximate monoclonality.
- the clones will be allowed to grow for a number of days, which will be empirically determined, after which a sufficient amount of antibody, capable of mediating ADCC activity, is produced. At the end of the incubation period, 50 ul of conditioned medium from each clone/well will be used to assess concentration of antibodies by ELISA, while another 50 ul of conditioned medium from the same well/clone will be utilized in the ADCC assay.
- an anti-ovarian cancer mAb is used in conjunction with the target cells, SKOV3 (passage 1 to 20, obtained from ATCC), which are seeded the day before the assay in a flat-bottom 96-well microplate at a density of 30,000 cell/well in complete growth medium (RPMI-1640 containing 10% FBS, 2 mM L-glutamine). The following day, the complete medium is replaced with 100 ul of CHO-CD serum-free medium and 50 ul of antibody-containing conditioned medium will be added to target cells and incubated for 20 minutes at 37° C.
- SKOV3 passage 1 to 20, obtained from ATCC
- Lead clones will be expanded to 50 ml cultures and antibody will be purified from their conditioned media by protein-A affinity column as described. ADCC activities of the antibodies produced by the lead clones will be compared to the parental antibody using concentrations ranging from 10-1000 ng/ml.
- ADCC assay the ability of antibody to produce ADCC was evaluated using SKOV-3, IGROV-1, and 1205 Lu (negative control) as target cells, and PBMCs from normal blood donors. Antibody was tested at a concentration of 10 micrograms/milliliter. Donor PBMCs used as effector cells were thawed and kept overnight in medium (IMDM supplemented with 10% FCS). The cells were resuspended in medium at a concentration of 10 7 cells/milliliter. The tumor cells used as target cells were detached from the culture flask and 10 6 cells in 100 microliters FCS were labeled with 100 uCi (3.7 MBq) 51 Cr (Amersham, Buckinghamshire, UK) for 2 hours at 37° C.
- ADCC assays using human ovarian cancer cells as target and peripheral blood mononuclear cells (PBMCs) as effector cells showed that anti-FR- ⁇ antibody mediated killing of tumor cell line SKOV-3.
- IGROV-1 aggregated very quickly and tended to form cell clumps. The cell line was sensitive to killing by PBMCs alone. Control antibody also mediated some killing. Antibody mediated killing of IGROV-1.
- Tissue preparation Human tissue samples were obtained at autopsy or biopsy. Tissues tested included adrenal, blood cells (granulocytes, lymphocytes, monocytes, platelets), blood vessels (endothelium), bone marrow, brain (cerebrum (cortex), cerebellum), breast (mammary gland), eye, gastrointestinal tract (colon (large intestine), esophagus, small intestine, stomach), heart, kidney (glomerulus, tubule), liver, lung, lymph node, ovary and fallopian tube (oviduct), pancreas, parathyroid, peripheral nerve, pituitary, placenta, prostate, salivary gland, skin, spinal cord, spleen, striated (skelet al) muscle, testis, thymus, thyroid, tonsil, ureter, urinary bladder, uterus (body (endometrium), cervix), ovarian carcinoma (carcinoma cells), ovarian carcinoma (stromal fibroblasts).
- adrenal blood cells
- Fresh unfixed tissue samples were placed in molds and frozen on dry ice in TISSUE-TEK O.C.T. embedding medium. Tissue samples were sectioned and fixed for 10 minutes in room temperature acetone. Tissues were stored below ⁇ 70° C. until staining. Just prior to staining, the slides were fixed in 10% neutral buffered formalin.
- Antibody preparation was applied to tissue samples at two concentrations: 1 microgram/milliliter and 25 micrograms/milliliter.
- Assays lacking primary antibody were used as an assay control.
- Mouse anti-fluorescein was used as secondary antibody.
- Goat anti-mouse IgG (GAMIgG)-peroxidase polymer was used as tertiary antibody.
- 3,3′-diaminobenzidinen (DAB) was used as substrate chromogen.
- the anti-FR- ⁇ antibody specifically and intensely stained human ovarian carcinoma cells (HT162) at both antibody concentrations as a positive control.
- Anti-FR- ⁇ antibody did not react with ovarian carcinoma (stromal fibroblasts) (negative control).
- Negative control antibodies HuIgG1 and MsIgG1 did not specifically react with the positive or negative control cells. No reactivity was observed with any tissues when primary antibody was omitted from the staining reaction. See Table 1.
- Tissue Cross-Reactivity of Anti-FR- ⁇ Antibody TABLE 5 Cancer-specific expression of target antigen % positive Total number Tumor tissue Expression samples of of samples origin by IHC total tested tested (n) Normal adult ⁇ 0 62 Ovarian +++++ 91 136 carcinoma cells Breast ++++ 21 53 Renal ++++ 50 18 Colorectal +++ 22 27 Lung +++ 33 18 Endometrial +++ 91 11 Brain +++ 80 5 Melanoma ⁇ 0 8 lymphoma ⁇ 0 32 +/ ⁇ indicates level of expression as detected by immunohistochemistry
- the antibodies of the invention do not react with stromal fibroblasts of ovarian carcinoma tissue (data not shown). Similar results for immunohistochemical and tissue distribution analyses were obtained with the antibodies of the invention in cynomolgus monkey and human (data not shown). Positive binding is seen in the cynomolgus monkey kidney cortex (proximal tubules and collecting ducts) and epithelium, tubular (membrane, cytoplasm/cytoplasmic granules), and uctules (membrane, cytoplasm) (data not shown).
- ovarian carcinoma tissue In neoplastic human tissues, anti-FR- ⁇ antibody specific staining was observed in ovarian carcinoma tissue, endometrial carcinoma tissue, and renal carcinoma tissue. Staining of ovarian and renal carcinoma cells occurred at the membrane and cytoplasm (data not shown).
- FR- ⁇ is a glycoprotein whose expression is highly restricted in normal tissues and highly expressed in a large portion of ovarian tumors.
- Anti-FR- ⁇ antibodies of the invention are capable of inducing ADCC, thus making the antibodies of the invention excellent drug candidates for the treatment of a variety of cancers, including ovarian cancer.
- CM-dextran surface which forms an extended hydrogel in solution, projecting roughly 100-150 nm into the flowcell, may be derivatized further with a ligand of choice by covalent immobilization to the carboxyl groups present on the CM-dextran layer.
- the angle necessary to allow the evanescent wave to interact with the gold layer will depend on the angle necessary to observe TIR, which in turn depends on the thickness or mass at the surface of the chip.
- the instrument thus allows for observation of the change in mass at the surface of the chip over time, as would be observed when an analyte which interacts with the immobilized ligand is injected into the flowcell. If injection of analyte is followed by injection of buffer, one can follow both the association (during injection of the analyte) and dissociation phases (during buffer injection) of the binding. Kinetic on-rates (k a ) and off-rates (k d ), as well as steady-state equilibrium constants (K a and K d ) can thus be extrapolated.
- the soluble, secreted form of the antigen will be purified from the serum-free culture supernatant of target cells by chromatography through Phenyl Sepharose (high sub), followed by ion exchange on S Sepharose Fast Flow. Briefly, culture supernatant containing secreted antigen will be loaded onto the Phenyl Sepharose (high sub) column in the absence of additional salts. Unbound proteins will be removed by extensive washing in HIC A (20 mM K phosphate pH 7.2), followed by elution of bound antigen using a linear gradient of 0-20 mM CHAPS in HIC buffer.
- Peak anti-FR- ⁇ antibody-containing fractions will be pooled, acidified (pH 5.5) with 1 M citrate, then applied to a S Sepharose cation exchange column. After washing with IEX buffer (20 mM K phosphate, pH 5.5), bound antigen will be eluted using a linear gradient of 0-1 M NaCl in IEX buffer. Peak fractions will be pooled, concentrated using a Centricon centrifugal concentration device (Millipore), and dialyzed against PBS. Based on the purity of the antigen preparation, an additional affinity chromatography step on covalently coupled folate Sepharose resin may be necessary (Sadasivan, E., da Costa, M., Rothenberg, S P. and Brink, L. Biochim. Biophys. Acta 1987;(925):36-47).
- the antibody to be assayed will be purified in one step by affinity chromatography on recombinant protein A Sepharose resin (RPA-Sepharose, Amersham Biosciences). Immunoglobulin (Ig) containing tissue culture supernatants will be loaded onto RPA-Sepharose columns by gravity, at an Ig/ml resin value of 10 mg/mL of resin. Unbound proteins will be removed by extensive washing with PBS, followed by elution using 0.1 M glycine-HCl pH 2.6. Fractions will be neutralized with 1 M Tris. Peak fractions will be pooled, and dialyzed against 1000 volumes of PBS. Ig concentration will be determined by BCA protein assay (Pierce Chemical Co.) and Ig-specific ELISA.
- Purified antigen will be diluted into coupling buffer (10 mM NaOAc pH 5.0), and immobilized onto the flowcell of a CM5 sensor chip (Biacore) by amine coupling, using a mixture of N-hydroxysuccinimide (NHS) and 1-ethyl-3-[dimethylaminopropyl]carbodiimide hydrochloride (EDC) to activate carboxyl groups in the CM-Dextran hydrogel attached to the surface of the CM5 sensor chip. Activated, underivatized carboxyl groups will be quenched with 1 M ethanolamine. A reference flowcell, consisting of the quenched CMDextran surface, activated in the absence of antigen, will be used to normalize all measurements.
- coupling buffer 10 mM NaOAc pH 5.0
- EDC 1-ethyl-3-[dimethylaminopropyl]carbodiimide hydrochloride
- mAb-containing culture supernatants, or purified mAb preparations will be injected at flow rates of 30 ul/min for kinetic assays, and 5 ul/mm for steady-state affinity ranking experiments, using HBS-EP (20 mM HEPES-OH, 150 mM NaCl, 3 mM EDTA, 0.005% Surfactant P-20, pH 7.4) as running buffer.
- HBS-EP 20 mM HEPES-OH, 150 mM NaCl, 3 mM EDTA, 0.005% Surfactant P-20, pH 7.4
- Purified mAb preparations will be dialyzed against HBS-EP, using 10K MWCO Slide-A-Lyzer dialysis cassettes (Pierce) prior to their use in Biacore analysis.
- CM-Dextran For samples containing tissue culture supernatant, BSA and soluble CM-Dextran will be added to final concentrations of 1% and 1 mg/ml, respectively. Regeneration of the surface will be accomplished by 30 second injection of 50 mM NaOH, at a flow rate of 100 ul/min. Data analysis will be performed using Bia Evaluation software (Biacore). Kinetic data will be fitted to a simple 1:1 (Langmuir) binding model. For ranking experiments, rank will be determined by K D values obtained from plots of Req versus C at different concentrations of sample.
- the SKOV-3 tumor cell line has been shown to express FR- ⁇ both on cells in culture and in tumor xenografts.
- Antibody may be evaluated in vivo using the tumor xenograft model of SKOV-3 cells in mice. Paclitaxel may be used as a positive control.
- Negative controls may be isotype matched, nonspecific murine IgG and vehicle control. Inhibition of tumor growth by the antibody relative to the negative controls is an indication that the antibody is useful in the treatment of ovarian cancer.
- the antibody preferably demonstrates tumor growth inhibition of at least about 58%.
- SRB sulforhodamine B test
- Shekan et al. (1990) J. Nat. Cancer Inst. 82:107-112, as modified by Keepers et al. (1991) Eur. J. Cancer 27:897-900 may be used to test the effect of antibody treatment on the susceptibility of cancer cells to treatment with antifolate compounds. Briefly (as described in Backus et al. (2000) Int. J. Cancer 87:771-778, cells are seeded in 100 ul medium (suitable for use with each particular cell line chosen for testing) in 96-well flat-bottom plates (in triplicate).
- Seeding density may vary according to the cell type used, but may be, for example, 8,000 cells/well for colon cancer cells,15,000 cells/well for squamous cell carcinoma cells of the head and neck.
- the cells are cultured in the presence of 1-100 ug/ml anti-folate receptor antibody. After 24 hours, 100 ul of drug containing medium is added and cells are cultured for an additional 72 hours.
- the concentration of drugs such as 5-fluoro-2′-deoxy-uridine-5′-monophosphate (FdUMP), leucovorin, ZD1649, MTA, GW1843U89, ZD9331, AG337, and PT523 ranges from 1 ⁇ 10 ⁇ 5 to 1 ⁇ 10 ⁇ 11 M.
- 5-FU is tested in a range of 1 ⁇ 10 ⁇ 4 to 1 ⁇ 10 ⁇ 10 M with or without 10 uM leucovorin.
- TCA trichloroacetic acid
- Results are expressed as % of control growth based on the difference in optical density (OD 540 ) at the beginning and end of the drug exposure period according to the formula published by Peters et al. ((1993) Int. J. Cancer 54:450-455): [(OD treated /OD start of exposure ) ⁇ 1/[(OD control /OD start of exposure ) ⁇ 1] ⁇ 100%.
- IC 50 values are calculated based on absorption values defined as drug concentration corresponding to a reduction of cellular growth by 50% when compared with values of untreated control cells.
- efficacy may be demonstrated in vitro using the assay described above for ovarian cancer cell lines and the monoclonal antibodies of the invention.
- One of skill in the art may extrapolate dosages from the in vitro efficacy assays to determine a range of efficacy in patients.
- dosages of antibodies accepted in the art for administration can be matched with dosages accepted for various folate inhibitors and adjusted to achieve maximum benefit with the minimum dosage.
- One of skill in the art is able to adjust these dosages to achieve the desired effect with routine experimentation particularly with the guidance on dosage for antibodies provided above and the assay described for determining an effect in vitro.
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Immunology (AREA)
- Organic Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Molecular Biology (AREA)
- Biochemistry (AREA)
- Cell Biology (AREA)
- Engineering & Computer Science (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Biophysics (AREA)
- Genetics & Genomics (AREA)
- Hematology (AREA)
- Urology & Nephrology (AREA)
- Biomedical Technology (AREA)
- Oncology (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Pharmacology & Pharmacy (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Biotechnology (AREA)
- Physics & Mathematics (AREA)
- Analytical Chemistry (AREA)
- Food Science & Technology (AREA)
- General Physics & Mathematics (AREA)
- Pathology (AREA)
- Microbiology (AREA)
- Hospice & Palliative Care (AREA)
- Gynecology & Obstetrics (AREA)
- Pregnancy & Childbirth (AREA)
- Reproductive Health (AREA)
- Epidemiology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
Priority Applications (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US11/056,776 US20050232919A1 (en) | 2004-02-12 | 2005-02-11 | Monoclonal antibodies that specifically block biological activity of a tumor antigen |
| US12/500,144 US9624297B2 (en) | 2004-02-12 | 2009-07-09 | Monoclonal antibodies that specifically block biological activity of a tumor antigen |
| US13/826,964 US9650440B2 (en) | 2004-02-12 | 2013-03-14 | Monoclonal antibodies that specifically block biological activity of a tumor antigen |
| US15/454,412 US10509037B2 (en) | 2004-02-12 | 2017-03-09 | Monoclonal antibodies that specifically block biological activity of a tumor antigen |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US54436404P | 2004-02-12 | 2004-02-12 | |
| US11/056,776 US20050232919A1 (en) | 2004-02-12 | 2005-02-11 | Monoclonal antibodies that specifically block biological activity of a tumor antigen |
Related Child Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US12/500,144 Division US9624297B2 (en) | 2004-02-12 | 2009-07-09 | Monoclonal antibodies that specifically block biological activity of a tumor antigen |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| US20050232919A1 true US20050232919A1 (en) | 2005-10-20 |
Family
ID=34886025
Family Applications (4)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US11/056,776 Abandoned US20050232919A1 (en) | 2004-02-12 | 2005-02-11 | Monoclonal antibodies that specifically block biological activity of a tumor antigen |
| US12/500,144 Active 2026-08-01 US9624297B2 (en) | 2004-02-12 | 2009-07-09 | Monoclonal antibodies that specifically block biological activity of a tumor antigen |
| US13/826,964 Active 2026-03-16 US9650440B2 (en) | 2004-02-12 | 2013-03-14 | Monoclonal antibodies that specifically block biological activity of a tumor antigen |
| US15/454,412 Expired - Lifetime US10509037B2 (en) | 2004-02-12 | 2017-03-09 | Monoclonal antibodies that specifically block biological activity of a tumor antigen |
Family Applications After (3)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US12/500,144 Active 2026-08-01 US9624297B2 (en) | 2004-02-12 | 2009-07-09 | Monoclonal antibodies that specifically block biological activity of a tumor antigen |
| US13/826,964 Active 2026-03-16 US9650440B2 (en) | 2004-02-12 | 2013-03-14 | Monoclonal antibodies that specifically block biological activity of a tumor antigen |
| US15/454,412 Expired - Lifetime US10509037B2 (en) | 2004-02-12 | 2017-03-09 | Monoclonal antibodies that specifically block biological activity of a tumor antigen |
Country Status (6)
| Country | Link |
|---|---|
| US (4) | US20050232919A1 (enExample) |
| EP (3) | EP2316857A1 (enExample) |
| JP (1) | JP4805848B2 (enExample) |
| AU (1) | AU2005214331B2 (enExample) |
| CA (1) | CA2556027C (enExample) |
| WO (1) | WO2005080431A2 (enExample) |
Cited By (31)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20040235108A1 (en) * | 2003-05-23 | 2004-11-25 | Luigi Grasso | Monoclonal antibodies that specifically bind a tumor antigen |
| US20060239910A1 (en) * | 2005-04-22 | 2006-10-26 | Morphotek Inc. | Antibodies with immune effector activity and that internalize in folate receptor alpha-positive cells |
| US20090274697A1 (en) * | 2004-02-12 | 2009-11-05 | Luigi Grasso | Monoclonal Antibodies That Specifically Block Biological Activity Of A Tumor Antigen |
| WO2012061759A2 (en) | 2010-11-05 | 2012-05-10 | Morphotek Inc. | Folate receptor alpha as a diagnostic and prognostic marker for folate receptor alpha-expressing cancers |
| WO2012054654A3 (en) * | 2010-10-20 | 2012-08-02 | Morphotek, Inc. | Anti-folate receptor alpha antibody glycoforms |
| WO2013012722A1 (en) | 2011-07-15 | 2013-01-24 | Eisai R&D Management Co., Ltd. | Anti-folate receptor alpha antibodies and uses thereof |
| US8980864B2 (en) | 2013-03-15 | 2015-03-17 | Moderna Therapeutics, Inc. | Compositions and methods of altering cholesterol levels |
| US8999380B2 (en) | 2012-04-02 | 2015-04-07 | Moderna Therapeutics, Inc. | Modified polynucleotides for the production of biologics and proteins associated with human disease |
| US9107886B2 (en) | 2012-04-02 | 2015-08-18 | Moderna Therapeutics, Inc. | Modified polynucleotides encoding basic helix-loop-helix family member E41 |
| US9181319B2 (en) | 2010-08-06 | 2015-11-10 | Moderna Therapeutics, Inc. | Engineered nucleic acids and methods of use thereof |
| US9186372B2 (en) | 2011-12-16 | 2015-11-17 | Moderna Therapeutics, Inc. | Split dose administration |
| US9207238B2 (en) | 2012-12-07 | 2015-12-08 | Kyowa Hakko Kirin Co., Ltd. | Anti-FOLR1 antibody |
| US9283287B2 (en) | 2012-04-02 | 2016-03-15 | Moderna Therapeutics, Inc. | Modified polynucleotides for the production of nuclear proteins |
| US9334328B2 (en) | 2010-10-01 | 2016-05-10 | Moderna Therapeutics, Inc. | Modified nucleosides, nucleotides, and nucleic acids, and uses thereof |
| US9402865B2 (en) | 2011-01-18 | 2016-08-02 | The Trustees Of The University Of Pennsylvania | Compositions and methods for treating cancer |
| US9428535B2 (en) | 2011-10-03 | 2016-08-30 | Moderna Therapeutics, Inc. | Modified nucleosides, nucleotides, and nucleic acids, and uses thereof |
| US9464124B2 (en) | 2011-09-12 | 2016-10-11 | Moderna Therapeutics, Inc. | Engineered nucleic acids and methods of use thereof |
| US9533047B2 (en) | 2011-03-31 | 2017-01-03 | Modernatx, Inc. | Delivery and formulation of engineered nucleic acids |
| US9572897B2 (en) | 2012-04-02 | 2017-02-21 | Modernatx, Inc. | Modified polynucleotides for the production of cytoplasmic and cytoskeletal proteins |
| US9597380B2 (en) | 2012-11-26 | 2017-03-21 | Modernatx, Inc. | Terminally modified RNA |
| US9598489B2 (en) | 2012-10-05 | 2017-03-21 | The Trustees Of The Univeristy Of Pennsylvania | Human alpha-folate receptor chimeric antigen receptor |
| WO2018098277A1 (en) | 2016-11-23 | 2018-05-31 | Eisai R&D Management Co., Ltd | Anti-folate receptor alpha antibodies and uses thereof |
| US10323076B2 (en) | 2013-10-03 | 2019-06-18 | Modernatx, Inc. | Polynucleotides encoding low density lipoprotein receptor |
| WO2019177372A1 (ko) | 2018-03-14 | 2019-09-19 | (주)알테오젠 | Folr1에 특이적으로 결합하는 항체 및 그의 용도 |
| US10815291B2 (en) | 2013-09-30 | 2020-10-27 | Modernatx, Inc. | Polynucleotides encoding immune modulating polypeptides |
| US10870701B2 (en) | 2016-03-15 | 2020-12-22 | Generon (Shanghai) Corporation Ltd. | Multispecific fab fusion proteins and use thereof |
| US11013800B2 (en) | 2011-05-16 | 2021-05-25 | Evive Biotech Ltd. | Multi-specific Fab fusion proteins comprising a CD3-binding Fab fragment with N-terminal fusion to binding domains and methods of use |
| CN116462768A (zh) * | 2023-06-13 | 2023-07-21 | 浙江时迈药业有限公司 | 针对folr1的双特异性抗体及其用途 |
| EP4342488A1 (en) | 2022-09-26 | 2024-03-27 | Miltenyi Biotec B.V. & Co. KG | Chimeric antigen receptor specific for folate receptor 1 |
| WO2025034965A1 (en) * | 2023-08-09 | 2025-02-13 | Board Of Regents, The University Of Texas System | Targeted therapeutic delivery of lipid nanoparticles |
| US12460000B2 (en) | 2018-09-07 | 2025-11-04 | Itabmed (Hk) Limited | Anti-CD19 and anti-CD3 bispecific antigen binding proteins and uses thereof |
Families Citing this family (50)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| JP2007500508A (ja) * | 2003-07-29 | 2007-01-18 | モルフォテック、インク. | 抗体とエフェクター機能が増強された遺伝子組み換え抗体を作成する方法 |
| EP1900752A1 (en) | 2006-09-15 | 2008-03-19 | DOMPE' pha.r.ma s.p.a. | Human anti-folate receptor alpha antibodies and antibody fragments for the radioimmunotherapy of ovarian carcinoma |
| EP2126087A4 (en) | 2007-02-20 | 2010-10-27 | Anaptysbio Inc | METHODS FOR PRODUCING PHARMACOTHEQUES, AND USES THEREOF |
| AU2014203172B2 (en) * | 2010-02-24 | 2016-03-10 | Immunogen, Inc. | Folate Receptor 1 Antibodies and Immunoconjugates and Uses Thereof |
| TWI796132B (zh) * | 2010-02-24 | 2023-03-11 | 美商免疫遺傳股份有限公司 | 葉酸受體1抗體類和免疫共軛物類及彼等之用途 |
| CN102782131B (zh) | 2010-03-02 | 2015-08-05 | 协和发酵麒麟株式会社 | 修饰抗体组合物 |
| JP5881085B2 (ja) | 2011-03-18 | 2016-03-09 | 国立大学法人 鹿児島大学 | 膵臓癌の治療用及び診断用の組成物 |
| HRP20180358T1 (hr) * | 2011-04-01 | 2018-04-06 | Immunogen, Inc. | Postupci povećavanja djelotvornosti terapije raka usmjerene protiv folr1 |
| US9629918B2 (en) | 2012-02-29 | 2017-04-25 | Purdue Research Foundation | Folate receptor alpha binding ligands |
| MX362497B (es) * | 2012-05-15 | 2019-01-21 | Eisai Inc | Un anticuerpo que se une específicamente al receptor alfa del folato y usos del mismo. |
| US9200073B2 (en) * | 2012-08-31 | 2015-12-01 | Immunogen, Inc. | Diagnostic assays and kits for detection of folate receptor 1 |
| AU2013364065B2 (en) | 2012-12-21 | 2018-10-04 | Altrubio Inc. | Hydrophilic self-immolative linkers and conjugates thereof |
| JP6233933B2 (ja) * | 2012-12-25 | 2017-11-22 | 国立大学法人 鹿児島大学 | 葉酸リセプターα及びβを認識する抗体 |
| SG11201509043RA (en) * | 2013-05-14 | 2015-12-30 | Immunogen Inc | Anti-folr1 immunoconjugate dosing regimens |
| US20160311921A1 (en) | 2013-06-20 | 2016-10-27 | Morphotek ,Inc. | Methods for treatment of ovarian cancer |
| ES2883191T3 (es) | 2013-08-30 | 2021-12-07 | Immunogen Inc | Anticuerpos y ensayos para la detección del receptor 1 de folato |
| WO2015186823A1 (ja) * | 2014-06-06 | 2015-12-10 | 協和発酵キリン株式会社 | Folr1標的薬および葉酸代謝拮抗剤によるがん患者のための治療方法並びに医薬 |
| CA2952876A1 (en) * | 2014-06-20 | 2015-12-23 | Bioalliance C.V. | Anti-folate receptor alpha (fra) antibody-drug conjugates and methods of using thereof |
| HRP20240959T1 (hr) | 2014-11-20 | 2024-10-25 | F. Hoffmann - La Roche Ag | Kombinirana terapija bispecifičnom antigen vezujućom molekulom koja aktivira t stanice i antagonistom vezivanja osi pd-1 |
| MX2017006571A (es) | 2014-11-20 | 2017-09-29 | Hoffmann La Roche | Moleculas de union a antigeno biespecificas activadoras de celulas t. |
| PL3221357T3 (pl) | 2014-11-20 | 2020-11-02 | F. Hoffmann-La Roche Ag | Wspólne łańcuchy lekkie i sposoby zastosowania |
| EP3034130B1 (en) | 2014-12-19 | 2019-12-04 | Althia Health, S.L. | Monoclonal antibody for the diagnosis, treatment and/or prevention of brain tumors and brain lesions |
| EP3283886B1 (en) * | 2015-04-17 | 2020-01-15 | Eisai Inc. | Methods for treating lung cancer |
| HK1255141A1 (zh) | 2015-09-17 | 2019-08-09 | 伊缪诺金公司 | 包含抗folr1免疫缀合物的治疗组合 |
| TWI753875B (zh) | 2016-01-08 | 2022-02-01 | 美商美國全心醫藥生技股份有限公司 | 四價抗psgl-1抗體及其用途 |
| SMT202100416T1 (it) * | 2016-03-02 | 2021-09-14 | Eisai R&D Man Co Ltd | Coniugati anticorpo-farmaco a base di eribulina e metodi di uso |
| CA3177187A1 (en) | 2016-08-12 | 2018-02-15 | L.E.A.F Holdings Group Llc | Alpha and gamma-d polyglutamated antifolates and uses thereof |
| CA3090391A1 (en) | 2018-02-07 | 2019-08-15 | L.E.A.F. Holdings Group Llc | Gamma polyglutamated raltitrexed and uses thereof |
| US12076402B2 (en) | 2018-02-07 | 2024-09-03 | L.E.A.F. Holdings Group Llc | Alpha polyglutamated antifolates and uses thereof |
| WO2019157145A1 (en) | 2018-02-07 | 2019-08-15 | L.E.A.F. Holdings Group Llc | Gamma polyglutamated pemetrexed and uses thereof |
| EP3749317A4 (en) | 2018-02-07 | 2022-06-22 | L.E.A.F Holdings Group LLC | PEMETREXED ALPHA-POLYGLUTAMATE AND ASSOCIATED USES |
| WO2019157129A1 (en) | 2018-02-07 | 2019-08-15 | L.E.A.F. Holdings Group Llc | Alpha polyglutamated pralatrexate and uses thereof |
| US12128046B2 (en) | 2018-02-07 | 2024-10-29 | L.E.A.F. Holdings Group Llc | Alpha polyglutamated methotrexate and uses thereof |
| CA3090506A1 (en) | 2018-02-07 | 2019-08-15 | L.E.A.F. Holdings Group Llc | Alpha polyglutamated tetrahydrofolates and uses thereof |
| US12220431B2 (en) | 2018-02-07 | 2025-02-11 | L.E.A.F. Holdings Group Llc | Gamma polyglutamated antifolates and uses thereof |
| EP3749320A4 (en) | 2018-02-07 | 2022-03-09 | L.E.A.F Holdings Group LLC | ALPHA-POLYGLUTAMATED AMINOPTERIN AND ITS USES |
| EP3752157A4 (en) | 2018-02-14 | 2022-07-06 | L.E.A.F Holdings Group LLC | GAMMA-POLYGLUTAMATED LOMETREXOLE AND USES THEREOF |
| EP3752156A4 (en) | 2018-02-14 | 2021-10-27 | L.E.A.F Holdings Group LLC | GAMMA-POLYGLUTAMIZED PRALATREXATE AND USES THEREOF |
| CN111936145A (zh) | 2018-02-14 | 2020-11-13 | L.E.A.F.控股集团公司 | γ聚谷氨酸化氨甲蝶呤及其用途 |
| WO2019160732A1 (en) | 2018-02-14 | 2019-08-22 | L.E.A.F. Holdings Group Llc | Gamma polyglutamated aminopterin and uses thereof |
| CA3090992A1 (en) | 2018-02-14 | 2019-08-22 | L.E.A.F. Holdings Group Llc | Gamma polyglutamated tetrahydrofolates and uses thereof |
| SG11202007494TA (en) * | 2018-03-13 | 2020-09-29 | Phanes Therapeutics Inc | Anti-folate receptor 1 antibodies and uses thereof |
| IL316090A (en) | 2018-06-01 | 2024-12-01 | Eisai R&D Man Co Ltd | Antibody-drug conjugates of splicing modulators and methods of use |
| US12331320B2 (en) | 2018-10-10 | 2025-06-17 | The Research Foundation For The State University Of New York | Genome edited cancer cell vaccines |
| PH12021551389A1 (en) | 2018-12-13 | 2022-05-16 | Eisai R&D Man Co Ltd | Herboxidiene antibody-drug conjugates and methods of use |
| TWI872065B (zh) | 2019-04-29 | 2025-02-11 | 美商免疫遺傳股份有限公司 | 雙互補位FR-α抗體及免疫結合物 |
| CN111393528B (zh) * | 2020-01-19 | 2023-01-31 | 中国药科大学 | 一种靶向叶酸受体α的单链抗体及其应用 |
| US20230265202A1 (en) * | 2020-04-15 | 2023-08-24 | Zymeworks Inc. | Antibody constructs binding 4-1bb and folate receptor alpha and uses thereof |
| JP7706668B2 (ja) | 2022-03-11 | 2025-07-11 | マブリンク ビオシオンス | 抗体-薬物コンジュゲート及びそれらの使用 |
| WO2024104431A1 (zh) * | 2022-11-16 | 2024-05-23 | 迈威(上海)生物科技股份有限公司 | 一种靶向FRα的抗体或其抗原结合片段及其应用 |
Citations (18)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4694778A (en) * | 1984-05-04 | 1987-09-22 | Anicon, Inc. | Chemical vapor deposition wafer boat |
| US4851332A (en) * | 1985-04-01 | 1989-07-25 | Sloan-Kettering Institute For Cancer Research | Choriocarcinoma monoclonal antibodies and antibody panels |
| US5320956A (en) * | 1990-10-12 | 1994-06-14 | The United States Of America As Represented By The Department Of Health And Human Services | Monoclonal antibody useful for the diagnosis of cancer |
| US5646253A (en) * | 1994-03-08 | 1997-07-08 | Memorial Sloan-Kettering Cancer Center | Recombinant human anti-LK26 antibodies |
| US5789650A (en) * | 1990-08-29 | 1998-08-04 | Genpharm International, Inc. | Transgenic non-human animals for producing heterologous antibodies |
| US5798230A (en) * | 1995-11-09 | 1998-08-25 | Gsf-Forschungszentrum Fur Umwelt Und Gesundheit Gmbh | Process for the preparation of human monoclonal antibodies and their use |
| US6083502A (en) * | 1996-01-05 | 2000-07-04 | The United States Of America As Represented By The Department Of Health And Human Services | Mesothelium antigen and methods and kits for targeting it |
| US6146894A (en) * | 1998-04-14 | 2000-11-14 | The Johns Hopkins University | Method for generating hypermutable organisms |
| US6191268B1 (en) * | 1993-12-17 | 2001-02-20 | Dana-Farber Cancer Institute | Compositions and methods relating to DNA mismatch repair genes |
| US6365410B1 (en) * | 1999-05-19 | 2002-04-02 | Genencor International, Inc. | Directed evolution of microorganisms |
| US20030027177A1 (en) * | 1994-01-27 | 2003-02-06 | Human Genome Sciences, Inc. | Human DNA mismatch repair proteins |
| US6602688B1 (en) * | 1995-04-11 | 2003-08-05 | Aventis Pharma Deutschland Gmbh | Cytoplasmic expression of antibodies, antibody fragments and antibody fragment fusion proteins in E. coli |
| US6808894B1 (en) * | 2000-11-07 | 2004-10-26 | Morphotek, Inc. | Methods for generating genetically altered antibody producing cell lines with improved antibody characteristics |
| US6809184B1 (en) * | 1997-12-01 | 2004-10-26 | The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services | Antibodies, including FV molecules, and immunoconjugates having high binding affinity for mesothelin and methods for their use |
| US20040235108A1 (en) * | 2003-05-23 | 2004-11-25 | Luigi Grasso | Monoclonal antibodies that specifically bind a tumor antigen |
| US7081518B1 (en) * | 1999-05-27 | 2006-07-25 | The United States Of America As Represented By The Department Of Health And Human Services | Anti-mesothelin antibodies having high binding affinity |
| US20060204506A1 (en) * | 2005-03-10 | 2006-09-14 | Wolfgang Ebel | Anti-mesothelin antibodies |
| US20060239910A1 (en) * | 2005-04-22 | 2006-10-26 | Morphotek Inc. | Antibodies with immune effector activity and that internalize in folate receptor alpha-positive cells |
Family Cites Families (31)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| GB8607679D0 (en) | 1986-03-27 | 1986-04-30 | Winter G P | Recombinant dna product |
| US5006470A (en) * | 1987-04-16 | 1991-04-09 | Sloan-Kettering Institute For Cancer Research | Human monoclonal antibodies to cell surface antigens of melanoma |
| IL162181A (en) | 1988-12-28 | 2006-04-10 | Pdl Biopharma Inc | A method of producing humanized immunoglubulin, and polynucleotides encoding the same |
| US5688488A (en) * | 1989-04-03 | 1997-11-18 | Purdue Research Foundation | Composition and method for tumor imaging |
| US5108921A (en) * | 1989-04-03 | 1992-04-28 | Purdue Research Foundation | Method for enhanced transmembrane transport of exogenous molecules |
| US5965132A (en) * | 1992-03-05 | 1999-10-12 | Board Of Regents, The University Of Texas System | Methods and compositions for targeting the vasculature of solid tumors |
| DE4335025A1 (de) * | 1993-10-14 | 1995-04-20 | Boehringer Ingelheim Int | Endosomolytisch wirksame Partikel |
| BR9708910A (pt) * | 1996-05-04 | 1999-08-03 | Zeneca Ltd | Anticorpo conjugado sequência de polinucleotídeos vetor célula hospedeira hibridoma composição farmacêutica processos para fabricar um anticorpo ou um conjugado e para tratar um humano ou animal em necessidade deste tratamento |
| AU2001275267A1 (en) * | 2000-06-05 | 2001-12-17 | Corixa Corporation | Leader peptides for enhancing secretion of recombinant protein from a host cell |
| ATE423467T1 (de) * | 2000-11-07 | 2009-03-15 | Morphotek Inc | Verfahren zur herstellung von genetisch modifizierten antikörperproduzierenden zelllinien mit verbesserten antikörpereigenschaften |
| JP5036119B2 (ja) | 2001-01-15 | 2012-09-26 | モーフオテク・インコーポレーテツド | ミスマッチ修復の化学阻害剤 |
| US7110683B2 (en) * | 2001-03-30 | 2006-09-19 | Agere Systems Inc. | Compensation of polarization mode dispersion in single mode fiber for maximum-likelihood sequence estimation |
| RU2316349C2 (ru) | 2001-05-02 | 2008-02-10 | Пердью Рисерч Фаундейшн | Лечение и диагностика заболеваний, опосредованных макрофагами |
| EP1258255A1 (en) * | 2001-05-18 | 2002-11-20 | Boehringer Ingelheim International GmbH | Conjugates of an antibody to CD44 and a maytansinoid |
| JP2005504517A (ja) * | 2001-05-18 | 2005-02-17 | ベーリンガー インゲルハイム インターナショナル ゲゼルシャフト ミット ベシュレンクテル ハフツング | CD44v6特異的抗体 |
| CA2481334A1 (en) | 2002-04-01 | 2003-10-16 | Anthony C. Stevens | Tissue-specific endothelial membrane proteins |
| GB0214013D0 (en) | 2002-06-18 | 2002-07-31 | Euro Celtique Sa | Pharmaceutical product |
| DE60335129D1 (de) * | 2002-07-19 | 2011-01-05 | Morphotek Inc | VERFAHREN ZUR ERZEUGUNG VERBESSERTER ANTIKöRPER PRODUZIERENDER ZELLINIEN MIT VERBESSERTEN WACHSTUMSEIGENSCHAFTEN |
| JP2007500508A (ja) * | 2003-07-29 | 2007-01-18 | モルフォテック、インク. | 抗体とエフェクター機能が増強された遺伝子組み換え抗体を作成する方法 |
| EP1651675A1 (en) | 2003-08-05 | 2006-05-03 | Morphotek, Inc. | A variant cell surface molecule associated with cancer |
| US20050232919A1 (en) * | 2004-02-12 | 2005-10-20 | Morphotek, Inc. | Monoclonal antibodies that specifically block biological activity of a tumor antigen |
| CN101027391A (zh) * | 2004-10-05 | 2007-08-29 | 惠氏公司 | 用于改善重组蛋白质产生的方法和组合物 |
| EP1864133B1 (en) * | 2005-03-30 | 2010-03-10 | Purdue Research Foundation | Method for breastcancer prognosis using cellular folate vitamin receptor quantification |
| US8795633B2 (en) * | 2005-09-23 | 2014-08-05 | Purdue Research Foundation | Multiphoton in vivo flow cytometry method and device |
| US20070154916A1 (en) * | 2005-11-04 | 2007-07-05 | Johji Inazawa | Method for detecting cancer and a method for suppressing cancer |
| EP1900752A1 (en) * | 2006-09-15 | 2008-03-19 | DOMPE' pha.r.ma s.p.a. | Human anti-folate receptor alpha antibodies and antibody fragments for the radioimmunotherapy of ovarian carcinoma |
| CA2668197A1 (en) * | 2006-11-03 | 2008-05-15 | Philip S. Low | Ex vivo flow cytometry method and device |
| WO2009002993A1 (en) | 2007-06-25 | 2008-12-31 | Endocyte, Inc. | Conjugates containing hydrophilic spacer linkers |
| US20090087849A1 (en) * | 2007-09-06 | 2009-04-02 | Tripath Imaging, Inc. | Nucleic acid-based methods and compositions for the detection of ovarian cancer |
| GB0725077D0 (en) | 2007-12-21 | 2008-01-30 | Univ Murcia | Antifolate com[ounds for the treatment of melanoma |
| WO2009132081A2 (en) | 2008-04-24 | 2009-10-29 | The Research Foundation Of State University Of New York | Monoclonal antibody-based targeting of folate receptors |
-
2005
- 2005-02-11 US US11/056,776 patent/US20050232919A1/en not_active Abandoned
- 2005-02-11 JP JP2006553229A patent/JP4805848B2/ja not_active Expired - Lifetime
- 2005-02-11 AU AU2005214331A patent/AU2005214331B2/en not_active Expired
- 2005-02-11 EP EP10183459A patent/EP2316857A1/en not_active Withdrawn
- 2005-02-11 CA CA2556027A patent/CA2556027C/en not_active Expired - Lifetime
- 2005-02-11 EP EP05722917A patent/EP1716179A2/en not_active Ceased
- 2005-02-11 EP EP16180435.6A patent/EP3101034A1/en not_active Ceased
- 2005-02-11 WO PCT/US2005/004240 patent/WO2005080431A2/en not_active Ceased
-
2009
- 2009-07-09 US US12/500,144 patent/US9624297B2/en active Active
-
2013
- 2013-03-14 US US13/826,964 patent/US9650440B2/en active Active
-
2017
- 2017-03-09 US US15/454,412 patent/US10509037B2/en not_active Expired - Lifetime
Patent Citations (24)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4694778A (en) * | 1984-05-04 | 1987-09-22 | Anicon, Inc. | Chemical vapor deposition wafer boat |
| US4851332A (en) * | 1985-04-01 | 1989-07-25 | Sloan-Kettering Institute For Cancer Research | Choriocarcinoma monoclonal antibodies and antibody panels |
| US5789650A (en) * | 1990-08-29 | 1998-08-04 | Genpharm International, Inc. | Transgenic non-human animals for producing heterologous antibodies |
| US5320956A (en) * | 1990-10-12 | 1994-06-14 | The United States Of America As Represented By The Department Of Health And Human Services | Monoclonal antibody useful for the diagnosis of cancer |
| US5525337A (en) * | 1990-10-12 | 1996-06-11 | The United States Of America As Represented By The Department Of Health And Human Services | Monoclonal antibody binding cell surface antigens for diagnosing cancer |
| US5817313A (en) * | 1990-10-12 | 1998-10-06 | The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services | Monoclonal antibodies and conjugates thereof useful for the treatment of cancer |
| US6191268B1 (en) * | 1993-12-17 | 2001-02-20 | Dana-Farber Cancer Institute | Compositions and methods relating to DNA mismatch repair genes |
| US20030027177A1 (en) * | 1994-01-27 | 2003-02-06 | Human Genome Sciences, Inc. | Human DNA mismatch repair proteins |
| US5646253A (en) * | 1994-03-08 | 1997-07-08 | Memorial Sloan-Kettering Cancer Center | Recombinant human anti-LK26 antibodies |
| US5952484A (en) * | 1994-03-08 | 1999-09-14 | Sloan-Kettering Cancer Center | Recombinant human anti-LK26 antibodies |
| US6348195B1 (en) * | 1994-03-08 | 2002-02-19 | Memorial Sloan Kettering Cancer Center | Method for treating cancers |
| US6124106A (en) * | 1994-03-08 | 2000-09-26 | Ludwig Institute For Cancer Research | Method for detecting cancers |
| US6602688B1 (en) * | 1995-04-11 | 2003-08-05 | Aventis Pharma Deutschland Gmbh | Cytoplasmic expression of antibodies, antibody fragments and antibody fragment fusion proteins in E. coli |
| US5798230A (en) * | 1995-11-09 | 1998-08-25 | Gsf-Forschungszentrum Fur Umwelt Und Gesundheit Gmbh | Process for the preparation of human monoclonal antibodies and their use |
| US6153430A (en) * | 1996-01-05 | 2000-11-28 | The United States Of America As Represented By The Department Of Health And Human Services | Nucleic acid encoding mesothelin, a differentiation antigen present on mesothelium, mesotheliomas and ovarian cancers |
| US6083502A (en) * | 1996-01-05 | 2000-07-04 | The United States Of America As Represented By The Department Of Health And Human Services | Mesothelium antigen and methods and kits for targeting it |
| US6809184B1 (en) * | 1997-12-01 | 2004-10-26 | The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services | Antibodies, including FV molecules, and immunoconjugates having high binding affinity for mesothelin and methods for their use |
| US6146894A (en) * | 1998-04-14 | 2000-11-14 | The Johns Hopkins University | Method for generating hypermutable organisms |
| US6365410B1 (en) * | 1999-05-19 | 2002-04-02 | Genencor International, Inc. | Directed evolution of microorganisms |
| US7081518B1 (en) * | 1999-05-27 | 2006-07-25 | The United States Of America As Represented By The Department Of Health And Human Services | Anti-mesothelin antibodies having high binding affinity |
| US6808894B1 (en) * | 2000-11-07 | 2004-10-26 | Morphotek, Inc. | Methods for generating genetically altered antibody producing cell lines with improved antibody characteristics |
| US20040235108A1 (en) * | 2003-05-23 | 2004-11-25 | Luigi Grasso | Monoclonal antibodies that specifically bind a tumor antigen |
| US20060204506A1 (en) * | 2005-03-10 | 2006-09-14 | Wolfgang Ebel | Anti-mesothelin antibodies |
| US20060239910A1 (en) * | 2005-04-22 | 2006-10-26 | Morphotek Inc. | Antibodies with immune effector activity and that internalize in folate receptor alpha-positive cells |
Cited By (86)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20040235108A1 (en) * | 2003-05-23 | 2004-11-25 | Luigi Grasso | Monoclonal antibodies that specifically bind a tumor antigen |
| US9624297B2 (en) | 2004-02-12 | 2017-04-18 | Morphotek, Inc. | Monoclonal antibodies that specifically block biological activity of a tumor antigen |
| US20090274697A1 (en) * | 2004-02-12 | 2009-11-05 | Luigi Grasso | Monoclonal Antibodies That Specifically Block Biological Activity Of A Tumor Antigen |
| US10509037B2 (en) | 2004-02-12 | 2019-12-17 | Eisai, Inc. | Monoclonal antibodies that specifically block biological activity of a tumor antigen |
| US9650440B2 (en) | 2004-02-12 | 2017-05-16 | Morphotek, Inc. | Monoclonal antibodies that specifically block biological activity of a tumor antigen |
| US9522195B2 (en) | 2005-04-22 | 2016-12-20 | Morphotek, Inc. | Antibodies with immune effector activity and that internalize in folate receptor alpha-positive cells |
| US10253106B2 (en) | 2005-04-22 | 2019-04-09 | Eisai, Inc. | Antibodies with immune effector activity and that internalize in folate receptor alpha-positive cells |
| US8124083B2 (en) | 2005-04-22 | 2012-02-28 | Morphotek, Inc. | Antibodies with immune effector activity and that internalize in folate receptor alpha-positive cells |
| US9144614B2 (en) | 2005-04-22 | 2015-09-29 | Morphotek, Inc. | Antibodies with immune effector activity and that internalize in folate receptor alpha-positive cells |
| US20090324594A1 (en) * | 2005-04-22 | 2009-12-31 | Nicolaides Nicholas C | Antibodies With Immune Effector Activity And That Internalize In Folate Receptor Alpha-Positive Cells |
| US20060239910A1 (en) * | 2005-04-22 | 2006-10-26 | Morphotek Inc. | Antibodies with immune effector activity and that internalize in folate receptor alpha-positive cells |
| US9447164B2 (en) | 2010-08-06 | 2016-09-20 | Moderna Therapeutics, Inc. | Engineered nucleic acids and methods of use thereof |
| US9937233B2 (en) | 2010-08-06 | 2018-04-10 | Modernatx, Inc. | Engineered nucleic acids and methods of use thereof |
| US9181319B2 (en) | 2010-08-06 | 2015-11-10 | Moderna Therapeutics, Inc. | Engineered nucleic acids and methods of use thereof |
| US9657295B2 (en) | 2010-10-01 | 2017-05-23 | Modernatx, Inc. | Modified nucleosides, nucleotides, and nucleic acids, and uses thereof |
| US10064959B2 (en) | 2010-10-01 | 2018-09-04 | Modernatx, Inc. | Modified nucleosides, nucleotides, and nucleic acids, and uses thereof |
| US9701965B2 (en) | 2010-10-01 | 2017-07-11 | Modernatx, Inc. | Engineered nucleic acids and methods of use thereof |
| US9334328B2 (en) | 2010-10-01 | 2016-05-10 | Moderna Therapeutics, Inc. | Modified nucleosides, nucleotides, and nucleic acids, and uses thereof |
| WO2012054654A3 (en) * | 2010-10-20 | 2012-08-02 | Morphotek, Inc. | Anti-folate receptor alpha antibody glycoforms |
| EP3130605A1 (en) | 2010-11-05 | 2017-02-15 | Morphotek, Inc. | Folate receptor alpha as a diagnostic and prognostic marker for folate receptor alpha-expressing cancers |
| WO2012061759A2 (en) | 2010-11-05 | 2012-05-10 | Morphotek Inc. | Folate receptor alpha as a diagnostic and prognostic marker for folate receptor alpha-expressing cancers |
| US10457729B2 (en) | 2011-01-18 | 2019-10-29 | The Trustees Of The University Of Pennsylvania | Compositions and methods for treating cancer |
| US9402865B2 (en) | 2011-01-18 | 2016-08-02 | The Trustees Of The University Of Pennsylvania | Compositions and methods for treating cancer |
| US11180550B2 (en) | 2011-01-18 | 2021-11-23 | The Trustees Of The University Of Pennsylvania | Compositions and methods for treating cancer |
| US9950068B2 (en) | 2011-03-31 | 2018-04-24 | Modernatx, Inc. | Delivery and formulation of engineered nucleic acids |
| US9533047B2 (en) | 2011-03-31 | 2017-01-03 | Modernatx, Inc. | Delivery and formulation of engineered nucleic acids |
| US11013800B2 (en) | 2011-05-16 | 2021-05-25 | Evive Biotech Ltd. | Multi-specific Fab fusion proteins comprising a CD3-binding Fab fragment with N-terminal fusion to binding domains and methods of use |
| EP3330291A1 (en) | 2011-07-15 | 2018-06-06 | Eisai R&D Management Co., Ltd. | Anti-folate receptor alpha antibodies and uses thereof |
| US9599621B2 (en) | 2011-07-15 | 2017-03-21 | Eisai R&D Management Co., Ltd. | Anti-folate receptor alpha antibodies and uses thereof |
| WO2013012722A1 (en) | 2011-07-15 | 2013-01-24 | Eisai R&D Management Co., Ltd. | Anti-folate receptor alpha antibodies and uses thereof |
| US8475795B2 (en) | 2011-07-15 | 2013-07-02 | Eisai R&D Management Co Ltd. | Anti-folate receptor alpha antibodies and uses thereof |
| US8834877B2 (en) | 2011-07-15 | 2014-09-16 | Eisai R&D Managment Co., Ltd. | Anti-folate receptor alpha antibodies and uses thereof |
| US10101343B2 (en) | 2011-07-15 | 2018-10-16 | Eisai R&D Management Co., Ltd. | Anti-folate receptor alpha antibodies and uses thereof |
| US10022425B2 (en) | 2011-09-12 | 2018-07-17 | Modernatx, Inc. | Engineered nucleic acids and methods of use thereof |
| US9464124B2 (en) | 2011-09-12 | 2016-10-11 | Moderna Therapeutics, Inc. | Engineered nucleic acids and methods of use thereof |
| US10751386B2 (en) | 2011-09-12 | 2020-08-25 | Modernatx, Inc. | Engineered nucleic acids and methods of use thereof |
| US9428535B2 (en) | 2011-10-03 | 2016-08-30 | Moderna Therapeutics, Inc. | Modified nucleosides, nucleotides, and nucleic acids, and uses thereof |
| US9295689B2 (en) | 2011-12-16 | 2016-03-29 | Moderna Therapeutics, Inc. | Formulation and delivery of PLGA microspheres |
| US9186372B2 (en) | 2011-12-16 | 2015-11-17 | Moderna Therapeutics, Inc. | Split dose administration |
| US9271996B2 (en) | 2011-12-16 | 2016-03-01 | Moderna Therapeutics, Inc. | Formulation and delivery of PLGA microspheres |
| US9050297B2 (en) | 2012-04-02 | 2015-06-09 | Moderna Therapeutics, Inc. | Modified polynucleotides encoding aryl hydrocarbon receptor nuclear translocator |
| US9149506B2 (en) | 2012-04-02 | 2015-10-06 | Moderna Therapeutics, Inc. | Modified polynucleotides encoding septin-4 |
| US9255129B2 (en) | 2012-04-02 | 2016-02-09 | Moderna Therapeutics, Inc. | Modified polynucleotides encoding SIAH E3 ubiquitin protein ligase 1 |
| US9233141B2 (en) | 2012-04-02 | 2016-01-12 | Moderna Therapeutics, Inc. | Modified polynucleotides for the production of proteins associated with blood and lymphatic disorders |
| US9572897B2 (en) | 2012-04-02 | 2017-02-21 | Modernatx, Inc. | Modified polynucleotides for the production of cytoplasmic and cytoskeletal proteins |
| US9587003B2 (en) | 2012-04-02 | 2017-03-07 | Modernatx, Inc. | Modified polynucleotides for the production of oncology-related proteins and peptides |
| US8999380B2 (en) | 2012-04-02 | 2015-04-07 | Moderna Therapeutics, Inc. | Modified polynucleotides for the production of biologics and proteins associated with human disease |
| US9301993B2 (en) | 2012-04-02 | 2016-04-05 | Moderna Therapeutics, Inc. | Modified polynucleotides encoding apoptosis inducing factor 1 |
| US9221891B2 (en) | 2012-04-02 | 2015-12-29 | Moderna Therapeutics, Inc. | In vivo production of proteins |
| US9220755B2 (en) | 2012-04-02 | 2015-12-29 | Moderna Therapeutics, Inc. | Modified polynucleotides for the production of proteins associated with blood and lymphatic disorders |
| US9220792B2 (en) | 2012-04-02 | 2015-12-29 | Moderna Therapeutics, Inc. | Modified polynucleotides encoding aquaporin-5 |
| US9216205B2 (en) | 2012-04-02 | 2015-12-22 | Moderna Therapeutics, Inc. | Modified polynucleotides encoding granulysin |
| US9675668B2 (en) | 2012-04-02 | 2017-06-13 | Moderna Therapeutics, Inc. | Modified polynucleotides encoding hepatitis A virus cellular receptor 2 |
| US9303079B2 (en) | 2012-04-02 | 2016-04-05 | Moderna Therapeutics, Inc. | Modified polynucleotides for the production of cytoplasmic and cytoskeletal proteins |
| US10501512B2 (en) | 2012-04-02 | 2019-12-10 | Modernatx, Inc. | Modified polynucleotides |
| US9782462B2 (en) | 2012-04-02 | 2017-10-10 | Modernatx, Inc. | Modified polynucleotides for the production of proteins associated with human disease |
| US9814760B2 (en) | 2012-04-02 | 2017-11-14 | Modernatx, Inc. | Modified polynucleotides for the production of biologics and proteins associated with human disease |
| US9828416B2 (en) | 2012-04-02 | 2017-11-28 | Modernatx, Inc. | Modified polynucleotides for the production of secreted proteins |
| US9827332B2 (en) | 2012-04-02 | 2017-11-28 | Modernatx, Inc. | Modified polynucleotides for the production of proteins |
| US9878056B2 (en) | 2012-04-02 | 2018-01-30 | Modernatx, Inc. | Modified polynucleotides for the production of cosmetic proteins and peptides |
| US9192651B2 (en) | 2012-04-02 | 2015-11-24 | Moderna Therapeutics, Inc. | Modified polynucleotides for the production of secreted proteins |
| US9283287B2 (en) | 2012-04-02 | 2016-03-15 | Moderna Therapeutics, Inc. | Modified polynucleotides for the production of nuclear proteins |
| US9061059B2 (en) | 2012-04-02 | 2015-06-23 | Moderna Therapeutics, Inc. | Modified polynucleotides for treating protein deficiency |
| US9254311B2 (en) | 2012-04-02 | 2016-02-09 | Moderna Therapeutics, Inc. | Modified polynucleotides for the production of proteins |
| US9114113B2 (en) | 2012-04-02 | 2015-08-25 | Moderna Therapeutics, Inc. | Modified polynucleotides encoding citeD4 |
| US9107886B2 (en) | 2012-04-02 | 2015-08-18 | Moderna Therapeutics, Inc. | Modified polynucleotides encoding basic helix-loop-helix family member E41 |
| US9095552B2 (en) | 2012-04-02 | 2015-08-04 | Moderna Therapeutics, Inc. | Modified polynucleotides encoding copper metabolism (MURR1) domain containing 1 |
| US9089604B2 (en) | 2012-04-02 | 2015-07-28 | Moderna Therapeutics, Inc. | Modified polynucleotides for treating galactosylceramidase protein deficiency |
| US9598489B2 (en) | 2012-10-05 | 2017-03-21 | The Trustees Of The Univeristy Of Pennsylvania | Human alpha-folate receptor chimeric antigen receptor |
| US12122829B2 (en) | 2012-10-05 | 2024-10-22 | The Trustees Of The University Of Pennsylvania | Human alpha-folate receptor chimeric antigen receptor |
| US10844117B2 (en) | 2012-10-05 | 2020-11-24 | The Trustees Of The University Of Pennsylvania | Human alpha-folate receptor chimeric antigen receptor |
| US9597380B2 (en) | 2012-11-26 | 2017-03-21 | Modernatx, Inc. | Terminally modified RNA |
| US9695237B2 (en) | 2012-12-07 | 2017-07-04 | Kyowa Hakko Kirin Co., Ltd | Anti-FOLR1 antibody |
| US9207238B2 (en) | 2012-12-07 | 2015-12-08 | Kyowa Hakko Kirin Co., Ltd. | Anti-FOLR1 antibody |
| US8980864B2 (en) | 2013-03-15 | 2015-03-17 | Moderna Therapeutics, Inc. | Compositions and methods of altering cholesterol levels |
| US10815291B2 (en) | 2013-09-30 | 2020-10-27 | Modernatx, Inc. | Polynucleotides encoding immune modulating polypeptides |
| US10323076B2 (en) | 2013-10-03 | 2019-06-18 | Modernatx, Inc. | Polynucleotides encoding low density lipoprotein receptor |
| US10870701B2 (en) | 2016-03-15 | 2020-12-22 | Generon (Shanghai) Corporation Ltd. | Multispecific fab fusion proteins and use thereof |
| WO2018098277A1 (en) | 2016-11-23 | 2018-05-31 | Eisai R&D Management Co., Ltd | Anti-folate receptor alpha antibodies and uses thereof |
| US10822410B2 (en) | 2016-11-23 | 2020-11-03 | Eisai R&D Management Co., Ltd. | Anti-folate receptor alpha antibodies and uses thereof |
| CN112424227A (zh) * | 2018-03-14 | 2021-02-26 | 阿特根公司 | 与folr1特异性结合的抗体及其用途 |
| WO2019177372A1 (ko) | 2018-03-14 | 2019-09-19 | (주)알테오젠 | Folr1에 특이적으로 결합하는 항체 및 그의 용도 |
| US12460000B2 (en) | 2018-09-07 | 2025-11-04 | Itabmed (Hk) Limited | Anti-CD19 and anti-CD3 bispecific antigen binding proteins and uses thereof |
| EP4342488A1 (en) | 2022-09-26 | 2024-03-27 | Miltenyi Biotec B.V. & Co. KG | Chimeric antigen receptor specific for folate receptor 1 |
| CN116462768A (zh) * | 2023-06-13 | 2023-07-21 | 浙江时迈药业有限公司 | 针对folr1的双特异性抗体及其用途 |
| WO2025034965A1 (en) * | 2023-08-09 | 2025-02-13 | Board Of Regents, The University Of Texas System | Targeted therapeutic delivery of lipid nanoparticles |
Also Published As
| Publication number | Publication date |
|---|---|
| US9650440B2 (en) | 2017-05-16 |
| AU2005214331A1 (en) | 2005-09-01 |
| US20090274697A1 (en) | 2009-11-05 |
| US10509037B2 (en) | 2019-12-17 |
| AU2005214331B2 (en) | 2011-09-15 |
| WO2005080431A2 (en) | 2005-09-01 |
| CA2556027C (en) | 2015-11-24 |
| US20130189272A1 (en) | 2013-07-25 |
| JP2008500025A (ja) | 2008-01-10 |
| CA2556027A1 (en) | 2005-09-01 |
| EP2316857A1 (en) | 2011-05-04 |
| US20170184603A1 (en) | 2017-06-29 |
| EP1716179A2 (en) | 2006-11-02 |
| JP4805848B2 (ja) | 2011-11-02 |
| US9624297B2 (en) | 2017-04-18 |
| EP3101034A1 (en) | 2016-12-07 |
| WO2005080431A3 (en) | 2005-11-24 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US10509037B2 (en) | Monoclonal antibodies that specifically block biological activity of a tumor antigen | |
| US7592426B2 (en) | Anti-mesothelin antibodies | |
| JP2009213486A (ja) | インスリン様成長因子i受容体に対する抗体及びその使用 | |
| US8524237B2 (en) | Antibodies with immune effector activity and that internalize in endosialin-positive cells | |
| US20240043540A1 (en) | Anti-b7-h3 antibody and uses thereof | |
| US20120189620A1 (en) | Methods for treating non-functioning pituitary adenoma | |
| TWI869582B (zh) | 抗cd47抗體及其用途 | |
| AU2017202341B2 (en) | Monoclonal antibodies that specifically bind to folate receptor alpha | |
| AU2013202884B2 (en) | Monoclonal antibodies that specifically bind to folate receptor alpha | |
| AU2011253933B2 (en) | Monoclonal antibodies that specifically bind to folate receptor alpha | |
| HK1262617A1 (en) | Obinutuzumab variants having altered cell death induction | |
| HK1262617B (en) | Obinutuzumab variants having altered cell death induction |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| AS | Assignment |
Owner name: MORPHOTEK, INC., PENNSYLVANIA Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:GRASSO, LUIGI;NICOLAIDES, NICHOLAS;SASS, PHILIP M.;REEL/FRAME:016415/0575 Effective date: 20040419 |
|
| AS | Assignment |
Owner name: MORPHOTEK, INC., PENNSYLVANIA Free format text: A CORRECTIVE ASSIGNMENT TO CORRECT THE ASSIGNOR ON REEL 016415 FRAME 0575;ASSIGNORS:GRASSO, LUIGI;NICOLAIDES, NICHOLAS C.;SASS, PHILIP M.;REEL/FRAME:016653/0501 Effective date: 20050419 |
|
| STCB | Information on status: application discontinuation |
Free format text: ABANDONED -- FAILURE TO RESPOND TO AN OFFICE ACTION |
|
| AS | Assignment |
Owner name: EISAI INC., NEW JERSEY Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNOR:MORPHOTEK, INC.;REEL/FRAME:047297/0278 Effective date: 20180926 |