NL1015480C2 - Semiconductor factory automation system and method for processing at least one semiconductor wafer cartridge. - Google Patents

Semiconductor factory automation system and method for processing at least one semiconductor wafer cartridge. Download PDF

Info

Publication number
NL1015480C2
NL1015480C2 NL1015480A NL1015480A NL1015480C2 NL 1015480 C2 NL1015480 C2 NL 1015480C2 NL 1015480 A NL1015480 A NL 1015480A NL 1015480 A NL1015480 A NL 1015480A NL 1015480 C2 NL1015480 C2 NL 1015480C2
Authority
NL
Netherlands
Prior art keywords
semiconductor wafer
semiconductor
wafer cassettes
data
processing means
Prior art date
Application number
NL1015480A
Other languages
Dutch (nl)
Other versions
NL1015480A1 (en
Inventor
Young-Jo Kang
Sung-Hae Ha
Kyeong-Seok Park
Original Assignee
Hyundai Electronics Ind
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority claimed from KR10-1999-0023539A external-priority patent/KR100529389B1/en
Priority claimed from KR10-1999-0023540A external-priority patent/KR100507871B1/en
Priority claimed from KR1019990024872A external-priority patent/KR100540471B1/en
Priority claimed from KR10-1999-0028417A external-priority patent/KR100498602B1/en
Application filed by Hyundai Electronics Ind filed Critical Hyundai Electronics Ind
Publication of NL1015480A1 publication Critical patent/NL1015480A1/en
Application granted granted Critical
Publication of NL1015480C2 publication Critical patent/NL1015480C2/en

Links

Classifications

    • G—PHYSICS
    • G05—CONTROLLING; REGULATING
    • G05B—CONTROL OR REGULATING SYSTEMS IN GENERAL; FUNCTIONAL ELEMENTS OF SUCH SYSTEMS; MONITORING OR TESTING ARRANGEMENTS FOR SUCH SYSTEMS OR ELEMENTS
    • G05B19/00—Programme-control systems
    • G05B19/02—Programme-control systems electric
    • G05B19/418—Total factory control, i.e. centrally controlling a plurality of machines, e.g. direct or distributed numerical control [DNC], flexible manufacturing systems [FMS], integrated manufacturing systems [IMS], computer integrated manufacturing [CIM]
    • G05B19/41865—Total factory control, i.e. centrally controlling a plurality of machines, e.g. direct or distributed numerical control [DNC], flexible manufacturing systems [FMS], integrated manufacturing systems [IMS], computer integrated manufacturing [CIM] characterised by job scheduling, process planning, material flow
    • G—PHYSICS
    • G05—CONTROLLING; REGULATING
    • G05B—CONTROL OR REGULATING SYSTEMS IN GENERAL; FUNCTIONAL ELEMENTS OF SUCH SYSTEMS; MONITORING OR TESTING ARRANGEMENTS FOR SUCH SYSTEMS OR ELEMENTS
    • G05B19/00—Programme-control systems
    • G05B19/02—Programme-control systems electric
    • G05B19/418—Total factory control, i.e. centrally controlling a plurality of machines, e.g. direct or distributed numerical control [DNC], flexible manufacturing systems [FMS], integrated manufacturing systems [IMS], computer integrated manufacturing [CIM]
    • G05B19/4183—Total factory control, i.e. centrally controlling a plurality of machines, e.g. direct or distributed numerical control [DNC], flexible manufacturing systems [FMS], integrated manufacturing systems [IMS], computer integrated manufacturing [CIM] characterised by data acquisition, e.g. workpiece identification
    • G—PHYSICS
    • G05—CONTROLLING; REGULATING
    • G05B—CONTROL OR REGULATING SYSTEMS IN GENERAL; FUNCTIONAL ELEMENTS OF SUCH SYSTEMS; MONITORING OR TESTING ARRANGEMENTS FOR SUCH SYSTEMS OR ELEMENTS
    • G05B2219/00—Program-control systems
    • G05B2219/30—Nc systems
    • G05B2219/31—From computer integrated manufacturing till monitoring
    • G05B2219/31218—Scheduling communication on bus
    • G—PHYSICS
    • G05—CONTROLLING; REGULATING
    • G05B—CONTROL OR REGULATING SYSTEMS IN GENERAL; FUNCTIONAL ELEMENTS OF SUCH SYSTEMS; MONITORING OR TESTING ARRANGEMENTS FOR SUCH SYSTEMS OR ELEMENTS
    • G05B2219/00—Program-control systems
    • G05B2219/30—Nc systems
    • G05B2219/32—Operator till task planning
    • G05B2219/32277—Agv schedule integrated into cell schedule
    • Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
    • Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
    • Y02P—CLIMATE CHANGE MITIGATION TECHNOLOGIES IN THE PRODUCTION OR PROCESSING OF GOODS
    • Y02P90/00—Enabling technologies with a potential contribution to greenhouse gas [GHG] emissions mitigation
    • Y02P90/02—Total factory control, e.g. smart factories, flexible manufacturing systems [FMS] or integrated manufacturing systems [IMS]
    • Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
    • Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
    • Y02P—CLIMATE CHANGE MITIGATION TECHNOLOGIES IN THE PRODUCTION OR PROCESSING OF GOODS
    • Y02P90/00—Enabling technologies with a potential contribution to greenhouse gas [GHG] emissions mitigation
    • Y02P90/60—Electric or hybrid propulsion means for production processes

Description

A00-30046/Me/FHEA00-30046 / Me / FHE

Korte aanduiding: Halfgeleiderfabriekautomatiseringssysteem en werkwijze voor de verwerking van ten minste een halfgeleiderwafelcassette.Brief description: Semiconductor factory automation system and method for processing at least one semiconductor wafer cartridge.

Gebied van de uitvindingFIELD OF THE INVENTION

De uitvinding heeft betrekking op een halfgeleiderfabriekauto-matiserings-(hierna aangeduid met FA) systeem, en meer in het bijzonder op een halfgeleider-FA-systeem en werkwijze voor het verwerken 5 van ten minste een halfgeleiderwafelcassette.The invention relates to a semiconductor factory automation (hereinafter referred to as FA) system, and more particularly to a semiconductor FA system and method for processing at least one semiconductor wafer cartridge.

Beschrijving van de stand van de techniekDescription of the prior art

Een gangbaar halfgeleider-FA-systeem verwerkt in het algemeen op automatische wijze halfgeleiderwafels. Het gangbare halfgeleider-FA-systeem bevat verwerkingsapparatuur (hierna aangeduid met EQ's), 10 voorraadhouders en een automatisch geleidervoertuig (hierna aangeduid met AGV). Een EQ voert een halfgeleiderproces uit op de halfgeleiderwafels. Een voorraadhouder laadt een de halfgeleiderwafels bevattende halfgeleiderwafelcassette in de EQ om te worden verwerkt. Verder slaat de voorraadhouder de halfgeleiderwafelcassette, die reeds in de 15 EQ is verwerkt, op. De AGV transporteert de halfgeleiderwafelcassette vanaf de EQ naar een andere EQ. Verder transporteert de AGV de halfgeleiderwafelcassette vanuit de voorraadhouder naar de EQ. Verder transporteert de AGV de halfgeleiderwafelcassette vanuit de procesapparatuur naar de voorraadhouder.A conventional semiconductor FA system generally automatically processes semiconductor wafers. The conventional semiconductor FA system contains processing equipment (hereinafter referred to as EQs), 10 storage containers and an automatic conductor vehicle (hereinafter referred to as AGV). An EQ performs a semiconductor process on the semiconductor wafers. A supply container loads a semiconductor wafer cassette containing the semiconductor wafers into the EQ for processing. Furthermore, the supply holder stores the semiconductor wafer cassette, which is already processed in the EQ. The AGV transports the semiconductor wafer cartridge from the EQ to another EQ. Furthermore, the AGV transports the semiconductor wafer cassette from the supply container to the EQ. Furthermore, the AGV transports the semiconductor wafer cassette from the process equipment to the supply container.

20 Het gangbare halfgeleider-FA-systeem bevat verder een bediener- koppelingserver (hierna aangeduid met OIS) en een EQ server (hierna aangeduid met EQS). De OIS ontvangt van een bediener een procesvoorschrift als procesomstandigheidgegevens, bevattende een procestempe-ratuur, een procesdruk enz. De OIS zendt het procesvoorschrift naar 25 de EQS. De EQS zendt het procesvoorschrift naar de EQ. De EQ dient het halfgeleiderproces volgens het procesvoorschrift uit te voeren.The conventional semiconductor FA system further comprises an operator link server (hereinafter referred to as OIS) and an EQ server (hereinafter referred to as EQS). The OIS receives a process prescription from an operator as process condition data, including a process temperature, a process pressure, etc. The OIS sends the process prescription to the EQS. The EQS sends the process regulation to the EQ. The EQ must perform the semiconductor process according to the process regulation.

Nadat de halfgeleiderwafelcassette door de AGV in de EQ is geladen, ontvangt de EQ typisch het procesvoorschrift van de EQS. Terwijl de halfgeleiderwafelcassette door de AGV in de EQ wordt geladen, 30 kan een foutwerking van de EQ of de AGV worden veroorzaakt. In dit stadium kan de EQS het procesvoorschrift niet naar de EQ zenden. Nadat de foutwerking van de EQ of de AGV is verholpen, dient de bediener opnieuw het procesvoorschrift in de OIS in te voeren. Dienover- .1015480 - 2 - eenkomstig treedt er een probleem op, dat de voor het verwerken van de halfgeleiderwafelcassette benodigde tijdsperiode toeneemt.After the semiconductor wafer cartridge has been loaded into the EQ by the AGV, the EQ typically receives the process rule from the EQS. While the semiconductor wafer cartridge is being loaded by the AGV into the EQ, an error operation of the EQ or the AGV can be caused. At this stage, the EQS cannot send the process regulation to the EQ. After the EQ or AGV malfunction has been corrected, the operator must re-enter the process code into the OIS. Accordingly, a problem arises that the time period required for processing the semiconductor wafer cartridge increases.

Samenvatting van de uitvindingSummary of the invention

Het is daarom een doel van de uitvinding om een halfgeleider-5 FA-systeem en een werkwijze voor het verwerken van ten minste een halfgeleiderwafelcassette te verschaffen, welke in staat is een voor het verwerken van de halfgeleiderwafelcassette benodigde tijdsperiode te verminderen.It is therefore an object of the invention to provide a semiconductor FA system and a method for processing at least one semiconductor wafer cartridge, which is capable of reducing a time period required for processing the semiconductor wafer cartridge.

Een ander doel van de uitvinding is het verschaffen van een 10 computer-leesbaar medium, dat programmaopdrachten opslaat, waarbij de programmaopdrachten in een computer geplaatst worden om een werkwijze voor het verwerken van ten minste een halfgeleiderwafelcassette uit te voeren, welke werkwijze in staat is een voor het verwerken van de halfgeleiderwafelcassette benodigde tijdsperiode te verminderen.Another object of the invention is to provide a computer-readable medium that stores program commands, wherein the program commands are placed in a computer to perform a method of processing at least one semiconductor wafer cartridge, which method is capable of reduce the time period required for processing the semiconductor wafer cartridge.

15 Volgens een uitvoeringsvorm van de uitvinding is een inrichting voor het verwerken van ten minste een halfgeleiderwafelcassette verschaft, waarbij de halfgeleiderwafelcassette een voorafbepaald aantal halfgeleiderwafels bevat, omvattende: een bedienerkoppelingsmiddel voor het ontvangen van processchemagegevens van de halfgeleiderwafel-20 cassette en een door een bediener ingevoerd, met de halfgeleiderwafelcassette corresponderend procesvoorschrift; een halfgeleiderver-werkingsmiddel voor het verzenden van een verzoek om het procesvoorschrift en voor het verwerken van de halfgeleiderwafelcassette volgens het procesvoorschrift en de processchemagegevens van de halfge-25 leiderwafelcassette; een opslagmiddel voor het opslaan van de processchemagegevens van de halfgeleiderwafelcassette en het procesvoorschrift; en een besturingsmiddel voor het zenden van de processchemagegevens van de halfgeleiderwafelcassette en het procesvoorschrift naar het halfgeleiderverwerkingsmiddel in reactie op het verzoek 30 voordat de halfgeleiderwafelcassette in het halfgeleiderverwerkingsmiddel wordt geladen.According to an embodiment of the invention, there is provided a device for processing at least one semiconductor wafer cassette, the semiconductor wafer cassette comprising a predetermined number of semiconductor wafers, comprising: an operator interface means for receiving process diagram data from the semiconductor wafer cassette and an operator input , process instruction corresponding to the semiconductor wafer cartridge; a semiconductor processing means for sending a request for the process protocol and for processing the semiconductor wafer cartridge according to the process protocol and the process diagram data of the semiconductor wafer cartridge; a storage means for storing the process diagram data of the semiconductor wafer cartridge and the process protocol; and a control means for transmitting the process diagram data from the semiconductor wafer cartridge and the process protocol to the semiconductor processor means in response to the request before the semiconductor wafer cartridge is loaded into the semiconductor processor means.

Volgens een andere uitvoeringsvorm van de uitvinding is een halfgeleiderfabriekautomatiserings(FA)systeem voor het verwerken van ten minste een halfgeleiderwafelcassette verschaft, waarbij de half-35 geleiderwafelcassette een voorafbepaald aantal halfgeleiderwafels bevat, omvattende: een bedienerkoppelingsmiddel voor het ontvangen van processchemagegevens van de halfgeleiderwafelcassette en een door een bediener ingevoerd, met de halfgeleiderwafelcassette corresponderend procesvoorschrift; een halfgeleiderverwerkingsmiddel voor het verwer-According to another embodiment of the invention, a semiconductor factory automation (FA) system for processing at least one semiconductor wafer cassette is provided, the semiconductor wafer cassette comprising a predetermined number of semiconductor wafers, comprising: an operator interface means for receiving process diagram data from the semiconductor wafer cassette and a process instruction entered by an operator corresponding to the semiconductor wafer cartridge; a semiconductor processing means for processing

)- '1 3 C V) - 1 3 C V

V l · · · : · .'· · • \j . v/ vy - 3 - ken van de halfgeleiderwafelcassette volgens het procesvoorschrift en de processchemagegevens van de halfgeleiderwafelcassette; een tussen het bedienerkoppelingsmiddel en het halfgeleiderverwerkingsmiddel geschakeld opslagmiddel voor het opslaan van de processchemagegevens 5 van de halfgeleiderwafelcassette en het procesvoorschrift; en een be-sturingsmiddel voor het zenden van de processchemagegevens van de halfgeleiderwafelcassette en het procesvoorschrift naar het halfgeleiderverwerkingsmiddel zodat de halfgeleiderwafelcassette in het halfgeleiderverwerkingsmiddel wordt geladen.V l · · ·: ·. '· · • \ j. v / vy - 3 - knowing the semiconductor wafer cartridge according to the process protocol and the process diagram data of the semiconductor wafer cartridge; a storage means connected between the operator coupling means and the semiconductor processing means for storing the process diagram data of the semiconductor wafer cartridge and the process protocol; and a control means for sending the process diagram data from the semiconductor wafer cartridge and the process protocol to the semiconductor processor means so that the semiconductor wafer cartridge is loaded into the semiconductor processor means.

10 Volgens een ander aspect van de uitvinding is een werkwijze voor het verwerken van ten minste een halfgeleiderwafelcassette in een halfgeleiderfabriekautomatiserings(FA)systeem verschaft, waarbij de halfgeleiderwafelcassette een voorafbepaald aantal halfgeleiderwa-fels bevat, omvattende de stappen van: a) het ontvangen van proces-15 schemagegevens van de halfgeleiderwafelcassette en een door een bediener ingevoerde, met de halfgeleiderwafelcassette corresponderend procesvoorschrift; b) het opslaan van de processchemagegevens van de halfgeleiderwafelcassette en het procesvoorschrift; c) het zenden van de processchemagegevens van de halfgeleiderwafels en het procesvoor-20 schrift naar een procesinrichting voordat de halfgeleiderwafelcassette in de procesinrichting wordt geladen; en d) het verwerken van de halfgeleiderwafelcassette volgens het procesvoorschrift en de processchemagegevens van de halfgeleiderwafelcassette.According to another aspect of the invention, a method for processing at least one semiconductor wafer cassette in a semiconductor factory automation (FA) system is provided, the semiconductor wafer cassette comprising a predetermined number of semiconductor wafers, comprising the steps of: a) receiving process -15 schematic data of the semiconductor wafer cassette and a process instruction entered by an operator corresponding to the semiconductor wafer cassette; b) storing the process diagram data of the semiconductor wafer cartridge and the process rule; c) sending the process diagram data from the semiconductor wafers and the process rule to a process device before the semiconductor wafer cartridge is loaded into the process device; and d) processing the semiconductor wafer cartridge according to the process rule and the process diagram data of the semiconductor wafer cartridge.

Volgens een verder aspect van de uitvinding is een computer-25 leesbaar medium, dat programmainstructies opslaat, welke programmain-structies geplaatst worden in een computer om de verwerking van ten minste een halfgeleiderwafelcassette in een halfgeleiderfabriekauto-matiseringssysteem uit te voeren, verschaft, waarbij de halfgeleiderwafelcassette een voorafbepaald aantal halfgeleiderwafels bevat, om-30 vattende de stappen van: a) het ontvangen van processchemagegevens van de halfgeleiderwafelcassette en een door een bediener ingevoerde, met de halfgeleiderwafelcassette corresponderend procesvoorschrift; b) het opslaan van de processchemagegevens van de halfgeleiderwafelcassette en het procesvoorschrift; c) het zenden van de processchema-35 gegevens van de halfgeleiderwafels en het procesvoorschrift naar een procesinrichting voordat de halfgeleiderwafelcassette in de procesinrichting wordt geladen; en d) het verwerken van de halfgeleiderwafelcassette volgens het procesvoorschrift en de processchemagegevens van de halfgeleiderwafelcassette.According to a further aspect of the invention, a computer-readable medium storing program instructions, which program instructions are placed in a computer to perform the processing of at least one semiconductor wafer cassette in a semiconductor factory automation system, is provided, the semiconductor wafer cassette includes a predetermined number of semiconductor wafers, comprising the steps of: a) receiving process diagram data from the semiconductor wafer cartridge and a process instruction entered by an operator corresponding to the semiconductor wafer cartridge; b) storing the process diagram data of the semiconductor wafer cartridge and the process rule; c) sending the process diagram data from the semiconductor wafers and the process protocol to a process device before the semiconductor wafer cartridge is loaded into the process device; and d) processing the semiconductor wafer cartridge according to the process rule and the process diagram data of the semiconductor wafer cartridge.

1015480 - 4 -1015480 - 4 -

Korte beschrijving van de tekeningBrief description of the drawing

De bovenstaande en andere doelen en kenmerken van de uitvinding zullen duidelijk worden uit de volgende beschrijving van voorkeursuitvoeringsvormen in samenhang met de bijgevoegde tekening, waarin: 5 fig. 1 een blokschema is, dat een halfgeleider-FA-systeem voor het verwerken van ten minste een halfgeleiderwafelcassette volgens de uitvinding beschrijft; fig. 2 een blokschema is, dat een in fig. 1 weergegeven trans-portbesturingsgedeelte toont; en 10 fig. 3 en 4 stroomschema's zijn, die een werkwijze voor het verwerken van ten minste een halfgeleiderwafelcassette in een halfgeleider-FA-systeem volgens de uitvinding tonen.The above and other objects and features of the invention will become apparent from the following description of preferred embodiments in conjunction with the accompanying drawings, in which: Figure 1 is a block diagram showing a semiconductor FA system for processing at least one describes a semiconductor wafer cartridge according to the invention; FIG. 2 is a block diagram showing a transport control portion shown in FIG. 1; and FIGS. 3 and 4 are flow charts showing a method for processing at least one semiconductor wafer cartridge in a semiconductor FA system according to the invention.

Gedetailleerde beschrijving van de uitvindingDetailed description of the invention

Er wordt nu verwezen naar fig. 1, waarin een blokschema is 15 weergegeven, dat een halfgeleider-FA-systeem voor het verwerken van ten minste een halfgeleiderwafelcassette volgens de uitvinding toont. Zoals is weergegeven bevat het halfgeleider-FA-systeem ten minste een cel, die een voorafbepaald aantal, bijv. 4, halfgeleiderproductiecom-partimenten heeft. Een halfgeleiderproductiecompartiment 400 is opge-20 nomen in een cel. Een halfgeleiderproductiecompartiment 400 is voorzien van EQ's 204, voorraadhouders 216 en een AGV 214. De EQ 204 verwerkt halfgeleiderwafels om halfgeleiderinrichtingen te verkrijgen.Reference is now made to Fig. 1, which shows a block diagram showing a semiconductor FA system for processing at least one semiconductor wafer cartridge according to the invention. As shown, the semiconductor FA system includes at least one cell that has a predetermined number, e.g., 4, semiconductor production compartments. A semiconductor production compartment 400 is included in a cell. A semiconductor production compartment 400 is provided with EQs 204, storage containers 216 and an AGV 214. The EQ 204 processes semiconductor wafers to obtain semiconductor devices.

De EQ 204 bevat bijv. een etsinrichting, een fotolithografische inrichting, een oveninrichting, een fysische opdamp(PVD)inrichting, een 25 sputterinrichting en dergelijke. Een voorraadhouder 216 slaat tijdelijk een aantal halfgeleiderwafelcassette op. De halfgeleiderwafel-cassettes hebben elk een voorafbepaald aantal halfgeleiderwafels, welk aantal als een partij wordt aangeduid. De halfgeleiderwafelcas-settes worden onder gebruikmaking van de AGV 214 selectief naar de EQ 30 204 getransporteerd. De in de voorraadhouder 216 opgeslagen halfge leiderwafelcassette wordt naar een ander halfgeleiderproductiecompar-timent 400 getransporteerd.The EQ 204 comprises, for example, an etching device, a photolithographic device, an oven device, a physical vapor deposition (PVD) device, a sputtering device and the like. A supply holder 216 temporarily stores a number of semiconductor wafer cartridges. The semiconductor wafer cassettes each have a predetermined number of semiconductor wafers, which number is referred to as a batch. The semiconductor wafer cassettes are selectively transported to the EQ 30 204 using the AGV 214. The semiconductor wafer cassette stored in the storage container 216 is transported to another semiconductor production compartment 400.

Een procesinrichtingserver (hierna aanduid met EQS) 202 is gekoppeld aan een gemeenschappelijke communicatielijn 500, bijv. Ether-35 net™, geleverd door Xerox Corporation. Een AGV-besturing (hierna aangeduid met AGVC) 212 bestuurt de AGV 214.A process provision server (hereinafter referred to as EQS) 202 is coupled to a common communication line 500, e.g. Ether-35 net ™, supplied by Xerox Corporation. An AGV control (hereinafter referred to as AGVC) 212 controls the AGV 214.

Het halfgeleider-FA-systeem bevat ook een celbeheergedeelte 100, een met het celbeheergedeelte 100 verbonden onvertraagde-gege-vensbestand 300, een tijdelijke opslageenheid 310, een met de tijde- 1015480 - 5 - lijke opslageenheid 310 verbonden historiebeheergedeelte 312 en een met het historiebeheergedeelte 312 verbonden historiegegevensbestand 314. Het celbeheergedeelte 100, het historiebeheergedeelte 312 en het historiegegevensbestand 314 zijn respectievelijk verbonden met de ge-5 meenschappelijke communicatielijn 500 voor onderlinge communicatie.The semiconductor FA system also includes a cell management portion 100, a real-time data file 300 connected to the cell management portion 100, a temporary storage unit 310, a history management portion 312 associated with the time storage unit 310, and a history management portion 312 associated with the history management portion 312 connected history data file 314. The cell management part 100, the history management part 312 and the history data file 314 are respectively connected to the common communication line 500 for mutual communication.

Het celbeheergedeelte 100 bevat een celbeheerserver (CMS) 206, een bedienerkoppelingserver (hierna aangeduid met OIS) 201 en een ge-gevensverzamelserver (DGS) 207. De DGS 207 slaat met de partij verbonden procesgegevens op in het onvertraagde-gegevensbestand 300.The cell management portion 100 includes a cell management server (CMS) 206, an operator link server (hereinafter referred to as OIS) 201 and a data collection server (DGS) 207. The DGS 207 stores process data associated with the batch in the real-time data file 300.

10 De OIS 201 ontvangt processchemagegevens van de halfgeleiderwa- felcassette en een met de halfgeleiderwafelcassette corresponderend procesvoorschrift van een bediener. De EQ 204 zendt fen verzoek voor het procesvoorschrift aan de EQS 202. De EQ 204 verwerkt de halfgeleiderwafelcassette volgens het procesvoorschrift en de processchema-15 gegevens van de halfgeleiderwafelcassette. De tussen de OIS 201 en de EQ 204 geschakelde EQS 202 slaat de processchemagegevens van de halfgeleiderwafelcassette en het procesvoorschrift op. De EQS 202 zendt de processchemagegevens van de halfgeleiderwafelcassette en het procesvoorschrift naar de EQ 204 in reactie op het verzoek voordat de 20 halfgeleiderwafelcassette in de EQ 204 wordt geladen.The OIS 201 receives process diagram data from the semiconductor wafer cartridge and a process instruction corresponding to the semiconductor wafer cartridge from an operator. The EQ 204 sends a request for the process rule to the EQS 202. The EQ 204 processes the semiconductor wafer cartridge according to the process rule and the process diagram data of the semiconductor wafer cartridge. The EQS 202 connected between the OIS 201 and the EQ 204 stores the process diagram data of the semiconductor wafer cartridge and the process rule. The EQS 202 sends the process diagram data from the semiconductor wafer cartridge and the process rule to the EQ 204 in response to the request before the semiconductor wafer cartridge is loaded into the EQ 204.

De OIS 201 zendt een lijnmodusomzettingsbericht naar de EQS 202. De EQS 202 zendt een met het lijnmodusomzettingsbericht corresponderend lijmodusomzettingscommando naar de EQ 204. De EQS 202 zet een communicatielijnmodus van een niet-gekoppelde naar een gekoppelde 25 modus om. Verder communiceert de EQS 202 met de EQ 204 op basis van de gekoppelde modus. De EQS 202 zendt gegevens en tijdgegevens naar de EQ 204. De in de EQ 204 opgenomen gegevens en tijdgegevens worden aangepast aan de in de EQ 202 opgenomen gegevens. De EQ 204 rapporteert een poorttoestand en een werkingsmodustoestand van de EQ 204 30 aan de EQS 202, waarbij de werkingsmodustoestand een volautomatische modus en een halfautomatische modus bevat. De EQ 202 zendt resultaatgegevens van het halfgeleiderproces naar de EQS 202 nadat het halfge-leiderproces met betrekking tot de halfgeleiderwafelcassette is voltooid .The OIS 201 sends a line mode conversion message to the EQS 202. The EQS 202 sends a paste mode conversion command corresponding to the line mode conversion message to the EQ 204. The EQS 202 converts a communication line mode from a non-coupled to a coupled mode. Furthermore, the EQS 202 communicates with the EQ 204 based on the linked mode. The EQS 202 sends data and time data to the EQ 204. The data and time data included in the EQ 204 is adapted to the data recorded in the EQ 202. The EQ 204 reports a port state and an operating mode state from the EQ 204 to the EQS 202, the operating mode state including a fully automatic mode and a semi-automatic mode. The EQ 202 sends result data of the semiconductor process to the EQS 202 after the semiconductor process with respect to the semiconductor wafer cartridge has been completed.

35 Dienovereenkomstig kan het halfgeleider-FA-systeem een voor het verwerken van de halfgeleiderwafelcassette benodigde tijdsperiode verminderen door het zenden van de processchemagegevens van de halfgeleiderwafelcassette en het procesvoorschrift naar de EQ 204 voordat de halfgeleiderwafelcassette in de EQ 204 wordt geladen.Accordingly, the semiconductor FA system can reduce a period of time required to process the semiconductor wafer cartridge by sending the process diagram data from the semiconductor wafer cartridge and the process protocol to the EQ 204 before the semiconductor wafer cartridge is loaded into the EQ 204.

1015480 - 6 -1015480 - 6 -

Er wordt nu verwezen naar fig. 2, waarin een blokschema is weergegeven, dat een in fig. 1 weergegeven transportbesturingsgedeel-te toont. Zoals is weergegeven, bevat het transportbesturingsgedeelte 116 aan de gemeenschappelijke communicatielijn 500 gekoppelde intra-5 compartimentbesturingsservers (hierna aangeduid met ICS's) en voor-raadhouderbesturingsservers (hierna aangeduid met SCS's) 218. De ICS 210 zet een van de gemeenschappelijke communicatielijn 500 afkomstig transportbericht om in een transportcommando. De SCS 218 wekt een voorraadhouderbesturingscommando op om de voorraadhouders 216 in re-10 actie op het transportcommando te besturen. De AGVC 212 wekt een AGV-besturingscommando op om een AGV 214 in reactie op het transportcommando te besturen.Reference is now made to Fig. 2, which shows a block diagram showing a transport control part shown in Fig. 1. As shown, the transport control section 116 includes intra-compartment control servers (hereinafter referred to as ICSs) and inventory manager control servers (hereinafter referred to as SCSs) 218 connected to the common communication line 500. The ICS 210 converts a transport message originating from the common communication line 500 into a transport command. The SCS 218 generates a supply container control command to control the supply containers 216 in response to the transport command. The AGVC 212 generates an AGV control command to control an AGV 214 in response to the transport command.

Er wordt nu verwezen naar fig. 3 en 4, waarin stroomschema's zijn weergegeven, die een werkwijze voor het verwerken van ten minste 15 een halfgeleiderwafelcassette in een halfgeleider-FA-systeem volgens de uitvinding tonen.Reference is now made to FIGS. 3 and 4, which show flow charts showing a method for processing at least one semiconductor wafer cartridge in a semiconductor FA system according to the invention.

Er wordt nu verwezen naar fig. 3, waarin in stap 302 de OIS 201 een door de bediener ingevoerd lijnmodusomzettingscommando ontvangt en een met het lijnmodusomzettingscommando corresponderend bericht 20 via de gemeenschappelijke communicatielijn 500 naar de EQS 202 zendt.Reference is now made to Fig. 3, in which in step 302 the OIS 201 receives a line mode conversion command entered by the operator and sends a message corresponding to the line mode conversion command via the common communication line 500 to the EQS 202.

In stap S304 zet de EQS 202 een communicatielijnmodus van een niet-gekoppelde modus om in een gekoppelde modus. De EQS 202 zendt het lijnmodusomzettingscommando naar de EQ 204. Vervolgens communiceert de EQS 202 met de EQ 204 op basis van een gekoppelde modus.In step S304, the EQS 202 converts a communication line mode from an uncoupled mode to a coupled mode. The EQS 202 sends the line mode conversion command to the EQ 204. Next, the EQS 202 communicates with the EQ 204 based on a linked mode.

25 In stap S306 vraagt de EQ 204 aan de EQS 202 om gegevens en tijdgegevens, na het ontvangen van het lijnmodusomzettingscommando van de EQS 202.In step S306, the EQ 204 requests the EQS 202 for data and time data, after receiving the line mode conversion command from the EQS 202.

In stap S308 zendt de EQ 202 de gegevens en tijdgegevens naar de EQ 204. Vervolgens worden de in de EQ 204 opgeslagen gegevens en 30 tijdgegevens aangepast aan de in de EQS 202 opgeslagen gegevens.In step S308, the EQ 202 sends the data and time data to the EQ 204. Next, the data and time data stored in the EQ 204 are adapted to the data stored in the EQS 202.

In stap S310 rapporteert de EQ 204 een poorttoestand, een EQ-toestand en een werkingsmodustoestand van de EQ 204 aan de EQS 202, waarbij de werkingsmodustoestand een volautomatische modus en een halfautomatische modus bevat.In step S310, the EQ 204 reports a port state, an EQ state, and an operating mode state from the EQ 204 to the EQS 202, the operating mode state including a fully automatic mode and a semi-automatic mode.

35 In stap S312 zendt de EQS 202 in reactie op het van de EQ 204 afkomstige rapport een bevestigingssignaal naar de EQ 204.In step S312, the EQS 202 sends a confirmation signal to the EQ 204 in response to the report from the EQ 204.

In stap S314 zendt de EQ 204 een verzoek aan de EQS 202, zodat de halfgeleiderwafelcassette in de EQ 204 kan worden geladen.In step S314, the EQ 204 sends a request to the EQS 202 so that the semiconductor wafer cartridge can be loaded into the EQ 204.

] η 1 r-T 3 o ,·-) - 7 -] η 1 r-T 3 o, · -) - 7 -

In stap S316 zendt de EQS 202 in reactie op het van de EQ 204 afkomstige verzoek het bevestigingssignaal naar de EQ 204.In step S316, the EQS 202 sends the acknowledgment signal to the EQ 204 in response to the request from the EQ 204.

In stap S318 ontvangt de OIS 201 van de bediener processchema-gegevens van de halfgeleiderwafelcassette, zodat de halfgeleiderwa-5 felcassette gepland wordt om in de EQ 204 te worden geladen volgens de processchemagegevens van de halfgeleiderwafelcassette. Verder ontvangt de OIS 201 van de bediener een met de halfgeleiderwafelcassette corresponderend procesvoorschrift, waarbij het procesvoorschrift een procestemperatuur, een procesdruk enz. als procesomstandigheidgege-10 vens bevat. Vervolgens zendt de OIS 201 de processchemagegevens van de halfgeleiderwafelcassette en het met de halfgeleiderwafelcassette corresponderende procesvoorschrift naar de EQS 202.In step S318, the OIS 201 of the operator receives process diagram data from the semiconductor wafer cartridge, so that the semiconductor wafer cartridge is scheduled to be loaded into the EQ 204 according to the process diagram data of the semiconductor wafer cartridge. Furthermore, the OIS 201 receives from the operator a process protocol corresponding to the semiconductor wafer cartridge, the process protocol including a process temperature, a process pressure, etc. as process condition data. Next, the OIS 201 sends the process diagram data from the semiconductor wafer cartridge and the process rule corresponding to the semiconductor wafer cartridge to the EQS 202.

In stap S320 slaat de EQS 202 de van de OIS 201 afkomstige processchemagegevens van de halfgeleiderwafelcassette en het met de 15 halfgeleiderwafelcassette corresponderende procesvoorschrift op. De EQS 202 vraagt aan de EQ 204 om een halfgeleiderproces te initialise-ren.In step S320, the EQS 202 stores the process diagram data from the OIS 201 of the semiconductor wafer cartridge and the process rule corresponding to the semiconductor wafer cartridge. The EQS 202 asks the EQ 204 to initialize a semiconductor process.

In stap S322 zendt de EQ 204 in reactie op de vraag van de EQS 202 het bevestigingssignaal de EQS 202.In step S322, the EQ 204, in response to the request from the EQS 202, sends the acknowledgment signal to the EQS 202.

20 In stap S324 zendt de EQS 202 het procesvoorschrift naar de EQIn step S324, the EQS 202 sends the process rule to the EQ

204 .204.

In stap S326 informeert de EQ 204 de EQS 202 dat de EQ 204 het procesvoorschrift van de EQS 202 heeft ontvangen.In step S326, the EQ 204 informs the EQS 202 that the EQ 204 has received the process rule from the EQS 202.

In stap S328 vraagt de EQS 202 aan de AGV 214 om de halfgelei-25 derwafelcassette in de EQ 204 te laden.In step S328, the EQS 202 requests the AGV 214 to load the semiconductor wafer cassette into the EQ 204.

In stap S330 zendt de AGV 214 in reactie op de vraag van de EQS 202 het bevestigingssignaal naar de EQS 202.In step S330, the AGV 214 sends the acknowledgment signal to the EQS 202 in response to the demand from the EQS 202.

In stap S332 informeert de AGV 214 de EQS 202 dat de AGV 214 voor de EQ 204 is gestart.In step S332, the AGV 214 informs the EQS 202 that the AGV 214 for the EQ 204 has been started.

30 In stap S334 bereikt de AGV 214 de EQ 204 om de halfgeleiderwa felcassette in de EQ 204 te laden.In step S334, the AGV 214 reaches the EQ 204 to load the semiconductor wafer cartridge into the EQ 204.

In stap S336 maakt de EQ 204 zijn deur open.In step S336, the EQ 204 opens its door.

In stap S338 laadt de AGV 214 de halfgeleiderwafelcassette in de EQ 204.In step S338, the AGV 214 loads the semiconductor wafer cartridge into the EQ 204.

35 In stap S340 rapporteert de EQ 204 de poorttoestand van de EQIn step S340, the EQ 204 reports the port state of the EQ

204 aan de EQS 202.204 at the EQS 202.

In stap S342 zendt de EQS 202 in reactie op het van de EQ 204 afkomstige rapport het bevestigingssignaal naar de EQ 204.In step S342, the EQS 202 sends the acknowledgment signal to the EQ 204 in response to the report from the EQ 204.

In stap S344 doet de EQ 204 zijn deur sluiten.In step S344, the EQ 204 closes its door.

— 'i "· ♦ r\ ··'> i i i.i. ’ i - 8 -- "i" · ♦ r \ ·· '> i i i.i. ’i - 8 -

In stap S346 informeert de AGV 214 de EQS 202 dat de AGV 214 de halfgeleiderwafelcassette in de EQ 204 heeft geladen.In step S346, the AGV 214 informs the EQS 202 that the AGV 214 has loaded the semiconductor wafer cartridge into the EQ 204.

In stap S348 informeert de EQ 204 de EQS 202 dat de halfgeleiderwafelcassette in de EQ 204 is geladen.In step S348, the EQ 204 informs the EQS 202 that the semiconductor wafer cartridge has been loaded into the EQ 204.

5 In stap S350 zendt de EQS 202 in reactie op de van de EQ 204 afkomstige informatie het bevestigingssignaal naar de EQ 204.In step S350, the EQS 202 sends the acknowledgment signal to the EQ 204 in response to the information from the EQ 204.

Er wordt nu verwezen naar fig. 4, waarin in stap S402 de EQS 202 aan de EQ 204 vraagt om de in de halfgeleiderwafelcassette aanwezige halfgeleiderwafels te verwerken.Reference is now made to Fig. 4, in which in step S402 the EQS 202 requests the EQ 204 to process the semiconductor wafers present in the semiconductor wafer cassette.

10 In stap S404 zendt de EQ 204 in reactie op de van de EQS 202 afkomstige vraag het bevestigingssignaal naar de EQS 202.In step S404, the EQ 204 sends the acknowledgment signal to the EQS 202 in response to the query from the EQS 202.

In stap S406 informeert de EQ 204 de EQS 202 dat de EQ 204 een met de halfgeleiderwafelcassette corresponderend halfgeleiderproces heeft gestart.In step S406, the EQ 204 informs the EQS 202 that the EQ 204 has started a semiconductor process corresponding to the semiconductor wafer cartridge.

15 In stap S408 zendt de EQS 202 in reactie op de van de EQ 204 afkomstige informatie het bevestigingssignaal naar de EQ 204.In step S408, the EQS 202 sends the acknowledgment signal to the EQ 204 in response to the information from the EQ 204.

In stap S410 voert de EQ 204 het halfgeleiderproces met betrekking tot de in de halfgeleiderwafelcassette aanwezige halfgeleiderwa-fels volgens het procesvoorschrift uit.In step S410, the EQ 204 performs the semiconductor process with respect to the semiconductor wafers contained in the semiconductor wafer cartridge according to the process rule.

20 In stap S412 zendt de EQ 204 resultaatgegevens van het halfge leiderproces naar de EQS 202.In step S412, the EQ 204 sends result data of the semiconductor process to the EQS 202.

In stap S414 zendt de EQS 202 het bevestigingssignaal naar de EQ 204 na het ontvangen van de resultaatgegevens van het halfgeleiderproces .In step S414, the EQS 202 sends the confirmation signal to the EQ 204 after receiving the semiconductor process result data.

25 In stap S416 informeert de EQ 204 de EQS 202 dat de EQ 204 het halfgeleiderproces heeft voltooid.In step S416, the EQ 204 informs the EQS 202 that the EQ 204 has completed the semiconductor process.

In stap S418 zendt de EQS 202 in reactie op de van de EQ 204 afkomstige informatie het bevestigingssignaal naar de EQ 204.In step S418, the EQS 202 sends the acknowledgment signal to the EQ 204 in response to the information from the EQ 204.

In stap S420 vraagt de EQS 202 aan de AGV 214 om de halfgelei- 30 derwafelcassette uit de EQ 204 te ontladen.In step S420, the EQS 202 requests the AGV 214 to discharge the semiconductor wafer cartridge from the EQ 204.

In stap S422 zendt de AGV 214 in reactie op de van de EQS 202 afkomstige vraag het bevestigingssignaal naar de EQS 202.In step S422, the AGV 214 sends the acknowledgment signal to the EQS 202 in response to the query from the EQS 202.

In stap S424 bereikt de AGV 214 de EQ 204 om de halfgeleiderwafelcassette uit de EQ 204 te ontladen.In step S424, the AGV 214 reaches the EQ 204 to discharge the semiconductor wafer cartridge from the EQ 204.

35 In stap S426 maakt de EQ 204 zijn deur open.In step S426, the EQ 204 opens its door.

In stap S428 ontlaadt de AGV 214 de halfgeleiderwafelcassette uit de EQ 204.In step S428, the AGV 214 discharges the semiconductor wafer cartridge from the EQ 204.

In stap S430 rapporteert de EQ 204 de poorttoestand van de EQ 204 aan de EQS 202.In step S430, the EQ 204 reports the port state of the EQ 204 to the EQS 202.

} d . - r O J} d. - r O J

- 9 -- 9 -

In stap S432 zendt de EQS 202 in reactie op het van de EQ 204 afkomstige rapport het bevestigingssignaal naar de EQ 204.In step S432, the EQS 202 sends the acknowledgment signal to the EQ 204 in response to the report from the EQ 204.

In stap S434 doet de EQ 204 zijn deur sluiten.In step S434, the EQ 204 closes its door.

In stap S436 informeert de AGV 214 de EQS 202 dat de AGV 214 de 5 halfgeleiderwafelcassette uit de EQ 204 heeft ontladen.In step S436, the AGV 214 informs the EQS 202 that the AGV 214 has discharged the semiconductor wafer cartridge from the EQ 204.

In stap S438 informeert de EQ 204 aan de EQS 202 dat de halfgeleiderwafelcassette uit de EQ 204 is ontladen.In step S438, the EQ 204 informs the EQS 202 that the semiconductor wafer cartridge has been discharged from the EQ 204.

In stap S440 zendt de EQS 202 in reactie op de van de EQ 204 afkomstige informatie het bevestigingssignaal naar de EQ 204.In step S440, the EQS 202 sends the acknowledgment signal to the EQ 204 in response to the information from the EQ 204.

10 Hoewel de voorkeursuitvoeringsvormen van de uitvinding zijn ge openbaard voor illustratieve doeleinden, zal het voor de vakman op dit gebied van de techniek duidelijk zijn dat verschillende modificaties, toevoegingen en vervangingen mogelijk zijn, zonder het kader en de gedachte van de uitvinding, zoals deze geopenbaard worden in de 15 bijgevoegde conclusies, te verlaten.Although the preferred embodiments of the invention have been disclosed for illustrative purposes, it will be apparent to those skilled in the art that various modifications, additions, and substitutions are possible without the scope and spirit of the invention as disclosed. in the attached claims.

10154801015480

Claims (30)

1. Inrichting voor het verwerken van halfgeleiderwafelcasset-5 tes, waarbij elk van de halfgeleiderwafelcassettes een voorafbepaald aantal halfgeleiderwafels bevat, omvattende: een bedienerkoppelingsmiddel voor het ontvangen van processche-magegevens van de halfgeleiderwafelcassettes en een door een bediener ingevoerd, met de halfgeleiderwafelcassettes corresponderend proces-10 voorschrift; een verwerkingsmiddel voor het verzenden van een verzoek om het procesvoorschrift en voor het verwerken van de halfgeleiderwafelcassettes volgens het procesvoorschrift en de processchemagegevens van de halfgeleiderwafelcassettes; 15 een opslagmiddel voor het opslaan van de processchemagegevens van de halfgeleiderwafelcassettes en het procesvoorschrift; en een besturingsmiddel voor het zenden van de processchemagegevens van de halfgeleiderwafelcassettes en het procesvoorschrift naar genoemd verwerkingsmiddel in reactie op het verzoek voordat de half-20 geleiderwafelcassettes in het verwerkingsmiddel worden geladen.What is claimed is: 1. An apparatus for processing semiconductor wafer cassettes, wherein each of the semiconductor wafer cassettes comprises a predetermined number of semiconductor wafers, comprising: 10 prescription; a processing means for transmitting a request for the process protocol and for processing the semiconductor wafer cassettes according to the process protocol and the process diagram data of the semiconductor wafer cassettes; 15 a storage means for storing the process diagram data of the semiconductor wafer cassettes and the process protocol; and a control means for transmitting the process diagram data from the semiconductor wafer cassettes and the process protocol to said processing means in response to the request before the semiconductor wafer cassettes are loaded into the processing means. 2. Inrichting volgens conclusie 1, verder omvattende: een transportmiddel voor het transporteren van de halfgeleiderwafelcassettes naar genoemd verwerkingsmiddel.The device of claim 1, further comprising: a transport means for transporting the semiconductor wafer cassettes to said processing means. 3. Inrichting volgens conclusie 2, waarbij genoemd bediener-25 koppelingsmiddel een lijnmodusomzettingsbericht naar genoemd besturingsmiddel zendt.3. Device as claimed in claim 2, wherein said operator-coupling means sends a line mode conversion message to said control means. 4. Inrichting volgens conclusie 3, waarbij genoemd besturingsmiddel een met het lijnmodusomzettingsbericht corresponderend lijnmodusomzettingscommando naar genoemd verwerkingsmiddel zendt, een 30 communicatielijnmodus van een niet-gekoppelde modus omzet in een gekoppelde modus, en communiceert met genoemd verwerkingsmiddel op basis van de gekoppelde modus.4. Device according to claim 3, wherein said control means sends a line mode conversion command corresponding to the line mode conversion message to said processing means, converts a communication line mode from an uncoupled mode to a coupled mode, and communicates with said processing means based on the coupled mode. 5. Inrichting volgens conclusie 4, waarbij genoemd besturingsmiddel datumgegevens en tijdgegevens naar genoemd verwerkings- 35 middel zendt en de in genoemd verwerkingsmiddel opgenomen datumgegevens en tijdgegevens worden aangepast aan de in genoemd besturingsmiddel aanwezige gegevens.5. Device as claimed in claim 4, wherein said control means transmits date data and time data to said processing means and the date data and time data included in said processing means are adapted to the data present in said control means. 6. Inrichting volgens conclusie 5, waarbij het verwerkingsmiddel een poorttoestand en een werkingsmodustoestand van genoemd 40 verwerkingsmiddel aan genoemd besturingsmiddel rapporteert en waarbij 101 5480"* de werkingsmodustoestand een volautomatische modus en een halfautoma-tische modus omvat.The apparatus of claim 5, wherein the processing means reports a gate state and an operating mode state of said processing means to said control means, and wherein 101 5480 "* the operating mode state comprises a fully automatic mode and a semi-automatic mode. 7. Inrichting volgens conclusie 6, waarbij genoemd bediener-koppelingsmiddel en genoemd besturingsmiddel het door Xerox Corpora- 5 tion geleverde Ethernet™ delen.Device according to claim 6, wherein said operator coupling means and said control means share the Ethernet ™ supplied by Xerox Corporation. 8. Inrichting volgens conclusie 7, waarbij genoemd verwer-kingsmiddel resultaatgegevens van het halfgeleiderproces naar genoemd besturingsmiddel zendt na voltooiing van het halfgeleiderproces met betrekking tot de halfgeleiderwafelcassettes.The apparatus of claim 7, wherein said processing means transmits semiconductor process result data to said control means upon completion of the semiconductor process with respect to the semiconductor wafer cartridges. 9. Halfgeleiderfabriekautomatiserings(FA)systeem voor het verwerken van halfgeleiderwafelcassettes, waarbij elk van de halfgeleiderwafelcassettes een voorafbepaald aantal halfgeleiderwafels bevat, omvattende: een bedienerkoppelingsmiddel voor het ontvangen van processche-15 magegevens van de halfgeleiderwafelcassettes en een door een bediener ingevoerd, met de halfgeleiderwafelcassettes corresponderend procesvoorschrift; een verwerkingsmiddel voor het verwerken van de halfgeleiderwafelcassettes volgens het procesvoorschrift en de processchemagegevens 20 van de halfgeleiderwafelcassettes; een tussen genoemd bedienerkoppelingsmiddel en genoemd verwerkingsmiddel geschakeld opslagmiddel voor het opslaan van de processchemagegevens van de halfgeleiderwafelcassettes en het procesvoorschrift; en 25 een besturingsmiddel voor het zenden van de processchemagege vens van de halfgeleiderwafelcassettes en het procesvoorschrift naar genoemd verwerkingsmiddel voordat de halfgeleiderwafelcassettes in genoemd verwerkingsmiddel worden geladen.9. A semiconductor factory automation (FA) system for processing semiconductor wafer cassettes, each of the semiconductor wafer cassettes comprising a predetermined number of semiconductor wafers, comprising: an operator interface means for receiving process data from the semiconductor wafer cassettes and an operator input corresponding to the semiconductor wafer cassettes procedural regulation; a processing means for processing the semiconductor wafer cassettes according to the process protocol and the process diagram data of the semiconductor wafer cassettes; a storage means connected between said operator coupling means and said processing means for storing the process diagram data of the semiconductor wafer cassettes and the process protocol; and a control means for sending the process diagram data of the semiconductor wafer cassettes and the process protocol to said processing means before the semiconductor wafer cassettes are loaded into said processing means. 10. Halfgeleider-FA-systeem volgens conclusie 9, verder omvat-30 tende: een transportmiddel voor het transporteren van de halfgeleiderwafelcassettes naar genoemd verwerkingsmiddel.10. The semiconductor FA system of claim 9, further comprising: a transport means for transporting the semiconductor wafer cassettes to said processing means. 11. Halfgeleider-FA-systeem volgens conclusie 10, verder omvattende : 35 een voorraadhouder voor het opslaan van de halfgeleiderwafel cassettes .11. A semiconductor FA system according to claim 10, further comprising: a supply holder for storing the semiconductor wafer cassettes. 12. Halfgeleider-FA-systeem volgens conclusie 11, waarbij genoemd transportmiddel de halfgeleiderwafelcassettes vanaf genoemde voorraadhouder naar genoemd verwerkingsmiddel transporteert. 1015480·The semiconductor FA system according to claim 11, wherein said transport means transports the semiconductor wafer cassettes from said supply container to said processing means. 1015480 · 13. Halfgeleider-FA-systeem volgens conclusie 12, waarbij genoemd verwerkingsmiddel, genoemde voorraadhouder en genoemd transportmiddel in een halfgeleiderproductiecompartiment zijn gelegen.The semiconductor FA system according to claim 12, wherein said processing means, said storage container, and said transport means are located in a semiconductor production compartment. 14. Halfgeleider-FA-systeem volgens conclusie 13, waarbij de 5 halfgeleiderwafelcassettes door een voertuig vanuit het halfgeleider-productiecompartiment naar een ander halfgeleiderproductiecomparti-ment worden getransporteerd.14. A semiconductor FA system according to claim 13, wherein the semiconductor wafer cassettes are transported by a vehicle from the semiconductor production compartment to another semiconductor production compartment. 15. Halfgeleider-FA-systeem volgens conclusie 14, waarbij genoemd bedienerkoppelingsmiddel een lijnmodusomzettingsbericht naar 10 genoemd besturingsmiddel zendt.The semiconductor FA system according to claim 14, wherein said operator coupling means sends a line mode conversion message to said control means. 16. Halfgeleider-FA-systeem volgens conclusie 15, waarbij genoemd besturingsmiddel een met het lijnmodusomzettingsbericht corresponderend lijnmodusomzettingscommando naar genoemd verwerkingsmiddel zendt en een communicatielijnmodus van een niet-gekoppelde modus om- 15 zet in een gekoppelde modus en genoemd besturingsmiddel communiceert met genoemd verwerkingsmiddel op basis van de gekoppelde modus.16. A semiconductor FA system according to claim 15, wherein said control means sends a line mode conversion message corresponding to the line mode conversion message to said processing means and converts a communication line mode of an uncoupled mode into a coupled mode and said control means communicates with said base processing means of the linked mode. 17. Halfgeleider-FA-systeem volgens conclusie 16, waarbij genoemd besturingsmiddel datumgegevens en tijdgegevens naar genoemd verwerkingsmiddel zendt en de in genoemd verwerkingsmiddel opgenomen 20 datumgegevens en tijdgegevens worden aangepast aan de in genoemd besturingsmiddel aanwezige gegevens.17. Semiconductor FA system according to claim 16, wherein said control means transmits date data and time data to said processing means and the date data and time data included in said processing means are adapted to the data present in said control means. 18. Halfgeleider-FA-systeem volgens conclusie 17, waarbij genoemd verwerkingsmiddel een poorttoestand en een werkingsmodustoe-stand van genoemd verwerkingsmiddel rapporteert aan genoemd bestu- 25 ringsmiddel en waarbij de werkingsmodustoestand een volautomatische modus en een halfautomatische modus omvat.18. Semiconductor FA system according to claim 17, wherein said processing means reports a gate state and an operating mode state of said processing means to said control means and wherein the operating mode state comprises a fully automatic mode and a semi-automatic mode. 19. Halfgeleider-FA-systeem volgens conclusie 18, waarbij genoemd bedienerkoppelingsmiddel en genoemd besturingsmiddel het door Xerox Corporation geleverde Ethernet™ delen.The semiconductor FA system according to claim 18, wherein said operator coupling means and said control means share the Ethernet ™ supplied by Xerox Corporation. 20. Halfgeleider-FA-systeem volgens conclusie 19, waarbij ge noemd verwerkingsmiddel resultaatgegevens van het halfgeleiderproces naar genoemd besturingsmiddel zendt na voltooiing van het halfgeleiderproces met betrekking tot de halfgeleiderwafelcassettes.The semiconductor FA system according to claim 19, wherein said processing means sends result data of the semiconductor process to said control means after completion of the semiconductor process with respect to the semiconductor wafer cartridges. 21. Werkwijze voor het verwerken van halfgeleiderwafelcasset- 35 tes in een halfgeleiderfabriekautomatiserings(FA)systeem, waarbij elk van de halfgeleiderwafelcassettes een voorafbepaald aantal halfgelei-derwafels bevat, omvattende de stappen van: a) het ontvangen van processchemagegevens van de halfgeleiderwafelcassettes en een door een bediener ingevoerd, met de halfge- 40 leiderwafelcassettes corresponderend procesvoorschrift; 1015480* b) het opslaan van de processchemagegevens van de halfgelei-derwafelcassettes en het procesvoorschrift; c) het zenden van de processchemagegevens van de halfgelei-derwafels en het procesvoorschrift naar een procesinrichting voordat 5 de halfgeleiderwafelcassettes in de procesinrichting worden geladen; en d) het verwerken van de halfgeleiderwafelcassettes volgens het procesvoorschrift en de processchemagegevens van de halfgeleiderwafelcassettes .21. A method for processing semiconductor wafer cassettes in a semiconductor factory automation (FA) system, wherein each of the semiconductor wafer cassettes comprises a predetermined number of semiconductor wafers, comprising the steps of: a) receiving process diagram data from the semiconductor wafer cassettes and one by one operator entered, process rule corresponding to the semiconductor wafer cassettes; 1015480 * b) storing the process diagram data of the semiconductor wafer cassettes and the process rule; c) sending the process diagram data from the semiconductor wafers and the process protocol to a process device before the semiconductor wafer cassettes are loaded into the process device; and d) processing the semiconductor wafer cassettes according to the process protocol and the process diagram data of the semiconductor wafer cassettes. 22. Werkwijze volgens conclusie 21, verder omvattende de stap van: e) het transporteren van de halfgeleiderwafelcassettes naar de procesinrichting.The method of claim 21, further comprising the step of: e) transporting the semiconductor wafer cassettes to the process device. 23. Werkwijze volgens conclusie 22, waarbij genoemde stap a) 15 verder de stappen omvat van: al) het zenden van een lijnmodusomzettingsbericht vanaf een bedienerkoppelingserver naar een procesinrichtingsserver; a2) het zenden van een met het lijnmodusomzettingsbericht corresponderend lijnmodusomzettingscommando vanaf de procesinrichtings-20 server naar de procesinrichting; en a3) het omzetten van een communicatielijnmodus tussen de procesinrichting en de procesinrichtingsserver van een niet-gekoppelde modus in een gekoppelde modus.The method of claim 22, wherein said step a) further comprises the steps of: a1) sending a line mode conversion message from an operator link server to a process provision server; a2) sending a line mode conversion command corresponding to the line mode conversion message from the process device server to the process device; and a3) converting a communication line mode between the process device and the process device server from a non-coupled mode to a coupled mode. 24. Werkwijze volgens conclusie 23, waarbij genoemde stap a) 25 verder de stappen omvat van: a4) het zenden van datumgegevens en tijdgegevens vanaf de procesinrichtingsserver naar de procesinrichting; en a5) het aanpassen van de in de procesinrichting opgeslagen datumgegevens en tijdgegevens aan de in de procesinrichtingsserver op-30 geslagen gegevens.The method of claim 23, wherein said step a) further comprises the steps of: a4) sending date data and time data from the process device server to the process device; and a5) adapting the date data and time data stored in the process device to the data stored in the process device server. 25. Werkwijze volgens conclusie 24, waarbij genoemde stap d) verder de stap omvat van: dl) het zenden van resultaatgegevens van het halfgeleiderpro-ces vanaf de procesinrichting naar de procesinrichtingsserver na het 35 voltooien van het halfgeleiderproces met betrekking tot de halfgeleiderwafelcassettes .25. The method of claim 24, wherein said step d) further comprises the step of: d1) sending result data of the semiconductor process from the process device to the process device server after completing the semiconductor process with respect to the semiconductor wafer cartridges. 26. Computer-leesbaar medium, dat programmainstructies opslaat, welke programmainstructies geplaatst worden in een computer om de verwerking van halfgeleiderwafelcassettes in een halfgeleiderfa- 40 briekautomatiseringssysteem uit te voeren, waarbij elk van de halfge- 1015480· leiderwafelcassettes een voorafbepaald aantal halfgeleiderwafels bevat, omvattende de stappen van: a) het ontvangen van processschemagegevens van de halfgelei-derwafelcassettes en een door een bediener ingevoerd, met de halfge- 5 leiderwafelcassettes corresponderend procesvoorschrift; b) het opslaan van de prcesschemagegevens van de halfgelei-derwafelcassettes en het procesvoorschrift; c) het zenden van de processchemagegevens van de halfgeleiderwafels en het procesvoorschrift naar een procesinrichting voordat 10 de halfgeleiderwafelcassettes in de procesinrichting worden geladen; en d) het verwerken van de halfgeleiderwafelcassettes volgens het procesvoorschrift en de processchemagegevens van de halfgeleiderwafelcassettes .A computer-readable medium that stores program instructions, which program instructions are placed in a computer to perform the processing of semiconductor wafer cassettes in a semiconductor factory automation system, each of the semiconductor wafer cassettes containing a predetermined number of semiconductor wafers comprising the steps of: a) receiving process diagram data from the semiconductor wafer cassettes and a process instruction input by an operator corresponding to the semiconductor wafer cassettes; b) storing the process diagram data of the semiconductor wafer cassettes and the process rule; c) sending the process diagram data from the semiconductor wafers and the process protocol to a process device before the semiconductor wafer cassettes are loaded into the process device; and d) processing the semiconductor wafer cassettes according to the process protocol and the process diagram data of the semiconductor wafer cassettes. 27. Computer-leesbaar medium volgens conclusie 26, verder om vattende de stap van: e) het transporteren van de halfgeleiderwafelcassettes naar de procesinrichting.The computer-readable medium of claim 26, further comprising the step of: e) transporting the semiconductor wafer cassettes to the process device. 28. Computer-leesbaar medum volgens conclusie 27, waarbij ge-20 noemde stap a) verder de stappen omvat van: al) het zenden van een lijnmodusomzettingsbericht vanaf een bedienerkoppelingsserver naar een procesinrichtingsserver; a2) het zenden van een met het lijnmodusomzettingsbericht corresponderend lijnmodusomzettingscommando vanaf de procesinrichtings-25 server naar de procesinrichting; en a3) het omzetten van een communicatielijnmodus tussen de procesinrichting en de procesinrichtingsserver van een niet-gekoppelde modus in een gekoppelde modus.28. The computer-readable medium of claim 27, wherein said step a) further comprises the steps of: a1) sending a line mode conversion message from an operator link server to a process provision server; a2) sending a line mode conversion command corresponding to the line mode conversion message from the process device server to the process device; and a3) converting a communication line mode between the process device and the process device server from a non-coupled mode to a coupled mode. 29. Computer-leesbaar medium volgens conclusie 28, waarbij ge-30 noemde stap a) verder de stappen omvat van: a4) het zenden van datumgegevens en tijdgegevens vanaf de procesinrichtingsserver naar de procesinrichting; en a5) het aanpassen van de in de procesinrichting opgeslagen datumgegevens en tijdgegevens aan de in de procesinrichtingsserver op-35 geslagen gegevens.29. The computer-readable medium of claim 28, wherein said step a) further comprises the steps of: a4) sending date data and time data from the process device server to the process device; and a5) adapting the date data and time data stored in the process device to the data stored in the process device server. 30. Computer-leesbaar medium volgens conclusie 29, waarbij genoemde stap d) verder de stap omvat van: dl) het zenden van resultaatgegevens van het halfgeleiderproces vanaf de procesinrichting naar de procesinrichtingsserver na het vol- f015480· 5 * tooien van het halfgeleiderproces met betrekking tot de halfgeleider-wafelcassettes. 1015480·The computer-readable medium of claim 29, wherein said step d) further comprises the step of: d1) sending result data of the semiconductor process from the process device to the process device server after completing the semiconductor process with respect to to the semiconductor wafer cassettes. 1015480 ·
NL1015480A 1999-06-22 2000-06-20 Semiconductor factory automation system and method for processing at least one semiconductor wafer cartridge. NL1015480C2 (en)

Applications Claiming Priority (8)

Application Number Priority Date Filing Date Title
KR10-1999-0023539A KR100529389B1 (en) 1999-06-22 1999-06-22 Method for operating scrubber used in manufacturing semiconductor
KR10-1999-0023540A KR100507871B1 (en) 1999-06-22 1999-06-22 Method for providing recipe to physical vapor depositor in plant manufacturing semiconductor
KR19990023539 1999-06-22
KR19990023540 1999-06-22
KR19990024872 1999-06-28
KR1019990024872A KR100540471B1 (en) 1999-06-28 1999-06-28 System for automatically operating single wafer type equipment used in manufacturing semiconductor and method using for the same
KR10-1999-0028417A KR100498602B1 (en) 1999-07-14 1999-07-14 Method for operating sputtering equipment in manufacturing semiconductor
KR19990028417 1999-07-14

Publications (2)

Publication Number Publication Date
NL1015480A1 NL1015480A1 (en) 2000-12-28
NL1015480C2 true NL1015480C2 (en) 2002-08-22

Family

ID=27483375

Family Applications (1)

Application Number Title Priority Date Filing Date
NL1015480A NL1015480C2 (en) 1999-06-22 2000-06-20 Semiconductor factory automation system and method for processing at least one semiconductor wafer cartridge.

Country Status (7)

Country Link
JP (1) JP2001068391A (en)
CN (1) CN1196044C (en)
DE (1) DE10030461A1 (en)
FR (1) FR2796474B1 (en)
GB (1) GB2351363B (en)
IT (1) IT1318042B1 (en)
NL (1) NL1015480C2 (en)

Families Citing this family (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US6535784B2 (en) * 2001-04-26 2003-03-18 Tokyo Electron, Ltd. System and method for scheduling the movement of wafers in a wafer-processing tool
US7337019B2 (en) * 2001-07-16 2008-02-26 Applied Materials, Inc. Integration of fault detection with run-to-run control
US6907305B2 (en) * 2002-04-30 2005-06-14 Advanced Micro Devices, Inc. Agent reactive scheduling in an automated manufacturing environment
JP4673548B2 (en) * 2003-11-12 2011-04-20 東京エレクトロン株式会社 Substrate processing apparatus and control method thereof
CN111301982A (en) * 2019-11-12 2020-06-19 深圳中集智能科技有限公司 Synchronous beat system and control method for container production factory

Citations (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4667403A (en) * 1984-05-16 1987-05-26 Siemens Aktiengesellschaft Method for manufacturing electronic card modules
WO1991010202A1 (en) * 1989-12-29 1991-07-11 Asyst Technologies, Inc. Processing systems with intelligent article tracking
EP0530973A1 (en) * 1991-09-05 1993-03-10 Hitachi, Ltd. Multiprocessing apparatus
EP0633207A1 (en) * 1993-07-07 1995-01-11 Siemens Aktiengesellschaft Conveying system for the transport of samples to different treating arrangements
US5432702A (en) * 1994-06-17 1995-07-11 Advanced Micro Devices Inc. Bar code recipe selection system using workstation controllers
US5751581A (en) * 1995-11-13 1998-05-12 Advanced Micro Devices Material movement server

Family Cites Families (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
GB2279775B (en) * 1990-09-17 1995-04-26 Honda Motor Co Ltd Production control method and system therefor
US5668056A (en) * 1990-12-17 1997-09-16 United Microelectronics Corporation Single semiconductor wafer transfer method and manufacturing system

Patent Citations (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4667403A (en) * 1984-05-16 1987-05-26 Siemens Aktiengesellschaft Method for manufacturing electronic card modules
WO1991010202A1 (en) * 1989-12-29 1991-07-11 Asyst Technologies, Inc. Processing systems with intelligent article tracking
EP0530973A1 (en) * 1991-09-05 1993-03-10 Hitachi, Ltd. Multiprocessing apparatus
EP0633207A1 (en) * 1993-07-07 1995-01-11 Siemens Aktiengesellschaft Conveying system for the transport of samples to different treating arrangements
US5432702A (en) * 1994-06-17 1995-07-11 Advanced Micro Devices Inc. Bar code recipe selection system using workstation controllers
US5751581A (en) * 1995-11-13 1998-05-12 Advanced Micro Devices Material movement server

Also Published As

Publication number Publication date
FR2796474A1 (en) 2001-01-19
GB0015352D0 (en) 2000-08-16
CN1280323A (en) 2001-01-17
GB2351363A (en) 2000-12-27
ITMI20001408A1 (en) 2001-12-22
GB2351363B (en) 2003-12-10
DE10030461A1 (en) 2001-01-25
IT1318042B1 (en) 2003-07-21
ITMI20001408A0 (en) 2000-06-22
FR2796474B1 (en) 2006-11-17
CN1196044C (en) 2005-04-06
JP2001068391A (en) 2001-03-16
NL1015480A1 (en) 2000-12-28

Similar Documents

Publication Publication Date Title
JP3197273B2 (en) Processing system with article tracking function with information
KR100628618B1 (en) Control apparatus and control method
US7778721B2 (en) Small lot size lithography bays
CN101393437B (en) Device for controlling processing system, method for controlling processing system
US5448470A (en) Multiprocessing apparatus
JP4760919B2 (en) Coating and developing equipment
US6269279B1 (en) Control system
US6622057B1 (en) Semiconductor factory automation system and method for controlling automatic guide vehicle
US6772032B2 (en) Semiconductor device manufacturing line
NL1015480C2 (en) Semiconductor factory automation system and method for processing at least one semiconductor wafer cartridge.
KR101079487B1 (en) Method and apparatus for enhanced operation of substrate carrier handlers
US6514345B1 (en) Processing apparatus and managing method of operational condition parameter thereof
JP2001068392A (en) Automatic assembly for semiconductor factory, automatic system thereof, and automatic method thereof
US20060271223A1 (en) Method and system for integrating equipment integration software, equipment events, mes and rules databases
JP3169001B2 (en) Lot transfer control system, transfer control method thereof, and storage medium storing transfer control program
US6604010B2 (en) System for selectively managing workpieces and a method for controlling the same
GB2358935A (en) Controlling the transport of special lots of semiconductor wafers between process stockers, eg for dust monitoring
KR100379847B1 (en) Method and system for automatic process controlling non product wafers and product wafers, and recording medium storing the method
JP2001076982A (en) System and method for automating semiconductor factory for controlling measurement equipment measuring semiconductor wafer
JP2001353644A (en) Production line
JP2003228412A (en) Managing system of production line
JP2003099126A (en) Transport system and method
KR100537190B1 (en) A method for reducing load of semiconductor fabricating line using buffer station
JP2001155980A (en) Test and repair system, product fabrication system, component test system, data processing system, component repair system, and information storage medium
JPH10270525A (en) Substrate processor, substrate processing system and data structure of processing recipe

Legal Events

Date Code Title Description
AD1A A request for search or an international type search has been filed
RD2N Patents in respect of which a decision has been taken or a report has been made (novelty report)

Effective date: 20020610

PD2B A search report has been drawn up
V1 Lapsed because of non-payment of the annual fee

Effective date: 20110101