KR102609624B1 - 방법 - Google Patents
방법 Download PDFInfo
- Publication number
- KR102609624B1 KR102609624B1 KR1020197026693A KR20197026693A KR102609624B1 KR 102609624 B1 KR102609624 B1 KR 102609624B1 KR 1020197026693 A KR1020197026693 A KR 1020197026693A KR 20197026693 A KR20197026693 A KR 20197026693A KR 102609624 B1 KR102609624 B1 KR 102609624B1
- Authority
- KR
- South Korea
- Prior art keywords
- cells
- cell
- delete delete
- cancer
- car
- Prior art date
Links
- 238000000034 method Methods 0.000 title abstract description 92
- 206010028980 Neoplasm Diseases 0.000 claims abstract description 231
- 201000011510 cancer Diseases 0.000 claims abstract description 142
- 108010019670 Chimeric Antigen Receptors Proteins 0.000 claims abstract description 120
- 239000003795 chemical substances by application Substances 0.000 claims abstract description 59
- 238000011282 treatment Methods 0.000 claims abstract description 54
- 201000005787 hematologic cancer Diseases 0.000 claims abstract description 23
- 208000024200 hematopoietic and lymphoid system neoplasm Diseases 0.000 claims abstract description 22
- 210000001744 T-lymphocyte Anatomy 0.000 claims description 158
- 108091008874 T cell receptors Proteins 0.000 claims description 89
- 206010035226 Plasma cell myeloma Diseases 0.000 claims description 66
- 102000016266 T-Cell Antigen Receptors Human genes 0.000 claims description 64
- 230000014509 gene expression Effects 0.000 claims description 53
- 201000000050 myeloid neoplasm Diseases 0.000 claims description 45
- 239000012634 fragment Substances 0.000 claims description 34
- 230000002489 hematologic effect Effects 0.000 claims description 31
- 210000002865 immune cell Anatomy 0.000 claims description 22
- 238000001990 intravenous administration Methods 0.000 claims description 21
- 239000008194 pharmaceutical composition Substances 0.000 claims description 18
- 210000000822 natural killer cell Anatomy 0.000 claims description 17
- 125000003275 alpha amino acid group Chemical group 0.000 claims description 16
- 230000002265 prevention Effects 0.000 claims description 15
- 208000010833 Chronic myeloid leukaemia Diseases 0.000 claims description 14
- 210000003719 b-lymphocyte Anatomy 0.000 claims description 14
- 210000000581 natural killer T-cell Anatomy 0.000 claims description 14
- 208000031261 Acute myeloid leukaemia Diseases 0.000 claims description 12
- 208000032852 chronic lymphocytic leukemia Diseases 0.000 claims description 12
- 239000000611 antibody drug conjugate Substances 0.000 claims description 4
- 229940049595 antibody-drug conjugate Drugs 0.000 claims description 4
- 208000024893 Acute lymphoblastic leukemia Diseases 0.000 claims description 3
- 208000014697 Acute lymphocytic leukaemia Diseases 0.000 claims 2
- 239000000427 antigen Substances 0.000 abstract description 115
- 102000036639 antigens Human genes 0.000 abstract description 115
- 108091007433 antigens Proteins 0.000 abstract description 115
- 230000008685 targeting Effects 0.000 abstract description 54
- 208000002250 Hematologic Neoplasms Diseases 0.000 abstract description 20
- 238000013459 approach Methods 0.000 abstract description 5
- 230000001024 immunotherapeutic effect Effects 0.000 abstract description 2
- 210000004027 cell Anatomy 0.000 description 446
- 239000013598 vector Substances 0.000 description 44
- 239000000203 mixture Substances 0.000 description 43
- 108090000765 processed proteins & peptides Proteins 0.000 description 41
- 108090000623 proteins and genes Proteins 0.000 description 41
- 150000007523 nucleic acids Chemical class 0.000 description 40
- 239000002609 medium Substances 0.000 description 39
- 102000039446 nucleic acids Human genes 0.000 description 39
- 108020004707 nucleic acids Proteins 0.000 description 39
- 206010061535 Ovarian neoplasm Diseases 0.000 description 35
- 101000851370 Homo sapiens Tumor necrosis factor receptor superfamily member 9 Proteins 0.000 description 34
- 102100036856 Tumor necrosis factor receptor superfamily member 9 Human genes 0.000 description 34
- 230000027455 binding Effects 0.000 description 33
- 239000000523 sample Substances 0.000 description 33
- 206010033128 Ovarian cancer Diseases 0.000 description 32
- 210000000130 stem cell Anatomy 0.000 description 32
- 210000003819 peripheral blood mononuclear cell Anatomy 0.000 description 30
- 210000004881 tumor cell Anatomy 0.000 description 30
- 235000001014 amino acid Nutrition 0.000 description 29
- 210000004369 blood Anatomy 0.000 description 28
- 239000008280 blood Substances 0.000 description 28
- 230000004083 survival effect Effects 0.000 description 28
- 239000011324 bead Substances 0.000 description 27
- 102000004169 proteins and genes Human genes 0.000 description 27
- 229940024606 amino acid Drugs 0.000 description 26
- 150000001413 amino acids Chemical class 0.000 description 26
- 208000032839 leukemia Diseases 0.000 description 26
- 241000699670 Mus sp. Species 0.000 description 25
- 235000018102 proteins Nutrition 0.000 description 25
- 230000011664 signaling Effects 0.000 description 25
- 108010002350 Interleukin-2 Proteins 0.000 description 24
- 102000000588 Interleukin-2 Human genes 0.000 description 24
- 230000009258 tissue cross reactivity Effects 0.000 description 23
- 229960005486 vaccine Drugs 0.000 description 22
- 241001465754 Metazoa Species 0.000 description 21
- 210000001185 bone marrow Anatomy 0.000 description 21
- 238000000338 in vitro Methods 0.000 description 21
- 208000034578 Multiple myelomas Diseases 0.000 description 20
- 238000003556 assay Methods 0.000 description 20
- 230000000139 costimulatory effect Effects 0.000 description 20
- 239000003814 drug Substances 0.000 description 20
- 102000004127 Cytokines Human genes 0.000 description 19
- 108090000695 Cytokines Proteins 0.000 description 19
- 101000914514 Homo sapiens T-cell-specific surface glycoprotein CD28 Proteins 0.000 description 19
- 102100027213 T-cell-specific surface glycoprotein CD28 Human genes 0.000 description 19
- 238000006467 substitution reaction Methods 0.000 description 19
- 238000012360 testing method Methods 0.000 description 19
- 101000946843 Homo sapiens T-cell surface glycoprotein CD8 alpha chain Proteins 0.000 description 18
- 102100034922 T-cell surface glycoprotein CD8 alpha chain Human genes 0.000 description 18
- 238000004458 analytical method Methods 0.000 description 18
- 239000002953 phosphate buffered saline Substances 0.000 description 18
- 102000004196 processed proteins & peptides Human genes 0.000 description 18
- 108091003079 Bovine Serum Albumin Proteins 0.000 description 17
- 108020004414 DNA Proteins 0.000 description 17
- 230000004913 activation Effects 0.000 description 17
- 239000012091 fetal bovine serum Substances 0.000 description 17
- 238000004519 manufacturing process Methods 0.000 description 17
- 238000010361 transduction Methods 0.000 description 17
- 230000026683 transduction Effects 0.000 description 17
- 230000004614 tumor growth Effects 0.000 description 17
- 206010025323 Lymphomas Diseases 0.000 description 16
- 239000000872 buffer Substances 0.000 description 16
- 238000000684 flow cytometry Methods 0.000 description 16
- 238000001943 fluorescence-activated cell sorting Methods 0.000 description 16
- 210000000265 leukocyte Anatomy 0.000 description 16
- 102000005962 receptors Human genes 0.000 description 16
- 108020003175 receptors Proteins 0.000 description 16
- 210000001519 tissue Anatomy 0.000 description 16
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 15
- 210000004698 lymphocyte Anatomy 0.000 description 15
- ZDXPYRJPNDTMRX-VKHMYHEASA-N L-glutamine Chemical compound OC(=O)[C@@H](N)CCC(N)=O ZDXPYRJPNDTMRX-VKHMYHEASA-N 0.000 description 14
- 230000001086 cytosolic effect Effects 0.000 description 14
- 201000010099 disease Diseases 0.000 description 14
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 14
- 230000000694 effects Effects 0.000 description 14
- 208000024891 symptom Diseases 0.000 description 14
- -1 CD86 Proteins 0.000 description 13
- 108010021625 Immunoglobulin Fragments Proteins 0.000 description 13
- 102000008394 Immunoglobulin Fragments Human genes 0.000 description 13
- 241000699666 Mus <mouse, genus> Species 0.000 description 13
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 13
- 230000004068 intracellular signaling Effects 0.000 description 13
- 208000010839 B-cell chronic lymphocytic leukemia Diseases 0.000 description 12
- 208000032791 BCR-ABL1 positive chronic myelogenous leukemia Diseases 0.000 description 12
- 241001529936 Murinae Species 0.000 description 12
- 208000033761 Myelogenous Chronic BCR-ABL Positive Leukemia Diseases 0.000 description 12
- 238000002474 experimental method Methods 0.000 description 12
- 238000009396 hybridization Methods 0.000 description 12
- 238000001727 in vivo Methods 0.000 description 12
- 210000001165 lymph node Anatomy 0.000 description 12
- DAEPDZWVDSPTHF-UHFFFAOYSA-M sodium pyruvate Chemical compound [Na+].CC(=O)C([O-])=O DAEPDZWVDSPTHF-UHFFFAOYSA-M 0.000 description 12
- 208000031422 Lymphocytic Chronic B-Cell Leukemia Diseases 0.000 description 11
- 238000004113 cell culture Methods 0.000 description 11
- 238000002512 chemotherapy Methods 0.000 description 11
- 230000028993 immune response Effects 0.000 description 11
- 230000004048 modification Effects 0.000 description 11
- 238000012986 modification Methods 0.000 description 11
- 230000035755 proliferation Effects 0.000 description 11
- 230000004936 stimulating effect Effects 0.000 description 11
- 208000025324 B-cell acute lymphoblastic leukemia Diseases 0.000 description 10
- 108091007741 Chimeric antigen receptor T cells Proteins 0.000 description 10
- 210000001772 blood platelet Anatomy 0.000 description 10
- 238000002648 combination therapy Methods 0.000 description 10
- 229940079593 drug Drugs 0.000 description 10
- 238000011156 evaluation Methods 0.000 description 10
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 10
- 235000004554 glutamine Nutrition 0.000 description 10
- 239000012071 phase Substances 0.000 description 10
- 239000011780 sodium chloride Substances 0.000 description 10
- 241000894007 species Species 0.000 description 10
- 238000010186 staining Methods 0.000 description 10
- 208000026310 Breast neoplasm Diseases 0.000 description 9
- 108060003951 Immunoglobulin Proteins 0.000 description 9
- 206010025280 Lymphocytosis Diseases 0.000 description 9
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 9
- 206010027406 Mesothelioma Diseases 0.000 description 9
- 208000033776 Myeloid Acute Leukemia Diseases 0.000 description 9
- 241000700605 Viruses Species 0.000 description 9
- 230000006870 function Effects 0.000 description 9
- 102000018358 immunoglobulin Human genes 0.000 description 9
- 238000011534 incubation Methods 0.000 description 9
- 229920001184 polypeptide Polymers 0.000 description 9
- 230000004044 response Effects 0.000 description 9
- 210000002966 serum Anatomy 0.000 description 9
- 239000000243 solution Substances 0.000 description 9
- HKZAAJSTFUZYTO-LURJTMIESA-N (2s)-2-[[2-[[2-[[2-[(2-aminoacetyl)amino]acetyl]amino]acetyl]amino]acetyl]amino]-3-hydroxypropanoic acid Chemical compound NCC(=O)NCC(=O)NCC(=O)NCC(=O)N[C@@H](CO)C(O)=O HKZAAJSTFUZYTO-LURJTMIESA-N 0.000 description 8
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 8
- ZDILXFDENZVOTL-BPNCWPANSA-N Ala-Val-Tyr Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(O)=O ZDILXFDENZVOTL-BPNCWPANSA-N 0.000 description 8
- 208000017604 Hodgkin disease Diseases 0.000 description 8
- 208000021519 Hodgkin lymphoma Diseases 0.000 description 8
- 208000010747 Hodgkins lymphoma Diseases 0.000 description 8
- 101000716102 Homo sapiens T-cell surface glycoprotein CD4 Proteins 0.000 description 8
- 239000012980 RPMI-1640 medium Substances 0.000 description 8
- 102100036011 T-cell surface glycoprotein CD4 Human genes 0.000 description 8
- 230000001154 acute effect Effects 0.000 description 8
- 230000000903 blocking effect Effects 0.000 description 8
- 230000000875 corresponding effect Effects 0.000 description 8
- 238000012217 deletion Methods 0.000 description 8
- 230000037430 deletion Effects 0.000 description 8
- NOESYZHRGYRDHS-UHFFFAOYSA-N insulin Chemical compound N1C(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(NC(=O)CN)C(C)CC)CSSCC(C(NC(CO)C(=O)NC(CC(C)C)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CCC(N)=O)C(=O)NC(CC(C)C)C(=O)NC(CCC(O)=O)C(=O)NC(CC(N)=O)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CSSCC(NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2C=CC(O)=CC=2)NC(=O)C(CC(C)C)NC(=O)C(C)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2NC=NC=2)NC(=O)C(CO)NC(=O)CNC2=O)C(=O)NCC(=O)NC(CCC(O)=O)C(=O)NC(CCCNC(N)=N)C(=O)NCC(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC(O)=CC=3)C(=O)NC(C(C)O)C(=O)N3C(CCC3)C(=O)NC(CCCCN)C(=O)NC(C)C(O)=O)C(=O)NC(CC(N)=O)C(O)=O)=O)NC(=O)C(C(C)CC)NC(=O)C(CO)NC(=O)C(C(C)O)NC(=O)C1CSSCC2NC(=O)C(CC(C)C)NC(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CC(N)=O)NC(=O)C(NC(=O)C(N)CC=1C=CC=CC=1)C(C)C)CC1=CN=CN1 NOESYZHRGYRDHS-UHFFFAOYSA-N 0.000 description 8
- 238000002955 isolation Methods 0.000 description 8
- 230000002829 reductive effect Effects 0.000 description 8
- 125000006850 spacer group Chemical group 0.000 description 8
- 239000006228 supernatant Substances 0.000 description 8
- 238000002560 therapeutic procedure Methods 0.000 description 8
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Chemical compound O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 8
- 206010006187 Breast cancer Diseases 0.000 description 7
- 206010009944 Colon cancer Diseases 0.000 description 7
- 241000701022 Cytomegalovirus Species 0.000 description 7
- 241000124008 Mammalia Species 0.000 description 7
- 208000015914 Non-Hodgkin lymphomas Diseases 0.000 description 7
- 230000006044 T cell activation Effects 0.000 description 7
- 108010021331 carfilzomib Proteins 0.000 description 7
- BLMPQMFVWMYDKT-NZTKNTHTSA-N carfilzomib Chemical compound C([C@@H](C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](CC(C)C)C(=O)[C@]1(C)OC1)NC(=O)CN1CCOCC1)CC1=CC=CC=C1 BLMPQMFVWMYDKT-NZTKNTHTSA-N 0.000 description 7
- 229960002438 carfilzomib Drugs 0.000 description 7
- 238000002659 cell therapy Methods 0.000 description 7
- 239000003153 chemical reaction reagent Substances 0.000 description 7
- 210000003743 erythrocyte Anatomy 0.000 description 7
- 208000015181 infectious disease Diseases 0.000 description 7
- 238000001802 infusion Methods 0.000 description 7
- 239000007924 injection Substances 0.000 description 7
- 238000002347 injection Methods 0.000 description 7
- 230000003834 intracellular effect Effects 0.000 description 7
- 210000004185 liver Anatomy 0.000 description 7
- 230000028327 secretion Effects 0.000 description 7
- 238000012546 transfer Methods 0.000 description 7
- 238000002255 vaccination Methods 0.000 description 7
- 108010073969 valyllysine Proteins 0.000 description 7
- 102000006306 Antigen Receptors Human genes 0.000 description 6
- 108010083359 Antigen Receptors Proteins 0.000 description 6
- 208000001333 Colorectal Neoplasms Diseases 0.000 description 6
- WHUUTDBJXJRKMK-UHFFFAOYSA-N Glutamic acid Natural products OC(=O)C(N)CCC(O)=O WHUUTDBJXJRKMK-UHFFFAOYSA-N 0.000 description 6
- UQJNXZSSGQIPIQ-FBCQKBJTSA-N Gly-Gly-Thr Chemical compound C[C@@H](O)[C@@H](C(O)=O)NC(=O)CNC(=O)CN UQJNXZSSGQIPIQ-FBCQKBJTSA-N 0.000 description 6
- YBAFDPFAUTYYRW-UHFFFAOYSA-N N-L-alpha-glutamyl-L-leucine Natural products CC(C)CC(C(O)=O)NC(=O)C(N)CCC(O)=O YBAFDPFAUTYYRW-UHFFFAOYSA-N 0.000 description 6
- 208000029052 T-cell acute lymphoblastic leukemia Diseases 0.000 description 6
- 125000000539 amino acid group Chemical group 0.000 description 6
- 229910002091 carbon monoxide Inorganic materials 0.000 description 6
- 230000022534 cell killing Effects 0.000 description 6
- 238000005119 centrifugation Methods 0.000 description 6
- 230000001684 chronic effect Effects 0.000 description 6
- 238000003745 diagnosis Methods 0.000 description 6
- 238000007912 intraperitoneal administration Methods 0.000 description 6
- 239000003446 ligand Substances 0.000 description 6
- 238000002826 magnetic-activated cell sorting Methods 0.000 description 6
- 239000013642 negative control Substances 0.000 description 6
- 208000002154 non-small cell lung carcinoma Diseases 0.000 description 6
- 238000000926 separation method Methods 0.000 description 6
- 108010026333 seryl-proline Proteins 0.000 description 6
- 229940054269 sodium pyruvate Drugs 0.000 description 6
- 230000000638 stimulation Effects 0.000 description 6
- UCSJYZPVAKXKNQ-HZYVHMACSA-N streptomycin Chemical compound CN[C@H]1[C@H](O)[C@@H](O)[C@H](CO)O[C@H]1O[C@@H]1[C@](C=O)(O)[C@H](C)O[C@H]1O[C@@H]1[C@@H](NC(N)=N)[C@H](O)[C@@H](NC(N)=N)[C@H](O)[C@H]1O UCSJYZPVAKXKNQ-HZYVHMACSA-N 0.000 description 6
- 229960005322 streptomycin Drugs 0.000 description 6
- 238000001356 surgical procedure Methods 0.000 description 6
- 230000001225 therapeutic effect Effects 0.000 description 6
- 239000013603 viral vector Substances 0.000 description 6
- JKMHFZQWWAIEOD-UHFFFAOYSA-N 2-[4-(2-hydroxyethyl)piperazin-1-yl]ethanesulfonic acid Chemical compound OCC[NH+]1CCN(CCS([O-])(=O)=O)CC1 JKMHFZQWWAIEOD-UHFFFAOYSA-N 0.000 description 5
- 206010000830 Acute leukaemia Diseases 0.000 description 5
- OYPRJOBELJOOCE-UHFFFAOYSA-N Calcium Chemical compound [Ca] OYPRJOBELJOOCE-UHFFFAOYSA-N 0.000 description 5
- OZHXXYOHPLLLMI-CIUDSAMLSA-N Cys-Lys-Ala Chemical compound [H]N[C@@H](CS)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(O)=O OZHXXYOHPLLLMI-CIUDSAMLSA-N 0.000 description 5
- 108010087819 Fc receptors Proteins 0.000 description 5
- 102000009109 Fc receptors Human genes 0.000 description 5
- 229920001917 Ficoll Polymers 0.000 description 5
- 239000007995 HEPES buffer Substances 0.000 description 5
- 101001057504 Homo sapiens Interferon-stimulated gene 20 kDa protein Proteins 0.000 description 5
- 101001055144 Homo sapiens Interleukin-2 receptor subunit alpha Proteins 0.000 description 5
- 229940076838 Immune checkpoint inhibitor Drugs 0.000 description 5
- 102000037982 Immune checkpoint proteins Human genes 0.000 description 5
- 108091008036 Immune checkpoint proteins Proteins 0.000 description 5
- 102100026878 Interleukin-2 receptor subunit alpha Human genes 0.000 description 5
- 241000713666 Lentivirus Species 0.000 description 5
- KAFOIVJDVSZUMD-UHFFFAOYSA-N Leu-Gln-Gln Natural products CC(C)CC(N)C(=O)NC(CCC(N)=O)C(=O)NC(CCC(N)=O)C(O)=O KAFOIVJDVSZUMD-UHFFFAOYSA-N 0.000 description 5
- SPSSJSICDYYTQN-HJGDQZAQSA-N Met-Thr-Gln Chemical compound CSCC[C@H](N)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@H](C(O)=O)CCC(N)=O SPSSJSICDYYTQN-HJGDQZAQSA-N 0.000 description 5
- 206010027476 Metastases Diseases 0.000 description 5
- 241000508269 Psidium Species 0.000 description 5
- OQPNSDWGAMFJNU-QWRGUYRKSA-N Ser-Gly-Tyr Chemical compound OC[C@H](N)C(=O)NCC(=O)N[C@H](C(O)=O)CC1=CC=C(O)C=C1 OQPNSDWGAMFJNU-QWRGUYRKSA-N 0.000 description 5
- DBMJMQXJHONAFJ-UHFFFAOYSA-M Sodium laurylsulphate Chemical compound [Na+].CCCCCCCCCCCCOS([O-])(=O)=O DBMJMQXJHONAFJ-UHFFFAOYSA-M 0.000 description 5
- 102100028785 Tumor necrosis factor receptor superfamily member 14 Human genes 0.000 description 5
- 238000002835 absorbance Methods 0.000 description 5
- 239000002253 acid Substances 0.000 description 5
- 108010086434 alanyl-seryl-glycine Proteins 0.000 description 5
- 230000000259 anti-tumor effect Effects 0.000 description 5
- 238000002617 apheresis Methods 0.000 description 5
- 239000012298 atmosphere Substances 0.000 description 5
- 230000015572 biosynthetic process Effects 0.000 description 5
- 210000000601 blood cell Anatomy 0.000 description 5
- 239000011575 calcium Substances 0.000 description 5
- 229910052791 calcium Inorganic materials 0.000 description 5
- 239000006285 cell suspension Substances 0.000 description 5
- 210000004978 chinese hamster ovary cell Anatomy 0.000 description 5
- 238000003501 co-culture Methods 0.000 description 5
- 230000006378 damage Effects 0.000 description 5
- 239000012636 effector Substances 0.000 description 5
- 238000009472 formulation Methods 0.000 description 5
- 108010045126 glycyl-tyrosyl-glycine Proteins 0.000 description 5
- 239000012274 immune-checkpoint protein inhibitor Substances 0.000 description 5
- 230000003053 immunization Effects 0.000 description 5
- 238000002649 immunization Methods 0.000 description 5
- 238000009169 immunotherapy Methods 0.000 description 5
- 108020001756 ligand binding domains Proteins 0.000 description 5
- 230000000527 lymphocytic effect Effects 0.000 description 5
- 210000000066 myeloid cell Anatomy 0.000 description 5
- 210000000056 organ Anatomy 0.000 description 5
- 239000013612 plasmid Substances 0.000 description 5
- 210000003289 regulatory T cell Anatomy 0.000 description 5
- 239000002356 single layer Substances 0.000 description 5
- 210000000952 spleen Anatomy 0.000 description 5
- 239000000126 substance Substances 0.000 description 5
- 238000010257 thawing Methods 0.000 description 5
- 108010061238 threonyl-glycine Proteins 0.000 description 5
- 238000002054 transplantation Methods 0.000 description 5
- 208000029729 tumor suppressor gene on chromosome 11 Diseases 0.000 description 5
- 210000003171 tumor-infiltrating lymphocyte Anatomy 0.000 description 5
- 230000003612 virological effect Effects 0.000 description 5
- 238000005406 washing Methods 0.000 description 5
- YYAVDNKUWLAFCV-ACZMJKKPSA-N Ala-Ser-Gln Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(N)=O)C(O)=O YYAVDNKUWLAFCV-ACZMJKKPSA-N 0.000 description 4
- CMSMOCZEIVJLDB-UHFFFAOYSA-N Cyclophosphamide Chemical compound ClCCN(CCCl)P1(=O)NCCCO1 CMSMOCZEIVJLDB-UHFFFAOYSA-N 0.000 description 4
- 102100039498 Cytotoxic T-lymphocyte protein 4 Human genes 0.000 description 4
- WSFSSNUMVMOOMR-UHFFFAOYSA-N Formaldehyde Chemical compound O=C WSFSSNUMVMOOMR-UHFFFAOYSA-N 0.000 description 4
- WZUVPPKBWHMQCE-UHFFFAOYSA-N Haematoxylin Chemical compound C12=CC(O)=C(O)C=C2CC2(O)C1C1=CC=C(O)C(O)=C1OC2 WZUVPPKBWHMQCE-UHFFFAOYSA-N 0.000 description 4
- 101000946889 Homo sapiens Monocyte differentiation antigen CD14 Proteins 0.000 description 4
- 101000914484 Homo sapiens T-lymphocyte activation antigen CD80 Proteins 0.000 description 4
- FBGXMKUWQFPHFB-JBDRJPRFSA-N Ile-Ser-Cys Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CO)C(=O)N[C@@H](CS)C(=O)O)N FBGXMKUWQFPHFB-JBDRJPRFSA-N 0.000 description 4
- 108090001061 Insulin Proteins 0.000 description 4
- 102000004877 Insulin Human genes 0.000 description 4
- 108010065920 Insulin Lispro Proteins 0.000 description 4
- 229930182816 L-glutamine Natural products 0.000 description 4
- RXGLHDWAZQECBI-SRVKXCTJSA-N Leu-Leu-Ser Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(O)=O RXGLHDWAZQECBI-SRVKXCTJSA-N 0.000 description 4
- 108010006444 Leucine-Rich Repeat Proteins Proteins 0.000 description 4
- 102100035877 Monocyte differentiation antigen CD14 Human genes 0.000 description 4
- 102100040678 Programmed cell death protein 1 Human genes 0.000 description 4
- NIOYDASGXWLHEZ-CIUDSAMLSA-N Ser-Met-Glu Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CCC(O)=O)C(O)=O NIOYDASGXWLHEZ-CIUDSAMLSA-N 0.000 description 4
- 206010041067 Small cell lung cancer Diseases 0.000 description 4
- 208000000102 Squamous Cell Carcinoma of Head and Neck Diseases 0.000 description 4
- 102100027222 T-lymphocyte activation antigen CD80 Human genes 0.000 description 4
- 230000003213 activating effect Effects 0.000 description 4
- 238000007792 addition Methods 0.000 description 4
- 230000000735 allogeneic effect Effects 0.000 description 4
- KOSRFJWDECSPRO-UHFFFAOYSA-N alpha-L-glutamyl-L-glutamic acid Natural products OC(=O)CCC(N)C(=O)NC(CCC(O)=O)C(O)=O KOSRFJWDECSPRO-UHFFFAOYSA-N 0.000 description 4
- 210000000612 antigen-presenting cell Anatomy 0.000 description 4
- 230000000890 antigenic effect Effects 0.000 description 4
- 108010068380 arginylarginine Proteins 0.000 description 4
- 230000001580 bacterial effect Effects 0.000 description 4
- 238000005415 bioluminescence Methods 0.000 description 4
- 230000029918 bioluminescence Effects 0.000 description 4
- 210000000988 bone and bone Anatomy 0.000 description 4
- 210000000481 breast Anatomy 0.000 description 4
- 239000006172 buffering agent Substances 0.000 description 4
- 238000006243 chemical reaction Methods 0.000 description 4
- 108700010039 chimeric receptor Proteins 0.000 description 4
- 239000000562 conjugate Substances 0.000 description 4
- 230000016396 cytokine production Effects 0.000 description 4
- 230000003247 decreasing effect Effects 0.000 description 4
- 230000004069 differentiation Effects 0.000 description 4
- 239000003937 drug carrier Substances 0.000 description 4
- 238000004520 electroporation Methods 0.000 description 4
- 210000004602 germ cell Anatomy 0.000 description 4
- 208000005017 glioblastoma Diseases 0.000 description 4
- 201000000459 head and neck squamous cell carcinoma Diseases 0.000 description 4
- 238000003364 immunohistochemistry Methods 0.000 description 4
- 210000005008 immunosuppressive cell Anatomy 0.000 description 4
- 229940125396 insulin Drugs 0.000 description 4
- GOTYRUGSSMKFNF-UHFFFAOYSA-N lenalidomide Chemical compound C1C=2C(N)=CC=CC=2C(=O)N1C1CCC(=O)NC1=O GOTYRUGSSMKFNF-UHFFFAOYSA-N 0.000 description 4
- 210000004901 leucine-rich repeat Anatomy 0.000 description 4
- 238000004020 luminiscence type Methods 0.000 description 4
- 208000003747 lymphoid leukemia Diseases 0.000 description 4
- 239000006166 lysate Substances 0.000 description 4
- 230000005291 magnetic effect Effects 0.000 description 4
- 230000003211 malignant effect Effects 0.000 description 4
- 230000001404 mediated effect Effects 0.000 description 4
- 239000012528 membrane Substances 0.000 description 4
- 238000002703 mutagenesis Methods 0.000 description 4
- 231100000350 mutagenesis Toxicity 0.000 description 4
- 208000025113 myeloid leukemia Diseases 0.000 description 4
- 239000002245 particle Substances 0.000 description 4
- 210000004180 plasmocyte Anatomy 0.000 description 4
- UVSMNLNDYGZFPF-UHFFFAOYSA-N pomalidomide Chemical compound O=C1C=2C(N)=CC=CC=2C(=O)N1C1CCC(=O)NC1=O UVSMNLNDYGZFPF-UHFFFAOYSA-N 0.000 description 4
- 239000013641 positive control Substances 0.000 description 4
- 238000012545 processing Methods 0.000 description 4
- 238000004393 prognosis Methods 0.000 description 4
- 238000001959 radiotherapy Methods 0.000 description 4
- 208000000587 small cell lung carcinoma Diseases 0.000 description 4
- 230000009870 specific binding Effects 0.000 description 4
- 241001430294 unidentified retrovirus Species 0.000 description 4
- 239000011534 wash buffer Substances 0.000 description 4
- MPLOSMWGDNJSEV-WHFBIAKZSA-N Ala-Gly-Asp Chemical compound [H]N[C@@H](C)C(=O)NCC(=O)N[C@@H](CC(O)=O)C(O)=O MPLOSMWGDNJSEV-WHFBIAKZSA-N 0.000 description 3
- ARHJJAAWNWOACN-FXQIFTODSA-N Ala-Ser-Val Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CO)C(=O)N[C@@H](C(C)C)C(O)=O ARHJJAAWNWOACN-FXQIFTODSA-N 0.000 description 3
- IASNWHAGGYTEKX-IUCAKERBSA-N Arg-Arg-Gly Chemical compound NC(N)=NCCC[C@H](N)C(=O)N[C@@H](CCCN=C(N)N)C(=O)NCC(O)=O IASNWHAGGYTEKX-IUCAKERBSA-N 0.000 description 3
- QLSRIZIDQXDQHK-RCWTZXSCSA-N Arg-Val-Thr Chemical compound [H]N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H]([C@@H](C)O)C(O)=O QLSRIZIDQXDQHK-RCWTZXSCSA-N 0.000 description 3
- IYVSIZAXNLOKFQ-BYULHYEWSA-N Asn-Asp-Val Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](C(C)C)C(O)=O IYVSIZAXNLOKFQ-BYULHYEWSA-N 0.000 description 3
- JREOBWLIZLXRIS-GUBZILKMSA-N Asn-Glu-Leu Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(O)=O JREOBWLIZLXRIS-GUBZILKMSA-N 0.000 description 3
- UYCPJVYQYARFGB-YDHLFZDLSA-N Asn-Phe-Val Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](C(C)C)C(O)=O UYCPJVYQYARFGB-YDHLFZDLSA-N 0.000 description 3
- MRQQMVZUHXUPEV-IHRRRGAJSA-N Asp-Arg-Phe Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC1=CC=CC=C1)C(O)=O MRQQMVZUHXUPEV-IHRRRGAJSA-N 0.000 description 3
- DPNWSMBUYCLEDG-CIUDSAMLSA-N Asp-Lys-Ser Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CO)C(O)=O DPNWSMBUYCLEDG-CIUDSAMLSA-N 0.000 description 3
- 102100029822 B- and T-lymphocyte attenuator Human genes 0.000 description 3
- 102100024222 B-lymphocyte antigen CD19 Human genes 0.000 description 3
- 108010074708 B7-H1 Antigen Proteins 0.000 description 3
- 208000035462 Biphenotypic Acute Leukemia Diseases 0.000 description 3
- 206010006002 Bone pain Diseases 0.000 description 3
- 102100038078 CD276 antigen Human genes 0.000 description 3
- IAZDPXIOMUYVGZ-UHFFFAOYSA-N Dimethylsulphoxide Chemical compound CS(C)=O IAZDPXIOMUYVGZ-UHFFFAOYSA-N 0.000 description 3
- 239000006144 Dulbecco’s modified Eagle's medium Substances 0.000 description 3
- 238000002965 ELISA Methods 0.000 description 3
- 239000006145 Eagle's minimal essential medium Substances 0.000 description 3
- 102000004190 Enzymes Human genes 0.000 description 3
- 108090000790 Enzymes Proteins 0.000 description 3
- 241000713730 Equine infectious anemia virus Species 0.000 description 3
- RZSLYUUFFVHFRQ-FXQIFTODSA-N Gln-Ala-Glu Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(O)=O RZSLYUUFFVHFRQ-FXQIFTODSA-N 0.000 description 3
- DTMLKCYOQKZXKZ-HJGDQZAQSA-N Gln-Arg-Thr Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H]([C@@H](C)O)C(O)=O DTMLKCYOQKZXKZ-HJGDQZAQSA-N 0.000 description 3
- QYKBTDOAMKORGL-FXQIFTODSA-N Gln-Gln-Asp Chemical compound C(CC(=O)N)[C@@H](C(=O)N[C@@H](CCC(=O)N)C(=O)N[C@@H](CC(=O)O)C(=O)O)N QYKBTDOAMKORGL-FXQIFTODSA-N 0.000 description 3
- MADFVRSKEIEZHZ-DCAQKATOSA-N Gln-Gln-Lys Chemical compound C(CCN)C[C@@H](C(=O)O)NC(=O)[C@H](CCC(=O)N)NC(=O)[C@H](CCC(=O)N)N MADFVRSKEIEZHZ-DCAQKATOSA-N 0.000 description 3
- LGIKBBLQVSWUGK-DCAQKATOSA-N Gln-Leu-Gln Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(O)=O LGIKBBLQVSWUGK-DCAQKATOSA-N 0.000 description 3
- OSCLNNWLKKIQJM-WDSKDSINSA-N Gln-Ser-Gly Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)N[C@@H](CO)C(=O)NCC(O)=O OSCLNNWLKKIQJM-WDSKDSINSA-N 0.000 description 3
- JRCUFCXYZLPSDZ-ACZMJKKPSA-N Glu-Asp-Ser Chemical compound OC(=O)CC[C@H](N)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CO)C(O)=O JRCUFCXYZLPSDZ-ACZMJKKPSA-N 0.000 description 3
- XTZDZAXYPDISRR-MNXVOIDGSA-N Glu-Ile-Lys Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CCCCN)C(=O)O)NC(=O)[C@H](CCC(=O)O)N XTZDZAXYPDISRR-MNXVOIDGSA-N 0.000 description 3
- GNPVTZJUUBPZKW-WDSKDSINSA-N Gly-Gln-Ser Chemical compound [H]NCC(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CO)C(O)=O GNPVTZJUUBPZKW-WDSKDSINSA-N 0.000 description 3
- AFWYPMDMDYCKMD-KBPBESRZSA-N Gly-Leu-Tyr Chemical compound NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@H](C(O)=O)CC1=CC=C(O)C=C1 AFWYPMDMDYCKMD-KBPBESRZSA-N 0.000 description 3
- XHVONGZZVUUORG-WEDXCCLWSA-N Gly-Thr-Lys Chemical compound NCC(=O)N[C@@H]([C@H](O)C)C(=O)N[C@H](C(O)=O)CCCCN XHVONGZZVUUORG-WEDXCCLWSA-N 0.000 description 3
- HQSKKSLNLSTONK-JTQLQIEISA-N Gly-Tyr-Gly Chemical compound OC(=O)CNC(=O)[C@@H](NC(=O)CN)CC1=CC=C(O)C=C1 HQSKKSLNLSTONK-JTQLQIEISA-N 0.000 description 3
- YGHSQRJSHKYUJY-SCZZXKLOSA-N Gly-Val-Pro Chemical compound CC(C)[C@@H](C(=O)N1CCC[C@@H]1C(=O)O)NC(=O)CN YGHSQRJSHKYUJY-SCZZXKLOSA-N 0.000 description 3
- 108010017213 Granulocyte-Macrophage Colony-Stimulating Factor Proteins 0.000 description 3
- 102100039620 Granulocyte-macrophage colony-stimulating factor Human genes 0.000 description 3
- ZNTSGDNUITWTRA-WDSOQIARSA-N His-Trp-Val Chemical compound [H]N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC1=CNC2=C1C=CC=C2)C(=O)N[C@@H](C(C)C)C(O)=O ZNTSGDNUITWTRA-WDSOQIARSA-N 0.000 description 3
- 101000864344 Homo sapiens B- and T-lymphocyte attenuator Proteins 0.000 description 3
- 101000980825 Homo sapiens B-lymphocyte antigen CD19 Proteins 0.000 description 3
- 101000917858 Homo sapiens Low affinity immunoglobulin gamma Fc region receptor III-A Proteins 0.000 description 3
- 101000917839 Homo sapiens Low affinity immunoglobulin gamma Fc region receptor III-B Proteins 0.000 description 3
- 101001137987 Homo sapiens Lymphocyte activation gene 3 protein Proteins 0.000 description 3
- 101000611936 Homo sapiens Programmed cell death protein 1 Proteins 0.000 description 3
- 101000831007 Homo sapiens T-cell immunoreceptor with Ig and ITIM domains Proteins 0.000 description 3
- 241000713772 Human immunodeficiency virus 1 Species 0.000 description 3
- UKTUOMWSJPXODT-GUDRVLHUSA-N Ile-Asn-Pro Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)N1CCC[C@@H]1C(=O)O)N UKTUOMWSJPXODT-GUDRVLHUSA-N 0.000 description 3
- NHJKZMDIMMTVCK-QXEWZRGKSA-N Ile-Gly-Arg Chemical compound CC[C@H](C)[C@H](N)C(=O)NCC(=O)N[C@H](C(O)=O)CCCN=C(N)N NHJKZMDIMMTVCK-QXEWZRGKSA-N 0.000 description 3
- LBRCLQMZAHRTLV-ZKWXMUAHSA-N Ile-Gly-Ser Chemical compound CC[C@H](C)[C@H](N)C(=O)NCC(=O)N[C@@H](CO)C(O)=O LBRCLQMZAHRTLV-ZKWXMUAHSA-N 0.000 description 3
- 235000003332 Ilex aquifolium Nutrition 0.000 description 3
- 241000209027 Ilex aquifolium Species 0.000 description 3
- 108010054477 Immunoglobulin Fab Fragments Proteins 0.000 description 3
- 102000001706 Immunoglobulin Fab Fragments Human genes 0.000 description 3
- 108010002386 Interleukin-3 Proteins 0.000 description 3
- IBMVEYRWAWIOTN-UHFFFAOYSA-N L-Leucyl-L-Arginyl-L-Proline Natural products CC(C)CC(N)C(=O)NC(CCCN=C(N)N)C(=O)N1CCCC1C(O)=O IBMVEYRWAWIOTN-UHFFFAOYSA-N 0.000 description 3
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 description 3
- 102000017578 LAG3 Human genes 0.000 description 3
- 241000880493 Leptailurus serval Species 0.000 description 3
- IEWBEPKLKUXQBU-VOAKCMCISA-N Leu-Leu-Thr Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)O)C(O)=O IEWBEPKLKUXQBU-VOAKCMCISA-N 0.000 description 3
- UHNQRAFSEBGZFZ-YESZJQIVSA-N Leu-Phe-Pro Chemical compound CC(C)C[C@@H](C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N2CCC[C@@H]2C(=O)O)N UHNQRAFSEBGZFZ-YESZJQIVSA-N 0.000 description 3
- ILDSIMPXNFWKLH-KATARQTJSA-N Leu-Thr-Ser Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CO)C(O)=O ILDSIMPXNFWKLH-KATARQTJSA-N 0.000 description 3
- AIQWYVFNBNNOLU-RHYQMDGZSA-N Leu-Thr-Val Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C(C)C)C(O)=O AIQWYVFNBNNOLU-RHYQMDGZSA-N 0.000 description 3
- WUHBLPVELFTPQK-KKUMJFAQSA-N Leu-Tyr-Asn Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC(N)=O)C(O)=O WUHBLPVELFTPQK-KKUMJFAQSA-N 0.000 description 3
- 102100029185 Low affinity immunoglobulin gamma Fc region receptor III-B Human genes 0.000 description 3
- LMVOVCYVZBBWQB-SRVKXCTJSA-N Lys-Asp-Lys Chemical compound NCCCC[C@H](N)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@H](C(O)=O)CCCCN LMVOVCYVZBBWQB-SRVKXCTJSA-N 0.000 description 3
- NNCDAORZCMPZPX-GUBZILKMSA-N Lys-Gln-Ser Chemical compound C(CCN)C[C@@H](C(=O)N[C@@H](CCC(=O)N)C(=O)N[C@@H](CO)C(=O)O)N NNCDAORZCMPZPX-GUBZILKMSA-N 0.000 description 3
- PRSBSVAVOQOAMI-BJDJZHNGSA-N Lys-Ile-Ser Chemical compound OC[C@@H](C(O)=O)NC(=O)[C@H]([C@@H](C)CC)NC(=O)[C@@H](N)CCCCN PRSBSVAVOQOAMI-BJDJZHNGSA-N 0.000 description 3
- 108010061593 Member 14 Tumor Necrosis Factor Receptors Proteins 0.000 description 3
- OOSPRDCGTLQLBP-NHCYSSNCSA-N Met-Glu-Val Chemical compound [H]N[C@@H](CCSC)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C(C)C)C(O)=O OOSPRDCGTLQLBP-NHCYSSNCSA-N 0.000 description 3
- BMHIFARYXOJDLD-WPRPVWTQSA-N Met-Gly-Val Chemical compound [H]N[C@@H](CCSC)C(=O)NCC(=O)N[C@@H](C(C)C)C(O)=O BMHIFARYXOJDLD-WPRPVWTQSA-N 0.000 description 3
- CTQNGGLPUBDAKN-UHFFFAOYSA-N O-Xylene Chemical compound CC1=CC=CC=C1C CTQNGGLPUBDAKN-UHFFFAOYSA-N 0.000 description 3
- 108090000526 Papain Proteins 0.000 description 3
- 229930182555 Penicillin Natural products 0.000 description 3
- JGSARLDLIJGVTE-MBNYWOFBSA-N Penicillin G Chemical compound N([C@H]1[C@H]2SC([C@@H](N2C1=O)C(O)=O)(C)C)C(=O)CC1=CC=CC=C1 JGSARLDLIJGVTE-MBNYWOFBSA-N 0.000 description 3
- OQTDZEJJWWAGJT-KKUMJFAQSA-N Phe-Lys-Asp Chemical compound [H]N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(O)=O)C(O)=O OQTDZEJJWWAGJT-KKUMJFAQSA-N 0.000 description 3
- FGWUALWGCZJQDJ-URLPEUOOSA-N Phe-Thr-Ile Chemical compound [H]N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H]([C@@H](C)CC)C(O)=O FGWUALWGCZJQDJ-URLPEUOOSA-N 0.000 description 3
- 102100024216 Programmed cell death 1 ligand 1 Human genes 0.000 description 3
- 239000004365 Protease Substances 0.000 description 3
- 229940079156 Proteasome inhibitor Drugs 0.000 description 3
- 241000700159 Rattus Species 0.000 description 3
- ZIFYDQAFEMIZII-GUBZILKMSA-N Ser-Leu-Glu Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(O)=O ZIFYDQAFEMIZII-GUBZILKMSA-N 0.000 description 3
- UGGWCAFQPKANMW-FXQIFTODSA-N Ser-Met-Ala Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](C)C(O)=O UGGWCAFQPKANMW-FXQIFTODSA-N 0.000 description 3
- FBLNYDYPCLFTSP-IXOXFDKPSA-N Ser-Phe-Thr Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H]([C@@H](C)O)C(O)=O FBLNYDYPCLFTSP-IXOXFDKPSA-N 0.000 description 3
- PYTKULIABVRXSC-BWBBJGPYSA-N Ser-Ser-Thr Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)O)C(O)=O PYTKULIABVRXSC-BWBBJGPYSA-N 0.000 description 3
- UYLKOSODXYSWMQ-XGEHTFHBSA-N Ser-Thr-Met Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CCSC)C(=O)O)NC(=O)[C@H](CO)N)O UYLKOSODXYSWMQ-XGEHTFHBSA-N 0.000 description 3
- JGUWRQWULDWNCM-FXQIFTODSA-N Ser-Val-Ser Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CO)C(O)=O JGUWRQWULDWNCM-FXQIFTODSA-N 0.000 description 3
- 208000005718 Stomach Neoplasms Diseases 0.000 description 3
- 102100024834 T-cell immunoreceptor with Ig and ITIM domains Human genes 0.000 description 3
- KRPKYGOFYUNIGM-XVSYOHENSA-N Thr-Asp-Phe Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)O)N)O KRPKYGOFYUNIGM-XVSYOHENSA-N 0.000 description 3
- FQPDRTDDEZXCEC-SVSWQMSJSA-N Thr-Ile-Ser Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CO)C(O)=O FQPDRTDDEZXCEC-SVSWQMSJSA-N 0.000 description 3
- 108700019146 Transgenes Proteins 0.000 description 3
- 102100022153 Tumor necrosis factor receptor superfamily member 4 Human genes 0.000 description 3
- MBFJIHUHHCJBSN-AVGNSLFASA-N Tyr-Asn-Gln Chemical compound [H]N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCC(N)=O)C(O)=O MBFJIHUHHCJBSN-AVGNSLFASA-N 0.000 description 3
- QUILOGWWLXMSAT-IHRRRGAJSA-N Tyr-Gln-Gln Chemical compound [H]N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(N)=O)C(O)=O QUILOGWWLXMSAT-IHRRRGAJSA-N 0.000 description 3
- BUPRFDPUIJNOLS-UFYCRDLUSA-N Tyr-Tyr-Met Chemical compound [H]N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CCSC)C(O)=O BUPRFDPUIJNOLS-UFYCRDLUSA-N 0.000 description 3
- 102100038929 V-set domain-containing T-cell activation inhibitor 1 Human genes 0.000 description 3
- CXWJFWAZIVWBOS-XQQFMLRXSA-N Val-Lys-Pro Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CCCCN)C(=O)N1CCC[C@@H]1C(=O)O)N CXWJFWAZIVWBOS-XQQFMLRXSA-N 0.000 description 3
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Natural products CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 description 3
- 230000002159 abnormal effect Effects 0.000 description 3
- 108010008685 alanyl-glutamyl-aspartic acid Proteins 0.000 description 3
- 108010076324 alanyl-glycyl-glycine Proteins 0.000 description 3
- 108010087924 alanylproline Proteins 0.000 description 3
- 229940100198 alkylating agent Drugs 0.000 description 3
- 239000002168 alkylating agent Substances 0.000 description 3
- 108010050025 alpha-glutamyltryptophan Proteins 0.000 description 3
- 208000007502 anemia Diseases 0.000 description 3
- 108010029539 arginyl-prolyl-proline Proteins 0.000 description 3
- 108010069205 aspartyl-phenylalanine Proteins 0.000 description 3
- 108010068265 aspartyltyrosine Proteins 0.000 description 3
- 230000004071 biological effect Effects 0.000 description 3
- 238000001574 biopsy Methods 0.000 description 3
- 230000037396 body weight Effects 0.000 description 3
- GXJABQQUPOEUTA-RDJZCZTQSA-N bortezomib Chemical compound C([C@@H](C(=O)N[C@@H](CC(C)C)B(O)O)NC(=O)C=1N=CC=NC=1)C1=CC=CC=C1 GXJABQQUPOEUTA-RDJZCZTQSA-N 0.000 description 3
- 210000004899 c-terminal region Anatomy 0.000 description 3
- 238000009566 cancer vaccine Methods 0.000 description 3
- 229940022399 cancer vaccine Drugs 0.000 description 3
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 description 3
- 230000001413 cellular effect Effects 0.000 description 3
- 239000012829 chemotherapy agent Substances 0.000 description 3
- KRKNYBCHXYNGOX-UHFFFAOYSA-N citric acid Chemical compound OC(=O)CC(O)(C(O)=O)CC(O)=O KRKNYBCHXYNGOX-UHFFFAOYSA-N 0.000 description 3
- 210000001072 colon Anatomy 0.000 description 3
- 239000002299 complementary DNA Substances 0.000 description 3
- 108091008034 costimulatory receptors Proteins 0.000 description 3
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 3
- 235000018417 cysteine Nutrition 0.000 description 3
- 230000009089 cytolysis Effects 0.000 description 3
- 229940127089 cytotoxic agent Drugs 0.000 description 3
- 231100000135 cytotoxicity Toxicity 0.000 description 3
- 230000003013 cytotoxicity Effects 0.000 description 3
- 230000007423 decrease Effects 0.000 description 3
- 229960003957 dexamethasone Drugs 0.000 description 3
- UREBDLICKHMUKA-CXSFZGCWSA-N dexamethasone Chemical compound C1CC2=CC(=O)C=C[C@]2(C)[C@]2(F)[C@@H]1[C@@H]1C[C@@H](C)[C@@](C(=O)CO)(O)[C@@]1(C)C[C@@H]2O UREBDLICKHMUKA-CXSFZGCWSA-N 0.000 description 3
- 230000029087 digestion Effects 0.000 description 3
- 239000012645 endogenous antigen Substances 0.000 description 3
- 238000005516 engineering process Methods 0.000 description 3
- 229940088598 enzyme Drugs 0.000 description 3
- 108010006664 gamma-glutamyl-glycyl-glycine Proteins 0.000 description 3
- 206010017758 gastric cancer Diseases 0.000 description 3
- 230000002068 genetic effect Effects 0.000 description 3
- 108010055341 glutamyl-glutamic acid Proteins 0.000 description 3
- 230000013595 glycosylation Effects 0.000 description 3
- 238000006206 glycosylation reaction Methods 0.000 description 3
- VPZXBVLAVMBEQI-UHFFFAOYSA-N glycyl-DL-alpha-alanine Natural products OC(=O)C(C)NC(=O)CN VPZXBVLAVMBEQI-UHFFFAOYSA-N 0.000 description 3
- XKUKSGPZAADMRA-UHFFFAOYSA-N glycyl-glycyl-glycine Natural products NCC(=O)NCC(=O)NCC(O)=O XKUKSGPZAADMRA-UHFFFAOYSA-N 0.000 description 3
- 108010001064 glycyl-glycyl-glycyl-glycine Proteins 0.000 description 3
- 108010050475 glycyl-leucyl-tyrosine Proteins 0.000 description 3
- 108010079413 glycyl-prolyl-glutamic acid Proteins 0.000 description 3
- 210000004408 hybridoma Anatomy 0.000 description 3
- 238000003384 imaging method Methods 0.000 description 3
- 230000002519 immonomodulatory effect Effects 0.000 description 3
- 230000016784 immunoglobulin production Effects 0.000 description 3
- 229940072221 immunoglobulins Drugs 0.000 description 3
- 230000001976 improved effect Effects 0.000 description 3
- 230000006872 improvement Effects 0.000 description 3
- 230000002401 inhibitory effect Effects 0.000 description 3
- 238000003780 insertion Methods 0.000 description 3
- 230000037431 insertion Effects 0.000 description 3
- 230000003993 interaction Effects 0.000 description 3
- 238000002372 labelling Methods 0.000 description 3
- 229960004942 lenalidomide Drugs 0.000 description 3
- 239000002502 liposome Substances 0.000 description 3
- 239000011159 matrix material Substances 0.000 description 3
- 229960001924 melphalan Drugs 0.000 description 3
- SGDBTWWWUNNDEQ-LBPRGKRZSA-N melphalan Chemical compound OC(=O)[C@@H](N)CC1=CC=C(N(CCCl)CCCl)C=C1 SGDBTWWWUNNDEQ-LBPRGKRZSA-N 0.000 description 3
- 230000001394 metastastic effect Effects 0.000 description 3
- 108010016686 methionyl-alanyl-serine Proteins 0.000 description 3
- 238000010369 molecular cloning Methods 0.000 description 3
- 239000002773 nucleotide Substances 0.000 description 3
- 125000003729 nucleotide group Chemical group 0.000 description 3
- 229940055729 papain Drugs 0.000 description 3
- 235000019834 papain Nutrition 0.000 description 3
- 239000013610 patient sample Substances 0.000 description 3
- 229940049954 penicillin Drugs 0.000 description 3
- 239000011886 peripheral blood Substances 0.000 description 3
- 229960000688 pomalidomide Drugs 0.000 description 3
- 238000002360 preparation method Methods 0.000 description 3
- 230000002062 proliferating effect Effects 0.000 description 3
- 108010031719 prolyl-serine Proteins 0.000 description 3
- 108010029020 prolylglycine Proteins 0.000 description 3
- 230000000069 prophylactic effect Effects 0.000 description 3
- 239000003207 proteasome inhibitor Substances 0.000 description 3
- 108010048818 seryl-histidine Proteins 0.000 description 3
- 201000011549 stomach cancer Diseases 0.000 description 3
- 238000002626 targeted therapy Methods 0.000 description 3
- 238000001890 transfection Methods 0.000 description 3
- 108010038745 tryptophylglycine Proteins 0.000 description 3
- 239000004474 valine Substances 0.000 description 3
- 208000016261 weight loss Diseases 0.000 description 3
- 230000004580 weight loss Effects 0.000 description 3
- 238000001262 western blot Methods 0.000 description 3
- 108010027345 wheylin-1 peptide Proteins 0.000 description 3
- 239000008096 xylene Substances 0.000 description 3
- 102100025573 1-alkyl-2-acetylglycerophosphocholine esterase Human genes 0.000 description 2
- NHJVRSWLHSJWIN-UHFFFAOYSA-N 2,4,6-trinitrobenzenesulfonic acid Chemical group OS(=O)(=O)C1=C([N+]([O-])=O)C=C([N+]([O-])=O)C=C1[N+]([O-])=O NHJVRSWLHSJWIN-UHFFFAOYSA-N 0.000 description 2
- 208000036832 Adenocarcinoma of ovary Diseases 0.000 description 2
- HJCMDXDYPOUFDY-WHFBIAKZSA-N Ala-Gln Chemical compound C[C@H](N)C(=O)N[C@H](C(O)=O)CCC(N)=O HJCMDXDYPOUFDY-WHFBIAKZSA-N 0.000 description 2
- SOBIAADAMRHGKH-CIUDSAMLSA-N Ala-Leu-Ser Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(O)=O SOBIAADAMRHGKH-CIUDSAMLSA-N 0.000 description 2
- IPZQNYYAYVRKKK-FXQIFTODSA-N Ala-Pro-Ala Chemical compound C[C@H](N)C(=O)N1CCC[C@H]1C(=O)N[C@@H](C)C(O)=O IPZQNYYAYVRKKK-FXQIFTODSA-N 0.000 description 2
- RTZCUEHYUQZIDE-WHFBIAKZSA-N Ala-Ser-Gly Chemical compound C[C@H](N)C(=O)N[C@@H](CO)C(=O)NCC(O)=O RTZCUEHYUQZIDE-WHFBIAKZSA-N 0.000 description 2
- KUFVXLQLDHJVOG-SHGPDSBTSA-N Ala-Thr-Thr Chemical compound C[C@H]([C@@H](C(=O)N[C@@H]([C@@H](C)O)C(=O)O)NC(=O)[C@H](C)N)O KUFVXLQLDHJVOG-SHGPDSBTSA-N 0.000 description 2
- VQBULXOHAZSTQY-GKCIPKSASA-N Ala-Trp-Phe Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CC1=CNC2=C1C=CC=C2)C(=O)N[C@@H](CC1=CC=CC=C1)C(O)=O VQBULXOHAZSTQY-GKCIPKSASA-N 0.000 description 2
- DEAGTWNKODHUIY-MRFFXTKBSA-N Ala-Tyr-Trp Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC1=CNC2=C1C=CC=C2)C(O)=O DEAGTWNKODHUIY-MRFFXTKBSA-N 0.000 description 2
- 101000878581 Aplysia californica Feeding circuit activating peptides Proteins 0.000 description 2
- MFAMTAVAFBPXDC-LPEHRKFASA-N Arg-Asp-Pro Chemical compound C1C[C@@H](N(C1)C(=O)[C@H](CC(=O)O)NC(=O)[C@H](CCCN=C(N)N)N)C(=O)O MFAMTAVAFBPXDC-LPEHRKFASA-N 0.000 description 2
- HQIZDMIGUJOSNI-IUCAKERBSA-N Arg-Gly-Arg Chemical compound N[C@@H](CCCNC(N)=N)C(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(O)=O HQIZDMIGUJOSNI-IUCAKERBSA-N 0.000 description 2
- BTJVOUQWFXABOI-IHRRRGAJSA-N Arg-Lys-Lys Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](N)CCCNC(N)=N BTJVOUQWFXABOI-IHRRRGAJSA-N 0.000 description 2
- NIELFHOLFTUZME-HJWJTTGWSA-N Arg-Phe-Ile Chemical compound [H]N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H]([C@@H](C)CC)C(O)=O NIELFHOLFTUZME-HJWJTTGWSA-N 0.000 description 2
- WOZDCBHUGJVJPL-AVGNSLFASA-N Arg-Val-Lys Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CCCCN)C(=O)O)NC(=O)[C@H](CCCN=C(N)N)N WOZDCBHUGJVJPL-AVGNSLFASA-N 0.000 description 2
- 206010003445 Ascites Diseases 0.000 description 2
- DNYRZPOWBTYFAF-IHRRRGAJSA-N Asn-Arg-Tyr Chemical compound C1=CC(=CC=C1C[C@@H](C(=O)O)NC(=O)[C@H](CCCN=C(N)N)NC(=O)[C@H](CC(=O)N)N)O DNYRZPOWBTYFAF-IHRRRGAJSA-N 0.000 description 2
- XYBJLTKSGFBLCS-QXEWZRGKSA-N Asp-Arg-Val Chemical compound NC(N)=NCCC[C@@H](C(=O)N[C@@H](C(C)C)C(O)=O)NC(=O)[C@@H](N)CC(O)=O XYBJLTKSGFBLCS-QXEWZRGKSA-N 0.000 description 2
- BIVYLQMZPHDUIH-WHFBIAKZSA-N Asp-Gly-Cys Chemical compound C([C@@H](C(=O)NCC(=O)N[C@@H](CS)C(=O)O)N)C(=O)O BIVYLQMZPHDUIH-WHFBIAKZSA-N 0.000 description 2
- 108010024976 Asparaginase Proteins 0.000 description 2
- 241000713840 Avian erythroblastosis virus Species 0.000 description 2
- 102100038080 B-cell receptor CD22 Human genes 0.000 description 2
- 206010004593 Bile duct cancer Diseases 0.000 description 2
- 208000004860 Blast Crisis Diseases 0.000 description 2
- 241001446316 Bohle iridovirus Species 0.000 description 2
- 208000018084 Bone neoplasm Diseases 0.000 description 2
- 208000003174 Brain Neoplasms Diseases 0.000 description 2
- 108010021064 CTLA-4 Antigen Proteins 0.000 description 2
- 229940045513 CTLA4 antagonist Drugs 0.000 description 2
- 241000713756 Caprine arthritis encephalitis virus Species 0.000 description 2
- JWBOIMRXGHLCPP-UHFFFAOYSA-N Chloditan Chemical compound C=1C=CC=C(Cl)C=1C(C(Cl)Cl)C1=CC=C(Cl)C=C1 JWBOIMRXGHLCPP-UHFFFAOYSA-N 0.000 description 2
- 206010052360 Colorectal adenocarcinoma Diseases 0.000 description 2
- NOCCABSVTRONIN-CIUDSAMLSA-N Cys-Ala-Leu Chemical compound C[C@@H](C(=O)N[C@@H](CC(C)C)C(=O)O)NC(=O)[C@H](CS)N NOCCABSVTRONIN-CIUDSAMLSA-N 0.000 description 2
- AOJJSUZBOXZQNB-TZSSRYMLSA-N Doxorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 AOJJSUZBOXZQNB-TZSSRYMLSA-N 0.000 description 2
- 241000713800 Feline immunodeficiency virus Species 0.000 description 2
- ZHNUHDYFZUAESO-UHFFFAOYSA-N Formamide Chemical compound NC=O ZHNUHDYFZUAESO-UHFFFAOYSA-N 0.000 description 2
- 241000714475 Fujinami sarcoma virus Species 0.000 description 2
- OFPWCBGRYAOLMU-AVGNSLFASA-N Gln-Asp-Tyr Chemical compound C1=CC(=CC=C1C[C@@H](C(=O)O)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CCC(=O)N)N)O OFPWCBGRYAOLMU-AVGNSLFASA-N 0.000 description 2
- RBWKVOSARCFSQQ-FXQIFTODSA-N Gln-Gln-Ser Chemical compound NC(=O)CC[C@H](N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CO)C(O)=O RBWKVOSARCFSQQ-FXQIFTODSA-N 0.000 description 2
- JXFLPKSDLDEOQK-JHEQGTHGSA-N Gln-Gly-Thr Chemical compound C[C@@H](O)[C@@H](C(O)=O)NC(=O)CNC(=O)[C@@H](N)CCC(N)=O JXFLPKSDLDEOQK-JHEQGTHGSA-N 0.000 description 2
- MQJDLNRXBOELJW-KKUMJFAQSA-N Gln-Pro-Phe Chemical compound N[C@@H](CCC(N)=O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](Cc1ccccc1)C(O)=O MQJDLNRXBOELJW-KKUMJFAQSA-N 0.000 description 2
- SYZZMPFLOLSMHL-XHNCKOQMSA-N Gln-Ser-Pro Chemical compound C1C[C@@H](N(C1)C(=O)[C@H](CO)NC(=O)[C@H](CCC(=O)N)N)C(=O)O SYZZMPFLOLSMHL-XHNCKOQMSA-N 0.000 description 2
- JVSBYEDSSRZQGV-GUBZILKMSA-N Glu-Asp-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@@H](N)CCC(O)=O JVSBYEDSSRZQGV-GUBZILKMSA-N 0.000 description 2
- BUZMZDDKFCSKOT-CIUDSAMLSA-N Glu-Glu-Glu Chemical compound OC(=O)CC[C@H](N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(O)=O BUZMZDDKFCSKOT-CIUDSAMLSA-N 0.000 description 2
- QMOSCLNJVKSHHU-YUMQZZPRSA-N Glu-Met-Gly Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCSC)C(=O)NCC(O)=O QMOSCLNJVKSHHU-YUMQZZPRSA-N 0.000 description 2
- JVZLZVJTIXVIHK-SXNHZJKMSA-N Glu-Trp-Ile Chemical compound CC[C@H](C)[C@@H](C(=O)O)NC(=O)[C@H](CC1=CNC2=CC=CC=C21)NC(=O)[C@H](CCC(=O)O)N JVZLZVJTIXVIHK-SXNHZJKMSA-N 0.000 description 2
- OCQUNKSFDYDXBG-QXEWZRGKSA-N Gly-Arg-Ile Chemical compound CC[C@H](C)[C@@H](C(O)=O)NC(=O)[C@@H](NC(=O)CN)CCCN=C(N)N OCQUNKSFDYDXBG-QXEWZRGKSA-N 0.000 description 2
- SOEGEPHNZOISMT-BYPYZUCNSA-N Gly-Ser-Gly Chemical compound NCC(=O)N[C@@H](CO)C(=O)NCC(O)=O SOEGEPHNZOISMT-BYPYZUCNSA-N 0.000 description 2
- NVTPVQLIZCOJFK-FOHZUACHSA-N Gly-Thr-Asp Chemical compound [H]NCC(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(O)=O)C(O)=O NVTPVQLIZCOJFK-FOHZUACHSA-N 0.000 description 2
- IROABALAWGJQGM-OALUTQOASA-N Gly-Trp-Tyr Chemical compound C1=CC=C2C(=C1)C(=CN2)C[C@@H](C(=O)N[C@@H](CC3=CC=C(C=C3)O)C(=O)O)NC(=O)CN IROABALAWGJQGM-OALUTQOASA-N 0.000 description 2
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 2
- 102000003886 Glycoproteins Human genes 0.000 description 2
- 108090000288 Glycoproteins Proteins 0.000 description 2
- 208000031886 HIV Infections Diseases 0.000 description 2
- 102100031573 Hematopoietic progenitor cell antigen CD34 Human genes 0.000 description 2
- 102000001554 Hemoglobins Human genes 0.000 description 2
- 108010054147 Hemoglobins Proteins 0.000 description 2
- 208000032843 Hemorrhage Diseases 0.000 description 2
- 102100034458 Hepatitis A virus cellular receptor 2 Human genes 0.000 description 2
- PUFNQIPSRXVLQJ-IHRRRGAJSA-N His-Val-Lys Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CCCCN)C(=O)O)NC(=O)[C@H](CC1=CN=CN1)N PUFNQIPSRXVLQJ-IHRRRGAJSA-N 0.000 description 2
- 101000834898 Homo sapiens Alpha-synuclein Proteins 0.000 description 2
- 101000884305 Homo sapiens B-cell receptor CD22 Proteins 0.000 description 2
- 101000884279 Homo sapiens CD276 antigen Proteins 0.000 description 2
- 101000889276 Homo sapiens Cytotoxic T-lymphocyte protein 4 Proteins 0.000 description 2
- 101000777663 Homo sapiens Hematopoietic progenitor cell antigen CD34 Proteins 0.000 description 2
- 101001068133 Homo sapiens Hepatitis A virus cellular receptor 2 Proteins 0.000 description 2
- 101000934338 Homo sapiens Myeloid cell surface antigen CD33 Proteins 0.000 description 2
- 101000652359 Homo sapiens Spermatogenesis-associated protein 2 Proteins 0.000 description 2
- 101000648507 Homo sapiens Tumor necrosis factor receptor superfamily member 14 Proteins 0.000 description 2
- 101000955999 Homo sapiens V-set domain-containing T-cell activation inhibitor 1 Proteins 0.000 description 2
- 101000666896 Homo sapiens V-type immunoglobulin domain-containing suppressor of T-cell activation Proteins 0.000 description 2
- 241000713340 Human immunodeficiency virus 2 Species 0.000 description 2
- LRAUKBMYHHNADU-DKIMLUQUSA-N Ile-Phe-Lys Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)[C@@H](NC(=O)[C@@H](N)[C@@H](C)CC)CC1=CC=CC=C1 LRAUKBMYHHNADU-DKIMLUQUSA-N 0.000 description 2
- KBDIBHQICWDGDL-PPCPHDFISA-N Ile-Thr-Leu Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(C)C)C(=O)O)N KBDIBHQICWDGDL-PPCPHDFISA-N 0.000 description 2
- NURNJECQNNCRBK-FLBSBUHZSA-N Ile-Thr-Thr Chemical compound CC[C@H](C)[C@H](N)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H]([C@@H](C)O)C(O)=O NURNJECQNNCRBK-FLBSBUHZSA-N 0.000 description 2
- REXAUQBGSGDEJY-IGISWZIWSA-N Ile-Tyr-Ile Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CC1=CC=C(C=C1)O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)O)N REXAUQBGSGDEJY-IGISWZIWSA-N 0.000 description 2
- 102000009786 Immunoglobulin Constant Regions Human genes 0.000 description 2
- 108010009817 Immunoglobulin Constant Regions Proteins 0.000 description 2
- 102100037850 Interferon gamma Human genes 0.000 description 2
- 108010074328 Interferon-gamma Proteins 0.000 description 2
- 108010002352 Interleukin-1 Proteins 0.000 description 2
- 102000000589 Interleukin-1 Human genes 0.000 description 2
- 102000003814 Interleukin-10 Human genes 0.000 description 2
- 108090000174 Interleukin-10 Proteins 0.000 description 2
- 102000013462 Interleukin-12 Human genes 0.000 description 2
- 108010065805 Interleukin-12 Proteins 0.000 description 2
- 108090000978 Interleukin-4 Proteins 0.000 description 2
- 102000004388 Interleukin-4 Human genes 0.000 description 2
- 108010002586 Interleukin-7 Proteins 0.000 description 2
- 102000000704 Interleukin-7 Human genes 0.000 description 2
- 108010043610 KIR Receptors Proteins 0.000 description 2
- 208000008839 Kidney Neoplasms Diseases 0.000 description 2
- PWKSKIMOESPYIA-BYPYZUCNSA-N L-N-acetyl-Cysteine Chemical compound CC(=O)N[C@@H](CS)C(O)=O PWKSKIMOESPYIA-BYPYZUCNSA-N 0.000 description 2
- FADYJNXDPBKVCA-UHFFFAOYSA-N L-Phenylalanyl-L-lysin Natural products NCCCCC(C(O)=O)NC(=O)C(N)CC1=CC=CC=C1 FADYJNXDPBKVCA-UHFFFAOYSA-N 0.000 description 2
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 2
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 2
- COLNVLDHVKWLRT-QMMMGPOBSA-N L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=CC=C1 COLNVLDHVKWLRT-QMMMGPOBSA-N 0.000 description 2
- QIVBCDIJIAJPQS-VIFPVBQESA-N L-tryptophane Chemical compound C1=CC=C2C(C[C@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-VIFPVBQESA-N 0.000 description 2
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 2
- WNGVUZWBXZKQES-YUMQZZPRSA-N Leu-Ala-Gly Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](C)C(=O)NCC(O)=O WNGVUZWBXZKQES-YUMQZZPRSA-N 0.000 description 2
- BQSLGJHIAGOZCD-CIUDSAMLSA-N Leu-Ala-Ser Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@@H](CO)C(O)=O BQSLGJHIAGOZCD-CIUDSAMLSA-N 0.000 description 2
- MYGQXVYRZMKRDB-SRVKXCTJSA-N Leu-Asp-Lys Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@H](C(O)=O)CCCCN MYGQXVYRZMKRDB-SRVKXCTJSA-N 0.000 description 2
- OYQUOLRTJHWVSQ-SRVKXCTJSA-N Leu-His-Ser Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CO)C(O)=O OYQUOLRTJHWVSQ-SRVKXCTJSA-N 0.000 description 2
- NRFGTHFONZYFNY-MGHWNKPDSA-N Leu-Ile-Tyr Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@H](C(O)=O)CC1=CC=C(O)C=C1 NRFGTHFONZYFNY-MGHWNKPDSA-N 0.000 description 2
- YQFZRHYZLARWDY-IHRRRGAJSA-N Leu-Val-Lys Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](C(C)C)C(=O)N[C@H](C(O)=O)CCCCN YQFZRHYZLARWDY-IHRRRGAJSA-N 0.000 description 2
- QESXLSQLQHHTIX-RHYQMDGZSA-N Leu-Val-Thr Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H]([C@@H](C)O)C(O)=O QESXLSQLQHHTIX-RHYQMDGZSA-N 0.000 description 2
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 2
- 208000028018 Lymphocytic leukaemia Diseases 0.000 description 2
- UWKNTTJNVSYXPC-CIUDSAMLSA-N Lys-Ala-Ser Chemical compound OC[C@@H](C(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CCCCN UWKNTTJNVSYXPC-CIUDSAMLSA-N 0.000 description 2
- GAOJCVKPIGHTGO-UWVGGRQHSA-N Lys-Arg-Gly Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CCCNC(N)=N)C(=O)NCC(O)=O GAOJCVKPIGHTGO-UWVGGRQHSA-N 0.000 description 2
- SKRGVGLIRUGANF-AVGNSLFASA-N Lys-Leu-Glu Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(O)=O SKRGVGLIRUGANF-AVGNSLFASA-N 0.000 description 2
- LNMKRJJLEFASGA-BZSNNMDCSA-N Lys-Phe-Leu Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CC(C)C)C(O)=O LNMKRJJLEFASGA-BZSNNMDCSA-N 0.000 description 2
- PDIDTSZKKFEDMB-UWVGGRQHSA-N Lys-Pro-Gly Chemical compound [H]N[C@@H](CCCCN)C(=O)N1CCC[C@H]1C(=O)NCC(O)=O PDIDTSZKKFEDMB-UWVGGRQHSA-N 0.000 description 2
- IOQWIOPSKJOEKI-SRVKXCTJSA-N Lys-Ser-Leu Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(O)=O IOQWIOPSKJOEKI-SRVKXCTJSA-N 0.000 description 2
- 239000004472 Lysine Substances 0.000 description 2
- 241000829100 Macaca mulatta polyomavirus 1 Species 0.000 description 2
- 101710085938 Matrix protein Proteins 0.000 description 2
- 108010052285 Membrane Proteins Proteins 0.000 description 2
- 101710127721 Membrane protein Proteins 0.000 description 2
- SJDQOYTYNGZZJX-SRVKXCTJSA-N Met-Glu-Leu Chemical compound CSCC[C@H](N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(O)=O SJDQOYTYNGZZJX-SRVKXCTJSA-N 0.000 description 2
- 241000713862 Moloney murine sarcoma virus Species 0.000 description 2
- 101000686985 Mouse mammary tumor virus (strain C3H) Protein PR73 Proteins 0.000 description 2
- 241000699660 Mus musculus Species 0.000 description 2
- 101100407308 Mus musculus Pdcd1lg2 gene Proteins 0.000 description 2
- 102100025243 Myeloid cell surface antigen CD33 Human genes 0.000 description 2
- 102100032965 Myomesin-2 Human genes 0.000 description 2
- SITLTJHOQZFJGG-UHFFFAOYSA-N N-L-alpha-glutamyl-L-valine Natural products CC(C)C(C(O)=O)NC(=O)C(N)CCC(O)=O SITLTJHOQZFJGG-UHFFFAOYSA-N 0.000 description 2
- 230000004988 N-glycosylation Effects 0.000 description 2
- 108010079364 N-glycylalanine Proteins 0.000 description 2
- 101100342977 Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) leu-1 gene Proteins 0.000 description 2
- PXHVJJICTQNCMI-UHFFFAOYSA-N Nickel Chemical compound [Ni] PXHVJJICTQNCMI-UHFFFAOYSA-N 0.000 description 2
- 241000283973 Oryctolagus cuniculus Species 0.000 description 2
- 206010061328 Ovarian epithelial cancer Diseases 0.000 description 2
- 206010061902 Pancreatic neoplasm Diseases 0.000 description 2
- 229930040373 Paraformaldehyde Natural products 0.000 description 2
- UHRNIXJAGGLKHP-DLOVCJGASA-N Phe-Ala-Ser Chemical compound [H]N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](C)C(=O)N[C@@H](CO)C(O)=O UHRNIXJAGGLKHP-DLOVCJGASA-N 0.000 description 2
- FSPGBMWPNMRWDB-AVGNSLFASA-N Phe-Cys-Gln Chemical compound C1=CC=C(C=C1)C[C@@H](C(=O)N[C@@H](CS)C(=O)N[C@@H](CCC(=O)N)C(=O)O)N FSPGBMWPNMRWDB-AVGNSLFASA-N 0.000 description 2
- BIYWZVCPZIFGPY-QWRGUYRKSA-N Phe-Gly-Ser Chemical compound [H]N[C@@H](CC1=CC=CC=C1)C(=O)NCC(=O)N[C@@H](CO)C(O)=O BIYWZVCPZIFGPY-QWRGUYRKSA-N 0.000 description 2
- YTILBRIUASDGBL-BZSNNMDCSA-N Phe-Leu-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](N)CC1=CC=CC=C1 YTILBRIUASDGBL-BZSNNMDCSA-N 0.000 description 2
- WEDZFLRYSIDIRX-IHRRRGAJSA-N Phe-Ser-Arg Chemical compound NC(=N)NCCC[C@@H](C(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CC1=CC=CC=C1 WEDZFLRYSIDIRX-IHRRRGAJSA-N 0.000 description 2
- BPIMVBKDLSBKIJ-FCLVOEFKSA-N Phe-Thr-Phe Chemical compound C([C@H](N)C(=O)N[C@@H]([C@H](O)C)C(=O)N[C@@H](CC=1C=CC=CC=1)C(O)=O)C1=CC=CC=C1 BPIMVBKDLSBKIJ-FCLVOEFKSA-N 0.000 description 2
- NBIIXXVUZAFLBC-UHFFFAOYSA-N Phosphoric acid Chemical compound OP(O)(O)=O NBIIXXVUZAFLBC-UHFFFAOYSA-N 0.000 description 2
- 208000008691 Precursor B-Cell Lymphoblastic Leukemia-Lymphoma Diseases 0.000 description 2
- 208000006664 Precursor Cell Lymphoblastic Leukemia-Lymphoma Diseases 0.000 description 2
- CGBYDGAJHSOGFQ-LPEHRKFASA-N Pro-Ala-Pro Chemical compound C[C@@H](C(=O)N1CCC[C@@H]1C(=O)O)NC(=O)[C@@H]2CCCN2 CGBYDGAJHSOGFQ-LPEHRKFASA-N 0.000 description 2
- UPJGUQPLYWTISV-GUBZILKMSA-N Pro-Gln-Glu Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(O)=O UPJGUQPLYWTISV-GUBZILKMSA-N 0.000 description 2
- NXEYSLRNNPWCRN-SRVKXCTJSA-N Pro-Glu-Leu Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(O)=O NXEYSLRNNPWCRN-SRVKXCTJSA-N 0.000 description 2
- CLNJSLSHKJECME-BQBZGAKWSA-N Pro-Gly-Ala Chemical compound OC(=O)[C@H](C)NC(=O)CNC(=O)[C@@H]1CCCN1 CLNJSLSHKJECME-BQBZGAKWSA-N 0.000 description 2
- RMODQFBNDDENCP-IHRRRGAJSA-N Pro-Lys-Leu Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(O)=O RMODQFBNDDENCP-IHRRRGAJSA-N 0.000 description 2
- SPLBRAKYXGOFSO-UNQGMJICSA-N Pro-Phe-Thr Chemical compound C[C@H]([C@@H](C(=O)O)NC(=O)[C@H](CC1=CC=CC=C1)NC(=O)[C@@H]2CCCN2)O SPLBRAKYXGOFSO-UNQGMJICSA-N 0.000 description 2
- RCYUBVHMVUHEBM-RCWTZXSCSA-N Pro-Pro-Thr Chemical compound [H]N1CCC[C@H]1C(=O)N1CCC[C@H]1C(=O)N[C@@H]([C@@H](C)O)C(O)=O RCYUBVHMVUHEBM-RCWTZXSCSA-N 0.000 description 2
- 108700030875 Programmed Cell Death 1 Ligand 2 Proteins 0.000 description 2
- 102100024213 Programmed cell death 1 ligand 2 Human genes 0.000 description 2
- 102100032859 Protein AMBP Human genes 0.000 description 2
- 206010037660 Pyrexia Diseases 0.000 description 2
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 2
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 2
- 208000001647 Renal Insufficiency Diseases 0.000 description 2
- 206010038389 Renal cancer Diseases 0.000 description 2
- 241000283984 Rodentia Species 0.000 description 2
- 241000714474 Rous sarcoma virus Species 0.000 description 2
- LVVBAKCGXXUHFO-ZLUOBGJFSA-N Ser-Ala-Asp Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(O)=O)C(O)=O LVVBAKCGXXUHFO-ZLUOBGJFSA-N 0.000 description 2
- HBZBPFLJNDXRAY-FXQIFTODSA-N Ser-Ala-Val Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](C)C(=O)N[C@@H](C(C)C)C(O)=O HBZBPFLJNDXRAY-FXQIFTODSA-N 0.000 description 2
- BLPYXIXXCFVIIF-FXQIFTODSA-N Ser-Cys-Arg Chemical compound C(C[C@@H](C(=O)O)NC(=O)[C@H](CS)NC(=O)[C@H](CO)N)CN=C(N)N BLPYXIXXCFVIIF-FXQIFTODSA-N 0.000 description 2
- FMDHKPRACUXATF-ACZMJKKPSA-N Ser-Gln-Ser Chemical compound OC[C@H](N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CO)C(O)=O FMDHKPRACUXATF-ACZMJKKPSA-N 0.000 description 2
- HJEBZBMOTCQYDN-ACZMJKKPSA-N Ser-Glu-Asp Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(O)=O)C(O)=O HJEBZBMOTCQYDN-ACZMJKKPSA-N 0.000 description 2
- DOSZISJPMCYEHT-NAKRPEOUSA-N Ser-Ile-Val Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C(C)C)C(O)=O DOSZISJPMCYEHT-NAKRPEOUSA-N 0.000 description 2
- IXZHZUGGKLRHJD-DCAQKATOSA-N Ser-Leu-Val Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(O)=O IXZHZUGGKLRHJD-DCAQKATOSA-N 0.000 description 2
- BDMWLJLPPUCLNV-XGEHTFHBSA-N Ser-Thr-Val Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C(C)C)C(O)=O BDMWLJLPPUCLNV-XGEHTFHBSA-N 0.000 description 2
- LGIMRDKGABDMBN-DCAQKATOSA-N Ser-Val-Lys Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CCCCN)C(=O)O)NC(=O)[C@H](CO)N LGIMRDKGABDMBN-DCAQKATOSA-N 0.000 description 2
- 208000000453 Skin Neoplasms Diseases 0.000 description 2
- FKNQFGJONOIPTF-UHFFFAOYSA-N Sodium cation Chemical compound [Na+] FKNQFGJONOIPTF-UHFFFAOYSA-N 0.000 description 2
- 241000713880 Spleen focus-forming virus Species 0.000 description 2
- 230000006052 T cell proliferation Effects 0.000 description 2
- 108091005735 TGF-beta receptors Proteins 0.000 description 2
- NKANXQFJJICGDU-QPLCGJKRSA-N Tamoxifen Chemical compound C=1C=CC=CC=1C(/CC)=C(C=1C=CC(OCCN(C)C)=CC=1)/C1=CC=CC=C1 NKANXQFJJICGDU-QPLCGJKRSA-N 0.000 description 2
- 208000024313 Testicular Neoplasms Diseases 0.000 description 2
- LYGKYFKSZTUXGZ-ZDLURKLDSA-N Thr-Cys-Gly Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CS)C(=O)NCC(O)=O LYGKYFKSZTUXGZ-ZDLURKLDSA-N 0.000 description 2
- JQAWYCUUFIMTHE-WLTAIBSBSA-N Thr-Gly-Tyr Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)NCC(=O)N[C@@H](CC1=CC=C(O)C=C1)C(O)=O JQAWYCUUFIMTHE-WLTAIBSBSA-N 0.000 description 2
- QFEYTTHKPSOFLV-OSUNSFLBSA-N Thr-Met-Ile Chemical compound CC[C@H](C)[C@@H](C(=O)O)NC(=O)[C@H](CCSC)NC(=O)[C@H]([C@@H](C)O)N QFEYTTHKPSOFLV-OSUNSFLBSA-N 0.000 description 2
- BIBYEFRASCNLAA-CDMKHQONSA-N Thr-Phe-Gly Chemical compound C[C@@H](O)[C@H](N)C(=O)N[C@H](C(=O)NCC(O)=O)CC1=CC=CC=C1 BIBYEFRASCNLAA-CDMKHQONSA-N 0.000 description 2
- WTMPKZWHRCMMMT-KZVJFYERSA-N Thr-Pro-Ala Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](C)C(O)=O WTMPKZWHRCMMMT-KZVJFYERSA-N 0.000 description 2
- 208000024770 Thyroid neoplasm Diseases 0.000 description 2
- 102000016715 Transforming Growth Factor beta Receptors Human genes 0.000 description 2
- VZBWRZGNEPBRDE-HZUKXOBISA-N Trp-Ala-Pro Chemical compound C[C@@H](C(=O)N1CCC[C@@H]1C(=O)O)NC(=O)[C@H](CC2=CNC3=CC=CC=C32)N VZBWRZGNEPBRDE-HZUKXOBISA-N 0.000 description 2
- SVGAWGVHFIYAEE-JSGCOSHPSA-N Trp-Gly-Gln Chemical compound C1=CC=C2C(C[C@H](N)C(=O)NCC(=O)N[C@@H](CCC(N)=O)C(O)=O)=CNC2=C1 SVGAWGVHFIYAEE-JSGCOSHPSA-N 0.000 description 2
- UOXPLPBMEPLZBW-WDSOQIARSA-N Trp-Val-Lys Chemical compound C1=CC=C2C(C[C@H](N)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCCN)C(O)=O)=CNC2=C1 UOXPLPBMEPLZBW-WDSOQIARSA-N 0.000 description 2
- GLNADSQYFUSGOU-GPTZEZBUSA-J Trypan blue Chemical compound [Na+].[Na+].[Na+].[Na+].C1=C(S([O-])(=O)=O)C=C2C=C(S([O-])(=O)=O)C(/N=N/C3=CC=C(C=C3C)C=3C=C(C(=CC=3)\N=N\C=3C(=CC4=CC(=CC(N)=C4C=3O)S([O-])(=O)=O)S([O-])(=O)=O)C)=C(O)C2=C1N GLNADSQYFUSGOU-GPTZEZBUSA-J 0.000 description 2
- QIVBCDIJIAJPQS-UHFFFAOYSA-N Tryptophan Natural products C1=CC=C2C(CC(N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-UHFFFAOYSA-N 0.000 description 2
- 102100040247 Tumor necrosis factor Human genes 0.000 description 2
- 101710165473 Tumor necrosis factor receptor superfamily member 4 Proteins 0.000 description 2
- GFHYISDTIWZUSU-QWRGUYRKSA-N Tyr-Asn-Gly Chemical compound [H]N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC(N)=O)C(=O)NCC(O)=O GFHYISDTIWZUSU-QWRGUYRKSA-N 0.000 description 2
- XYNFFTNEQDWZNY-ULQDDVLXSA-N Tyr-Met-His Chemical compound CSCC[C@@H](C(=O)N[C@@H](CC1=CN=CN1)C(=O)O)NC(=O)[C@H](CC2=CC=C(C=C2)O)N XYNFFTNEQDWZNY-ULQDDVLXSA-N 0.000 description 2
- HRHYJNLMIJWGLF-BZSNNMDCSA-N Tyr-Ser-Phe Chemical compound C([C@H](N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC=1C=CC=CC=1)C(O)=O)C1=CC=C(O)C=C1 HRHYJNLMIJWGLF-BZSNNMDCSA-N 0.000 description 2
- UMSZZGTXGKHTFJ-SRVKXCTJSA-N Tyr-Ser-Ser Chemical compound OC[C@@H](C(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CC1=CC=C(O)C=C1 UMSZZGTXGKHTFJ-SRVKXCTJSA-N 0.000 description 2
- ANHVRCNNGJMJNG-BZSNNMDCSA-N Tyr-Tyr-Cys Chemical compound C1=CC(=CC=C1C[C@@H](C(=O)N[C@@H](CC2=CC=C(C=C2)O)C(=O)N[C@@H](CS)C(=O)O)N)O ANHVRCNNGJMJNG-BZSNNMDCSA-N 0.000 description 2
- 208000007097 Urinary Bladder Neoplasms Diseases 0.000 description 2
- 102100038282 V-type immunoglobulin domain-containing suppressor of T-cell activation Human genes 0.000 description 2
- 241000700618 Vaccinia virus Species 0.000 description 2
- 206010046865 Vaccinia virus infection Diseases 0.000 description 2
- BMGOFDMKDVVGJG-NHCYSSNCSA-N Val-Asp-Lys Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CCCCN)C(=O)O)N BMGOFDMKDVVGJG-NHCYSSNCSA-N 0.000 description 2
- VFOHXOLPLACADK-GVXVVHGQSA-N Val-Gln-Leu Chemical compound CC(C)C[C@@H](C(=O)O)NC(=O)[C@H](CCC(=O)N)NC(=O)[C@H](C(C)C)N VFOHXOLPLACADK-GVXVVHGQSA-N 0.000 description 2
- ZXYPHBKIZLAQTL-QXEWZRGKSA-N Val-Pro-Asp Chemical compound CC(C)[C@@H](C(=O)N1CCC[C@H]1C(=O)N[C@@H](CC(=O)O)C(=O)O)N ZXYPHBKIZLAQTL-QXEWZRGKSA-N 0.000 description 2
- KSFXWENSJABBFI-ZKWXMUAHSA-N Val-Ser-Asn Chemical compound [H]N[C@@H](C(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(O)=O KSFXWENSJABBFI-ZKWXMUAHSA-N 0.000 description 2
- GBIUHAYJGWVNLN-AEJSXWLSSA-N Val-Ser-Pro Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CO)C(=O)N1CCC[C@@H]1C(=O)O)N GBIUHAYJGWVNLN-AEJSXWLSSA-N 0.000 description 2
- GBIUHAYJGWVNLN-UHFFFAOYSA-N Val-Ser-Pro Natural products CC(C)C(N)C(=O)NC(CO)C(=O)N1CCCC1C(O)=O GBIUHAYJGWVNLN-UHFFFAOYSA-N 0.000 description 2
- HTONZBWRYUKUKC-RCWTZXSCSA-N Val-Thr-Val Chemical compound CC(C)[C@H](N)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C(C)C)C(O)=O HTONZBWRYUKUKC-RCWTZXSCSA-N 0.000 description 2
- SXEHKFHPFVVDIR-UHFFFAOYSA-N [4-(4-hydrazinylphenyl)phenyl]hydrazine Chemical compound C1=CC(NN)=CC=C1C1=CC=C(NN)C=C1 SXEHKFHPFVVDIR-UHFFFAOYSA-N 0.000 description 2
- 238000009825 accumulation Methods 0.000 description 2
- 108010081404 acein-2 Proteins 0.000 description 2
- 229960004308 acetylcysteine Drugs 0.000 description 2
- 150000007513 acids Chemical class 0.000 description 2
- 239000012190 activator Substances 0.000 description 2
- OIRDTQYFTABQOQ-KQYNXXCUSA-N adenosine Chemical compound C1=NC=2C(N)=NC=NC=2N1[C@@H]1O[C@H](CO)[C@@H](O)[C@H]1O OIRDTQYFTABQOQ-KQYNXXCUSA-N 0.000 description 2
- 230000001464 adherent effect Effects 0.000 description 2
- 239000002671 adjuvant Substances 0.000 description 2
- 108010047495 alanylglycine Proteins 0.000 description 2
- 150000001408 amides Chemical class 0.000 description 2
- 229960003437 aminoglutethimide Drugs 0.000 description 2
- ROBVIMPUHSLWNV-UHFFFAOYSA-N aminoglutethimide Chemical compound C=1C=C(N)C=CC=1C1(CC)CCC(=O)NC1=O ROBVIMPUHSLWNV-UHFFFAOYSA-N 0.000 description 2
- 239000012491 analyte Substances 0.000 description 2
- 239000005557 antagonist Substances 0.000 description 2
- 239000002246 antineoplastic agent Substances 0.000 description 2
- 230000004596 appetite loss Effects 0.000 description 2
- 108010062796 arginyllysine Proteins 0.000 description 2
- 108010060035 arginylproline Proteins 0.000 description 2
- VSRXQHXAPYXROS-UHFFFAOYSA-N azanide;cyclobutane-1,1-dicarboxylic acid;platinum(2+) Chemical compound [NH2-].[NH2-].[Pt+2].OC(=O)C1(C(O)=O)CCC1 VSRXQHXAPYXROS-UHFFFAOYSA-N 0.000 description 2
- 210000003651 basophil Anatomy 0.000 description 2
- 102000015736 beta 2-Microglobulin Human genes 0.000 description 2
- 108010081355 beta 2-Microglobulin Proteins 0.000 description 2
- 208000026900 bile duct neoplasm Diseases 0.000 description 2
- 210000003969 blast cell Anatomy 0.000 description 2
- 208000034158 bleeding Diseases 0.000 description 2
- 230000000740 bleeding effect Effects 0.000 description 2
- 210000002798 bone marrow cell Anatomy 0.000 description 2
- 229960001467 bortezomib Drugs 0.000 description 2
- 210000004556 brain Anatomy 0.000 description 2
- 229960004562 carboplatin Drugs 0.000 description 2
- 230000015556 catabolic process Effects 0.000 description 2
- 230000010261 cell growth Effects 0.000 description 2
- 230000005754 cellular signaling Effects 0.000 description 2
- 238000007385 chemical modification Methods 0.000 description 2
- 208000024207 chronic leukemia Diseases 0.000 description 2
- 229960004316 cisplatin Drugs 0.000 description 2
- DQLATGHUWYMOKM-UHFFFAOYSA-L cisplatin Chemical compound N[Pt](N)(Cl)Cl DQLATGHUWYMOKM-UHFFFAOYSA-L 0.000 description 2
- 238000003776 cleavage reaction Methods 0.000 description 2
- 230000000295 complement effect Effects 0.000 description 2
- 150000001875 compounds Chemical class 0.000 description 2
- 238000011254 conventional chemotherapy Methods 0.000 description 2
- DDRJAANPRJIHGJ-UHFFFAOYSA-N creatinine Chemical compound CN1CC(=O)NC1=N DDRJAANPRJIHGJ-UHFFFAOYSA-N 0.000 description 2
- 229960004397 cyclophosphamide Drugs 0.000 description 2
- XVOYSCVBGLVSOL-UHFFFAOYSA-N cysteic acid Chemical compound OC(=O)C(N)CS(O)(=O)=O XVOYSCVBGLVSOL-UHFFFAOYSA-N 0.000 description 2
- 230000002559 cytogenic effect Effects 0.000 description 2
- 231100000433 cytotoxic Toxicity 0.000 description 2
- 239000002254 cytotoxic agent Substances 0.000 description 2
- 230000001472 cytotoxic effect Effects 0.000 description 2
- 229960002204 daratumumab Drugs 0.000 description 2
- 238000006731 degradation reaction Methods 0.000 description 2
- 230000003111 delayed effect Effects 0.000 description 2
- 210000004443 dendritic cell Anatomy 0.000 description 2
- 229940029030 dendritic cell vaccine Drugs 0.000 description 2
- 230000001419 dependent effect Effects 0.000 description 2
- 238000013461 design Methods 0.000 description 2
- 238000001514 detection method Methods 0.000 description 2
- 238000010586 diagram Methods 0.000 description 2
- 150000002019 disulfides Chemical class 0.000 description 2
- 229960004137 elotuzumab Drugs 0.000 description 2
- 230000007717 exclusion Effects 0.000 description 2
- IJJVMEJXYNJXOJ-UHFFFAOYSA-N fluquinconazole Chemical compound C=1C=C(Cl)C=C(Cl)C=1N1C(=O)C2=CC(F)=CC=C2N=C1N1C=NC=N1 IJJVMEJXYNJXOJ-UHFFFAOYSA-N 0.000 description 2
- 229960002074 flutamide Drugs 0.000 description 2
- MKXKFYHWDHIYRV-UHFFFAOYSA-N flutamide Chemical compound CC(C)C(=O)NC1=CC=C([N+]([O-])=O)C(C(F)(F)F)=C1 MKXKFYHWDHIYRV-UHFFFAOYSA-N 0.000 description 2
- 239000012537 formulation buffer Substances 0.000 description 2
- 239000012737 fresh medium Substances 0.000 description 2
- 230000005714 functional activity Effects 0.000 description 2
- 108020001507 fusion proteins Proteins 0.000 description 2
- 102000037865 fusion proteins Human genes 0.000 description 2
- 108010078144 glutaminyl-glycine Proteins 0.000 description 2
- 108010057083 glutamyl-aspartyl-leucine Proteins 0.000 description 2
- XBGGUPMXALFZOT-UHFFFAOYSA-N glycyl-L-tyrosine hemihydrate Natural products NCC(=O)NC(C(O)=O)CC1=CC=C(O)C=C1 XBGGUPMXALFZOT-UHFFFAOYSA-N 0.000 description 2
- 108010010147 glycylglutamine Proteins 0.000 description 2
- 108010050848 glycylleucine Proteins 0.000 description 2
- 108010015792 glycyllysine Proteins 0.000 description 2
- 210000003714 granulocyte Anatomy 0.000 description 2
- 230000012010 growth Effects 0.000 description 2
- 239000003102 growth factor Substances 0.000 description 2
- 239000001963 growth medium Substances 0.000 description 2
- 210000003958 hematopoietic stem cell Anatomy 0.000 description 2
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 2
- JYGXADMDTFJGBT-VWUMJDOOSA-N hydrocortisone Chemical compound O=C1CC[C@]2(C)[C@H]3[C@@H](O)C[C@](C)([C@@](CC4)(O)C(=O)CO)[C@@H]4[C@@H]3CCC2=C1 JYGXADMDTFJGBT-VWUMJDOOSA-N 0.000 description 2
- 210000000987 immune system Anatomy 0.000 description 2
- 230000002055 immunohistochemical effect Effects 0.000 description 2
- 238000012744 immunostaining Methods 0.000 description 2
- 230000003308 immunostimulating effect Effects 0.000 description 2
- 239000003018 immunosuppressive agent Substances 0.000 description 2
- 229940124589 immunosuppressive drug Drugs 0.000 description 2
- 230000001771 impaired effect Effects 0.000 description 2
- 230000008676 import Effects 0.000 description 2
- 210000004263 induced pluripotent stem cell Anatomy 0.000 description 2
- 238000011081 inoculation Methods 0.000 description 2
- 239000007928 intraperitoneal injection Substances 0.000 description 2
- 230000002601 intratumoral effect Effects 0.000 description 2
- JDNTWHVOXJZDSN-UHFFFAOYSA-N iodoacetic acid Chemical compound OC(=O)CI JDNTWHVOXJZDSN-UHFFFAOYSA-N 0.000 description 2
- 210000003734 kidney Anatomy 0.000 description 2
- 201000006370 kidney failure Diseases 0.000 description 2
- 238000009533 lab test Methods 0.000 description 2
- 230000003902 lesion Effects 0.000 description 2
- 108010057821 leucylproline Proteins 0.000 description 2
- 230000000670 limiting effect Effects 0.000 description 2
- 230000007774 longterm Effects 0.000 description 2
- 208000019017 loss of appetite Diseases 0.000 description 2
- 235000021266 loss of appetite Nutrition 0.000 description 2
- 108010003700 lysyl aspartic acid Proteins 0.000 description 2
- 239000006249 magnetic particle Substances 0.000 description 2
- 238000007885 magnetic separation Methods 0.000 description 2
- 239000003550 marker Substances 0.000 description 2
- 239000000463 material Substances 0.000 description 2
- 230000009401 metastasis Effects 0.000 description 2
- 206010061289 metastatic neoplasm Diseases 0.000 description 2
- 230000003278 mimic effect Effects 0.000 description 2
- 230000035772 mutation Effects 0.000 description 2
- 230000008520 organization Effects 0.000 description 2
- 230000002611 ovarian Effects 0.000 description 2
- 208000013371 ovarian adenocarcinoma Diseases 0.000 description 2
- 210000001672 ovary Anatomy 0.000 description 2
- 201000006588 ovary adenocarcinoma Diseases 0.000 description 2
- 201000002528 pancreatic cancer Diseases 0.000 description 2
- 229960005184 panobinostat Drugs 0.000 description 2
- FPOHNWQLNRZRFC-ZHACJKMWSA-N panobinostat Chemical compound CC=1NC2=CC=CC=C2C=1CCNCC1=CC=C(\C=C\C(=O)NO)C=C1 FPOHNWQLNRZRFC-ZHACJKMWSA-N 0.000 description 2
- 210000005259 peripheral blood Anatomy 0.000 description 2
- 210000005105 peripheral blood lymphocyte Anatomy 0.000 description 2
- 230000002085 persistent effect Effects 0.000 description 2
- 239000000546 pharmaceutical excipient Substances 0.000 description 2
- COLNVLDHVKWLRT-UHFFFAOYSA-N phenylalanine Natural products OC(=O)C(N)CC1=CC=CC=C1 COLNVLDHVKWLRT-UHFFFAOYSA-N 0.000 description 2
- 108010070409 phenylalanyl-glycyl-glycine Proteins 0.000 description 2
- 108010024607 phenylalanylalanine Proteins 0.000 description 2
- 108010051242 phenylalanylserine Proteins 0.000 description 2
- 201000008814 placenta cancer Diseases 0.000 description 2
- 239000013600 plasmid vector Substances 0.000 description 2
- BASFCYQUMIYNBI-UHFFFAOYSA-N platinum Chemical compound [Pt] BASFCYQUMIYNBI-UHFFFAOYSA-N 0.000 description 2
- 230000037452 priming Effects 0.000 description 2
- 230000008569 process Effects 0.000 description 2
- 239000000047 product Substances 0.000 description 2
- 108010004914 prolylarginine Proteins 0.000 description 2
- 230000001902 propagating effect Effects 0.000 description 2
- 210000001938 protoplast Anatomy 0.000 description 2
- 238000000746 purification Methods 0.000 description 2
- 230000009257 reactivity Effects 0.000 description 2
- 230000001105 regulatory effect Effects 0.000 description 2
- 238000011160 research Methods 0.000 description 2
- 230000001177 retroviral effect Effects 0.000 description 2
- 238000012552 review Methods 0.000 description 2
- 150000003839 salts Chemical class 0.000 description 2
- 230000007017 scission Effects 0.000 description 2
- 238000012163 sequencing technique Methods 0.000 description 2
- 238000009097 single-agent therapy Methods 0.000 description 2
- 208000010721 smoldering plasma cell myeloma Diseases 0.000 description 2
- 229910001415 sodium ion Inorganic materials 0.000 description 2
- 239000007790 solid phase Substances 0.000 description 2
- 238000010561 standard procedure Methods 0.000 description 2
- 238000011272 standard treatment Methods 0.000 description 2
- 238000003860 storage Methods 0.000 description 2
- 238000007920 subcutaneous administration Methods 0.000 description 2
- 231100000617 superantigen Toxicity 0.000 description 2
- 238000003786 synthesis reaction Methods 0.000 description 2
- 230000009885 systemic effect Effects 0.000 description 2
- 210000001550 testis Anatomy 0.000 description 2
- WYWHKKSPHMUBEB-UHFFFAOYSA-N tioguanine Chemical compound N1C(N)=NC(=S)C2=C1N=CN2 WYWHKKSPHMUBEB-UHFFFAOYSA-N 0.000 description 2
- 230000000699 topical effect Effects 0.000 description 2
- 231100000331 toxic Toxicity 0.000 description 2
- 230000002588 toxic effect Effects 0.000 description 2
- 230000009466 transformation Effects 0.000 description 2
- 238000011830 transgenic mouse model Methods 0.000 description 2
- LWIHDJKSTIGBAC-UHFFFAOYSA-K tripotassium phosphate Chemical compound [K+].[K+].[K+].[O-]P([O-])([O-])=O LWIHDJKSTIGBAC-UHFFFAOYSA-K 0.000 description 2
- 229910052721 tungsten Inorganic materials 0.000 description 2
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 2
- 108010003137 tyrosyltyrosine Proteins 0.000 description 2
- 241000701161 unidentified adenovirus Species 0.000 description 2
- 206010046766 uterine cancer Diseases 0.000 description 2
- 208000007089 vaccinia Diseases 0.000 description 2
- 108010009962 valyltyrosine Proteins 0.000 description 2
- 230000035899 viability Effects 0.000 description 2
- 239000011782 vitamin Substances 0.000 description 2
- 235000013343 vitamin Nutrition 0.000 description 2
- 229940088594 vitamin Drugs 0.000 description 2
- 229930003231 vitamin Natural products 0.000 description 2
- 150000003722 vitamin derivatives Chemical class 0.000 description 2
- 201000005102 vulva cancer Diseases 0.000 description 2
- 108010000998 wheylin-2 peptide Proteins 0.000 description 2
- MTCFGRXMJLQNBG-REOHCLBHSA-N (2S)-2-Amino-3-hydroxypropansäure Chemical compound OC[C@H](N)C(O)=O MTCFGRXMJLQNBG-REOHCLBHSA-N 0.000 description 1
- IYKLZBIWFXPUCS-VIFPVBQESA-N (2s)-2-(naphthalen-1-ylamino)propanoic acid Chemical compound C1=CC=C2C(N[C@@H](C)C(O)=O)=CC=CC2=C1 IYKLZBIWFXPUCS-VIFPVBQESA-N 0.000 description 1
- CNMAQBJBWQQZFZ-LURJTMIESA-N (2s)-2-(pyridin-2-ylamino)propanoic acid Chemical compound OC(=O)[C@H](C)NC1=CC=CC=N1 CNMAQBJBWQQZFZ-LURJTMIESA-N 0.000 description 1
- MZOFCQQQCNRIBI-VMXHOPILSA-N (3s)-4-[[(2s)-1-[[(2s)-1-[[(1s)-1-carboxy-2-hydroxyethyl]amino]-4-methyl-1-oxopentan-2-yl]amino]-5-(diaminomethylideneamino)-1-oxopentan-2-yl]amino]-3-[[2-[[(2s)-2,6-diaminohexanoyl]amino]acetyl]amino]-4-oxobutanoic acid Chemical compound OC[C@@H](C(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCN=C(N)N)NC(=O)[C@H](CC(O)=O)NC(=O)CNC(=O)[C@@H](N)CCCCN MZOFCQQQCNRIBI-VMXHOPILSA-N 0.000 description 1
- YJGVMLPVUAXIQN-LGWHJFRWSA-N (5s,5ar,8ar,9r)-5-hydroxy-9-(3,4,5-trimethoxyphenyl)-5a,6,8a,9-tetrahydro-5h-[2]benzofuro[5,6-f][1,3]benzodioxol-8-one Chemical compound COC1=C(OC)C(OC)=CC([C@@H]2C3=CC=4OCOC=4C=C3[C@@H](O)[C@@H]3[C@@H]2C(OC3)=O)=C1 YJGVMLPVUAXIQN-LGWHJFRWSA-N 0.000 description 1
- VSNHCAURESNICA-NJFSPNSNSA-N 1-oxidanylurea Chemical compound N[14C](=O)NO VSNHCAURESNICA-NJFSPNSNSA-N 0.000 description 1
- BFPYWIDHMRZLRN-UHFFFAOYSA-N 17alpha-ethynyl estradiol Natural products OC1=CC=C2C3CCC(C)(C(CC4)(O)C#C)C4C3CCC2=C1 BFPYWIDHMRZLRN-UHFFFAOYSA-N 0.000 description 1
- BLCJBICVQSYOIF-UHFFFAOYSA-N 2,2-diaminobutanoic acid Chemical compound CCC(N)(N)C(O)=O BLCJBICVQSYOIF-UHFFFAOYSA-N 0.000 description 1
- WTOFYLAWDLQMBZ-UHFFFAOYSA-N 2-azaniumyl-3-thiophen-2-ylpropanoate Chemical compound OC(=O)C(N)CC1=CC=CS1 WTOFYLAWDLQMBZ-UHFFFAOYSA-N 0.000 description 1
- CTRPRMNBTVRDFH-UHFFFAOYSA-N 2-n-methyl-1,3,5-triazine-2,4,6-triamine Chemical compound CNC1=NC(N)=NC(N)=N1 CTRPRMNBTVRDFH-UHFFFAOYSA-N 0.000 description 1
- 108010082808 4-1BB Ligand Proteins 0.000 description 1
- STQGQHZAVUOBTE-UHFFFAOYSA-N 7-Cyan-hept-2t-en-4,6-diinsaeure Natural products C1=2C(O)=C3C(=O)C=4C(OC)=CC=CC=4C(=O)C3=C(O)C=2CC(O)(C(C)=O)CC1OC1CC(N)C(O)C(C)O1 STQGQHZAVUOBTE-UHFFFAOYSA-N 0.000 description 1
- 102100031585 ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1 Human genes 0.000 description 1
- 241000714175 Abelson murine leukemia virus Species 0.000 description 1
- 208000016520 Acute leukemia of ambiguous lineage Diseases 0.000 description 1
- 102000009346 Adenosine receptors Human genes 0.000 description 1
- 108050000203 Adenosine receptors Proteins 0.000 description 1
- 101150051188 Adora2a gene Proteins 0.000 description 1
- RLMISHABBKUNFO-WHFBIAKZSA-N Ala-Ala-Gly Chemical compound C[C@H](N)C(=O)N[C@@H](C)C(=O)NCC(O)=O RLMISHABBKUNFO-WHFBIAKZSA-N 0.000 description 1
- TTXMOJWKNRJWQJ-FXQIFTODSA-N Ala-Arg-Ser Chemical compound OC[C@@H](C(O)=O)NC(=O)[C@@H](NC(=O)[C@@H](N)C)CCCN=C(N)N TTXMOJWKNRJWQJ-FXQIFTODSA-N 0.000 description 1
- NHCPCLJZRSIDHS-ZLUOBGJFSA-N Ala-Asp-Ala Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](C)C(O)=O NHCPCLJZRSIDHS-ZLUOBGJFSA-N 0.000 description 1
- WJRXVTCKASUIFF-FXQIFTODSA-N Ala-Cys-Arg Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CS)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O WJRXVTCKASUIFF-FXQIFTODSA-N 0.000 description 1
- DAEFQZCYZKRTLR-ZLUOBGJFSA-N Ala-Cys-Asp Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CS)C(=O)N[C@@H](CC(O)=O)C(O)=O DAEFQZCYZKRTLR-ZLUOBGJFSA-N 0.000 description 1
- FUSPCLTUKXQREV-ACZMJKKPSA-N Ala-Glu-Ala Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(O)=O FUSPCLTUKXQREV-ACZMJKKPSA-N 0.000 description 1
- VGPWRRFOPXVGOH-BYPYZUCNSA-N Ala-Gly-Gly Chemical compound C[C@H](N)C(=O)NCC(=O)NCC(O)=O VGPWRRFOPXVGOH-BYPYZUCNSA-N 0.000 description 1
- OBVSBEYOMDWLRJ-BFHQHQDPSA-N Ala-Gly-Thr Chemical compound C[C@@H](O)[C@@H](C(O)=O)NC(=O)CNC(=O)[C@H](C)N OBVSBEYOMDWLRJ-BFHQHQDPSA-N 0.000 description 1
- TZDNWXDLYFIFPT-BJDJZHNGSA-N Ala-Ile-Leu Chemical compound [H]N[C@@H](C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC(C)C)C(O)=O TZDNWXDLYFIFPT-BJDJZHNGSA-N 0.000 description 1
- DPNZTBKGAUAZQU-DLOVCJGASA-N Ala-Leu-His Chemical compound C[C@@H](C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC1=CN=CN1)C(=O)O)N DPNZTBKGAUAZQU-DLOVCJGASA-N 0.000 description 1
- OYJCVIGKMXUVKB-GARJFASQSA-N Ala-Leu-Pro Chemical compound C[C@@H](C(=O)N[C@@H](CC(C)C)C(=O)N1CCC[C@@H]1C(=O)O)N OYJCVIGKMXUVKB-GARJFASQSA-N 0.000 description 1
- CHFFHQUVXHEGBY-GARJFASQSA-N Ala-Lys-Pro Chemical compound C[C@@H](C(=O)N[C@@H](CCCCN)C(=O)N1CCC[C@@H]1C(=O)O)N CHFFHQUVXHEGBY-GARJFASQSA-N 0.000 description 1
- MAZZQZWCCYJQGZ-GUBZILKMSA-N Ala-Pro-Arg Chemical compound [H]N[C@@H](C)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCNC(N)=N)C(O)=O MAZZQZWCCYJQGZ-GUBZILKMSA-N 0.000 description 1
- ADSGHMXEAZJJNF-DCAQKATOSA-N Ala-Pro-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@@H]1CCCN1C(=O)[C@H](C)N ADSGHMXEAZJJNF-DCAQKATOSA-N 0.000 description 1
- DCVYRWFAMZFSDA-ZLUOBGJFSA-N Ala-Ser-Ala Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CO)C(=O)N[C@@H](C)C(O)=O DCVYRWFAMZFSDA-ZLUOBGJFSA-N 0.000 description 1
- HOVPGJUNRLMIOZ-CIUDSAMLSA-N Ala-Ser-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@H](CO)NC(=O)[C@H](C)N HOVPGJUNRLMIOZ-CIUDSAMLSA-N 0.000 description 1
- SAHQGRZIQVEJPF-JXUBOQSCSA-N Ala-Thr-Lys Chemical compound C[C@H](N)C(=O)N[C@@H]([C@H](O)C)C(=O)N[C@H](C(O)=O)CCCCN SAHQGRZIQVEJPF-JXUBOQSCSA-N 0.000 description 1
- QDGMZAOSMNGBLP-MRFFXTKBSA-N Ala-Trp-Tyr Chemical compound C[C@@H](C(=O)N[C@@H](CC1=CNC2=CC=CC=C21)C(=O)N[C@@H](CC3=CC=C(C=C3)O)C(=O)O)N QDGMZAOSMNGBLP-MRFFXTKBSA-N 0.000 description 1
- QRIYOHQJRDHFKF-UWJYBYFXSA-N Ala-Tyr-Ser Chemical compound OC[C@@H](C(O)=O)NC(=O)[C@@H](NC(=O)[C@@H](N)C)CC1=CC=C(O)C=C1 QRIYOHQJRDHFKF-UWJYBYFXSA-N 0.000 description 1
- CLOMBHBBUKAUBP-LSJOCFKGSA-N Ala-Val-His Chemical compound C[C@@H](C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC1=CN=CN1)C(=O)O)N CLOMBHBBUKAUBP-LSJOCFKGSA-N 0.000 description 1
- 102000002260 Alkaline Phosphatase Human genes 0.000 description 1
- 108020004774 Alkaline Phosphatase Proteins 0.000 description 1
- 102100035248 Alpha-(1,3)-fucosyltransferase 4 Human genes 0.000 description 1
- XPSGESXVBSQZPL-SRVKXCTJSA-N Arg-Arg-Arg Chemical compound NC(N)=NCCC[C@H](N)C(=O)N[C@@H](CCCN=C(N)N)C(=O)N[C@@H](CCCN=C(N)N)C(O)=O XPSGESXVBSQZPL-SRVKXCTJSA-N 0.000 description 1
- UXJCMQFPDWCHKX-DCAQKATOSA-N Arg-Arg-Glu Chemical compound NC(N)=NCCC[C@H](N)C(=O)N[C@@H](CCCN=C(N)N)C(=O)N[C@@H](CCC(O)=O)C(O)=O UXJCMQFPDWCHKX-DCAQKATOSA-N 0.000 description 1
- HJVGMOYJDDXLMI-AVGNSLFASA-N Arg-Arg-Lys Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@@H](N)CCCNC(N)=N HJVGMOYJDDXLMI-AVGNSLFASA-N 0.000 description 1
- OQCWXQJLCDPRHV-UWVGGRQHSA-N Arg-Gly-Leu Chemical compound [H]N[C@@H](CCCNC(N)=N)C(=O)NCC(=O)N[C@@H](CC(C)C)C(O)=O OQCWXQJLCDPRHV-UWVGGRQHSA-N 0.000 description 1
- PHHRSPBBQUFULD-UWVGGRQHSA-N Arg-Gly-Lys Chemical compound C(CCN)C[C@@H](C(=O)O)NC(=O)CNC(=O)[C@H](CCCN=C(N)N)N PHHRSPBBQUFULD-UWVGGRQHSA-N 0.000 description 1
- SSZGOKWBHLOCHK-DCAQKATOSA-N Arg-Lys-Asn Chemical compound NC(=O)C[C@@H](C(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](N)CCCN=C(N)N SSZGOKWBHLOCHK-DCAQKATOSA-N 0.000 description 1
- LXMKTIZAGIBQRX-HRCADAONSA-N Arg-Phe-Pro Chemical compound C1C[C@@H](N(C1)C(=O)[C@H](CC2=CC=CC=C2)NC(=O)[C@H](CCCN=C(N)N)N)C(=O)O LXMKTIZAGIBQRX-HRCADAONSA-N 0.000 description 1
- XSPKAHFVDKRGRL-DCAQKATOSA-N Arg-Pro-Glu Chemical compound [H]N[C@@H](CCCNC(N)=N)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCC(O)=O)C(O)=O XSPKAHFVDKRGRL-DCAQKATOSA-N 0.000 description 1
- YCYXHLZRUSJITQ-SRVKXCTJSA-N Arg-Pro-Pro Chemical compound NC(=N)NCCC[C@H](N)C(=O)N1CCC[C@H]1C(=O)N1[C@H](C(O)=O)CCC1 YCYXHLZRUSJITQ-SRVKXCTJSA-N 0.000 description 1
- VUGWHBXPMAHEGZ-SRVKXCTJSA-N Arg-Pro-Val Chemical compound CC(C)[C@@H](C(O)=O)NC(=O)[C@@H]1CCCN1C(=O)[C@@H](N)CCCN=C(N)N VUGWHBXPMAHEGZ-SRVKXCTJSA-N 0.000 description 1
- KMFPQTITXUKJOV-DCAQKATOSA-N Arg-Ser-Leu Chemical compound [H]N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(O)=O KMFPQTITXUKJOV-DCAQKATOSA-N 0.000 description 1
- UVTGNSWSRSCPLP-UHFFFAOYSA-N Arg-Tyr Natural products NC(CCNC(=N)N)C(=O)NC(Cc1ccc(O)cc1)C(=O)O UVTGNSWSRSCPLP-UHFFFAOYSA-N 0.000 description 1
- 239000004475 Arginine Substances 0.000 description 1
- 208000006820 Arthralgia Diseases 0.000 description 1
- PCKRJVZAQZWNKM-WHFBIAKZSA-N Asn-Asn-Gly Chemical compound NC(=O)C[C@H](N)C(=O)N[C@@H](CC(N)=O)C(=O)NCC(O)=O PCKRJVZAQZWNKM-WHFBIAKZSA-N 0.000 description 1
- WPOLSNAQGVHROR-GUBZILKMSA-N Asn-Gln-Leu Chemical compound CC(C)C[C@@H](C(=O)O)NC(=O)[C@H](CCC(=O)N)NC(=O)[C@H](CC(=O)N)N WPOLSNAQGVHROR-GUBZILKMSA-N 0.000 description 1
- WIDVAWAQBRAKTI-YUMQZZPRSA-N Asn-Leu-Gly Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)NCC(O)=O WIDVAWAQBRAKTI-YUMQZZPRSA-N 0.000 description 1
- JTXVXGXTRXMOFJ-FXQIFTODSA-N Asn-Pro-Asn Chemical compound NC(=O)C[C@H](N)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CC(N)=O)C(O)=O JTXVXGXTRXMOFJ-FXQIFTODSA-N 0.000 description 1
- SUIJFTJDTJKSRK-IHRRRGAJSA-N Asn-Pro-Tyr Chemical compound NC(=O)C[C@H](N)C(=O)N1CCC[C@H]1C(=O)N[C@H](C(O)=O)CC1=CC=C(O)C=C1 SUIJFTJDTJKSRK-IHRRRGAJSA-N 0.000 description 1
- NPZJLGMWMDNQDD-GHCJXIJMSA-N Asn-Ser-Ile Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)CC)C(O)=O NPZJLGMWMDNQDD-GHCJXIJMSA-N 0.000 description 1
- HPNDKUOLNRVRAY-BIIVOSGPSA-N Asn-Ser-Pro Chemical compound C1C[C@@H](N(C1)C(=O)[C@H](CO)NC(=O)[C@H](CC(=O)N)N)C(=O)O HPNDKUOLNRVRAY-BIIVOSGPSA-N 0.000 description 1
- DPSUVAPLRQDWAO-YDHLFZDLSA-N Asn-Tyr-Val Chemical compound CC(C)[C@@H](C(=O)O)NC(=O)[C@H](CC1=CC=C(C=C1)O)NC(=O)[C@H](CC(=O)N)N DPSUVAPLRQDWAO-YDHLFZDLSA-N 0.000 description 1
- PBVLJOIPOGUQQP-CIUDSAMLSA-N Asp-Ala-Leu Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(O)=O PBVLJOIPOGUQQP-CIUDSAMLSA-N 0.000 description 1
- QCVXMEHGFUMKCO-YUMQZZPRSA-N Asp-Gly-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)CNC(=O)[C@@H](N)CC(O)=O QCVXMEHGFUMKCO-YUMQZZPRSA-N 0.000 description 1
- UZFHNLYQWMGUHU-DCAQKATOSA-N Asp-Lys-Arg Chemical compound OC(=O)C[C@H](N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O UZFHNLYQWMGUHU-DCAQKATOSA-N 0.000 description 1
- FQHBAQLBIXLWAG-DCAQKATOSA-N Asp-Lys-Met Chemical compound CSCC[C@@H](C(=O)O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CC(=O)O)N FQHBAQLBIXLWAG-DCAQKATOSA-N 0.000 description 1
- GYWQGGUCMDCUJE-DLOVCJGASA-N Asp-Phe-Ala Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](C)C(O)=O GYWQGGUCMDCUJE-DLOVCJGASA-N 0.000 description 1
- AHWRSSLYSGLBGD-CIUDSAMLSA-N Asp-Pro-Glu Chemical compound OC(=O)C[C@H](N)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCC(O)=O)C(O)=O AHWRSSLYSGLBGD-CIUDSAMLSA-N 0.000 description 1
- JDDYEZGPYBBPBN-JRQIVUDYSA-N Asp-Thr-Tyr Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(O)=O JDDYEZGPYBBPBN-JRQIVUDYSA-N 0.000 description 1
- HTSSXFASOUSJQG-IHPCNDPISA-N Asp-Tyr-Trp Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC1=CNC2=C1C=CC=C2)C(O)=O HTSSXFASOUSJQG-IHPCNDPISA-N 0.000 description 1
- GIKOVDMXBAFXDF-NHCYSSNCSA-N Asp-Val-Leu Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(C)C)C(O)=O GIKOVDMXBAFXDF-NHCYSSNCSA-N 0.000 description 1
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 description 1
- 241000972773 Aulopiformes Species 0.000 description 1
- 241000713834 Avian myelocytomatosis virus 29 Species 0.000 description 1
- 208000032800 BCR-ABL1 positive blast phase chronic myelogenous leukemia Diseases 0.000 description 1
- 206010005003 Bladder cancer Diseases 0.000 description 1
- 206010005949 Bone cancer Diseases 0.000 description 1
- 206010061728 Bone lesion Diseases 0.000 description 1
- 241000283690 Bos taurus Species 0.000 description 1
- 208000023611 Burkitt leukaemia Diseases 0.000 description 1
- 208000011691 Burkitt lymphomas Diseases 0.000 description 1
- COVZYZSDYWQREU-UHFFFAOYSA-N Busulfan Chemical compound CS(=O)(=O)OCCCCOS(C)(=O)=O COVZYZSDYWQREU-UHFFFAOYSA-N 0.000 description 1
- 239000002126 C01EB10 - Adenosine Substances 0.000 description 1
- 102100024217 CAMPATH-1 antigen Human genes 0.000 description 1
- 102100024263 CD160 antigen Human genes 0.000 description 1
- 101710185679 CD276 antigen Proteins 0.000 description 1
- 102100032937 CD40 ligand Human genes 0.000 description 1
- 108010065524 CD52 Antigen Proteins 0.000 description 1
- 210000001266 CD8-positive T-lymphocyte Anatomy 0.000 description 1
- 102100037904 CD9 antigen Human genes 0.000 description 1
- 101100510617 Caenorhabditis elegans sel-8 gene Proteins 0.000 description 1
- 101100421200 Caenorhabditis elegans sep-1 gene Proteins 0.000 description 1
- 102100025570 Cancer/testis antigen 1 Human genes 0.000 description 1
- 241000282465 Canis Species 0.000 description 1
- 241000283707 Capra Species 0.000 description 1
- 102100025466 Carcinoembryonic antigen-related cell adhesion molecule 3 Human genes 0.000 description 1
- 108010078791 Carrier Proteins Proteins 0.000 description 1
- 241000700199 Cavia porcellus Species 0.000 description 1
- 102000000844 Cell Surface Receptors Human genes 0.000 description 1
- 108010001857 Cell Surface Receptors Proteins 0.000 description 1
- 206010057248 Cell death Diseases 0.000 description 1
- 206010008342 Cervix carcinoma Diseases 0.000 description 1
- 201000006082 Chickenpox Diseases 0.000 description 1
- 241001217856 Chimpanzee adenovirus Species 0.000 description 1
- 241001227713 Chiron Species 0.000 description 1
- 108020004705 Codon Proteins 0.000 description 1
- 108010047041 Complementarity Determining Regions Proteins 0.000 description 1
- 108091035707 Consensus sequence Proteins 0.000 description 1
- 208000034656 Contusions Diseases 0.000 description 1
- AMRLSQGGERHDHJ-FXQIFTODSA-N Cys-Ala-Arg Chemical compound [H]N[C@@H](CS)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O AMRLSQGGERHDHJ-FXQIFTODSA-N 0.000 description 1
- QLCPDGRAEJSYQM-LPEHRKFASA-N Cys-Arg-Pro Chemical compound C1C[C@@H](N(C1)C(=O)[C@H](CCCN=C(N)N)NC(=O)[C@H](CS)N)C(=O)O QLCPDGRAEJSYQM-LPEHRKFASA-N 0.000 description 1
- UXIYYUMGFNSGBK-XPUUQOCRSA-N Cys-Gly-Val Chemical compound [H]N[C@@H](CS)C(=O)NCC(=O)N[C@@H](C(C)C)C(O)=O UXIYYUMGFNSGBK-XPUUQOCRSA-N 0.000 description 1
- BCWIFCLVCRAIQK-ZLUOBGJFSA-N Cys-Ser-Cys Chemical compound C([C@@H](C(=O)N[C@@H](CS)C(=O)O)NC(=O)[C@H](CS)N)O BCWIFCLVCRAIQK-ZLUOBGJFSA-N 0.000 description 1
- FBPFZTCFMRRESA-KVTDHHQDSA-N D-Mannitol Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-KVTDHHQDSA-N 0.000 description 1
- HMFHBZSHGGEWLO-SOOFDHNKSA-N D-ribofuranose Chemical group OC[C@H]1OC(O)[C@H](O)[C@@H]1O HMFHBZSHGGEWLO-SOOFDHNKSA-N 0.000 description 1
- 102000012410 DNA Ligases Human genes 0.000 description 1
- 108010061982 DNA Ligases Proteins 0.000 description 1
- 108010041986 DNA Vaccines Proteins 0.000 description 1
- 230000006820 DNA synthesis Effects 0.000 description 1
- 229940021995 DNA vaccine Drugs 0.000 description 1
- 241000702421 Dependoparvovirus Species 0.000 description 1
- 208000000059 Dyspnea Diseases 0.000 description 1
- 206010013975 Dyspnoeas Diseases 0.000 description 1
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 1
- 238000008157 ELISA kit Methods 0.000 description 1
- 206010014733 Endometrial cancer Diseases 0.000 description 1
- 206010014759 Endometrial neoplasm Diseases 0.000 description 1
- 108010042407 Endonucleases Proteins 0.000 description 1
- 102000004533 Endonucleases Human genes 0.000 description 1
- 102100029727 Enteropeptidase Human genes 0.000 description 1
- 108010013369 Enteropeptidase Proteins 0.000 description 1
- 102000018651 Epithelial Cell Adhesion Molecule Human genes 0.000 description 1
- 108010066687 Epithelial Cell Adhesion Molecule Proteins 0.000 description 1
- 241000283074 Equus asinus Species 0.000 description 1
- 241000283073 Equus caballus Species 0.000 description 1
- 241000588724 Escherichia coli Species 0.000 description 1
- BFPYWIDHMRZLRN-SLHNCBLASA-N Ethinyl estradiol Chemical compound OC1=CC=C2[C@H]3CC[C@](C)([C@](CC4)(O)C#C)[C@@H]4[C@@H]3CCC2=C1 BFPYWIDHMRZLRN-SLHNCBLASA-N 0.000 description 1
- 241000713859 FBR murine osteosarcoma virus Species 0.000 description 1
- 241000282324 Felis Species 0.000 description 1
- 241000282326 Felis catus Species 0.000 description 1
- 238000012413 Fluorescence activated cell sorting analysis Methods 0.000 description 1
- GHASVSINZRGABV-UHFFFAOYSA-N Fluorouracil Chemical compound FC1=CNC(=O)NC1=O GHASVSINZRGABV-UHFFFAOYSA-N 0.000 description 1
- 206010017076 Fracture Diseases 0.000 description 1
- 101150066002 GFP gene Proteins 0.000 description 1
- 102100031351 Galectin-9 Human genes 0.000 description 1
- 101100229077 Gallus gallus GAL9 gene Proteins 0.000 description 1
- 206010061968 Gastric neoplasm Diseases 0.000 description 1
- 201000003741 Gastrointestinal carcinoma Diseases 0.000 description 1
- 108700039691 Genetic Promoter Regions Proteins 0.000 description 1
- KVYVOGYEMPEXBT-GUBZILKMSA-N Gln-Ala-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CCC(N)=O KVYVOGYEMPEXBT-GUBZILKMSA-N 0.000 description 1
- TWHDOEYLXXQYOZ-FXQIFTODSA-N Gln-Asn-Gln Chemical compound C(CC(=O)N)[C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)N[C@@H](CCC(=O)N)C(=O)O)N TWHDOEYLXXQYOZ-FXQIFTODSA-N 0.000 description 1
- JKPGHIQCHIIRMS-AVGNSLFASA-N Gln-Asp-Phe Chemical compound C1=CC=C(C=C1)C[C@@H](C(=O)O)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CCC(=O)N)N JKPGHIQCHIIRMS-AVGNSLFASA-N 0.000 description 1
- NVEASDQHBRZPSU-BQBZGAKWSA-N Gln-Gln-Gly Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(N)=O)C(=O)NCC(O)=O NVEASDQHBRZPSU-BQBZGAKWSA-N 0.000 description 1
- SNLOOPZHAQDMJG-CIUDSAMLSA-N Gln-Glu-Glu Chemical compound NC(=O)CC[C@H](N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(O)=O SNLOOPZHAQDMJG-CIUDSAMLSA-N 0.000 description 1
- KCJJFESQRXGTGC-BQBZGAKWSA-N Gln-Glu-Gly Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)NCC(O)=O KCJJFESQRXGTGC-BQBZGAKWSA-N 0.000 description 1
- CLPQUWHBWXFJOX-BQBZGAKWSA-N Gln-Gly-Gln Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)NCC(=O)N[C@@H](CCC(N)=O)C(O)=O CLPQUWHBWXFJOX-BQBZGAKWSA-N 0.000 description 1
- FGYPOQPQTUNESW-IUCAKERBSA-N Gln-Gly-Leu Chemical compound CC(C)C[C@@H](C(=O)O)NC(=O)CNC(=O)[C@H](CCC(=O)N)N FGYPOQPQTUNESW-IUCAKERBSA-N 0.000 description 1
- HSHCEAUPUPJPTE-JYJNAYRXSA-N Gln-Leu-Tyr Chemical compound CC(C)C[C@@H](C(=O)N[C@@H](CC1=CC=C(C=C1)O)C(=O)O)NC(=O)[C@H](CCC(=O)N)N HSHCEAUPUPJPTE-JYJNAYRXSA-N 0.000 description 1
- TWIAMTNJOMRDAK-GUBZILKMSA-N Gln-Lys-Asp Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(O)=O)C(O)=O TWIAMTNJOMRDAK-GUBZILKMSA-N 0.000 description 1
- ILKYYKRAULNYMS-JYJNAYRXSA-N Gln-Lys-Phe Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC1=CC=CC=C1)C(O)=O ILKYYKRAULNYMS-JYJNAYRXSA-N 0.000 description 1
- XQDGOJPVMSWZSO-SRVKXCTJSA-N Gln-Pro-Leu Chemical compound CC(C)C[C@@H](C(=O)O)NC(=O)[C@@H]1CCCN1C(=O)[C@H](CCC(=O)N)N XQDGOJPVMSWZSO-SRVKXCTJSA-N 0.000 description 1
- STHSGOZLFLFGSS-SUSMZKCASA-N Gln-Thr-Thr Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H]([C@@H](C)O)C(O)=O STHSGOZLFLFGSS-SUSMZKCASA-N 0.000 description 1
- HNAUFGBKJLTWQE-IFFSRLJSSA-N Gln-Val-Thr Chemical compound C[C@H]([C@@H](C(=O)O)NC(=O)[C@H](C(C)C)NC(=O)[C@H](CCC(=O)N)N)O HNAUFGBKJLTWQE-IFFSRLJSSA-N 0.000 description 1
- UTKICHUQEQBDGC-ACZMJKKPSA-N Glu-Ala-Cys Chemical compound C[C@@H](C(=O)N[C@@H](CS)C(=O)O)NC(=O)[C@H](CCC(=O)O)N UTKICHUQEQBDGC-ACZMJKKPSA-N 0.000 description 1
- KBKGRMNVKPSQIF-XDTLVQLUSA-N Glu-Ala-Tyr Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(O)=O KBKGRMNVKPSQIF-XDTLVQLUSA-N 0.000 description 1
- WOMUDRVDJMHTCV-DCAQKATOSA-N Glu-Arg-Arg Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O WOMUDRVDJMHTCV-DCAQKATOSA-N 0.000 description 1
- DSPQRJXOIXHOHK-WDSKDSINSA-N Glu-Asp-Gly Chemical compound OC(=O)CC[C@H](N)C(=O)N[C@@H](CC(O)=O)C(=O)NCC(O)=O DSPQRJXOIXHOHK-WDSKDSINSA-N 0.000 description 1
- SJPMNHCEWPTRBR-BQBZGAKWSA-N Glu-Glu-Gly Chemical compound OC(=O)CC[C@H](N)C(=O)N[C@@H](CCC(O)=O)C(=O)NCC(O)=O SJPMNHCEWPTRBR-BQBZGAKWSA-N 0.000 description 1
- BUAKRRKDHSSIKK-IHRRRGAJSA-N Glu-Glu-Tyr Chemical compound OC(=O)CC[C@H](N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@H](C(O)=O)CC1=CC=C(O)C=C1 BUAKRRKDHSSIKK-IHRRRGAJSA-N 0.000 description 1
- OAGVHWYIBZMWLA-YFKPBYRVSA-N Glu-Gly-Gly Chemical compound OC(=O)CC[C@H](N)C(=O)NCC(=O)NCC(O)=O OAGVHWYIBZMWLA-YFKPBYRVSA-N 0.000 description 1
- ITBHUUMCJJQUSC-LAEOZQHASA-N Glu-Ile-Gly Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)NCC(O)=O ITBHUUMCJJQUSC-LAEOZQHASA-N 0.000 description 1
- VMKCPNBBPGGQBJ-GUBZILKMSA-N Glu-Leu-Asn Chemical compound CC(C)C[C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)O)NC(=O)[C@H](CCC(=O)O)N VMKCPNBBPGGQBJ-GUBZILKMSA-N 0.000 description 1
- MWMJCGBSIORNCD-AVGNSLFASA-N Glu-Leu-Leu Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(O)=O MWMJCGBSIORNCD-AVGNSLFASA-N 0.000 description 1
- HHSKZJZWQFPSKN-AVGNSLFASA-N Glu-Tyr-Asp Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC(O)=O)C(O)=O HHSKZJZWQFPSKN-AVGNSLFASA-N 0.000 description 1
- 102000003676 Glucocorticoid Receptors Human genes 0.000 description 1
- 108090000079 Glucocorticoid Receptors Proteins 0.000 description 1
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Chemical compound OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 1
- QSDKBRMVXSWAQE-BFHQHQDPSA-N Gly-Ala-Thr Chemical compound C[C@@H](O)[C@@H](C(O)=O)NC(=O)[C@H](C)NC(=O)CN QSDKBRMVXSWAQE-BFHQHQDPSA-N 0.000 description 1
- JRDYDYXZKFNNRQ-XPUUQOCRSA-N Gly-Ala-Val Chemical compound CC(C)[C@@H](C(O)=O)NC(=O)[C@H](C)NC(=O)CN JRDYDYXZKFNNRQ-XPUUQOCRSA-N 0.000 description 1
- UPOJUWHGMDJUQZ-IUCAKERBSA-N Gly-Arg-Arg Chemical compound NC(=N)NCCC[C@H](NC(=O)CN)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O UPOJUWHGMDJUQZ-IUCAKERBSA-N 0.000 description 1
- XXGQRGQPGFYECI-WDSKDSINSA-N Gly-Cys-Glu Chemical compound NCC(=O)N[C@@H](CS)C(=O)N[C@H](C(O)=O)CCC(O)=O XXGQRGQPGFYECI-WDSKDSINSA-N 0.000 description 1
- BULIVUZUDBHKKZ-WDSKDSINSA-N Gly-Gln-Asn Chemical compound NCC(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(N)=O)C(O)=O BULIVUZUDBHKKZ-WDSKDSINSA-N 0.000 description 1
- DHDOADIPGZTAHT-YUMQZZPRSA-N Gly-Glu-Arg Chemical compound NCC(=O)N[C@@H](CCC(O)=O)C(=O)N[C@H](C(O)=O)CCCN=C(N)N DHDOADIPGZTAHT-YUMQZZPRSA-N 0.000 description 1
- CCQOOWAONKGYKQ-BYPYZUCNSA-N Gly-Gly-Ala Chemical compound OC(=O)[C@H](C)NC(=O)CNC(=O)CN CCQOOWAONKGYKQ-BYPYZUCNSA-N 0.000 description 1
- IDOGEHIWMJMAHT-BYPYZUCNSA-N Gly-Gly-Cys Chemical compound NCC(=O)NCC(=O)N[C@@H](CS)C(O)=O IDOGEHIWMJMAHT-BYPYZUCNSA-N 0.000 description 1
- QITBQGJOXQYMOA-ZETCQYMHSA-N Gly-Gly-Lys Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)CNC(=O)CN QITBQGJOXQYMOA-ZETCQYMHSA-N 0.000 description 1
- VAXIVIPMCTYSHI-YUMQZZPRSA-N Gly-His-Asp Chemical compound C1=C(NC=N1)C[C@@H](C(=O)N[C@@H](CC(=O)O)C(=O)O)NC(=O)CN VAXIVIPMCTYSHI-YUMQZZPRSA-N 0.000 description 1
- YTSVAIMKVLZUDU-YUMQZZPRSA-N Gly-Leu-Asp Chemical compound [H]NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(O)=O)C(O)=O YTSVAIMKVLZUDU-YUMQZZPRSA-N 0.000 description 1
- NNCSJUBVFBDDLC-YUMQZZPRSA-N Gly-Leu-Ser Chemical compound NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(O)=O NNCSJUBVFBDDLC-YUMQZZPRSA-N 0.000 description 1
- PDUHNKAFQXQNLH-ZETCQYMHSA-N Gly-Lys-Gly Chemical compound NCCCC[C@H](NC(=O)CN)C(=O)NCC(O)=O PDUHNKAFQXQNLH-ZETCQYMHSA-N 0.000 description 1
- WDEHMRNSGHVNOH-VHSXEESVSA-N Gly-Lys-Pro Chemical compound C1C[C@@H](N(C1)C(=O)[C@H](CCCCN)NC(=O)CN)C(=O)O WDEHMRNSGHVNOH-VHSXEESVSA-N 0.000 description 1
- ZWRDOVYMQAAISL-UWVGGRQHSA-N Gly-Met-Lys Chemical compound CSCC[C@H](NC(=O)CN)C(=O)N[C@H](C(O)=O)CCCCN ZWRDOVYMQAAISL-UWVGGRQHSA-N 0.000 description 1
- WDXLKVQATNEAJQ-BQBZGAKWSA-N Gly-Pro-Asp Chemical compound NCC(=O)N1CCC[C@H]1C(=O)N[C@@H](CC(O)=O)C(O)=O WDXLKVQATNEAJQ-BQBZGAKWSA-N 0.000 description 1
- JJGBXTYGTKWGAT-YUMQZZPRSA-N Gly-Pro-Glu Chemical compound NCC(=O)N1CCC[C@H]1C(=O)N[C@@H](CCC(O)=O)C(O)=O JJGBXTYGTKWGAT-YUMQZZPRSA-N 0.000 description 1
- ZZWUYQXMIFTIIY-WEDXCCLWSA-N Gly-Thr-Leu Chemical compound [H]NCC(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(C)C)C(O)=O ZZWUYQXMIFTIIY-WEDXCCLWSA-N 0.000 description 1
- AFMOTCMSEBITOE-YEPSODPASA-N Gly-Val-Thr Chemical compound NCC(=O)N[C@@H](C(C)C)C(=O)N[C@@H]([C@@H](C)O)C(O)=O AFMOTCMSEBITOE-YEPSODPASA-N 0.000 description 1
- 239000004471 Glycine Substances 0.000 description 1
- 108010017080 Granulocyte Colony-Stimulating Factor Proteins 0.000 description 1
- 102000004269 Granulocyte Colony-Stimulating Factor Human genes 0.000 description 1
- 208000012766 Growth delay Diseases 0.000 description 1
- 206010066476 Haematological malignancy Diseases 0.000 description 1
- 102100029360 Hematopoietic cell signal transducer Human genes 0.000 description 1
- 206010019695 Hepatic neoplasm Diseases 0.000 description 1
- 206010019842 Hepatomegaly Diseases 0.000 description 1
- 102100026122 High affinity immunoglobulin gamma Fc receptor I Human genes 0.000 description 1
- LSQHWKPPOFDHHZ-YUMQZZPRSA-N His-Asp-Gly Chemical compound C1=C(NC=N1)C[C@@H](C(=O)N[C@@H](CC(=O)O)C(=O)NCC(=O)O)N LSQHWKPPOFDHHZ-YUMQZZPRSA-N 0.000 description 1
- NQKRILCJYCASDV-QWRGUYRKSA-N His-Gly-Lys Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)CNC(=O)[C@@H](N)CC1=CN=CN1 NQKRILCJYCASDV-QWRGUYRKSA-N 0.000 description 1
- NKRWVZQTPXPNRZ-SRVKXCTJSA-N His-Met-Gln Chemical compound NC(=O)CC[C@@H](C(O)=O)NC(=O)[C@H](CCSC)NC(=O)[C@@H](N)CC1=CN=CN1 NKRWVZQTPXPNRZ-SRVKXCTJSA-N 0.000 description 1
- VDHOMPFVSABJKU-ULQDDVLXSA-N His-Phe-Val Chemical compound CC(C)[C@@H](C(=O)O)NC(=O)[C@H](CC1=CC=CC=C1)NC(=O)[C@H](CC2=CN=CN2)N VDHOMPFVSABJKU-ULQDDVLXSA-N 0.000 description 1
- PZAJPILZRFPYJJ-SRVKXCTJSA-N His-Ser-Leu Chemical compound [H]N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(O)=O PZAJPILZRFPYJJ-SRVKXCTJSA-N 0.000 description 1
- FCPSGEVYIVXPPO-QTKMDUPCSA-N His-Thr-Arg Chemical compound [H]N[C@@H](CC1=CNC=N1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O FCPSGEVYIVXPPO-QTKMDUPCSA-N 0.000 description 1
- 241000282412 Homo Species 0.000 description 1
- 101000777636 Homo sapiens ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1 Proteins 0.000 description 1
- 101001022185 Homo sapiens Alpha-(1,3)-fucosyltransferase 4 Proteins 0.000 description 1
- 101000761938 Homo sapiens CD160 antigen Proteins 0.000 description 1
- 101000738354 Homo sapiens CD9 antigen Proteins 0.000 description 1
- 101000856237 Homo sapiens Cancer/testis antigen 1 Proteins 0.000 description 1
- 101000914337 Homo sapiens Carcinoembryonic antigen-related cell adhesion molecule 3 Proteins 0.000 description 1
- 101000990188 Homo sapiens Hematopoietic cell signal transducer Proteins 0.000 description 1
- 101000913074 Homo sapiens High affinity immunoglobulin gamma Fc receptor I Proteins 0.000 description 1
- 101000976075 Homo sapiens Insulin Proteins 0.000 description 1
- 101001046686 Homo sapiens Integrin alpha-M Proteins 0.000 description 1
- 101000777628 Homo sapiens Leukocyte antigen CD37 Proteins 0.000 description 1
- 101001138062 Homo sapiens Leukocyte-associated immunoglobulin-like receptor 1 Proteins 0.000 description 1
- 101001012157 Homo sapiens Receptor tyrosine-protein kinase erbB-2 Proteins 0.000 description 1
- 101000738771 Homo sapiens Receptor-type tyrosine-protein phosphatase C Proteins 0.000 description 1
- 101000934341 Homo sapiens T-cell surface glycoprotein CD5 Proteins 0.000 description 1
- 101000611183 Homo sapiens Tumor necrosis factor Proteins 0.000 description 1
- 101000801234 Homo sapiens Tumor necrosis factor receptor superfamily member 18 Proteins 0.000 description 1
- 241000598436 Human T-cell lymphotropic virus Species 0.000 description 1
- 241000725303 Human immunodeficiency virus Species 0.000 description 1
- 241000701806 Human papillomavirus Species 0.000 description 1
- DOMWKUIIPQCAJU-LJHIYBGHSA-N Hydroxyprogesterone caproate Chemical compound C1CC2=CC(=O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@@](C(C)=O)(OC(=O)CCCCC)[C@@]1(C)CC2 DOMWKUIIPQCAJU-LJHIYBGHSA-N 0.000 description 1
- 208000037147 Hypercalcaemia Diseases 0.000 description 1
- 206010062767 Hypophysitis Diseases 0.000 description 1
- 108010091358 Hypoxanthine Phosphoribosyltransferase Proteins 0.000 description 1
- 102100029098 Hypoxanthine-guanine phosphoribosyltransferase Human genes 0.000 description 1
- 102100034980 ICOS ligand Human genes 0.000 description 1
- 101710093458 ICOS ligand Proteins 0.000 description 1
- HDOYNXLPTRQLAD-JBDRJPRFSA-N Ile-Ala-Ser Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](C)C(=O)N[C@@H](CO)C(=O)O)N HDOYNXLPTRQLAD-JBDRJPRFSA-N 0.000 description 1
- LWWILHPVAKKLQS-QXEWZRGKSA-N Ile-Gly-Met Chemical compound CC[C@H](C)[C@@H](C(=O)NCC(=O)N[C@@H](CCSC)C(=O)O)N LWWILHPVAKKLQS-QXEWZRGKSA-N 0.000 description 1
- UIEZQYNXCYHMQS-BJDJZHNGSA-N Ile-Lys-Ala Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(=O)O)N UIEZQYNXCYHMQS-BJDJZHNGSA-N 0.000 description 1
- NZGTYCMLUGYMCV-XUXIUFHCSA-N Ile-Lys-Arg Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCN=C(N)N)C(=O)O)N NZGTYCMLUGYMCV-XUXIUFHCSA-N 0.000 description 1
- UOPBQSJRBONRON-STECZYCISA-N Ile-Met-Tyr Chemical compound CC[C@H](C)[C@H](N)C(=O)N[C@@H](CCSC)C(=O)N[C@H](C(O)=O)CC1=CC=C(O)C=C1 UOPBQSJRBONRON-STECZYCISA-N 0.000 description 1
- SAEWJTCJQVZQNZ-IUKAMOBKSA-N Ile-Thr-Asn Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(=O)N)C(=O)O)N SAEWJTCJQVZQNZ-IUKAMOBKSA-N 0.000 description 1
- RKQAYOWLSFLJEE-SVSWQMSJSA-N Ile-Thr-Cys Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CS)C(=O)O)N RKQAYOWLSFLJEE-SVSWQMSJSA-N 0.000 description 1
- 206010061598 Immunodeficiency Diseases 0.000 description 1
- 208000029462 Immunodeficiency disease Diseases 0.000 description 1
- 102000018071 Immunoglobulin Fc Fragments Human genes 0.000 description 1
- 108010091135 Immunoglobulin Fc Fragments Proteins 0.000 description 1
- 108700005091 Immunoglobulin Genes Proteins 0.000 description 1
- 102000012745 Immunoglobulin Subunits Human genes 0.000 description 1
- 108010079585 Immunoglobulin Subunits Proteins 0.000 description 1
- 108010067060 Immunoglobulin Variable Region Proteins 0.000 description 1
- 102000017727 Immunoglobulin Variable Region Human genes 0.000 description 1
- 206010062016 Immunosuppression Diseases 0.000 description 1
- 102000037984 Inhibitory immune checkpoint proteins Human genes 0.000 description 1
- 108091008026 Inhibitory immune checkpoint proteins Proteins 0.000 description 1
- 102100022338 Integrin alpha-M Human genes 0.000 description 1
- 102000006992 Interferon-alpha Human genes 0.000 description 1
- 108010047761 Interferon-alpha Proteins 0.000 description 1
- 102000004551 Interleukin-10 Receptors Human genes 0.000 description 1
- 108010017550 Interleukin-10 Receptors Proteins 0.000 description 1
- 102000003812 Interleukin-15 Human genes 0.000 description 1
- 108090000172 Interleukin-15 Proteins 0.000 description 1
- 102000000646 Interleukin-3 Human genes 0.000 description 1
- 108010002616 Interleukin-5 Proteins 0.000 description 1
- 102000000743 Interleukin-5 Human genes 0.000 description 1
- 102000002698 KIR Receptors Human genes 0.000 description 1
- XUJNEKJLAYXESH-REOHCLBHSA-N L-Cysteine Chemical compound SC[C@H](N)C(O)=O XUJNEKJLAYXESH-REOHCLBHSA-N 0.000 description 1
- AHLPHDHHMVZTML-BYPYZUCNSA-N L-Ornithine Chemical compound NCCC[C@H](N)C(O)=O AHLPHDHHMVZTML-BYPYZUCNSA-N 0.000 description 1
- ONIBWKKTOPOVIA-BYPYZUCNSA-N L-Proline Chemical compound OC(=O)[C@@H]1CCCN1 ONIBWKKTOPOVIA-BYPYZUCNSA-N 0.000 description 1
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 1
- ZGUNAGUHMKGQNY-ZETCQYMHSA-N L-alpha-phenylglycine zwitterion Chemical compound OC(=O)[C@@H](N)C1=CC=CC=C1 ZGUNAGUHMKGQNY-ZETCQYMHSA-N 0.000 description 1
- 150000008575 L-amino acids Chemical class 0.000 description 1
- ODKSFYDXXFIFQN-BYPYZUCNSA-P L-argininium(2+) Chemical compound NC(=[NH2+])NCCC[C@H]([NH3+])C(O)=O ODKSFYDXXFIFQN-BYPYZUCNSA-P 0.000 description 1
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 1
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 description 1
- HNDVDQJCIGZPNO-YFKPBYRVSA-N L-histidine Chemical compound OC(=O)[C@@H](N)CC1=CN=CN1 HNDVDQJCIGZPNO-YFKPBYRVSA-N 0.000 description 1
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 description 1
- SENJXOPIZNYLHU-UHFFFAOYSA-N L-leucyl-L-arginine Natural products CC(C)CC(N)C(=O)NC(C(O)=O)CCCN=C(N)N SENJXOPIZNYLHU-UHFFFAOYSA-N 0.000 description 1
- KDXKERNSBIXSRK-YFKPBYRVSA-N L-lysine Chemical compound NCCCC[C@H](N)C(O)=O KDXKERNSBIXSRK-YFKPBYRVSA-N 0.000 description 1
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 1
- FBOZXECLQNJBKD-ZDUSSCGKSA-N L-methotrexate Chemical compound C=1N=C2N=C(N)N=C(N)C2=NC=1CN(C)C1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 FBOZXECLQNJBKD-ZDUSSCGKSA-N 0.000 description 1
- LRQKBLKVPFOOQJ-YFKPBYRVSA-N L-norleucine Chemical compound CCCC[C@H]([NH3+])C([O-])=O LRQKBLKVPFOOQJ-YFKPBYRVSA-N 0.000 description 1
- AYFVYJQAPQTCCC-GBXIJSLDSA-N L-threonine Chemical compound C[C@@H](O)[C@H](N)C(O)=O AYFVYJQAPQTCCC-GBXIJSLDSA-N 0.000 description 1
- IBMVEYRWAWIOTN-RWMBFGLXSA-N Leu-Arg-Pro Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](CCCN=C(N)N)C(=O)N1CCC[C@@H]1C(O)=O IBMVEYRWAWIOTN-RWMBFGLXSA-N 0.000 description 1
- UCOCBWDBHCUPQP-DCAQKATOSA-N Leu-Arg-Ser Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CO)C(O)=O UCOCBWDBHCUPQP-DCAQKATOSA-N 0.000 description 1
- JKGHDYGZRDWHGA-SRVKXCTJSA-N Leu-Asn-Leu Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(O)=O JKGHDYGZRDWHGA-SRVKXCTJSA-N 0.000 description 1
- JQSXWJXBASFONF-KKUMJFAQSA-N Leu-Asp-Phe Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(O)=O JQSXWJXBASFONF-KKUMJFAQSA-N 0.000 description 1
- FQZPTCNSNPWHLJ-AVGNSLFASA-N Leu-Gln-Lys Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCCN)C(O)=O FQZPTCNSNPWHLJ-AVGNSLFASA-N 0.000 description 1
- BABSVXFGKFLIGW-UWVGGRQHSA-N Leu-Gly-Arg Chemical compound CC(C)C[C@H](N)C(=O)NCC(=O)N[C@H](C(O)=O)CCCNC(N)=N BABSVXFGKFLIGW-UWVGGRQHSA-N 0.000 description 1
- MPSBSKHOWJQHBS-IHRRRGAJSA-N Leu-His-Met Chemical compound CC(C)C[C@@H](C(=O)N[C@@H](CC1=CN=CN1)C(=O)N[C@@H](CCSC)C(=O)O)N MPSBSKHOWJQHBS-IHRRRGAJSA-N 0.000 description 1
- HRTRLSRYZZKPCO-BJDJZHNGSA-N Leu-Ile-Ser Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CO)C(O)=O HRTRLSRYZZKPCO-BJDJZHNGSA-N 0.000 description 1
- DSFYPIUSAMSERP-IHRRRGAJSA-N Leu-Leu-Arg Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@H](C(O)=O)CCCN=C(N)N DSFYPIUSAMSERP-IHRRRGAJSA-N 0.000 description 1
- UCNNZELZXFXXJQ-BZSNNMDCSA-N Leu-Leu-Tyr Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@H](C(O)=O)CC1=CC=C(O)C=C1 UCNNZELZXFXXJQ-BZSNNMDCSA-N 0.000 description 1
- KZZCOWMDDXDKSS-CIUDSAMLSA-N Leu-Ser-Asn Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(O)=O KZZCOWMDDXDKSS-CIUDSAMLSA-N 0.000 description 1
- XOWMDXHFSBCAKQ-SRVKXCTJSA-N Leu-Ser-Leu Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](CO)C(=O)N[C@H](C(O)=O)CC(C)C XOWMDXHFSBCAKQ-SRVKXCTJSA-N 0.000 description 1
- SXOFUVGLPHCPRQ-KKUMJFAQSA-N Leu-Tyr-Cys Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CS)C(O)=O SXOFUVGLPHCPRQ-KKUMJFAQSA-N 0.000 description 1
- VHTIZYYHIUHMCA-JYJNAYRXSA-N Leu-Tyr-Gln Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CCC(N)=O)C(O)=O VHTIZYYHIUHMCA-JYJNAYRXSA-N 0.000 description 1
- VKVDRTGWLVZJOM-DCAQKATOSA-N Leu-Val-Ser Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CO)C(O)=O VKVDRTGWLVZJOM-DCAQKATOSA-N 0.000 description 1
- 101710201625 Leucine-rich protein Proteins 0.000 description 1
- 102100031586 Leukocyte antigen CD37 Human genes 0.000 description 1
- 102100020943 Leukocyte-associated immunoglobulin-like receptor 1 Human genes 0.000 description 1
- 108010000817 Leuprolide Proteins 0.000 description 1
- 241000186781 Listeria Species 0.000 description 1
- 206010058467 Lung neoplasm malignant Diseases 0.000 description 1
- 208000030289 Lymphoproliferative disease Diseases 0.000 description 1
- NFLFJGGKOHYZJF-BJDJZHNGSA-N Lys-Ala-Ile Chemical compound CC[C@H](C)[C@@H](C(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CCCCN NFLFJGGKOHYZJF-BJDJZHNGSA-N 0.000 description 1
- NCTDKZKNBDZDOL-GARJFASQSA-N Lys-Asn-Pro Chemical compound C1C[C@@H](N(C1)C(=O)[C@H](CC(=O)N)NC(=O)[C@H](CCCCN)N)C(=O)O NCTDKZKNBDZDOL-GARJFASQSA-N 0.000 description 1
- KWUKZRFFKPLUPE-HJGDQZAQSA-N Lys-Asp-Thr Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H]([C@@H](C)O)C(O)=O KWUKZRFFKPLUPE-HJGDQZAQSA-N 0.000 description 1
- MQMIRLVJXQNTRJ-SDDRHHMPSA-N Lys-Gln-Pro Chemical compound C1C[C@@H](N(C1)C(=O)[C@H](CCC(=O)N)NC(=O)[C@H](CCCCN)N)C(=O)O MQMIRLVJXQNTRJ-SDDRHHMPSA-N 0.000 description 1
- UETQMSASAVBGJY-QWRGUYRKSA-N Lys-Gly-His Chemical compound NCCCC[C@H](N)C(=O)NCC(=O)N[C@H](C(O)=O)CC1=CNC=N1 UETQMSASAVBGJY-QWRGUYRKSA-N 0.000 description 1
- AIRZWUMAHCDDHR-KKUMJFAQSA-N Lys-Leu-Leu Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(O)=O AIRZWUMAHCDDHR-KKUMJFAQSA-N 0.000 description 1
- HVAUKHLDSDDROB-KKUMJFAQSA-N Lys-Lys-Leu Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(O)=O HVAUKHLDSDDROB-KKUMJFAQSA-N 0.000 description 1
- URGPVYGVWLIRGT-DCAQKATOSA-N Lys-Met-Ala Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](C)C(O)=O URGPVYGVWLIRGT-DCAQKATOSA-N 0.000 description 1
- AFLBTVGQCQLOFJ-AVGNSLFASA-N Lys-Pro-Arg Chemical compound NCCCC[C@H](N)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCN=C(N)N)C(O)=O AFLBTVGQCQLOFJ-AVGNSLFASA-N 0.000 description 1
- LOGFVTREOLYCPF-RHYQMDGZSA-N Lys-Pro-Thr Chemical compound C[C@@H](O)[C@@H](C(O)=O)NC(=O)[C@@H]1CCCN1C(=O)[C@@H](N)CCCCN LOGFVTREOLYCPF-RHYQMDGZSA-N 0.000 description 1
- 108091054437 MHC class I family Proteins 0.000 description 1
- 102000043129 MHC class I family Human genes 0.000 description 1
- 108091054438 MHC class II family Proteins 0.000 description 1
- 102000043131 MHC class II family Human genes 0.000 description 1
- FYYHWMGAXLPEAU-UHFFFAOYSA-N Magnesium Chemical compound [Mg] FYYHWMGAXLPEAU-UHFFFAOYSA-N 0.000 description 1
- 108700018351 Major Histocompatibility Complex Proteins 0.000 description 1
- PEEHTFAAVSWFBL-UHFFFAOYSA-N Maleimide Chemical compound O=C1NC(=O)C=C1 PEEHTFAAVSWFBL-UHFFFAOYSA-N 0.000 description 1
- 229930195725 Mannitol Natural products 0.000 description 1
- 208000025205 Mantle-Cell Lymphoma Diseases 0.000 description 1
- 102000018697 Membrane Proteins Human genes 0.000 description 1
- ONGCSGVHCSAATF-CIUDSAMLSA-N Met-Ala-Glu Chemical compound CSCC[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@H](C(O)=O)CCC(O)=O ONGCSGVHCSAATF-CIUDSAMLSA-N 0.000 description 1
- ZAJNRWKGHWGPDQ-SDDRHHMPSA-N Met-Arg-Pro Chemical compound CSCC[C@@H](C(=O)N[C@@H](CCCN=C(N)N)C(=O)N1CCC[C@@H]1C(=O)O)N ZAJNRWKGHWGPDQ-SDDRHHMPSA-N 0.000 description 1
- PNDCUTDWYVKBHX-IHRRRGAJSA-N Met-Asp-Tyr Chemical compound CSCC[C@H](N)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@H](C(O)=O)CC1=CC=C(O)C=C1 PNDCUTDWYVKBHX-IHRRRGAJSA-N 0.000 description 1
- YLLWCSDBVGZLOW-CIUDSAMLSA-N Met-Gln-Ala Chemical compound [H]N[C@@H](CCSC)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](C)C(O)=O YLLWCSDBVGZLOW-CIUDSAMLSA-N 0.000 description 1
- AXHNAGAYRGCDLG-UWVGGRQHSA-N Met-Lys-Gly Chemical compound CSCC[C@H](N)C(=O)N[C@@H](CCCCN)C(=O)NCC(O)=O AXHNAGAYRGCDLG-UWVGGRQHSA-N 0.000 description 1
- ATBJCCFCJXCNGZ-UFYCRDLUSA-N Met-Tyr-Phe Chemical compound C([C@H](NC(=O)[C@@H](N)CCSC)C(=O)N[C@@H](CC=1C=CC=CC=1)C(O)=O)C1=CC=C(O)C=C1 ATBJCCFCJXCNGZ-UFYCRDLUSA-N 0.000 description 1
- 208000029725 Metabolic bone disease Diseases 0.000 description 1
- 241000500121 Mirax Species 0.000 description 1
- 241000713869 Moloney murine leukemia virus Species 0.000 description 1
- 101100425828 Mus musculus Tpbg gene Proteins 0.000 description 1
- 101000597780 Mus musculus Tumor necrosis factor ligand superfamily member 18 Proteins 0.000 description 1
- 208000002231 Muscle Neoplasms Diseases 0.000 description 1
- 201000003793 Myelodysplastic syndrome Diseases 0.000 description 1
- 208000014767 Myeloproliferative disease Diseases 0.000 description 1
- PESQCPHRXOFIPX-UHFFFAOYSA-N N-L-methionyl-L-tyrosine Natural products CSCCC(N)C(=O)NC(C(O)=O)CC1=CC=C(O)C=C1 PESQCPHRXOFIPX-UHFFFAOYSA-N 0.000 description 1
- KZNQNBZMBZJQJO-UHFFFAOYSA-N N-glycyl-L-proline Natural products NCC(=O)N1CCCC1C(O)=O KZNQNBZMBZJQJO-UHFFFAOYSA-N 0.000 description 1
- 108700019961 Neoplasm Genes Proteins 0.000 description 1
- 102000048850 Neoplasm Genes Human genes 0.000 description 1
- 206010029098 Neoplasm skin Diseases 0.000 description 1
- 206010058116 Nephrogenic anaemia Diseases 0.000 description 1
- 101100068676 Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) gln-1 gene Proteins 0.000 description 1
- 206010029783 Normochromic normocytic anaemia Diseases 0.000 description 1
- 101710163270 Nuclease Proteins 0.000 description 1
- 108091028043 Nucleic acid sequence Proteins 0.000 description 1
- 206010030155 Oesophageal carcinoma Diseases 0.000 description 1
- 108020005187 Oligonucleotide Probes Proteins 0.000 description 1
- 108010038807 Oligopeptides Proteins 0.000 description 1
- 102000015636 Oligopeptides Human genes 0.000 description 1
- 102000004140 Oncostatin M Human genes 0.000 description 1
- 108090000630 Oncostatin M Proteins 0.000 description 1
- AHLPHDHHMVZTML-UHFFFAOYSA-N Orn-delta-NH2 Natural products NCCCC(N)C(O)=O AHLPHDHHMVZTML-UHFFFAOYSA-N 0.000 description 1
- UTJLXEIPEHZYQJ-UHFFFAOYSA-N Ornithine Natural products OC(=O)C(C)CCCN UTJLXEIPEHZYQJ-UHFFFAOYSA-N 0.000 description 1
- 206010049088 Osteopenia Diseases 0.000 description 1
- 229910019142 PO4 Chemical group 0.000 description 1
- 229930012538 Paclitaxel Natural products 0.000 description 1
- 241001494479 Pecora Species 0.000 description 1
- 102000057297 Pepsin A Human genes 0.000 description 1
- 108090000284 Pepsin A Proteins 0.000 description 1
- 102000010292 Peptide Elongation Factor 1 Human genes 0.000 description 1
- 108010077524 Peptide Elongation Factor 1 Proteins 0.000 description 1
- 241000009328 Perro Species 0.000 description 1
- MDHZEOMXGNBSIL-DLOVCJGASA-N Phe-Ala-Cys Chemical compound C[C@@H](C(=O)N[C@@H](CS)C(=O)O)NC(=O)[C@H](CC1=CC=CC=C1)N MDHZEOMXGNBSIL-DLOVCJGASA-N 0.000 description 1
- NOFBJKKOPKJDCO-KKXDTOCCSA-N Phe-Ala-Tyr Chemical compound [H]N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](C)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(O)=O NOFBJKKOPKJDCO-KKXDTOCCSA-N 0.000 description 1
- NAXPHWZXEXNDIW-JTQLQIEISA-N Phe-Gly-Gly Chemical compound OC(=O)CNC(=O)CNC(=O)[C@@H](N)CC1=CC=CC=C1 NAXPHWZXEXNDIW-JTQLQIEISA-N 0.000 description 1
- OSBADCBXAMSPQD-YESZJQIVSA-N Phe-Leu-Pro Chemical compound CC(C)C[C@@H](C(=O)N1CCC[C@@H]1C(=O)O)NC(=O)[C@H](CC2=CC=CC=C2)N OSBADCBXAMSPQD-YESZJQIVSA-N 0.000 description 1
- IEOHQGFKHXUALJ-JYJNAYRXSA-N Phe-Met-Arg Chemical compound [H]N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O IEOHQGFKHXUALJ-JYJNAYRXSA-N 0.000 description 1
- QARPMYDMYVLFMW-KKUMJFAQSA-N Phe-Pro-Glu Chemical compound C([C@H](N)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCC(O)=O)C(O)=O)C1=CC=CC=C1 QARPMYDMYVLFMW-KKUMJFAQSA-N 0.000 description 1
- ILGCZYGFYQLSDZ-KKUMJFAQSA-N Phe-Ser-His Chemical compound N[C@@H](Cc1ccccc1)C(=O)N[C@@H](CO)C(=O)N[C@@H](Cc1cnc[nH]1)C(O)=O ILGCZYGFYQLSDZ-KKUMJFAQSA-N 0.000 description 1
- VIIRRNQMMIHYHQ-XHSDSOJGSA-N Phe-Val-Pro Chemical compound CC(C)[C@@H](C(=O)N1CCC[C@@H]1C(=O)O)NC(=O)[C@H](CC2=CC=CC=C2)N VIIRRNQMMIHYHQ-XHSDSOJGSA-N 0.000 description 1
- 208000002151 Pleural effusion Diseases 0.000 description 1
- 102100029740 Poliovirus receptor Human genes 0.000 description 1
- DZZCICYRSZASNF-FXQIFTODSA-N Pro-Ala-Ala Chemical compound OC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@@H]1CCCN1 DZZCICYRSZASNF-FXQIFTODSA-N 0.000 description 1
- FYQSMXKJYTZYRP-DCAQKATOSA-N Pro-Ala-Lys Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H]1CCCN1 FYQSMXKJYTZYRP-DCAQKATOSA-N 0.000 description 1
- LCRSGSIRKLXZMZ-BPNCWPANSA-N Pro-Ala-Tyr Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](C)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(O)=O LCRSGSIRKLXZMZ-BPNCWPANSA-N 0.000 description 1
- HMNSRTLZAJHSIK-YUMQZZPRSA-N Pro-Arg Chemical compound NC(=N)NCCC[C@@H](C(O)=O)NC(=O)[C@@H]1CCCN1 HMNSRTLZAJHSIK-YUMQZZPRSA-N 0.000 description 1
- LNLNHXIQPGKRJQ-SRVKXCTJSA-N Pro-Arg-Arg Chemical compound NC(N)=NCCC[C@@H](C(O)=O)NC(=O)[C@H](CCCN=C(N)N)NC(=O)[C@@H]1CCCN1 LNLNHXIQPGKRJQ-SRVKXCTJSA-N 0.000 description 1
- ICTZKEXYDDZZFP-SRVKXCTJSA-N Pro-Arg-Pro Chemical compound N([C@@H](CCCN=C(N)N)C(=O)N1[C@@H](CCC1)C(O)=O)C(=O)[C@@H]1CCCN1 ICTZKEXYDDZZFP-SRVKXCTJSA-N 0.000 description 1
- KPDRZQUWJKTMBP-DCAQKATOSA-N Pro-Asp-Leu Chemical compound CC(C)C[C@@H](C(=O)O)NC(=O)[C@H](CC(=O)O)NC(=O)[C@@H]1CCCN1 KPDRZQUWJKTMBP-DCAQKATOSA-N 0.000 description 1
- LHALYDBUDCWMDY-CIUDSAMLSA-N Pro-Glu-Ala Chemical compound C[C@H](NC(=O)[C@H](CCC(O)=O)NC(=O)[C@@H]1CCCN1)C(O)=O LHALYDBUDCWMDY-CIUDSAMLSA-N 0.000 description 1
- FRKBNXCFJBPJOL-GUBZILKMSA-N Pro-Glu-Glu Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(O)=O FRKBNXCFJBPJOL-GUBZILKMSA-N 0.000 description 1
- HAAQQNHQZBOWFO-LURJTMIESA-N Pro-Gly-Gly Chemical compound OC(=O)CNC(=O)CNC(=O)[C@@H]1CCCN1 HAAQQNHQZBOWFO-LURJTMIESA-N 0.000 description 1
- FKYKZHOKDOPHSA-DCAQKATOSA-N Pro-Leu-Ser Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(O)=O FKYKZHOKDOPHSA-DCAQKATOSA-N 0.000 description 1
- JLMZKEQFMVORMA-SRVKXCTJSA-N Pro-Pro-Arg Chemical compound NC(N)=NCCC[C@@H](C(O)=O)NC(=O)[C@@H]1CCCN1C(=O)[C@H]1NCCC1 JLMZKEQFMVORMA-SRVKXCTJSA-N 0.000 description 1
- CHYAYDLYYIJCKY-OSUNSFLBSA-N Pro-Thr-Ile Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H]([C@@H](C)CC)C(O)=O CHYAYDLYYIJCKY-OSUNSFLBSA-N 0.000 description 1
- FDMCIBSQRKFSTJ-RHYQMDGZSA-N Pro-Thr-Leu Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(C)C)C(O)=O FDMCIBSQRKFSTJ-RHYQMDGZSA-N 0.000 description 1
- AIOWVDNPESPXRB-YTWAJWBKSA-N Pro-Thr-Pro Chemical compound C[C@H]([C@@H](C(=O)N1CCC[C@@H]1C(=O)O)NC(=O)[C@@H]2CCCN2)O AIOWVDNPESPXRB-YTWAJWBKSA-N 0.000 description 1
- GZNYIXWOIUFLGO-ZJDVBMNYSA-N Pro-Thr-Thr Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H]([C@@H](C)O)C(O)=O GZNYIXWOIUFLGO-ZJDVBMNYSA-N 0.000 description 1
- JXVXYRZQIUPYSA-NHCYSSNCSA-N Pro-Val-Gln Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(N)=O)C(O)=O JXVXYRZQIUPYSA-NHCYSSNCSA-N 0.000 description 1
- VDHGTOHMHHQSKG-JYJNAYRXSA-N Pro-Val-Phe Chemical compound CC(C)[C@H](NC(=O)[C@@H]1CCCN1)C(=O)N[C@@H](Cc1ccccc1)C(O)=O VDHGTOHMHHQSKG-JYJNAYRXSA-N 0.000 description 1
- 101710089372 Programmed cell death protein 1 Proteins 0.000 description 1
- ONIBWKKTOPOVIA-UHFFFAOYSA-N Proline Natural products OC(=O)C1CCCN1 ONIBWKKTOPOVIA-UHFFFAOYSA-N 0.000 description 1
- 206010060862 Prostate cancer Diseases 0.000 description 1
- 208000000236 Prostatic Neoplasms Diseases 0.000 description 1
- 102000003923 Protein Kinase C Human genes 0.000 description 1
- 108090000315 Protein Kinase C Proteins 0.000 description 1
- 102000016971 Proto-Oncogene Proteins c-kit Human genes 0.000 description 1
- 108010014608 Proto-Oncogene Proteins c-kit Proteins 0.000 description 1
- 229940022005 RNA vaccine Drugs 0.000 description 1
- 239000012979 RPMI medium Substances 0.000 description 1
- 102100030086 Receptor tyrosine-protein kinase erbB-2 Human genes 0.000 description 1
- 102100037422 Receptor-type tyrosine-protein phosphatase C Human genes 0.000 description 1
- 108020004511 Recombinant DNA Proteins 0.000 description 1
- 108091028664 Ribonucleotide Proteins 0.000 description 1
- PYMYPHUHKUWMLA-LMVFSUKVSA-N Ribose Natural products OC[C@@H](O)[C@@H](O)[C@@H](O)C=O PYMYPHUHKUWMLA-LMVFSUKVSA-N 0.000 description 1
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 1
- 206010039491 Sarcoma Diseases 0.000 description 1
- 238000012300 Sequence Analysis Methods 0.000 description 1
- QVOGDCQNGLBNCR-FXQIFTODSA-N Ser-Arg-Ser Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CO)C(O)=O QVOGDCQNGLBNCR-FXQIFTODSA-N 0.000 description 1
- WXUBSIDKNMFAGS-IHRRRGAJSA-N Ser-Arg-Tyr Chemical compound NC(N)=NCCC[C@H](NC(=O)[C@H](CO)N)C(=O)N[C@H](C(O)=O)CC1=CC=C(O)C=C1 WXUBSIDKNMFAGS-IHRRRGAJSA-N 0.000 description 1
- OBXVZEAMXFSGPU-FXQIFTODSA-N Ser-Asn-Arg Chemical compound C(C[C@@H](C(=O)O)NC(=O)[C@H](CC(=O)N)NC(=O)[C@H](CO)N)CN=C(N)N OBXVZEAMXFSGPU-FXQIFTODSA-N 0.000 description 1
- RDFQNDHEHVSONI-ZLUOBGJFSA-N Ser-Asn-Ser Chemical compound OC[C@H](N)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CO)C(O)=O RDFQNDHEHVSONI-ZLUOBGJFSA-N 0.000 description 1
- BQWCDDAISCPDQV-XHNCKOQMSA-N Ser-Gln-Pro Chemical compound C1C[C@@H](N(C1)C(=O)[C@H](CCC(=O)N)NC(=O)[C@H](CO)N)C(=O)O BQWCDDAISCPDQV-XHNCKOQMSA-N 0.000 description 1
- BRGQQXQKPUCUJQ-KBIXCLLPSA-N Ser-Glu-Ile Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H]([C@@H](C)CC)C(O)=O BRGQQXQKPUCUJQ-KBIXCLLPSA-N 0.000 description 1
- YMTLKLXDFCSCNX-BYPYZUCNSA-N Ser-Gly-Gly Chemical compound OC[C@H](N)C(=O)NCC(=O)NCC(O)=O YMTLKLXDFCSCNX-BYPYZUCNSA-N 0.000 description 1
- SFTZWNJFZYOLBD-ZDLURKLDSA-N Ser-Gly-Thr Chemical compound C[C@@H](O)[C@@H](C(O)=O)NC(=O)CNC(=O)[C@@H](N)CO SFTZWNJFZYOLBD-ZDLURKLDSA-N 0.000 description 1
- QGAHMVHBORDHDC-YUMQZZPRSA-N Ser-His-Gly Chemical compound OC[C@H](N)C(=O)N[C@H](C(=O)NCC(O)=O)CC1=CN=CN1 QGAHMVHBORDHDC-YUMQZZPRSA-N 0.000 description 1
- MOQDPPUMFSMYOM-KKUMJFAQSA-N Ser-His-Phe Chemical compound C1=CC=C(C=C1)C[C@@H](C(=O)O)NC(=O)[C@H](CC2=CN=CN2)NC(=O)[C@H](CO)N MOQDPPUMFSMYOM-KKUMJFAQSA-N 0.000 description 1
- ZUDXUJSYCCNZQJ-DCAQKATOSA-N Ser-His-Val Chemical compound CC(C)[C@@H](C(=O)O)NC(=O)[C@H](CC1=CN=CN1)NC(=O)[C@H](CO)N ZUDXUJSYCCNZQJ-DCAQKATOSA-N 0.000 description 1
- YMDNFPNTIPQMJP-NAKRPEOUSA-N Ser-Ile-Met Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCSC)C(O)=O YMDNFPNTIPQMJP-NAKRPEOUSA-N 0.000 description 1
- QYSFWUIXDFJUDW-DCAQKATOSA-N Ser-Leu-Arg Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O QYSFWUIXDFJUDW-DCAQKATOSA-N 0.000 description 1
- KQNDIKOYWZTZIX-FXQIFTODSA-N Ser-Ser-Arg Chemical compound OC[C@H](N)C(=O)N[C@@H](CO)C(=O)N[C@H](C(O)=O)CCCNC(N)=N KQNDIKOYWZTZIX-FXQIFTODSA-N 0.000 description 1
- CUXJENOFJXOSOZ-BIIVOSGPSA-N Ser-Ser-Pro Chemical compound C1C[C@@H](N(C1)C(=O)[C@H](CO)NC(=O)[C@H](CO)N)C(=O)O CUXJENOFJXOSOZ-BIIVOSGPSA-N 0.000 description 1
- XQJCEKXQUJQNNK-ZLUOBGJFSA-N Ser-Ser-Ser Chemical compound OC[C@H](N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(O)=O XQJCEKXQUJQNNK-ZLUOBGJFSA-N 0.000 description 1
- XJDMUQCLVSCRSJ-VZFHVOOUSA-N Ser-Thr-Ala Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C)C(O)=O XJDMUQCLVSCRSJ-VZFHVOOUSA-N 0.000 description 1
- NADLKBTYNKUJEP-KATARQTJSA-N Ser-Thr-Leu Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(C)C)C(O)=O NADLKBTYNKUJEP-KATARQTJSA-N 0.000 description 1
- VLMIUSLQONKLDV-HEIBUPTGSA-N Ser-Thr-Thr Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H]([C@@H](C)O)C(O)=O VLMIUSLQONKLDV-HEIBUPTGSA-N 0.000 description 1
- OQSQCUWQOIHECT-YJRXYDGGSA-N Ser-Tyr-Thr Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H]([C@@H](C)O)C(O)=O OQSQCUWQOIHECT-YJRXYDGGSA-N 0.000 description 1
- SIEBDTCABMZCLF-XGEHTFHBSA-N Ser-Val-Thr Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H]([C@@H](C)O)C(O)=O SIEBDTCABMZCLF-XGEHTFHBSA-N 0.000 description 1
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 1
- 108010071390 Serum Albumin Proteins 0.000 description 1
- 102000007562 Serum Albumin Human genes 0.000 description 1
- 102100029215 Signaling lymphocytic activation molecule Human genes 0.000 description 1
- 101710163413 Signaling lymphocytic activation molecule Proteins 0.000 description 1
- 208000004346 Smoldering Multiple Myeloma Diseases 0.000 description 1
- 206010041660 Splenomegaly Diseases 0.000 description 1
- 208000005250 Spontaneous Fractures Diseases 0.000 description 1
- 229930006000 Sucrose Natural products 0.000 description 1
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 1
- 241000282898 Sus scrofa Species 0.000 description 1
- 208000000389 T-cell leukemia Diseases 0.000 description 1
- 208000028530 T-cell lymphoblastic leukemia/lymphoma Diseases 0.000 description 1
- 102100025244 T-cell surface glycoprotein CD5 Human genes 0.000 description 1
- 206010057644 Testis cancer Diseases 0.000 description 1
- PDMMFKSKQVNJMI-BLQWBTBKSA-N Testosterone propionate Chemical compound C1CC2=CC(=O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@H](OC(=O)CC)[C@@]1(C)CC2 PDMMFKSKQVNJMI-BLQWBTBKSA-N 0.000 description 1
- DWYAUVCQDTZIJI-VZFHVOOUSA-N Thr-Ala-Ser Chemical compound C[C@@H](O)[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@@H](CO)C(O)=O DWYAUVCQDTZIJI-VZFHVOOUSA-N 0.000 description 1
- CAJFZCICSVBOJK-SHGPDSBTSA-N Thr-Ala-Thr Chemical compound C[C@@H](O)[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@@H]([C@@H](C)O)C(O)=O CAJFZCICSVBOJK-SHGPDSBTSA-N 0.000 description 1
- NFMPFBCXABPALN-OWLDWWDNSA-N Thr-Ala-Trp Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](C)C(=O)N[C@@H](CC1=CNC2=CC=CC=C21)C(=O)O)N)O NFMPFBCXABPALN-OWLDWWDNSA-N 0.000 description 1
- DGDCHPCRMWEOJR-FQPOAREZSA-N Thr-Ala-Tyr Chemical compound C[C@@H](O)[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@H](C(O)=O)CC1=CC=C(O)C=C1 DGDCHPCRMWEOJR-FQPOAREZSA-N 0.000 description 1
- TWLMXDWFVNEFFK-FJXKBIBVSA-N Thr-Arg-Gly Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)NCC(O)=O TWLMXDWFVNEFFK-FJXKBIBVSA-N 0.000 description 1
- VUVCRYXYUUPGSB-GLLZPBPUSA-N Thr-Gln-Glu Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CCC(=O)N)C(=O)N[C@@H](CCC(=O)O)C(=O)O)N)O VUVCRYXYUUPGSB-GLLZPBPUSA-N 0.000 description 1
- XOWKUMFHEZLKLT-CIQUZCHMSA-N Thr-Ile-Ala Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(O)=O XOWKUMFHEZLKLT-CIQUZCHMSA-N 0.000 description 1
- GXUWHVZYDAHFSV-FLBSBUHZSA-N Thr-Ile-Thr Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)O)C(O)=O GXUWHVZYDAHFSV-FLBSBUHZSA-N 0.000 description 1
- HOVLHEKTGVIKAP-WDCWCFNPSA-N Thr-Leu-Gln Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(O)=O HOVLHEKTGVIKAP-WDCWCFNPSA-N 0.000 description 1
- MEJHFIOYJHTWMK-VOAKCMCISA-N Thr-Leu-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](N)[C@@H](C)O MEJHFIOYJHTWMK-VOAKCMCISA-N 0.000 description 1
- ZSPQUTWLWGWTPS-HJGDQZAQSA-N Thr-Lys-Asp Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(O)=O)C(O)=O ZSPQUTWLWGWTPS-HJGDQZAQSA-N 0.000 description 1
- WNQJTLATMXYSEL-OEAJRASXSA-N Thr-Phe-Leu Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CC(C)C)C(O)=O WNQJTLATMXYSEL-OEAJRASXSA-N 0.000 description 1
- GFRIEEKFXOVPIR-RHYQMDGZSA-N Thr-Pro-Lys Chemical compound C[C@@H](O)[C@H](N)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCCN)C(O)=O GFRIEEKFXOVPIR-RHYQMDGZSA-N 0.000 description 1
- GVMXJJAJLIEASL-ZJDVBMNYSA-N Thr-Pro-Thr Chemical compound C[C@@H](O)[C@H](N)C(=O)N1CCC[C@H]1C(=O)N[C@@H]([C@@H](C)O)C(O)=O GVMXJJAJLIEASL-ZJDVBMNYSA-N 0.000 description 1
- MFMGPEKYBXFIRF-SUSMZKCASA-N Thr-Thr-Gln Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCC(N)=O)C(O)=O MFMGPEKYBXFIRF-SUSMZKCASA-N 0.000 description 1
- ZESGVALRVJIVLZ-VFCFLDTKSA-N Thr-Thr-Pro Chemical compound C[C@H]([C@@H](C(=O)N[C@@H]([C@@H](C)O)C(=O)N1CCC[C@@H]1C(=O)O)N)O ZESGVALRVJIVLZ-VFCFLDTKSA-N 0.000 description 1
- COYHRQWNJDJCNA-NUJDXYNKSA-N Thr-Thr-Thr Chemical compound C[C@@H](O)[C@H](N)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H]([C@@H](C)O)C(O)=O COYHRQWNJDJCNA-NUJDXYNKSA-N 0.000 description 1
- NJGMALCNYAMYCB-JRQIVUDYSA-N Thr-Tyr-Asn Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC(N)=O)C(O)=O NJGMALCNYAMYCB-JRQIVUDYSA-N 0.000 description 1
- BZTSQFWJNJYZSX-JRQIVUDYSA-N Thr-Tyr-Asp Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC(O)=O)C(O)=O BZTSQFWJNJYZSX-JRQIVUDYSA-N 0.000 description 1
- QGVBFDIREUUSHX-IFFSRLJSSA-N Thr-Val-Gln Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(N)=O)C(O)=O QGVBFDIREUUSHX-IFFSRLJSSA-N 0.000 description 1
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 description 1
- 239000004473 Threonine Substances 0.000 description 1
- 101710120037 Toxin CcdB Proteins 0.000 description 1
- 102000004887 Transforming Growth Factor beta Human genes 0.000 description 1
- 108090001012 Transforming Growth Factor beta Proteins 0.000 description 1
- 206010052779 Transplant rejections Diseases 0.000 description 1
- 239000007983 Tris buffer Substances 0.000 description 1
- 108060008682 Tumor Necrosis Factor Proteins 0.000 description 1
- 102100032101 Tumor necrosis factor ligand superfamily member 9 Human genes 0.000 description 1
- 102100033728 Tumor necrosis factor receptor superfamily member 18 Human genes 0.000 description 1
- DLZKEQQWXODGGZ-KWQFWETISA-N Tyr-Ala-Gly Chemical compound OC(=O)CNC(=O)[C@H](C)NC(=O)[C@@H](N)CC1=CC=C(O)C=C1 DLZKEQQWXODGGZ-KWQFWETISA-N 0.000 description 1
- PEVVXUGSAKEPEN-AVGNSLFASA-N Tyr-Asn-Glu Chemical compound [H]N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(O)=O PEVVXUGSAKEPEN-AVGNSLFASA-N 0.000 description 1
- SCCKSNREWHMKOJ-SRVKXCTJSA-N Tyr-Asn-Ser Chemical compound N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CO)C(O)=O SCCKSNREWHMKOJ-SRVKXCTJSA-N 0.000 description 1
- GAYLGYUVTDMLKC-UWJYBYFXSA-N Tyr-Asp-Ala Chemical compound OC(=O)[C@H](C)NC(=O)[C@H](CC(O)=O)NC(=O)[C@@H](N)CC1=CC=C(O)C=C1 GAYLGYUVTDMLKC-UWJYBYFXSA-N 0.000 description 1
- UABYBEBXFFNCIR-YDHLFZDLSA-N Tyr-Asp-Val Chemical compound [H]N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](C(C)C)C(O)=O UABYBEBXFFNCIR-YDHLFZDLSA-N 0.000 description 1
- FFCRCJZJARTYCG-KKUMJFAQSA-N Tyr-Cys-Lys Chemical compound C1=CC(=CC=C1C[C@@H](C(=O)N[C@@H](CS)C(=O)N[C@@H](CCCCN)C(=O)O)N)O FFCRCJZJARTYCG-KKUMJFAQSA-N 0.000 description 1
- RYSNTWVRSLCAJZ-RYUDHWBXSA-N Tyr-Gln-Gly Chemical compound OC(=O)CNC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](N)CC1=CC=C(O)C=C1 RYSNTWVRSLCAJZ-RYUDHWBXSA-N 0.000 description 1
- AZZLDIDWPZLCCW-ZEWNOJEFSA-N Tyr-Ile-Phe Chemical compound [H]N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC1=CC=CC=C1)C(O)=O AZZLDIDWPZLCCW-ZEWNOJEFSA-N 0.000 description 1
- LQGDFDYGDQEMGA-PXDAIIFMSA-N Tyr-Ile-Trp Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CC1=CNC2=CC=CC=C21)C(=O)O)NC(=O)[C@H](CC3=CC=C(C=C3)O)N LQGDFDYGDQEMGA-PXDAIIFMSA-N 0.000 description 1
- XDGPTBVOSHKDFT-KKUMJFAQSA-N Tyr-Met-Glu Chemical compound [H]N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CCC(O)=O)C(O)=O XDGPTBVOSHKDFT-KKUMJFAQSA-N 0.000 description 1
- WTTRJMAZPDHPGS-KKXDTOCCSA-N Tyr-Phe-Ala Chemical compound C[C@H](NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@@H](N)Cc1ccc(O)cc1)C(O)=O WTTRJMAZPDHPGS-KKXDTOCCSA-N 0.000 description 1
- NVZVJIUDICCMHZ-BZSNNMDCSA-N Tyr-Phe-Ser Chemical compound [H]N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CO)C(O)=O NVZVJIUDICCMHZ-BZSNNMDCSA-N 0.000 description 1
- QFXVAFIHVWXXBJ-AVGNSLFASA-N Tyr-Ser-Glu Chemical compound [H]N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(O)=O)C(O)=O QFXVAFIHVWXXBJ-AVGNSLFASA-N 0.000 description 1
- ZZDYJFVIKVSUFA-WLTAIBSBSA-N Tyr-Thr-Gly Chemical compound [H]N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H]([C@@H](C)O)C(=O)NCC(O)=O ZZDYJFVIKVSUFA-WLTAIBSBSA-N 0.000 description 1
- WQOHKVRQDLNDIL-YJRXYDGGSA-N Tyr-Thr-Ser Chemical compound [H]N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CO)C(O)=O WQOHKVRQDLNDIL-YJRXYDGGSA-N 0.000 description 1
- SMUWZUSWMWVOSL-JYJNAYRXSA-N Tyr-Val-Met Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CCSC)C(=O)O)NC(=O)[C@H](CC1=CC=C(C=C1)O)N SMUWZUSWMWVOSL-JYJNAYRXSA-N 0.000 description 1
- 208000006105 Uterine Cervical Neoplasms Diseases 0.000 description 1
- 208000002495 Uterine Neoplasms Diseases 0.000 description 1
- 108010079206 V-Set Domain-Containing T-Cell Activation Inhibitor 1 Proteins 0.000 description 1
- VJOWWOGRNXRQMF-UVBJJODRSA-N Val-Ala-Trp Chemical compound C1=CC=C2C(C[C@H](NC(=O)[C@H](C)NC(=O)[C@@H](N)C(C)C)C(O)=O)=CNC2=C1 VJOWWOGRNXRQMF-UVBJJODRSA-N 0.000 description 1
- NYTKXWLZSNRILS-IFFSRLJSSA-N Val-Gln-Thr Chemical compound C[C@H]([C@@H](C(=O)O)NC(=O)[C@H](CCC(=O)N)NC(=O)[C@H](C(C)C)N)O NYTKXWLZSNRILS-IFFSRLJSSA-N 0.000 description 1
- JVYIGCARISMLMV-HOCLYGCPSA-N Val-Gly-Trp Chemical compound CC(C)[C@@H](C(=O)NCC(=O)N[C@@H](CC1=CNC2=CC=CC=C21)C(=O)O)N JVYIGCARISMLMV-HOCLYGCPSA-N 0.000 description 1
- ZIGZPYJXIWLQFC-QTKMDUPCSA-N Val-His-Thr Chemical compound C[C@H]([C@@H](C(=O)O)NC(=O)[C@H](CC1=CN=CN1)NC(=O)[C@H](C(C)C)N)O ZIGZPYJXIWLQFC-QTKMDUPCSA-N 0.000 description 1
- APQIVBCUIUDSMB-OSUNSFLBSA-N Val-Ile-Thr Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H]([C@@H](C)O)C(=O)O)NC(=O)[C@H](C(C)C)N APQIVBCUIUDSMB-OSUNSFLBSA-N 0.000 description 1
- HPANGHISDXDUQY-ULQDDVLXSA-N Val-Lys-Phe Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)O)N HPANGHISDXDUQY-ULQDDVLXSA-N 0.000 description 1
- HJSLDXZAZGFPDK-ULQDDVLXSA-N Val-Phe-Leu Chemical compound CC(C)C[C@@H](C(=O)O)NC(=O)[C@H](CC1=CC=CC=C1)NC(=O)[C@H](C(C)C)N HJSLDXZAZGFPDK-ULQDDVLXSA-N 0.000 description 1
- QSPOLEBZTMESFY-SRVKXCTJSA-N Val-Pro-Val Chemical compound CC(C)[C@H](N)C(=O)N1CCC[C@H]1C(=O)N[C@@H](C(C)C)C(O)=O QSPOLEBZTMESFY-SRVKXCTJSA-N 0.000 description 1
- DEGUERSKQBRZMZ-FXQIFTODSA-N Val-Ser-Ala Chemical compound CC(C)[C@H](N)C(=O)N[C@@H](CO)C(=O)N[C@@H](C)C(O)=O DEGUERSKQBRZMZ-FXQIFTODSA-N 0.000 description 1
- PZTZYZUTCPZWJH-FXQIFTODSA-N Val-Ser-Ser Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)O)N PZTZYZUTCPZWJH-FXQIFTODSA-N 0.000 description 1
- LCHZBEUVGAVMKS-RHYQMDGZSA-N Val-Thr-Leu Chemical compound CC(C)C[C@H](NC(=O)[C@@H](NC(=O)[C@@H](N)C(C)C)[C@@H](C)O)C(O)=O LCHZBEUVGAVMKS-RHYQMDGZSA-N 0.000 description 1
- OFTXTCGQJXTNQS-XGEHTFHBSA-N Val-Thr-Ser Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CO)C(=O)O)NC(=O)[C@H](C(C)C)N)O OFTXTCGQJXTNQS-XGEHTFHBSA-N 0.000 description 1
- 206010046980 Varicella Diseases 0.000 description 1
- JXLYSJRDGCGARV-WWYNWVTFSA-N Vinblastine Natural products O=C(O[C@H]1[C@](O)(C(=O)OC)[C@@H]2N(C)c3c(cc(c(OC)c3)[C@]3(C(=O)OC)c4[nH]c5c(c4CCN4C[C@](O)(CC)C[C@H](C3)C4)cccc5)[C@@]32[C@H]2[C@@]1(CC)C=CCN2CC3)C JXLYSJRDGCGARV-WWYNWVTFSA-N 0.000 description 1
- 241000713325 Visna/maedi virus Species 0.000 description 1
- 206010047741 Vulval cancer Diseases 0.000 description 1
- 208000004354 Vulvar Neoplasms Diseases 0.000 description 1
- 208000027418 Wounds and injury Diseases 0.000 description 1
- 101710185494 Zinc finger protein Proteins 0.000 description 1
- 102100023597 Zinc finger protein 816 Human genes 0.000 description 1
- 210000001015 abdomen Anatomy 0.000 description 1
- 230000003187 abdominal effect Effects 0.000 description 1
- 230000009471 action Effects 0.000 description 1
- 239000013543 active substance Substances 0.000 description 1
- 230000010933 acylation Effects 0.000 description 1
- 238000005917 acylation reaction Methods 0.000 description 1
- 210000005006 adaptive immune system Anatomy 0.000 description 1
- 230000002730 additional effect Effects 0.000 description 1
- 239000000654 additive Substances 0.000 description 1
- 230000000996 additive effect Effects 0.000 description 1
- 229960005305 adenosine Drugs 0.000 description 1
- 238000011467 adoptive cell therapy Methods 0.000 description 1
- 239000003470 adrenal cortex hormone Substances 0.000 description 1
- 230000001780 adrenocortical effect Effects 0.000 description 1
- 230000032683 aging Effects 0.000 description 1
- 235000004279 alanine Nutrition 0.000 description 1
- 108010005233 alanylglutamic acid Proteins 0.000 description 1
- 229940045714 alkyl sulfonate alkylating agent Drugs 0.000 description 1
- 150000008052 alkyl sulfonates Chemical class 0.000 description 1
- 238000011316 allogeneic transplantation Methods 0.000 description 1
- HMFHBZSHGGEWLO-UHFFFAOYSA-N alpha-D-Furanose-Ribose Natural products OCC1OC(O)C(O)C1O HMFHBZSHGGEWLO-UHFFFAOYSA-N 0.000 description 1
- AZDRQVAHHNSJOQ-UHFFFAOYSA-N alumane Chemical class [AlH3] AZDRQVAHHNSJOQ-UHFFFAOYSA-N 0.000 description 1
- 229910000147 aluminium phosphate Inorganic materials 0.000 description 1
- 230000009435 amidation Effects 0.000 description 1
- 238000007112 amidation reaction Methods 0.000 description 1
- 125000003277 amino group Chemical group 0.000 description 1
- 238000012197 amplification kit Methods 0.000 description 1
- 206010002022 amyloidosis Diseases 0.000 description 1
- 239000003098 androgen Substances 0.000 description 1
- 229940030486 androgens Drugs 0.000 description 1
- 210000004102 animal cell Anatomy 0.000 description 1
- RGHILYZRVFRRNK-UHFFFAOYSA-N anthracene-1,2-dione Chemical compound C1=CC=C2C=C(C(C(=O)C=C3)=O)C3=CC2=C1 RGHILYZRVFRRNK-UHFFFAOYSA-N 0.000 description 1
- 229940045799 anthracyclines and related substance Drugs 0.000 description 1
- 230000002280 anti-androgenic effect Effects 0.000 description 1
- 229940046836 anti-estrogen Drugs 0.000 description 1
- 230000001833 anti-estrogenic effect Effects 0.000 description 1
- 230000000340 anti-metabolite Effects 0.000 description 1
- 230000006023 anti-tumor response Effects 0.000 description 1
- 239000000051 antiandrogen Substances 0.000 description 1
- 229940030495 antiandrogen sex hormone and modulator of the genital system Drugs 0.000 description 1
- 230000030741 antigen processing and presentation Effects 0.000 description 1
- 229940100197 antimetabolite Drugs 0.000 description 1
- 239000002256 antimetabolite Substances 0.000 description 1
- 229940045719 antineoplastic alkylating agent nitrosoureas Drugs 0.000 description 1
- 229940045713 antineoplastic alkylating drug ethylene imines Drugs 0.000 description 1
- 230000036528 appetite Effects 0.000 description 1
- 235000019789 appetite Nutrition 0.000 description 1
- 239000007864 aqueous solution Substances 0.000 description 1
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 1
- 235000009697 arginine Nutrition 0.000 description 1
- 229960003272 asparaginase Drugs 0.000 description 1
- DCXYFEDJOCDNAF-UHFFFAOYSA-M asparaginate Chemical compound [O-]C(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-M 0.000 description 1
- 235000009582 asparagine Nutrition 0.000 description 1
- 229960001230 asparagine Drugs 0.000 description 1
- 108010077245 asparaginyl-proline Proteins 0.000 description 1
- 235000003704 aspartic acid Nutrition 0.000 description 1
- 108010047857 aspartylglycine Proteins 0.000 description 1
- 230000002238 attenuated effect Effects 0.000 description 1
- 230000008901 benefit Effects 0.000 description 1
- OQFSQFPPLPISGP-UHFFFAOYSA-N beta-carboxyaspartic acid Natural products OC(=O)C(N)C(C(O)=O)C(O)=O OQFSQFPPLPISGP-UHFFFAOYSA-N 0.000 description 1
- 230000000975 bioactive effect Effects 0.000 description 1
- 238000002306 biochemical method Methods 0.000 description 1
- 239000002981 blocking agent Substances 0.000 description 1
- 238000004820 blood count Methods 0.000 description 1
- 238000010322 bone marrow transplantation Methods 0.000 description 1
- 201000008275 breast carcinoma Diseases 0.000 description 1
- 229960005520 bryostatin Drugs 0.000 description 1
- MJQUEDHRCUIRLF-TVIXENOKSA-N bryostatin 1 Chemical compound C([C@@H]1CC(/[C@@H]([C@@](C(C)(C)/C=C/2)(O)O1)OC(=O)/C=C/C=C/CCC)=C\C(=O)OC)[C@H]([C@@H](C)O)OC(=O)C[C@H](O)C[C@@H](O1)C[C@H](OC(C)=O)C(C)(C)[C@]1(O)C[C@@H]1C\C(=C\C(=O)OC)C[C@H]\2O1 MJQUEDHRCUIRLF-TVIXENOKSA-N 0.000 description 1
- MUIWQCKLQMOUAT-AKUNNTHJSA-N bryostatin 20 Natural products COC(=O)C=C1C[C@@]2(C)C[C@]3(O)O[C@](C)(C[C@@H](O)CC(=O)O[C@](C)(C[C@@]4(C)O[C@](O)(CC5=CC(=O)O[C@]45C)C(C)(C)C=C[C@@](C)(C1)O2)[C@@H](C)O)C[C@H](OC(=O)C(C)(C)C)C3(C)C MUIWQCKLQMOUAT-AKUNNTHJSA-N 0.000 description 1
- 229960002092 busulfan Drugs 0.000 description 1
- 239000003710 calcium ionophore Substances 0.000 description 1
- 239000001506 calcium phosphate Substances 0.000 description 1
- 229910000389 calcium phosphate Inorganic materials 0.000 description 1
- 235000011010 calcium phosphates Nutrition 0.000 description 1
- 238000004364 calculation method Methods 0.000 description 1
- 235000013877 carbamide Nutrition 0.000 description 1
- 230000021235 carbamoylation Effects 0.000 description 1
- 239000000969 carrier Substances 0.000 description 1
- 125000002091 cationic group Chemical group 0.000 description 1
- 150000001768 cations Chemical class 0.000 description 1
- 230000020411 cell activation Effects 0.000 description 1
- 239000006143 cell culture medium Substances 0.000 description 1
- 230000003915 cell function Effects 0.000 description 1
- 239000013592 cell lysate Substances 0.000 description 1
- 210000000170 cell membrane Anatomy 0.000 description 1
- 229940030156 cell vaccine Drugs 0.000 description 1
- 201000007455 central nervous system cancer Diseases 0.000 description 1
- 208000025997 central nervous system neoplasm Diseases 0.000 description 1
- 201000010881 cervical cancer Diseases 0.000 description 1
- 230000008859 change Effects 0.000 description 1
- 125000003636 chemical group Chemical group 0.000 description 1
- 208000006990 cholangiocarcinoma Diseases 0.000 description 1
- 230000002759 chromosomal effect Effects 0.000 description 1
- 238000000975 co-precipitation Methods 0.000 description 1
- 238000004440 column chromatography Methods 0.000 description 1
- 230000002860 competitive effect Effects 0.000 description 1
- 238000004590 computer program Methods 0.000 description 1
- 230000021615 conjugation Effects 0.000 description 1
- 238000007796 conventional method Methods 0.000 description 1
- 230000002596 correlated effect Effects 0.000 description 1
- 230000004940 costimulation Effects 0.000 description 1
- 229940109239 creatinine Drugs 0.000 description 1
- 239000012228 culture supernatant Substances 0.000 description 1
- 238000012258 culturing Methods 0.000 description 1
- XLJMAIOERFSOGZ-UHFFFAOYSA-M cyanate Chemical compound [O-]C#N XLJMAIOERFSOGZ-UHFFFAOYSA-M 0.000 description 1
- 230000001461 cytolytic effect Effects 0.000 description 1
- 210000000805 cytoplasm Anatomy 0.000 description 1
- 210000005220 cytoplasmic tail Anatomy 0.000 description 1
- 239000000824 cytostatic agent Substances 0.000 description 1
- 210000001151 cytotoxic T lymphocyte Anatomy 0.000 description 1
- 231100000599 cytotoxic agent Toxicity 0.000 description 1
- 238000007405 data analysis Methods 0.000 description 1
- 229960000975 daunorubicin Drugs 0.000 description 1
- STQGQHZAVUOBTE-VGBVRHCVSA-N daunorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(C)=O)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 STQGQHZAVUOBTE-VGBVRHCVSA-N 0.000 description 1
- 230000034994 death Effects 0.000 description 1
- 231100000517 death Toxicity 0.000 description 1
- 238000000354 decomposition reaction Methods 0.000 description 1
- 230000002950 deficient Effects 0.000 description 1
- 230000006735 deficit Effects 0.000 description 1
- 230000018044 dehydration Effects 0.000 description 1
- 238000006297 dehydration reaction Methods 0.000 description 1
- 238000011161 development Methods 0.000 description 1
- 230000018109 developmental process Effects 0.000 description 1
- RGLYKWWBQGJZGM-ISLYRVAYSA-N diethylstilbestrol Chemical compound C=1C=C(O)C=CC=1C(/CC)=C(\CC)C1=CC=C(O)C=C1 RGLYKWWBQGJZGM-ISLYRVAYSA-N 0.000 description 1
- 229960000452 diethylstilbestrol Drugs 0.000 description 1
- 206010012818 diffuse large B-cell lymphoma Diseases 0.000 description 1
- 208000018554 digestive system carcinoma Diseases 0.000 description 1
- 239000003085 diluting agent Substances 0.000 description 1
- 238000010790 dilution Methods 0.000 description 1
- 239000012895 dilution Substances 0.000 description 1
- XPPKVPWEQAFLFU-UHFFFAOYSA-J diphosphate(4-) Chemical compound [O-]P([O-])(=O)OP([O-])([O-])=O XPPKVPWEQAFLFU-UHFFFAOYSA-J 0.000 description 1
- 235000011180 diphosphates Nutrition 0.000 description 1
- LOKCTEFSRHRXRJ-UHFFFAOYSA-I dipotassium trisodium dihydrogen phosphate hydrogen phosphate dichloride Chemical compound P(=O)(O)(O)[O-].[K+].P(=O)(O)([O-])[O-].[Na+].[Na+].[Cl-].[K+].[Cl-].[Na+] LOKCTEFSRHRXRJ-UHFFFAOYSA-I 0.000 description 1
- 238000010494 dissociation reaction Methods 0.000 description 1
- 230000005593 dissociations Effects 0.000 description 1
- 239000012153 distilled water Substances 0.000 description 1
- 238000009826 distribution Methods 0.000 description 1
- 229930188854 dolastatin Chemical group 0.000 description 1
- 229960004679 doxorubicin Drugs 0.000 description 1
- 239000003596 drug target Substances 0.000 description 1
- 239000000839 emulsion Substances 0.000 description 1
- 208000023965 endometrium neoplasm Diseases 0.000 description 1
- 230000006862 enzymatic digestion Effects 0.000 description 1
- 230000002255 enzymatic effect Effects 0.000 description 1
- YJGVMLPVUAXIQN-UHFFFAOYSA-N epipodophyllotoxin Natural products COC1=C(OC)C(OC)=CC(C2C3=CC=4OCOC=4C=C3C(O)C3C2C(OC3)=O)=C1 YJGVMLPVUAXIQN-UHFFFAOYSA-N 0.000 description 1
- 229930013356 epothilone Natural products 0.000 description 1
- 150000003883 epothilone derivatives Chemical class 0.000 description 1
- 230000008029 eradication Effects 0.000 description 1
- 239000003797 essential amino acid Substances 0.000 description 1
- 235000020776 essential amino acid Nutrition 0.000 description 1
- 239000000262 estrogen Substances 0.000 description 1
- 229940011871 estrogen Drugs 0.000 description 1
- 239000000328 estrogen antagonist Substances 0.000 description 1
- 229960002568 ethinylestradiol Drugs 0.000 description 1
- CJAONIOAQZUHPN-KKLWWLSJSA-N ethyl 12-[[2-[(2r,3r)-3-[2-[(12-ethoxy-12-oxododecyl)-methylamino]-2-oxoethoxy]butan-2-yl]oxyacetyl]-methylamino]dodecanoate Chemical compound CCOC(=O)CCCCCCCCCCCN(C)C(=O)CO[C@H](C)[C@@H](C)OCC(=O)N(C)CCCCCCCCCCCC(=O)OCC CJAONIOAQZUHPN-KKLWWLSJSA-N 0.000 description 1
- 239000013604 expression vector Substances 0.000 description 1
- 210000004700 fetal blood Anatomy 0.000 description 1
- 229960000390 fludarabine Drugs 0.000 description 1
- GIUYCYHIANZCFB-FJFJXFQQSA-N fludarabine phosphate Chemical compound C1=NC=2C(N)=NC(F)=NC=2N1[C@@H]1O[C@H](COP(O)(O)=O)[C@@H](O)[C@@H]1O GIUYCYHIANZCFB-FJFJXFQQSA-N 0.000 description 1
- 229910052731 fluorine Inorganic materials 0.000 description 1
- 229960002949 fluorouracil Drugs 0.000 description 1
- 229960001751 fluoxymesterone Drugs 0.000 description 1
- YLRFCQOZQXIBAB-RBZZARIASA-N fluoxymesterone Chemical compound C1CC2=CC(=O)CC[C@]2(C)[C@]2(F)[C@@H]1[C@@H]1CC[C@](C)(O)[C@@]1(C)C[C@@H]2O YLRFCQOZQXIBAB-RBZZARIASA-N 0.000 description 1
- 230000037406 food intake Effects 0.000 description 1
- 230000033581 fucosylation Effects 0.000 description 1
- 238000002825 functional assay Methods 0.000 description 1
- 230000004927 fusion Effects 0.000 description 1
- 210000004475 gamma-delta t lymphocyte Anatomy 0.000 description 1
- 230000002496 gastric effect Effects 0.000 description 1
- 210000001035 gastrointestinal tract Anatomy 0.000 description 1
- 238000001502 gel electrophoresis Methods 0.000 description 1
- 229960005277 gemcitabine Drugs 0.000 description 1
- SDUQYLNIPVEERB-QPPQHZFASA-N gemcitabine Chemical compound O=C1N=C(N)C=CN1[C@H]1C(F)(F)[C@H](O)[C@@H](CO)O1 SDUQYLNIPVEERB-QPPQHZFASA-N 0.000 description 1
- 238000003500 gene array Methods 0.000 description 1
- 238000001415 gene therapy Methods 0.000 description 1
- 238000010353 genetic engineering Methods 0.000 description 1
- 238000010362 genome editing Methods 0.000 description 1
- 239000003862 glucocorticoid Substances 0.000 description 1
- 235000013922 glutamic acid Nutrition 0.000 description 1
- 239000004220 glutamic acid Substances 0.000 description 1
- 108010042598 glutamyl-aspartyl-glycine Proteins 0.000 description 1
- 108010049041 glutamylalanine Proteins 0.000 description 1
- 108010079547 glutamylmethionine Proteins 0.000 description 1
- 108010020688 glycylhistidine Proteins 0.000 description 1
- 108010077515 glycylproline Proteins 0.000 description 1
- 108010037850 glycylvaline Proteins 0.000 description 1
- XLXSAKCOAKORKW-AQJXLSMYSA-N gonadorelin Chemical class C([C@@H](C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N1[C@@H](CCC1)C(=O)NCC(N)=O)NC(=O)[C@H](CO)NC(=O)[C@H](CC=1C2=CC=CC=C2NC=1)NC(=O)[C@H](CC=1N=CNC=1)NC(=O)[C@H]1NC(=O)CC1)C1=CC=C(O)C=C1 XLXSAKCOAKORKW-AQJXLSMYSA-N 0.000 description 1
- 238000003306 harvesting Methods 0.000 description 1
- 208000014829 head and neck neoplasm Diseases 0.000 description 1
- 230000036541 health Effects 0.000 description 1
- 210000002443 helper t lymphocyte Anatomy 0.000 description 1
- 201000011066 hemangioma Diseases 0.000 description 1
- 206010073071 hepatocellular carcinoma Diseases 0.000 description 1
- 231100000844 hepatocellular carcinoma Toxicity 0.000 description 1
- 239000000833 heterodimer Substances 0.000 description 1
- 210000003630 histaminocyte Anatomy 0.000 description 1
- 108010092114 histidylphenylalanine Proteins 0.000 description 1
- 230000001744 histochemical effect Effects 0.000 description 1
- 229940088597 hormone Drugs 0.000 description 1
- 239000005556 hormone Substances 0.000 description 1
- 238000011577 humanized mouse model Methods 0.000 description 1
- 229960000890 hydrocortisone Drugs 0.000 description 1
- 125000001165 hydrophobic group Chemical group 0.000 description 1
- 229920001600 hydrophobic polymer Polymers 0.000 description 1
- 229950000801 hydroxyprogesterone caproate Drugs 0.000 description 1
- 230000000148 hypercalcaemia Effects 0.000 description 1
- 230000005746 immune checkpoint blockade Effects 0.000 description 1
- 230000001900 immune effect Effects 0.000 description 1
- 230000008076 immune mechanism Effects 0.000 description 1
- 229940124452 immunizing agent Drugs 0.000 description 1
- 230000007813 immunodeficiency Effects 0.000 description 1
- 230000002163 immunogen Effects 0.000 description 1
- 238000002991 immunohistochemical analysis Methods 0.000 description 1
- 238000011532 immunohistochemical staining Methods 0.000 description 1
- 239000000367 immunologic factor Substances 0.000 description 1
- 230000001506 immunosuppresive effect Effects 0.000 description 1
- 238000002513 implantation Methods 0.000 description 1
- 230000005917 in vivo anti-tumor Effects 0.000 description 1
- 230000000415 inactivating effect Effects 0.000 description 1
- 230000002779 inactivation Effects 0.000 description 1
- 230000002458 infectious effect Effects 0.000 description 1
- 239000003112 inhibitor Substances 0.000 description 1
- 230000005764 inhibitory process Effects 0.000 description 1
- 208000014674 injury Diseases 0.000 description 1
- 210000005007 innate immune system Anatomy 0.000 description 1
- PBGKTOXHQIOBKM-FHFVDXKLSA-N insulin (human) Chemical compound C([C@@H](C(=O)N[C@@H](CC(C)C)C(=O)N[C@H]1CSSC[C@H]2C(=O)N[C@H](C(=O)N[C@@H](CO)C(=O)N[C@H](C(=O)N[C@H](C(N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC=3C=CC(O)=CC=3)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC=3C=CC(O)=CC=3)C(=O)N[C@@H](CSSC[C@H](NC(=O)[C@H](C(C)C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC=3C=CC(O)=CC=3)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](C)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C(C)C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC=3NC=NC=3)NC(=O)[C@H](CO)NC(=O)CNC1=O)C(=O)NCC(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)NCC(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H]([C@@H](C)O)C(O)=O)C(=O)N[C@@H](CC(N)=O)C(O)=O)=O)CSSC[C@@H](C(N2)=O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C(C)C)NC(=O)[C@@H](NC(=O)CN)[C@@H](C)CC)[C@@H](C)CC)[C@@H](C)O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CC(N)=O)NC(=O)[C@@H](NC(=O)[C@@H](N)CC=1C=CC=CC=1)C(C)C)C1=CN=CN1 PBGKTOXHQIOBKM-FHFVDXKLSA-N 0.000 description 1
- 230000010354 integration Effects 0.000 description 1
- 230000004073 interleukin-2 production Effects 0.000 description 1
- 238000007918 intramuscular administration Methods 0.000 description 1
- 238000010253 intravenous injection Methods 0.000 description 1
- PGHMRUGBZOYCAA-UHFFFAOYSA-N ionomycin Natural products O1C(CC(O)C(C)C(O)C(C)C=CCC(C)CC(C)C(O)=CC(=O)C(C)CC(C)CC(CCC(O)=O)C)CCC1(C)C1OC(C)(C(C)O)CC1 PGHMRUGBZOYCAA-UHFFFAOYSA-N 0.000 description 1
- PGHMRUGBZOYCAA-ADZNBVRBSA-N ionomycin Chemical compound O1[C@H](C[C@H](O)[C@H](C)[C@H](O)[C@H](C)/C=C/C[C@@H](C)C[C@@H](C)C(/O)=C/C(=O)[C@@H](C)C[C@@H](C)C[C@@H](CCC(O)=O)C)CC[C@@]1(C)[C@@H]1O[C@](C)([C@@H](C)O)CC1 PGHMRUGBZOYCAA-ADZNBVRBSA-N 0.000 description 1
- AGPKZVBTJJNPAG-UHFFFAOYSA-N isoleucine Natural products CCC(C)C(N)C(O)=O AGPKZVBTJJNPAG-UHFFFAOYSA-N 0.000 description 1
- 229960000310 isoleucine Drugs 0.000 description 1
- MXAYKZJJDUDWDS-LBPRGKRZSA-N ixazomib Chemical compound CC(C)C[C@@H](B(O)O)NC(=O)CNC(=O)C1=CC(Cl)=CC=C1Cl MXAYKZJJDUDWDS-LBPRGKRZSA-N 0.000 description 1
- 201000010982 kidney cancer Diseases 0.000 description 1
- 230000003907 kidney function Effects 0.000 description 1
- 229940000764 kyprolis Drugs 0.000 description 1
- 108010073472 leucyl-prolyl-proline Proteins 0.000 description 1
- 108010000761 leucylarginine Proteins 0.000 description 1
- GFIJNRVAKGFPGQ-LIJARHBVSA-N leuprolide Chemical compound CCNC(=O)[C@@H]1CCCN1C(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@H](CO)NC(=O)[C@H](CC=1C2=CC=CC=C2NC=1)NC(=O)[C@H](CC=1N=CNC=1)NC(=O)[C@H]1NC(=O)CC1)CC1=CC=C(O)C=C1 GFIJNRVAKGFPGQ-LIJARHBVSA-N 0.000 description 1
- 229960004338 leuprorelin Drugs 0.000 description 1
- 239000007788 liquid Substances 0.000 description 1
- 208000014018 liver neoplasm Diseases 0.000 description 1
- 238000001325 log-rank test Methods 0.000 description 1
- 210000004072 lung Anatomy 0.000 description 1
- 201000005202 lung cancer Diseases 0.000 description 1
- 208000020816 lung neoplasm Diseases 0.000 description 1
- 208000037841 lung tumor Diseases 0.000 description 1
- 201000011649 lymphoblastic lymphoma Diseases 0.000 description 1
- 201000001268 lymphoproliferative syndrome Diseases 0.000 description 1
- 108010025153 lysyl-alanyl-alanine Proteins 0.000 description 1
- 108010057952 lysyl-phenylalanyl-lysine Proteins 0.000 description 1
- 108010038320 lysylphenylalanine Proteins 0.000 description 1
- 230000007434 lytic lesion Effects 0.000 description 1
- 108700021021 mRNA Vaccine Proteins 0.000 description 1
- 210000002540 macrophage Anatomy 0.000 description 1
- 239000011777 magnesium Substances 0.000 description 1
- 229910052749 magnesium Inorganic materials 0.000 description 1
- 208000015486 malignant pancreatic neoplasm Diseases 0.000 description 1
- 239000000594 mannitol Substances 0.000 description 1
- 235000010355 mannitol Nutrition 0.000 description 1
- 125000000311 mannosyl group Chemical group C1([C@@H](O)[C@@H](O)[C@H](O)[C@H](O1)CO)* 0.000 description 1
- 230000035800 maturation Effects 0.000 description 1
- 201000000638 mature B-cell neoplasm Diseases 0.000 description 1
- 210000001939 mature NK cell Anatomy 0.000 description 1
- 210000003519 mature b lymphocyte Anatomy 0.000 description 1
- 230000007246 mechanism Effects 0.000 description 1
- 229960002985 medroxyprogesterone acetate Drugs 0.000 description 1
- PSGAAPLEWMOORI-PEINSRQWSA-N medroxyprogesterone acetate Chemical compound C([C@@]12C)CC(=O)C=C1[C@@H](C)C[C@@H]1[C@@H]2CC[C@]2(C)[C@@](OC(C)=O)(C(C)=O)CC[C@H]21 PSGAAPLEWMOORI-PEINSRQWSA-N 0.000 description 1
- 229960004296 megestrol acetate Drugs 0.000 description 1
- RQZAXGRLVPAYTJ-GQFGMJRRSA-N megestrol acetate Chemical compound C1=C(C)C2=CC(=O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@@](C(C)=O)(OC(=O)C)[C@@]1(C)CC2 RQZAXGRLVPAYTJ-GQFGMJRRSA-N 0.000 description 1
- 210000002752 melanocyte Anatomy 0.000 description 1
- 238000002844 melting Methods 0.000 description 1
- 230000008018 melting Effects 0.000 description 1
- 210000003071 memory t lymphocyte Anatomy 0.000 description 1
- 150000002730 mercury Chemical class 0.000 description 1
- 229930182817 methionine Natural products 0.000 description 1
- 229960000485 methotrexate Drugs 0.000 description 1
- 238000012737 microarray-based gene expression Methods 0.000 description 1
- 239000011325 microbead Substances 0.000 description 1
- 239000011859 microparticle Substances 0.000 description 1
- 230000027939 micturition Effects 0.000 description 1
- 208000030247 mild fever Diseases 0.000 description 1
- 239000007758 minimum essential medium Substances 0.000 description 1
- 230000002297 mitogenic effect Effects 0.000 description 1
- 229960000350 mitotane Drugs 0.000 description 1
- 108091005601 modified peptides Proteins 0.000 description 1
- 238000002625 monoclonal antibody therapy Methods 0.000 description 1
- 210000001616 monocyte Anatomy 0.000 description 1
- 238000004264 monolayer culture Methods 0.000 description 1
- HDZGCSFEDULWCS-UHFFFAOYSA-N monomethylhydrazine Chemical compound CNN HDZGCSFEDULWCS-UHFFFAOYSA-N 0.000 description 1
- 238000010172 mouse model Methods 0.000 description 1
- 229940126619 mouse monoclonal antibody Drugs 0.000 description 1
- 210000002894 multi-fate stem cell Anatomy 0.000 description 1
- 238000002887 multiple sequence alignment Methods 0.000 description 1
- 238000012243 multiplex automated genomic engineering Methods 0.000 description 1
- 201000002077 muscle cancer Diseases 0.000 description 1
- 210000001167 myeloblast Anatomy 0.000 description 1
- 230000002071 myeloproliferative effect Effects 0.000 description 1
- 208000017708 myomatous neoplasm Diseases 0.000 description 1
- OHDXDNUPVVYWOV-UHFFFAOYSA-N n-methyl-1-(2-naphthalen-1-ylsulfanylphenyl)methanamine Chemical compound CNCC1=CC=CC=C1SC1=CC=CC2=CC=CC=C12 OHDXDNUPVVYWOV-UHFFFAOYSA-N 0.000 description 1
- 210000004897 n-terminal region Anatomy 0.000 description 1
- 238000011227 neoadjuvant chemotherapy Methods 0.000 description 1
- 208000025402 neoplasm of esophagus Diseases 0.000 description 1
- 208000010915 neoplasm of mature B-cells Diseases 0.000 description 1
- 230000009826 neoplastic cell growth Effects 0.000 description 1
- 210000005036 nerve Anatomy 0.000 description 1
- 230000001537 neural effect Effects 0.000 description 1
- 229910052759 nickel Inorganic materials 0.000 description 1
- 230000036565 night sweats Effects 0.000 description 1
- 206010029410 night sweats Diseases 0.000 description 1
- 229940030115 ninlaro Drugs 0.000 description 1
- 239000003956 nonsteroidal anti androgen Substances 0.000 description 1
- 208000037233 normocytic anemia Diseases 0.000 description 1
- 230000009437 off-target effect Effects 0.000 description 1
- 239000002751 oligonucleotide probe Substances 0.000 description 1
- 238000011369 optimal treatment Methods 0.000 description 1
- 238000005457 optimization Methods 0.000 description 1
- 229960003104 ornithine Drugs 0.000 description 1
- 238000012261 overproduction Methods 0.000 description 1
- 229960001756 oxaliplatin Drugs 0.000 description 1
- DWAFYCQODLXJNR-BNTLRKBRSA-L oxaliplatin Chemical compound O1C(=O)C(=O)O[Pt]11N[C@@H]2CCCC[C@H]2N1 DWAFYCQODLXJNR-BNTLRKBRSA-L 0.000 description 1
- 230000003647 oxidation Effects 0.000 description 1
- 238000007254 oxidation reaction Methods 0.000 description 1
- 229960001592 paclitaxel Drugs 0.000 description 1
- 238000002638 palliative care Methods 0.000 description 1
- 208000008443 pancreatic carcinoma Diseases 0.000 description 1
- 239000012188 paraffin wax Substances 0.000 description 1
- 230000005298 paramagnetic effect Effects 0.000 description 1
- 230000001575 pathological effect Effects 0.000 description 1
- 239000008188 pellet Substances 0.000 description 1
- 229940111202 pepsin Drugs 0.000 description 1
- 230000000737 periodic effect Effects 0.000 description 1
- 102000013415 peroxidase activity proteins Human genes 0.000 description 1
- 108040007629 peroxidase activity proteins Proteins 0.000 description 1
- 238000002823 phage display Methods 0.000 description 1
- NBIIXXVUZAFLBC-UHFFFAOYSA-K phosphate Chemical group [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 description 1
- 239000010452 phosphate Chemical group 0.000 description 1
- 230000000704 physical effect Effects 0.000 description 1
- 230000001766 physiological effect Effects 0.000 description 1
- 210000003635 pituitary gland Anatomy 0.000 description 1
- 210000002826 placenta Anatomy 0.000 description 1
- 208000024361 placenta neoplasm Diseases 0.000 description 1
- 206010035485 plasmacytosis Diseases 0.000 description 1
- 238000002616 plasmapheresis Methods 0.000 description 1
- 229910052697 platinum Inorganic materials 0.000 description 1
- 210000001778 pluripotent stem cell Anatomy 0.000 description 1
- 108010048507 poliovirus receptor Proteins 0.000 description 1
- 229920002338 polyhydroxyethylmethacrylate Polymers 0.000 description 1
- 229920000642 polymer Polymers 0.000 description 1
- 108091033319 polynucleotide Proteins 0.000 description 1
- 102000040430 polynucleotide Human genes 0.000 description 1
- 229940008606 pomalyst Drugs 0.000 description 1
- 238000010837 poor prognosis Methods 0.000 description 1
- 229910000160 potassium phosphate Inorganic materials 0.000 description 1
- 235000011009 potassium phosphates Nutrition 0.000 description 1
- 230000003389 potentiating effect Effects 0.000 description 1
- 201000011174 precursor lymphoblastic lymphoma/leukemia Diseases 0.000 description 1
- 229960004618 prednisone Drugs 0.000 description 1
- XOFYZVNMUHMLCC-ZPOLXVRWSA-N prednisone Chemical compound O=C1C=C[C@]2(C)[C@H]3C(=O)C[C@](C)([C@@](CC4)(O)C(=O)CO)[C@@H]4[C@@H]3CCC2=C1 XOFYZVNMUHMLCC-ZPOLXVRWSA-N 0.000 description 1
- 238000002953 preparative HPLC Methods 0.000 description 1
- 230000003449 preventive effect Effects 0.000 description 1
- 210000004986 primary T-cell Anatomy 0.000 description 1
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 1
- 229960000624 procarbazine Drugs 0.000 description 1
- CPTBDICYNRMXFX-UHFFFAOYSA-N procarbazine Chemical compound CNNCC1=CC=C(C(=O)NC(C)C)C=C1 CPTBDICYNRMXFX-UHFFFAOYSA-N 0.000 description 1
- 239000000583 progesterone congener Substances 0.000 description 1
- 108010020755 prolyl-glycyl-glycine Proteins 0.000 description 1
- 108010070643 prolylglutamic acid Proteins 0.000 description 1
- 108010090894 prolylleucine Proteins 0.000 description 1
- 108010053725 prolylvaline Proteins 0.000 description 1
- 230000000644 propagated effect Effects 0.000 description 1
- 238000011321 prophylaxis Methods 0.000 description 1
- 208000023958 prostate neoplasm Diseases 0.000 description 1
- 230000001681 protective effect Effects 0.000 description 1
- 230000009145 protein modification Effects 0.000 description 1
- 150000003230 pyrimidines Chemical class 0.000 description 1
- 230000002285 radioactive effect Effects 0.000 description 1
- 238000003259 recombinant expression Methods 0.000 description 1
- 238000010188 recombinant method Methods 0.000 description 1
- 230000009467 reduction Effects 0.000 description 1
- 238000006722 reduction reaction Methods 0.000 description 1
- 238000005932 reductive alkylation reaction Methods 0.000 description 1
- 210000001350 reed-sternberg cell Anatomy 0.000 description 1
- 201000010174 renal carcinoma Diseases 0.000 description 1
- 238000009877 rendering Methods 0.000 description 1
- 230000010076 replication Effects 0.000 description 1
- 229920005989 resin Polymers 0.000 description 1
- 239000011347 resin Substances 0.000 description 1
- 108091008146 restriction endonucleases Proteins 0.000 description 1
- 229940120975 revlimid Drugs 0.000 description 1
- 239000002336 ribonucleotide Substances 0.000 description 1
- 125000002652 ribonucleotide group Chemical group 0.000 description 1
- 229960004641 rituximab Drugs 0.000 description 1
- 235000019515 salmon Nutrition 0.000 description 1
- 238000002864 sequence alignment Methods 0.000 description 1
- 238000013207 serial dilution Methods 0.000 description 1
- 108010071207 serylmethionine Proteins 0.000 description 1
- 208000013220 shortness of breath Diseases 0.000 description 1
- 230000019491 signal transduction Effects 0.000 description 1
- 238000002741 site-directed mutagenesis Methods 0.000 description 1
- 201000000849 skin cancer Diseases 0.000 description 1
- 201000009295 smoldering myeloma Diseases 0.000 description 1
- 239000011734 sodium Substances 0.000 description 1
- 239000001509 sodium citrate Substances 0.000 description 1
- NLJMYIDDQXHKNR-UHFFFAOYSA-K sodium citrate Chemical compound O.O.[Na+].[Na+].[Na+].[O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O NLJMYIDDQXHKNR-UHFFFAOYSA-K 0.000 description 1
- 239000007787 solid Substances 0.000 description 1
- 210000001082 somatic cell Anatomy 0.000 description 1
- 210000004989 spleen cell Anatomy 0.000 description 1
- 238000011301 standard therapy Methods 0.000 description 1
- 125000001424 substituent group Chemical group 0.000 description 1
- 239000000758 substrate Substances 0.000 description 1
- 239000005720 sucrose Substances 0.000 description 1
- BDHFUVZGWQCTTF-UHFFFAOYSA-M sulfonate Chemical compound [O-]S(=O)=O BDHFUVZGWQCTTF-UHFFFAOYSA-M 0.000 description 1
- 230000003319 supportive effect Effects 0.000 description 1
- 230000001629 suppression Effects 0.000 description 1
- 230000020382 suppression by virus of host antigen processing and presentation of peptide antigen via MHC class I Effects 0.000 description 1
- 238000011477 surgical intervention Methods 0.000 description 1
- 239000000725 suspension Substances 0.000 description 1
- 238000013268 sustained release Methods 0.000 description 1
- 239000012730 sustained-release form Substances 0.000 description 1
- 208000011580 syndromic disease Diseases 0.000 description 1
- 238000007910 systemic administration Methods 0.000 description 1
- 229960001603 tamoxifen Drugs 0.000 description 1
- RCINICONZNJXQF-MZXODVADSA-N taxol Chemical compound O([C@@H]1[C@@]2(C[C@@H](C(C)=C(C2(C)C)[C@H](C([C@]2(C)[C@@H](O)C[C@H]3OC[C@]3([C@H]21)OC(C)=O)=O)OC(=O)C)OC(=O)[C@H](O)[C@@H](NC(=O)C=1C=CC=CC=1)C=1C=CC=CC=1)O)C(=O)C1=CC=CC=C1 RCINICONZNJXQF-MZXODVADSA-N 0.000 description 1
- 229950010127 teplizumab Drugs 0.000 description 1
- 201000003120 testicular cancer Diseases 0.000 description 1
- 229960001712 testosterone propionate Drugs 0.000 description 1
- 229940124597 therapeutic agent Drugs 0.000 description 1
- 125000003396 thiol group Chemical group [H]S* 0.000 description 1
- 206010043554 thrombocytopenia Diseases 0.000 description 1
- 210000001541 thymus gland Anatomy 0.000 description 1
- 201000002510 thyroid cancer Diseases 0.000 description 1
- 208000013076 thyroid tumor Diseases 0.000 description 1
- 229960003087 tioguanine Drugs 0.000 description 1
- 238000011200 topical administration Methods 0.000 description 1
- 238000013518 transcription Methods 0.000 description 1
- 230000035897 transcription Effects 0.000 description 1
- 230000002463 transducing effect Effects 0.000 description 1
- 230000009261 transgenic effect Effects 0.000 description 1
- 230000001052 transient effect Effects 0.000 description 1
- 102000035160 transmembrane proteins Human genes 0.000 description 1
- 108091005703 transmembrane proteins Proteins 0.000 description 1
- 230000017105 transposition Effects 0.000 description 1
- QORWJWZARLRLPR-UHFFFAOYSA-H tricalcium bis(phosphate) Chemical compound [Ca+2].[Ca+2].[Ca+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O QORWJWZARLRLPR-UHFFFAOYSA-H 0.000 description 1
- LENZDBCJOHFCAS-UHFFFAOYSA-N tris Chemical compound OCC(N)(CO)CO LENZDBCJOHFCAS-UHFFFAOYSA-N 0.000 description 1
- JOPDZQBPOWAEHC-UHFFFAOYSA-H tristrontium;diphosphate Chemical compound [Sr+2].[Sr+2].[Sr+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O JOPDZQBPOWAEHC-UHFFFAOYSA-H 0.000 description 1
- 210000002993 trophoblast Anatomy 0.000 description 1
- 108010044292 tryptophyltyrosine Proteins 0.000 description 1
- 208000025421 tumor of uterus Diseases 0.000 description 1
- 231100000588 tumorigenic Toxicity 0.000 description 1
- 230000000381 tumorigenic effect Effects 0.000 description 1
- WFKWXMTUELFFGS-UHFFFAOYSA-N tungsten Chemical compound [W] WFKWXMTUELFFGS-UHFFFAOYSA-N 0.000 description 1
- 239000010937 tungsten Substances 0.000 description 1
- 108010005834 tyrosyl-alanyl-glycine Proteins 0.000 description 1
- 150000003672 ureas Chemical class 0.000 description 1
- 201000005112 urinary bladder cancer Diseases 0.000 description 1
- 210000002700 urine Anatomy 0.000 description 1
- 208000024719 uterine cervix neoplasm Diseases 0.000 description 1
- 229940099039 velcade Drugs 0.000 description 1
- 229960003048 vinblastine Drugs 0.000 description 1
- JXLYSJRDGCGARV-XQKSVPLYSA-N vincaleukoblastine Chemical compound C([C@@H](C[C@]1(C(=O)OC)C=2C(=CC3=C([C@]45[C@H]([C@@]([C@H](OC(C)=O)[C@]6(CC)C=CCN([C@H]56)CC4)(O)C(=O)OC)N3C)C=2)OC)C[C@@](C2)(O)CC)N2CCC2=C1NC1=CC=CC=C21 JXLYSJRDGCGARV-XQKSVPLYSA-N 0.000 description 1
- 229960004528 vincristine Drugs 0.000 description 1
- OGWKCGZFUXNPDA-XQKSVPLYSA-N vincristine Chemical compound C([N@]1C[C@@H](C[C@]2(C(=O)OC)C=3C(=CC4=C([C@]56[C@H]([C@@]([C@H](OC(C)=O)[C@]7(CC)C=CCN([C@H]67)CC5)(O)C(=O)OC)N4C=O)C=3)OC)C[C@@](C1)(O)CC)CC1=C2NC2=CC=CC=C12 OGWKCGZFUXNPDA-XQKSVPLYSA-N 0.000 description 1
- OGWKCGZFUXNPDA-UHFFFAOYSA-N vincristine Natural products C1C(CC)(O)CC(CC2(C(=O)OC)C=3C(=CC4=C(C56C(C(C(OC(C)=O)C7(CC)C=CCN(C67)CC5)(O)C(=O)OC)N4C=O)C=3)OC)CN1CCC1=C2NC2=CC=CC=C12 OGWKCGZFUXNPDA-UHFFFAOYSA-N 0.000 description 1
- 230000003442 weekly effect Effects 0.000 description 1
- 229910052727 yttrium Inorganic materials 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/30—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K35/00—Medicinal preparations containing materials or reaction products thereof with undetermined constitution
- A61K35/12—Materials from mammals; Compositions comprising non-specified tissues or cells; Compositions comprising non-embryonic stem cells; Genetically modified cells
- A61K35/14—Blood; Artificial blood
- A61K35/17—Lymphocytes; B-cells; T-cells; Natural killer cells; Interferon-activated or cytokine-activated lymphocytes
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/177—Receptors; Cell surface antigens; Cell surface determinants
- A61K38/1774—Immunoglobulin superfamily (e.g. CD2, CD4, CD8, ICAM molecules, B7 molecules, Fc-receptors, MHC-molecules)
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0011—Cancer antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
- A61K39/39533—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
- A61K39/39558—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against tumor tissues, cells, antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/46—Cellular immunotherapy
- A61K39/461—Cellular immunotherapy characterised by the cell type used
- A61K39/4611—T-cells, e.g. tumor infiltrating lymphocytes [TIL], lymphokine-activated killer cells [LAK] or regulatory T cells [Treg]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/46—Cellular immunotherapy
- A61K39/463—Cellular immunotherapy characterised by recombinant expression
- A61K39/4631—Chimeric Antigen Receptors [CAR]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/46—Cellular immunotherapy
- A61K39/464—Cellular immunotherapy characterised by the antigen targeted or presented
- A61K39/4643—Vertebrate antigens
- A61K39/4644—Cancer antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K45/00—Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
- A61K45/06—Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6801—Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6835—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
- A61K47/6851—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a determinant of a tumour cell
- A61K47/6857—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a determinant of a tumour cell the tumour determinant being from lung cancer cell
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6835—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
- A61K47/6851—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a determinant of a tumour cell
- A61K47/6867—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a determinant of a tumour cell the tumour determinant being from a cell of a blood cancer
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6835—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
- A61K47/6851—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a determinant of a tumour cell
- A61K47/6869—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a determinant of a tumour cell the tumour determinant being from a cell of the reproductive system: ovaria, uterus, testes, prostate
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K9/00—Medicinal preparations characterised by special physical form
- A61K9/0012—Galenical forms characterised by the site of application
- A61K9/0019—Injectable compositions; Intramuscular, intravenous, arterial, subcutaneous administration; Compositions to be administered through the skin in an invasive manner
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
- A61P35/02—Antineoplastic agents specific for leukemia
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
- C07K14/7051—T-cell receptor (TcR)-CD3 complex
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
- C07K14/70517—CD8
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70578—NGF-receptor/TNF-receptor superfamily, e.g. CD27, CD30, CD40, CD95
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N5/00—Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
- C12N5/06—Animal cells or tissues; Human cells or tissues
- C12N5/0602—Vertebrate cells
- C12N5/0634—Cells from the blood or the immune system
- C12N5/0636—T lymphocytes
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/51—Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
- A61K2039/515—Animal cells
- A61K2039/5156—Animal cells expressing foreign proteins
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/51—Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
- A61K2039/515—Animal cells
- A61K2039/5158—Antigen-pulsed cells, e.g. T-cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/54—Medicinal preparations containing antigens or antibodies characterised by the route of administration
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/545—Medicinal preparations containing antigens or antibodies characterised by the dose, timing or administration schedule
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K39/46
- A61K2239/31—Indexing codes associated with cellular immunotherapy of group A61K39/46 characterized by the route of administration
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K39/46
- A61K2239/38—Indexing codes associated with cellular immunotherapy of group A61K39/46 characterised by the dose, timing or administration schedule
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
- C07K2317/62—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
- C07K2317/622—Single chain antibody (scFv)
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/02—Fusion polypeptide containing a localisation/targetting motif containing a signal sequence
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/03—Fusion polypeptide containing a localisation/targetting motif containing a transmembrane segment
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/033—Fusion polypeptide containing a localisation/targetting motif containing a motif for targeting to the internal surface of the plasma membrane, e.g. containing a myristoylation motif
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/30—Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/33—Fusion polypeptide fusions for targeting to specific cell types, e.g. tissue specific targeting, targeting of a bacterial subspecies
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2510/00—Genetically modified cells
Abstract
본 발명은 혈액암 치료에 대한 면역치료적 접근법에 관한 것이다. 특히, 본 발명은 5T4 항원을 표적화함으로써 혈액암을 치료하는 방법에 관한 것이다. 따라서, 본 발명은 대상체에게 5T4-표적화제를 투여하는 단계를 포함하는 혈액암 치료 방법을 제공한다. 또한, 본 발명은 5T4-특이적 키메라 항원 수용체(CAR) 및 암 치료에서의 이의 용도를 제공한다.
Description
본 발명은 혈액암(haematological cancer) 치료에 대한 면역치료적 접근법에 관한 것이다. 특히, 본 발명은 5T4 항원을 표적화함으로써 혈액암을 치료하는 방법에 관한 것이다. 따라서, 본 발명은 대상체에게 5T4 표적화제(targeting agent)를 투여하는 단계를 포함하는 혈액암 치료 방법을 제공한다. 또한, 본 발명은 5T4 특이적 키메라 항원 수용체(chimeric antigen receptor, CAR) 및 암 치료에서의 이의 용도를 제공한다.
혈액암은 두 가지 주요한 혈액 세포 계통인 골수성(myeloid) 세포주 및 림프성(lymphoid) 세포주로부터 유래할 수 있다. 골수성 세포주는 정상적으로 과립구(granulocyte), 적혈구(erythrocyte), 혈소판(thrombocyte), 대식세포(macrophage) 및 비만세포(mast cell)를 생산하고; 림프성 세포주는 B 세포, T 세포, NK 세포 및 형질세포(plasma cell)를 생산한다. 림프종(lymphoma), 림프구성 백혈병(lymphocytic leukaemia), 및 골수종(myeloma)은 림프성 세포주로부터 유래하지만, 급성 및 만성 골수성 백혈병(acute and chronic myelogenous leukaemia), 골수이형성 증후군(myelodysplastic syndrome) 및 골수증식성 질환(myeloproliferative disease)의 기원은 골수이다.
혈액암은 다수의 증상을 유발할 수 있다. 가장 흔한 증상 중 일부는 허약(weakness), 피로(fatigue), 숨가쁨(shortness of breath), 멍(bruising) 및 출혈(bleeding)이 생기기 쉬움, 잦은 감염(infection), 림프절 비대(enlarged lymph nodes), (복부 기관 비대로 인한) 복부 팽창(distended) 또는 통증, 뼈 또는 관절 통증, 골절(fracture), 계획하지 않은 체중 감소(weight loss), 식욕 부진(poor appetite), 야간발한(night sweat), 지속적인 미열(persistent mild fever) 및 (손상된 신장 기능으로 인한) 배뇨 감소(decreased urination)이다. 어떤 증상은 다른 암보다 일부 암에서 발생할 가능성이 더 크다. 예를 들어, 뼈 통증은 골수종에서 더욱 빈번하게 발견되며, 림프절 비대는 림프종에서 가장 흔하다. 림프절 비대의 구체적인 영향은 이들 림프절의 위치 및 크기에 달려있다.
종합하면, 혈액 악성 종양(haematological malignancy)은 미국에서 새로운 암 진단의 9.5%를 차지하며, 영국에서는 30,000명의 환자가 매년 진단된다. 혈액암의 유병률(prevalence)은 인구 고령화 및 대부분의 경우 예방 조치가 불가능한 결과로서 수반되는 결과에 따라 증가할 수 있음을 예상할 수 있다.
혈액암 치료를 위한 일부 치료적 옵션, 예를 들어 화학요법, 방사선요법, 면역요법 및 골수 이식이 현재 이용 가능하다.
그러나 혈액암을 치료 또는 예방하는 대안적인 방법이 당해 분야에 필요하다.
본 발명자들은 놀랍게도 혈액암에서 항원 5T4가 세포 상에 발현되므로, 5T4 표적화가 혈액암의 치료 또는 예방을 위한 옵션을 제공함을 발견하였다.
따라서, 본 발명은 대상체에게 5T4 표적화제를 투여하는 단계를 포함하는, 대상체에서 혈액암을 치료 또는 예방하는 방법을 제공한다.
추가의 양태에서, 본 발명은 혈액암의 치료 또는 예방에 사용하기 위한 5T4 표적화제를 제공한다.
또한, 혈액암 치료 또는 예방을 위한 약제의 제조에 있어서 5T4 표적화제의 용도 및 혈액암 치료 또는 예방을 위한 5T4 표적화제의 용도가 제공된다.
또한, 본 발명은 5T4-특이적 키메라 항원 수용체(CAR) 및 5T4-특이적 CAR을 발현하는 세포, 및 암, 특히 혈액암의 치료 또는 예방에 있어서의 이의 용도를 제공한다.
대안적인 양태에서, 본 발명은 혈액암의 치료 또는 예방을 위한 5T4를 표적화하는 암 백신을 제공한다.
본 발명의 다른 양태는 첨부된 청구범위 및 다음의 설명 및 논의에서 제시된다. 이러한 양태는 별개의 섹션 제목으로 제시될 수 있다. 그러나 각 섹션 제목 아래의 교시가 반드시 그 특정 섹션 제목으로 한정되는 것은 아니라는 것을 이해하여야 한다.
달리 정의되지 않는 한, 본원에 사용되는 모든 기술 및 과학 용어는 (예를 들어, 세포 배양, 분자유전학, 핵산 화학, 혼성화 기술 및 생화학의 용어) 당업자에 의해 일반적으로 이해되는 것과 동일한 의미를 갖는다. 분자, 유전 및 생화학적 방법에는 표준 기술 사용된다. 일반적으로, Sambrook et al., Molecular Cloning: A Laboratory Manual, 2d ed. (1989) Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y. 및 Ausubel et al., Short Protocols in Molecular Biology (1999) 4th Ed, John Wiley & Sons, Inc.; 및 Guthrie et al., Guide to Yeast Genetics and Molecular Biology, Methods in Enzymology, Vol. 194, Academic Press, Inc., (1991), PCR Protocols: A Guide to Methods and Applications (Innis, et al. 1990. Academic Press, San Diego, Calif.), McPherson et al., PCR Volume 1, Oxford University Press, (1991), Culture of Animal Cells: A Manual of Basic Technique, 2nd Ed. (R. I. Freshney. 1987. Liss, Inc. New York, N.Y.), 및 Gene Transfer and Expression Protocols, pp. 109-128, ed. E. J. Murray, The Humana Press Inc., Clifton, N.J.) 참조. 이들 문헌은 본원에 참조로 포함된다.
혈액암
혈액암에는 수많은 유형이 있다. 본 발명은 프리-B(pre-B) 급성 림프구성 백혈병이 아닌 혈액암에 관한 것이다.
혈액암의 주요 유형은 백혈병(leukaemia), 림프종(lymphoma) 또는 골수종(myeloma)으로 분류될 수 있다.
백혈병은 보통 골수에서 시작하여, 많은 수의 비정상적인 백혈구를 초래하는 암 그룹이다. 이들 백혈구는 완전히 발달하지 않은 것으로, 아세포(blast) 또는 백혈병 세포(leukaemia cell)라 불린다.
임상 및 병리학적으로, 백혈병은 여러 그룹으로 세분화된다. 첫 번째 구분은 급성 및 만성 형태 사이에서 이루어진다:
급성 백혈병(acute leukaemia)은 미성숙 혈액 세포 수의 급격한 증가를 특징으로 한다. 이러한 세포들로 인해 생기는 군집(crowding)은 골수가 건강한 혈액 세포를 생산할 수 없게 만든다. 악성 세포(malignant cell)의 빠른 진행과 축적, 그 후 세포가 혈류로 흘러나와 신체의 타기관으로 확산됨으로 인하여, 급성 백혈병은 즉각적인 치료가 필요하다. 급성 형태의 백혈병은 소아에서 가장 흔한 형태의 백혈병이다.
만성 백혈병(chronic leukaemia)은 비교적 성숙하지만 여전히 비정상적인 백혈구의 과도한 축적을 특징으로 한다. 진행하는 데 전형적으로 몇 개월 또는 몇 년이 걸리지만, 세포는 정상보다 훨씬 빠른 속도로 생산되어 많은 비정상적인 백혈구가 생긴다. 급성 백혈병은 즉시 치료되어야 하지만, 만성 형태는 때때로 치료의 효과를 극대화하기 위하여 치료 전에 얼마 동안 모니터링된다. 만성 백혈병은 주로 노인에서 발생하지만, 모든 연령대에서 발생할 수 있다.
또한, 질병은 영향을 받는 혈액 세포의 종류에 따라 세분화된다. 이는 백혈병을 림프아구성(lymphoblastic) 또는 림프구성(lymphocytic) 백혈병 및 골수(myeloid) 또는 골수성(myelogenous) 백혈병으로 나눈다. 대부분의 림프구성 백혈병은 B 세포와 관련이 있다. 골수 또는 골수성 백혈병에서, 암성 변화는 일반적으로 적혈구, 일부 다른 유형의 백혈구 및 혈소판을 형성하는 골수 세포의 일종에서 발생한다.
따라서, 백혈병에는 급성 골수성(acute myeloid, AML), 급성 림프아구성(acute lymphoblastic, ALL), 만성 골수성(chronic myeloid, CML) 및 만성 림프구성(chronic lymphocytic, CLL)의 4가지 주요 유형이 있다. 이러한 4가지의 주요 유형이 모든 백혈병 사례의 약 85%를 차지한다.
치료는 필요에 따라 지지 치료(supportive care) 및 완화 치료(palliative care) 이외에도, 화학요법(chemotherapy), 방사선요법(radiation therapy), 표적 요법(targeted therapy) 및 골수 이식(bone marrow transplant)의 일부 조합을 수반할 수 있다.
백혈병은 다양한 규칙(convention), 예를 들어 아래에서 논의되지만 이에 한정되지 않는 규칙에 따라 분류 및/또는 계층화될 수 있다. 본 발명은 모든 병기(stage) 및 분류를 포함한다.
AML
AML의 프랑스-미국-영국(FAB) 분류는 다음을 기초로 한다:
CML
CML은 전망을 예측하는데 도움을 주는 3개 그룹으로 분류된다. 이들 그룹은 병기(stage) 대신 기(phase)로 지칭된다. 기는 주로 혈액 또는 골수에서 보이는 미성숙 백혈구(골수아세포(아세포))의 수에 기초한다. 서로 다른 전문가 그룹이 기를 정의하기 위하여 약간씩 다른 컷오프(cutoff)를 제안하였으나, 공통 체계(세계보건기구에 의해 제안됨)를 아래에 기술하였다.
만성기(chronic phase)
이 기의 환자는 전형적으로 혈액 또는 골수 샘플에서 10% 미만의 아세포를 나타낸다. 이들 환자는 대개 (존재할 경우) 상당히 경미한(mild) 증상을 나타내며, 보통 표준 치료에 반응한다. 대부분의 환자는 만성기에서 진단된다.
가속기(accelerated phase)
환자가 다음 중 하나에 해당될 경우 가속기에 있는 것으로 간주된다:
· 골수 또는 혈액 샘플에서 10% 초과 20% 미만의 아세포를 나타냄
· 높은 혈액 호염구 수(백혈구의 적어도 20%를 구성하는 호염구)
· 치료로 감소되지 않는 높은 백혈구 수
· 치료에 의한 것인 아닌 매우 높거나 매우 낮은 혈소판 수
· 백혈병 세포의 새로운 염색체 변화
CML이 가속기에 있는 환자는 열, 식욕 부진 및 체중 감소와 같은 증상이 있을 수 있다. 가속기의 CML은 만성기의 CML과 마찬가지로 치료에 반응하지 않는다.
아세포기(blast phase)(급성기(acute phase) 또는 아세포 급증(blast crisis)으로도 지칭됨)
이 기의 환자로부터의 골수 및/또는 혈액 샘플은 20% 초과의 아세포를 나타낸다. 아세포는 종종 골수를 넘어 조직과 기관으로 확산된다. 이들 환자는 종종 열, 식욕 부진 및 체중 감소를 나타낸다. 이 기에서, CML은 공격적 급성 백혈병과 매우 유사하다.
ALL
분류는 면역표현형(immunophenotype)에 기초할 수 있다. 세포유전학적 시험, 유세포 분석 및 기타 실험실 시험은 ALL의 아형 및 환자의 예후에 관한 더욱 상세한 정보를 제공한다. 이들 시험은 다음을 고려하여 백혈병의 면역표현형에 기초하여 ALL을 그룹으로 나누는데 도움이 된다:
· 백혈병 세포가 유래되는 림프구의 종류(B 세포 또는 T 세포)
· 이들 백혈병 세포의 성숙 정도
ALL의 아형은 현재 다음과 같이 명명된다:
B 세포 ALL
· 조기 pre-B ALL(pro-B ALL로도 지칭됨) - 사례의 약 10%
· 공통 ALL - 사례의 약 50%
· Pre-B ALL - 사례의 약 10%
· 성숙 B 세포 ALL(버킷 백혈병(Burkitt leukemia)) - 사례의 약 4%
T 세포 ALL
· Pre-T ALL - 사례의 약 5% 내지 10%
· 성숙 T 세포 ALL - 사례의 약 15% 내지 20%
ALL의 아형 각각은 약간씩 상이한 전망(예후)을 갖지만, (백혈병 세포의 유전자 변화와 같은) 다른 인자 또한 영향을 미칠 수 있다.
혼합 직계성 급성 백혈병(mixed lineage acute leukemia)
최근 몇 년 동안, 새로운 실험실 시험은 소수의 급성 백혈병이 실제로 림프구성 및 골수성 특징을 모두 가지고 있음을 보여주었다. 때때로 백혈병 세포는 동일한 세포에 골수성 및 림프구성 특성(trait)을 둘 다 가지고 있다. 다른 사례에서, 한 사람이 골수성 특징을 가진 일부 백혈병 세포와 림프구성 특징을 가진 다른 백혈병 세포를 가질 수 있다. 이러한 유형의 백혈병은 혼합 직계성 백혈병, 골수성 마커를 갖는 ALL(My+ ALL), 림프구성 마커를 갖는 AML 또는 이중표현형 급성 백혈병(biphenotypic acute leukemia, BAL)이라 지칭될 수 있다.
대부분의 연구는 이들 백혈병이 ALL 또는 AML의 표준 아형보다 불량한 전망을 나타내는 경향이 있음을 시사한다.
CLL
CLL 병기 분류(staging)를 위한 2가지의 상이한 체계가 있다:
· Rai 체계: 이것은 미국에서 더 자주 사용된다.
· Binet 체계: 이것은 유럽에서 더욱 널리 사용된다.
Rai
병기 분류 체계
Rai 체계는 본래 1968년에 고안되었다. 당시 CLL 진단에 필요한 것은 림프구 증가증(lymphocytosis)(혈액 및 골수에 감염과 같은 임의의 다른 원인이 없는 많은 수의 림프구)이었다. 이것은 본래 혈액 mm3 당 15,000개 이상의 림프구 및 골수의 적어도 40%가 림프구로 구성되는 것으로서 정의되었다.
현재 CLL 진단을 위해서는, 환자는 적어도 5,000/mm3의 단일클론성(monoclonal) 림프구를 가져야 하지만(때때로 단일클론성 림프구 증가증이라 지칭됨), 전체 림프구 수가 높을 필요는 없다. 단일클론성은 세포 모두가 동일한 세포로부터 유래함을 의미하며, 이는 특별한 시험에서 세포가 동일한 화학적 패턴을 갖게 할 수 있다.
이러한 병기 분류를 위해, 림프구 증가증에 대해 CLL의 진단(예컨대, 단일클론성 림프구 증가증)을 대신할 수 있다.
이 체계는 CLL을 5가지 병기로 나눈다:
· Rai 0기: 림프구 증가증이 있음, 림프절, 비장 또는 간 비대 없음, 정상에 가까운 백혈구 및 혈소판 수.
· Rai 1기: 림프구 증가증 및 림프절 비대. 비장 및 간은 비대되지 않고, 적혈구 및 혈소판 수는 정상에 가까움.
· Rai 2기: 림프구 증가증 및, 림프절 비대 여부와 관계없이 비장 비대(및 아마도 간 비대). 적혈구 및 혈소판 수는 정상에 가까움.
· Rai 3기: 림프구 증가증 및, 림프절, 비장 또는 간 비대 여부와 관계없이 빈혈(매우 적은 수의 적혈구). 혈소판 수는 정상에 가까움.
· Rai 4기: 림프구 증가증 및, 빈혈, 림프절, 비장 또는 간 비대 여부와 관계없이 저혈소판증(매우 적은 수의 혈소판).
본 발명의 일 양태에서, 혈액암은 백혈병이다. 백혈병은 만성 골수성 백혈병, 만성 림프구성 백혈병, 급성 골수성 백혈병, B-세포 급성 림프아구성 백혈병(B-ALL) 및 T-세포 급성 림프아구성 백혈병(T-ALL)으로부터 선택될 수 있다.
본 발명의 일 양태에서, 혈액암은 ALL이 아니다. 일 양태에서, 혈액암은 B-ALL이 아니다.
본 발명에 따른 혈액암은 림프종일 수 있다. 림프종은 림프구에서 발생하는 암 그룹이다. 림프종의 두 가지 주요 카테고리는 호지킨 림프종(Hodgkin's lymphoma, HL)과 비호지킨 림프종(non-Hodgkin lymphoma, NHL)이다. 호지킨 림프종은 림프종의 약 15%를 차지한다. 호지킨 림프종은 예후 및 여러 병리학적 특성에서 다른 형태의 림프종과 상이하다. 호지킨 림프종은 리드-스텐버그 세포(Reed-Sternberg cell)라 불리는 세포 유형의 존재로 표시된다. 호지킨 림프종을 제외한 모든 림프종으로 정의되는 비호지킨 림프종은 호지킨 림프종보다 더 흔하다. 다양한 림프종이 이 부류에 있으며, 원인, 관련된 세포의 유형 및 예후는 유형에 따라 다르다. 비호지킨 림프종의 발생률(incidence)은 나이가 들면서 증가한다. 비호지킨 림프종은 여러 아형으로 더 나뉜다.
2001년에 발표되고 2008년에 업데이트된 WHO 분류는 "개정된 유럽-미국 림프종 분류"(revised European-American lymphoma classification, REAL)에 기초를 두고 있다. 이 체계는 림프종을 세포 유형(즉, 종양과 가장 유사한 정상 세포 유형)으로 분류하고, 표현형, 분자 또는 세포유전학적 특성을 정의한다. 다섯 가지 그룹은 다음과 같다:
1. 성숙한 B 세포 신생물(neoplasma)
2. 성숙한 T 세포 및 NK 세포 신생물
3. 림프계 전구세포 신생물(precursor lymphoid neoplasm)
4. 호지킨 림프종
5. 면역결핍 관련 림프증식성 장애(immunodeficiency-associated lymphoproliferative disorder)
림프종은 15 내지 24세의 젊은이에게 가장 흔한 혈액암이며, 매년 영국에서 14,000건 이상의 새로운 림프종 사례가 진단된다.
현재의 치료는 화학요법, 방사선요법, 표적 요법 및 수술 중 하나 이상을 포함할 수 있다. 일부 비호지킨 림프종에서, 림프종 세포에 의해 생성된 단백질의 양이 증가하면 혈액이 너무 걸쭉해져서 단백질 제거를 위해 혈장 교환술(plasmapheresis)이 수행된다.
본 발명의 일 양태에서, 혈액암은 림프종이다.
본 발명에 따른 혈액암은 대안적으로 골수종일 수 있다. 골수종은 골수에서 발생하는 형질 세포(항체 생산을 정상적으로 담당하는 백혈구의 한 유형)의 암이다. 골수종 세포는 혈류를 통해 이동하여 다른 뼈에 모일 수 있다. 골수종은 골수의 많은 부위에서 발생하므로, 종종 다발성 골수종이라 지칭된다.
초기에는 종종 어떠한 증상도 나타나지 않는다. 진행되면, 뼈 통증, 출혈, 잦은 감염 및 빈혈이 발생할 수 있다. 합병증은 아밀로이드증(amyloidosis)을 포함할 수 있다. 골수에서의 골수종 세포의 과잉 생성은 혈액을 구성하는 다른 유형의 세포인 백혈구, 적혈구 및 혈소판의 생성에 영향을 미친다. 골수종 세포는 또한 뼈에 손상을 일으켜 부러지기 쉽게 할 수 있다.
골수종은 일반적으로 나이가 많은 환자에서 발생하지만, 때로는 40세 미만의 환자에서도 발견된다. 골수종 세포로 인한 뼈 손상은 고칼슘혈증(hypercalcaemia)을 유발할 수 있다. 높은 칼슘은 탈수(dehydration) 및 신장 손상을 유발할 수 있다.
미국에서 골수종의 유병률(prevalence)은 약 77,600건으로 보고되었으며, 2014년에는 약 24,000건의 새로운 사례가 보고되었다. 평균 5년 생존율은 연령, 진단의 병기 등과 같은 인자에 따라 생존율이 45% 미만인 것으로 추정된다. 환자는 전형적으로 반복 라운드(repeat round)의 병용 요법으로 치료되며, 각각의 연속적인 치료 라인에서 재발하는 시간 간격이 더 짧아진다. 대다수의 환자는 결국 재발하며, 이는 더 치료될 수 없다. 이 말기(late stage)에서, 평균 생존기간(median survival)은 겨우 6 내지 9개월이며, 치료는 주로 증상을 감소시키고 삶의 질을 관리하는 완화적인 것이다.
상기 논의된 바와 같이, 골수종은 형질 세포를 포함하는 질병이다.
골수종은 다양한 규칙에 따라 분류 및/또는 계층화될 수 있다. 예를 들어, Fonseca et al. Leukemia (2009) 23, 2210-2221 참조. 질병의 규모(bulk) 및 공격성(aggressiveness)을 특성화하는 여러 체계가 사용되고 있다.
예를 들어, 국제 골수종 연구 그룹 진단 기준(International Myeloma Working Group diagnostic criteria) 및 국제 병기 결정 분류 체계(International Staging System, ISS)가 일반적으로 사용된다.
국제 골수종 연구 그룹 진단 기준:
무증상(asymptomatic/smoldering) 골수종: 단일클론성 (M)-단백질 ≥ 30 g/L 및/또는 골수 클론성 세포 ≥ 10%이지만, 관련 장기 또는 조직 손상(organ or tissue impairment, ROTI)(말단 기관(end-organ) 손상)은 없음.
증상을 동반하는(symptomatic) 골수종: M-단백질 ≥ 30 g/L 및/또는 골수 클론성 세포 ≥ 10%이며, 형질 세포 증식 과정이 원인일 수 있는 ROTI(말단 기관 손상)의 증거가 반드시 있어야 함; CRAB(칼슘, 신부전, 빈혈 및 골 병변: 혈청 칼슘 ≥ 11.5 mg/100 mL 증가; 신부전[혈청 크레아티닌 > 1.73 mmol/L]; 정상의 하한치 이하인 2 g/100 mL를 초과하는 헤모글로빈 값 또는 10 g/100 mL 미만의 헤모글로빈 값을 갖는 정색소성(normochromic), 정구성(normocytic) 빈혈; 용해성 병변(lytic lesion), 중증 골감소증(osteopenia) 또는 병리학적 골절(pathologic fracture))에 의해 나타남.
비분비성(nonsecretory) 골수종: 혈청 및 소변 중 M-단백질의 부재(absence), 골수 형질세포종(plasmacytosis) 및 ROTI.
골수종의 병기는 국제 병기 분류 체계에 따라 분류될 수 있다:
1기: 혈청 베타-2 마이크로글로불린 < 3.5 mg/L 및 혈청 알부민 ≥ 3.5 g/dL
2기: 1기도 3기도 아님
3기: 혈청 베타-2 마이크로글로불린 ≥ 5.5 mg/L
본원에서 "골수종"에 대한 언급은 모든 유형 및 병기의 골수종을 포함하는 것으로 의도된다.
예를 들어, 골수종은 다발성 골수종(multiple myeloma)일 수 있다.
골수종은 1기, 2기 또는 3기 골수종일 수 있다.
암 줄기세포(cancer stem cell)
본 발명의 또 다른 양태에서, 본 발명자는 놀랍게도 5T4가 혈액암 및 고형 종양을 특징으로 하는 암 둘 다의 암 줄기세포에서 발현됨을 발견하였다.
암 줄기세포는 막결합 다중 약물 수송체(membrane-bound multi-drug transporter) 및 표면 마커의 발현, 자가 재생과 분화 능력 및 유사한 신호전달 경로에 대한 의존성을 포함하는 정상 줄기세포의 특성 중 일부를 공유한다. 이러한 특성은 CSC가 기존의 화학요법을 회피할 수 있게 하며, 이는 치료 후 많은 종양이 재발하는 이유를 설명할 수 있다(도 18).
본 실시예에서 입증되는 바와 같이, 5T4는 고형 종양 및 혈액암 둘 다의 줄기세포에서 발현된다. 본원에서 사용되는 "암 줄기세포(cancer stem cell)"는 정상 줄기세포와 관련된 특징을 보유하는 암 줄기세포를 지칭한다. 예를 들어, 특정 암 샘플에서 발견되는 모든 세포 유형을 만들어내는 능력. 암 줄기세포는 종양 형성성(tumorigenic or tumour-forming) 세포이다. 암 줄기세포는 자가 재생 및 여러 세포 유형으로의 분화의 줄기세포 과정을 통해 종양을 생성할 수 있다. 이러한 세포는 종양에서 별개의 집단으로서 지속될 수 있고, 새로운 종양을 만들어냄으로써 재발 및 전이를 유발할 수 있다.
도 18에 도시된 바와 같이, 암 줄기세포를 표적화하는 것은 암 줄기세포를 사멸시켜 종양 세포의 생존 및 종양 재발 유발 가능성을 감소시키기 때문에, 환자 결과를 개선할 수 있다.
따라서, 암 줄기세포 상에 존재하는 5T4를 표적화하는 것은 암의 재발 가능성을 감소시킬 수 있다.
따라서, 일 양태에서, 본 발명은 대상체에서 암 재발을 예방 또는 감소시키는 방법을 제공하며, 여기에서 상기 방법은 상기 대상체에게 5T4 표적화제를 투여하는 단계를 포함한다.
추가의 양태에서, 본 발명은 대상체에서 암 재발을 예방 또는 감소시키는 데 사용하기 위한 5T4 표적화제를 제공한다.
또한, 대상체에서 암 재발을 예방 또는 감소시키기 위한 약제의 제조에 있어서 5T4 표적화제의 용도, 및 대상체에서 암 재발을 예방 또는 감소시키기 위한 5T4 표적화제의 용도가 제공된다.
용어 "암 재발(cancer relapse)"은 개선 또는 관해(remission) 기간 후의, 암의 재발(return)의 방사선 진단, 또는 암의 재발의 징후 및 증상을 포함하는 재발의 진단을 지칭한다.
본 발명의 일 양태에서, 암 전이(cancer metastasis)를 치료하는 방법이 제공되며, 여기에서 상기 방법은 상기 대상체에게 5T4 표적화제를 투여하는 단계를 포함한다. 추가의 양태에서, 본 발명은 대상체에서 암 전이를 치료하는 데 사용하기 위한 5T4 표적화제를 제공한다. 또한, 대상체에서 암 전이를 치료하기 위한 약제의 제조에 있어서 5T4 표적화제의 용도, 및 암 전이를 치료하기 위한 5T4 표적화제의 용도가 제공된다.
또한, 본 발명은 암 환자의 생존기간을 향상시키기 위한 방법에 관한 것이며, 여기에서 상기 방법은 상기 대상체에게 5T4 표적화제를 투여하는 단계를 포함한다. 추가의 양태에서, 본 발명은 암 환자의 생존기간을 향상시키는데 사용하기 위한 5T4 표적화제를 제공한다. 또한, 암 환자의 생존기간을 향상시키기 위한 약제의 제조에 있어서 5T4 표적화제의 용도, 및 암 환자의 생존기간을 향상시키기 위한 5T4 표적화제의 용도가 제공된다.
또한, 본 발명은 암 환자에서 암 줄기세포를 감소시키거나 제거하는 방법에 관한 것이며, 상기 방법은 상기 대상체에게 5T4 표적화제를 투여하는 단계를 포함한다. 추가의 양태에서, 본 발명은 암 환자에서 암 줄기세포를 감소시키거나 제거하는 데 사용하기 위한 5T4 표적화제를 제공한다. 또한, 암 환자에서 암 줄기세포를 감소시키거나 제거하기 위한 약제의 제조에 있어서 5T4 표적화제의 용도, 및 암 환자에서 암 줄기세포를 감소시키거나 제거하기 위한 5T4 표적화제의 용도가 제공된다.
표현 "암 줄기세포를 감소시키는 것"은 종양 조직에서, 예를 들어 종양 조직의 주어진 부피 또는 주어진 단면적(section area)에서 암 줄기세포의 수를 감소시키는 것을 포괄한다.
일 양태에서, 대상체는 이전에 대안적인 암 치료, 예컨대 화학요법제로 치료된 적이 있을 수 있다. 대상체는 화학요법 치료와 같은 적어도 하나의 암 치료법에 불응성(refractory)일 수 있다. 대상체는 화학요법 치료와 같은 암 치료법으로 이전에 치료 후 재발 중일 수 있다. 암은 약물 내성(drug resistant) 암일 수 있다.
일 양태에서, 암은 본원에 기술된 바와 같은 혈액암이다.
일 양태에서, 혈액암은 만성 림프구성 백혈병, 다발성 골수종, 급성 골수성 백혈병 및 B 세포 급성 림프아구성 림프종으로부터 선택될 수 있다.
일 양태에서, 암은 고형 종양을 특징으로 하며, 상기 암은 두경부 편평상피세포 암종(head and neck squamous cell carcinoma, HNSCC), 비소세포 폐암(non small cell lung cancer, NSCLC), 유방암(breast cancer) 또는 위암(gastric cancer)이 아니다. 일 양태에서, 암은 두경부 편평상피세포 암종(HNSCC), 비소세포 폐암(NSCLC), 유방암, 전립선암(prostate cancer), 간세포 암종(hepatocellular carcinoma), 위암 또는 췌장암(pancreatic cancer)이 아니다.
비제한적인 예로, 고형 종양을 특징으로 하는 암은 담관암(bile duct cancer), 골암(bone cancer), 방광암(bladder cancer), 뇌/CNS 암(brain/CNS cancer), 자궁경부암(cervical cancer), 자궁내막암(endometrial cancer), 근육암(muscle cancer), 중피종(mesothelioma), 신경암(neuronal cancer), 식도암(oesophageal cancer), 난소암(ovarian cancer), 흉막/복막암(pleural/peritoneal membrane cancer), 신장암(renal cancer), 피부암(skin cancer), 소세포 폐암(small cell lung cancer, SCLC), 고환암(testicular cancer), 갑상선암(thyroid cancer), 태반암(uterine cancer), 자궁암(uterine cancer) 및 외음부암(vulval cancer)을 포함한다.
일 양태에서, 암은 난소암, 교아세포종(glioblastoma) 및 결장직장암(colorectal cancer)으로부터 선택된다. 일 양태에서, 암은 소세포 폐암(SCLC)일 수 있다.
일 양태에서, 암은 난소암 또는 교아세포종이다.
5T4 항원(5T4 antigen)
5T4는 신장, 유방, 위장관, 결장 및 난소 암종의 70% 이상에서 발현되는 것으로 알려진 72 kDa의 종양태아성 당단백질(oncofetal glycoprotein)이다. 그러나 본 발명 이전에는 이것은 혈액 악성 종양에서 발현되는 것으로 생각되지 않았다.
조직화학적 염색에 의해 검출된 5T4 발현은 소화관 및 뇌하수체에서 관찰된 낮은 수준의 산발성 염색만으로 종양 특이적인 것으로 보인다. 그러나 이 염색 수준이 매우 낮아서, 특이적인지를 결정하기가 어렵다. 면역조직화학적 분석은 5T4 발현이 결장직장암, 난소암, 위암 및 비소세포 폐암에서 불량한 예후의 지표(indicator)임을 나타낸다. 또한, 종양 세포가 5T4를 암호화하는 cDNA로 형질도입될 때, 이들은 이 분자의 발현이 종양에서 전이 특성을 유도할 수 있음을 시사하는 증가된 이동성을 나타낸다.
5T4 항원은 5T4로 공지된 폴리펩티드이며, 예를 들어 WO89/07947에서 특성이 분석되었다. "5T4"는 Myers 등에 의해 특성 분석된 바와 같이 인간 5T4일 수 있고, 이의 서열은 GenBank의 등록번호 Z29083에 나타나 있다. 마우스 또는 쥣과(murine) 5T4(m5T4)의 서열은 GenBank의 등록번호(accession no.) AJ012160에 나타나 있다. 마우스 및 인간 5T4 유전자의 구성(organisation)은 예를 들어, King et al. Biochim Biophys Acta 1999; 1445 (3); 257-70에 기술되어 있다. 개 및 고양이 5T4 서열은 예를 들어, WO02/38612에 기술되어 있다.
인간 5T4 cDNA의 서열 분석으로 이 항원이 단백질의 류신 풍부 반복부(leucine rich repeat, LRR) 패밀리의 구성원임이 확인되었다(Myers, K. A. et al. (1994)). 이 단백질은 44개 아미노산의 짧은 세포질 꼬리(cytoplasmic tail) 및, 연관된 시스테인 함유 측부 영역(cysteine containing flanking region)을 갖는 두 개의 류신 풍부 반복부(LRR) 영역으로 이루어지며 친수성 도메인에 의해 분리된 세포 외 도메인을 함유한다. 세포 외 도메인의 7개의 공통 NxS/T N-글리코실화 부위(consensus NxS/T N-glycosylation site)는 모두 소량의 코어 푸코실화(core fucosylation)를 갖는 두 개의 높은 만노오스 사슬(mannose chain) 및 다섯 개의 시알산화된(sialylated) 바이-안테너리(bi-antennary) 내지 테트라-안테너리(tetra-antennary) 복합 사슬을 포함하는 복합 글리칸(complex glycan)의 조합으로 글리코실화된다(Shaw, D. M. et al. (2002)).
인간 및 마우스 5T4 cDNA 사이의 서열 비교(King et al. (1999))는 종 사이에서 5T4 분자의 고도로 보존된(highly conserved) 구조를 보여준다. 이들 분자는 81%의 아미노산 동일성(identity)을 공유하며, 세포질 및 막관통 도메인은 완전히 보존된다. 인간 분자의 7개의 N-연결 글리코실화 부위 중에서 여섯 개가 마우스에서 보존된다. 대부분의 N 말단 부위(N81)는 없지만, C 말단 측부 영역에 추가 부위(N334)가 존재하여, 인간 분자와 유사한 수준의 글리코실화가 예상된다. 쥣과 단백질은 친수성 도메인의 글리코실화 부위에 인접한, 추가의 6개의 아미노산을 함유하며, 이는 선행하는 6개 아미노산의 직접적인 반복부이다. 세포영양막(trophoblast)에서 5T4의 발현은 그것이 모든 포유동물에 대한 공통적인 발달 단계에 존재함을 시사한다. 이는 5T4가 포유동물 전체에 걸쳐 고도로 보존되어 있을 가능성을 높인다.
본원에 사용된 표현 "5T4 항원" 또는 "5T4"는 이의 단편, 그리고 바람직하게는 별개의 에피토프를 갖는 단편, 및 5T4의 항원성을 보유하는 아미노산 삽입, 결실 또는 치환을 포함하는 이의 변이체를 포괄한다. 적합하게는, 용어 5T4 항원은 5T4의 적어도 하나의 공통 항원 결정기(common antigenic determinant)를 보유하는, 펩티드 및 5T4의 다른 단편을 포함한다.
따라서 본원에 언급되는 5T4 항원은 아미노산 돌연변이체, 글리코실화 변이체, 및 5T4의 생리학적 및/또는 물리적 특성을 보유하는 5T4의 기타 공유 유도체(covalent derivative)를 포함한다. 예시적인 유도체로는 5T4가 자연 발생적인 아미노산 이외의 모이어티(moiety)로 치환, 화학적, 효소적 또는 기타 적절한 수단에 의해 공유적으로 변형되는(covalently modified) 분자를 포함한다. 이러한 모이어티는 효소 또는 방사성 동위원소와 같은 검출 가능한 모이어티일 수 있다.
나아가, 특정 종, 바람직하게는 포유동물 내에서 발견되는 5T4의 자연 발생적인 변이체가 포함된다. 이러한 변이체는 동일한 유전자 패밀리의 관련 유전자에 의해, 특정 유전자의 대립 유전자(allelic) 변이체에 의해 암호화될 수 있거나, 또는 5T4 유전자의 대안적인 스플라이싱 변이체를 나타낸다.
공통 항원 결정기를 보유하는 유도체는 5T4의 단편일 수 있다. 5T4의 단편은 이의 개별적인 도메인뿐만 아니라, 이 도메인으로부터 유래되는 더 작은 폴리펩티드도 포함한다. 바람직하게는, 본 발명에 따른 5T4로부터 유래되는 더 작은 폴리펩티드는 5T4의 특징인 단일 에피토프를 정의한다. 단편은 그것들이 5T4의 하나의 특징을 보유하기만 하면 이론상으로 거의 임의의 크기일 수 있다. 바람직하게는, 단편의 길이는 5 내지 400개 아미노산일 것이다. 더 긴 단편은 전장 5T4의 절단부(truncation)로 간주되며, 일반적으로 용어 "5T4"에 포함된다. 유리하게는, 단편은 5 내지 25개 아미노산 길이 단위의 비교적 작은 펩티드이다. 약 9개 아미노산 길이의 펩티드가 바람직하다.
5T4의 유도체는 또한 5T4의 적어도 하나의 특징적 특성을 유지하도록 하기 위해, 아미노산 결실, 부가 또는 치환을 함유할 수 있는 이의 돌연변이체를 포함한다. 따라서, 보존적 아미노산 치환은 5' 또는 3' 말단으로부터의 절단일 수 있는 바와 같이, 5T4의 성질을 실질적으로 변경시키지 않고 이루어질 수 있다. 나아가, 결실 및 치환은 본 발명에 포함되는 5T4의 단편에 대해서도 이루어질 수 있다. 5T4 돌연변이체는 예를 들어, 하나 이상의 아미노산의 부가, 교환 및/또는 결실을 초래하는 시험관 내(in vitro) 돌연변이 유발을 거친, 5T4를 암호화하는 DNA로부터 생산될 수 있다. 예를 들어, 5T4의 치환, 결실 또는 삽입 변이체는 재조합 방법에 의해 제조되며, 5T4의 천연형과의 면역 교차반응성(immuno-crossreactivity)에 대해 스크리닝될 수 있다.
5T4의 단편, 돌연변이체 및 기타 유도체는 바람직하게는 5T4와의 실질적인 상동성(substantial homology)을 보유한다. 본원에서 사용되는 "상동성"은 두 개체(entity)가 당업자가 이들이 기원 및 기능면에서 유사하다고 결정하기에 충분한 특징을 공유함을 의미한다.
상동성이 서열 동일성(identity)을 나타내는 "실질적인 상동성"은 직접 서열 정렬 및 비교에 의해 판단되는 바와 같이, 40% 초과의 서열 동일성, 바람직하게는 45% 초과의 서열 동일성 및 가장 바람직하게는 50% 초과의 서열 동일성을 의미한다.
5T4
표적화
(targeting 5T4)
"표적화"는 치료적 또는 예방적 개입(intervention)이 5T4 항원을 기초로 하거나 5T4 항원을 대상으로 함을 의미한다. 이는 예를 들어, 능동적 면역요법 접근법(active immunotherapy approach), 예컨대 5T4 항원을 포함하는 면역학적 조성물 또는 백신을 대상체에게 투여하는 것을 포함할 수 있다. 대안적으로, 수동적 면역요법 접근법(passive immunotherapy approach), 예를 들어 5T4 항원을 인식하는 T 또는 B 세포 또는 T 및 B 세포가 종양, 또는 다른 체조직(림프절, 혈액 또는 복수를 포함하나 이에 한정되지 않음)으로부터 분리되고, 생체 외(ex vivo) 또는 시험관 내(in vitro)에서 증식되어, 대상체에게 재투여되는 입양 T 세포 이식(adoptive T cell transfer) 또는 B 세포 이식을 취할 수 있다. 이러한 T 또는 B 세포는 5T4 항원을 인식하도록 유전자 조작될 수 있다.
추가의 대안에서, 5T4 항원을 인식하는 항체가 대상체에게 투여될 수 있다. 일 양태에서, 이러한 항체는 5T4 항원을 발현하는 세포에 세포독성 페이로드(cytotoxic payload)를 전달하도록 변형될 수 있다.
본원에서 논의되는 바와 같이, 또 다른 양태에서, 5T4 항체 약물 컨쥬게이트(conjugate)가 사용될 수 있다. 항체 약물 컨쥬게이트(antigen-drug conjugate, ADC)는 단일클론성 항체의 결합 특이성을 화학치료제의 효능과 결합시킨다. 한 예는 환자에서 5T4 양성 암, 예를 들어 결장직장암 및 유방암을 치료하는데 유용한, 비 천연 아미노산 및 돌라스타틴 링커(dolastatin linker) 유도체를 함유하는 특이적 항체를 포함하는 항체 약물 컨쥬게이트이다(예를 들어, WO2013/068874 참조).
당업자는 세포 표면 항원의 경우, 항체가 항원을 인식할 것임을 이해할 것이다. 항원이 세포 내 항원인 경우, 항체는 항원 펩티드:MHC 복합체를 인식한다. 항원을 "인식하는" 항체는 이러한 가능성을 모두 포괄한다.
본원에서 정의되는 바와 같이, "치료(treatment)"는 치료 이전의 증상과 비교하여, 치료중인 질병의 하나 이상의 증상을 감소, 완화 또는 제거하는 것을 지칭한다.
"예방(prevention or prophylaxis)"은 질병의 증상의 개시(onset)를 지연시키거나 방지하는 것을 지칭한다. 예방은 절대적일 수 있거나(어떠한 질병도 발생하지 않도록 함), 또는 일부 개체에서만 또는 한정된 기간 동안만 효과적일 수 있다.
본원에 기술된 바와 같이, 본 발명의 일 양태에서, 대상체는 포유동물, 바람직하게는 고양이, 개, 말, 당나귀, 양, 돼지, 염소, 소, 마우스, 랫트, 토끼 또는 기니피그이지만, 가장 바람직하게는 대상체는 인간이다.
본원에 기술된 바와 같이, 본 발명의 일 양태에서, 본 발명에 따른 암의 치료 또는 예방 방법은 상기 치료 또는 예방을 필요로 하는 대상체를 확인하는 단계를 포함한다.
본원에 기술된 바와 같이, 본 발명의 일 양태에서, 환자로부터 얻은 종양 샘플은 5T4 표적화제 투여 전에 5T4 발현에 대해 분석 또는 스크리닝될 수 있다. 예를 들어, 샘플은 대상체로부터의 종양 샘플, 혈액 샘플 또는 조직 샘플 또는 말초 혈액 단핵구 세포 샘플일 수 있다. 일 양태에서, 샘플은 골수 샘플일 수 있다. 5T4 표적화제는 종양 샘플이 5T4 발현을 나타내는 환자에게 본 발명에 따라 투여될 수 있다. 즉, 본 발명에 따른 암은 5T4 양성 암, 즉 5T4를 발현하는 세포를 포함하는 5T4 양성 암일 수 있다.
항체
일 양태에서, 5T4 표적화제는 항체이다. 즉, 5T4를 인식하거나 5T4에 대해 특이적인 항체이며, 즉 항체는 5T4 항원에 특이적으로 결합한다.
"특이적 결합(specific binding)"은 이종(동종) 샘플에 동시에 존재하는 2개의 분자 종이 샘플 내의 다른 분자 종에 결합하는 것보다 우선하여 서로 결합하는 능력을 지칭한다. 전형적으로, 특이적 결합 상호작용은 반응에서 적어도 2배, 더욱 전형적으로는 적어도 10배, 종종 적어도 100배까지 우연한 결합 상호작용을 구별할 것이며; 분석물 검출에 사용될 때, 특이적 결합은 이종(동종) 샘플 내의 분석물의 존재를 결정할 때 충분히 차별적이다.
"항체(antibody)"(Ab)는 단일클론성 항체, 다클론성 항체, 다중특이적 항체(예를 들어, 이중 특이적 항체) 및 원하는 생물학적 활성을 나타내는 항체 단편을 포함한다. 항체 단편은 적어도 하나의 항체-항원 결합 부위를 포함하는 단편일 수 있다. 항체 단편은 예를 들어, 5T4 또는 이의 단편에 대한 특이적인 결합을 나타낼 수 있다. 따라서, 생물학적 활성은 5T4에 대한 결합 활성일 수 있다. 용어 "면역글로불린(immunoglobulin)"(Ig)은 "항체"와 상호 교환적으로 사용될 수 있다.
"항체 단편"은 온전한(intact) 항체의 부분, 바람직하게는 온전한 항체의 항원 결합 또는 가변 영역을 포함한다. 항체 단편의 예는 Fab, Fab', F(ab')2 및 Fv 단편; 선형 항체; 단일-사슬 항체 분자; 및 항체 단편으로부터 형성된 다중특이적 항체를 포함한다.
"Fc" 단편은 이황화물에 의해 함께 유지되는 두 H 사슬의 카복시 말단 부분을 포함한다. 항체의 효과기(effector) 기능은 Fc 영역의 서열에 의해 결정되며, 이 영역은 또한 특정 유형의 세포에서 발견되는 Fc 수용체(FcR)에 의해 인식되는 부분이다.
일 양태에서, 항체는 단일클론성 항체이다.
본원에 사용되는 용어 "단일클론성 항체(monoclonal antibody)"는 실질적으로 동종인 항체의 집단으로부터 수득되는 항체를 지칭하며, 즉 집단을 포함하는 개별 항체는 소량으로 존재할 수 있는 가능한 자연 발생적인 돌연변이를 제외하고는 동일하다.
단일클론성 항체는 단일 항원 부위에 대해 매우 특이적이다. 나아가, 상이한 결정인자(determinant)(에피토프)에 대한 상이한 항체를 포함하는 다클론성 항체 제제와는 대조적으로, 각각의 단일클론성 항체는 항원의 단일 결정인자에 대한 것이다. 단일클론성 항체는 당해 분야의 표준 방법에 의해 제조될 수 있다.
단일클론성 항체는 당해 분야에 공지된 방법, 예를 들어 하이브리도마 방법을 이용하여 제조될 수 있다. 하이브리도마 방법에서, 마우스 또는 다른 적절한 숙주 동물은 전형적으로 면역제(immunizing agent)로 면역되어 표적, 즉 본 경우에서는 5T4에 특이적으로 결합할 항체를 생산하거나 생산할 수 있는 림프구를 유도한다.
또한, 단일클론성 항체는 당해 분야에 공지된 재조합 DNA 방법에 의해 생산될 수 있다. 종래의 절차를 이용하여(예를 들어, 쥣과 항체의 중사슬 및 경사슬를 암호화하는 유전자에 특이적으로 결합할 수 있는 올리고뉴클레오티드 프로브를 이용함으로써) 적합한 단일클론성 항체를 암호화하는 DNA가 분리 및 시퀀싱될 수 있다.
또한, 시험관 내 방법은 1가 항체를 제조하는데 적합하다. 항체의 단편, 특히 Fab 단편을 생성하기 위한 항체의 분해(digestion)는 당해 분야에 공지된 통상의 기술을 사용하여 달성될 수 있다. 예를 들어, 분해는 파파인을 사용하여 수행될 수 있다. 파파인 분해의 예는 WO 94/29348에 기술되어 있다. 항체의 파파인 분해는 전형적으로 각각 단일 항원 결합 부위를 갖는 Fab 단편이라 불리는 두 개의 동일한 항원 결합 단편과 나머지(residual) Fc 단편을 생성한다. 펩신 처리는 F(ab')2 단편 및 pFc' 단편을 생성한다.
단일클론성 항체는 중사슬 및/또는 경사슬의 일부가 특정 종으로부터 유래하거나 또는 특정 항체 종류(class) 또는 하위 종류(subclass)에 속하는 항체의 상응하는 서열과 동일하거나 이에 대해 상동인 "키메라 항체"를 포함할 수 있으며, 사슬(들)의 나머지는 동일한 생물학적 활성을 나타내는 한 다른 종으로부터 유래하거나 또는 다른 항체 종류 또는 하위 종류에 속하는 항체뿐만 아니라 이러한 항체의 단편의 상응하는 서열과 동일하거나 이에 대해 상동이다.
또한, 항체 단편은 단편의 결합 활성이 비변형 항체 또는 항체 단편과 비교하여 현저하게 변경되거나 손상되지 않는다면, 특정 영역 또는 특정 아미노산 잔기의 삽입, 결실, 치환 또는 다른 선택된 변형을 포함할 수 있다.
이들 변형은 이황화 결합이 가능한 아미노산을 제거/부가하고, 생체 수명(bio-longevity)을 증가시키고, 그것의 분비 특성을 변경하는 등과 같은 몇몇 부가적인 특성을 제공할 수 있다. 어떤 경우든, 항체 단편은 결합 활성, 결합 도메인에서의 결합의 조절 등과 같은 생물활성(bioactive) 특성을 가져야 한다. 항체의 작용 또는 활성 영역은 단백질의 특정 영역의 돌연변이 유발(mutagenesis) 후 발현 및 발현된 폴리펩티드의 시험에 의해 확인될 수 있다. 이러한 방법은 당업자에게 공지되어 있을 것이며, 항체 단편을 암호화하는 핵산의 부위-특이적 돌연변이 유발(site-specific mutagenesis)을 포함할 수 있다.
항체는 인간화(humanized) 항체 또는 인간 항체일 수 있다. 비인간(예를 들어, 쥣과) 항체의 인간화된 형태는 비인간 면역글로불린으로부터 유래하는 최소 서열을 함유하는 키메라 면역글로불린, 면역글로불린 사슬 또는 이의 단편(예컨대, Fv, Fab, Fab' 또는 다른 항체의 항원-결합 하위 서열)이다.
인간화 항체는 수용(recipient) 항체의 상보성 결정 영역(complementary determining region, CDR)으로부터의 잔기가 원하는 특이성, 친화도 및 능력을 갖는 마우스, 랫트 또는 토끼와 같은 비인간 종(공여(donor) 항체)의 CDR로부터의 잔기로 대체되는 인간 면역글로불린(수용 항체)을 포함한다. 일부 경우에, 인간 면역글로불린의 Fv 프레임워크(framework, FR) 잔기는 상응하는 비인간 잔기로 대체된다. 또한, 인간화 항체는 수용 항체에서도, 유입된(imported) CDR 또는 프레임워크 서열에서도 발견되지 않는 잔기를 포함할 수 있다. 일반적으로, 인간화 항체는 모든 또는 실질적으로 모든 적어도 하나의, 전형적으로는 두 개의 가변 도메인을 포함할 것이며, 여기서 모든 또는 실질적으로 모든 CDR 영역은 비인간 면역글로불린의 CDR 영역과 상응하며, 모든 또는 실질적으로 모든 FR 영역은 인간 면역글로불린 공통 서열(consensus sequence)의 FR 영역이다. 인간화 항체는 면역글로불린 불변 영역(Fc)의 적어도 일부, 전형적으로는 인간 면역글로불린의 불변 영역(Fc)의 적어도 일부를 포함할 수 있다.
비인간 항체를 인간화하기 위한 방법은 당해 분야에 공지되어 있다. 일반적으로, 인간화 항체는 비인간 공급원(source)으로부터 인간화 항체 내로 도입되는 하나 이상의 아미노산 잔기를 갖는다. 이러한 비인간 아미노산 잔기는 종종 "유입(import)" 잔기라 지칭되며, 이들은 전형적으로 "유입" 가변 도메인으로부터 받아들여진다. 인간화는 본질적으로 인간 항체의 상응하는 서열을 설치류 CDR 또는 CDR 서열로 대체함으로써 수행될 수 있다. 따라서, "인간화" 항체는 온전한 인간 가변 도메인보다 실질적으로 적은 가변 도메인이 비인간 종으로부터의 상응하는 서열로 대체된 키메라 항체이다. 실제로, 인간화 항체는 전형적으로 일부 CDR 잔기 및 가능하게는 일부 FR 잔기가 설치류 항체의 유사한 부위로부터의 잔기로 치환된 인간 항체이다.
형질전환 동물(예를 들어, 마우스)은 내인성 면역글로불린 생산의 부재 하에 인간 항체의 전체 레퍼토리를 생성하는 데 사용될 수 있다. 예를 들어, 키메라 및 생식선 돌연변이 마우스에서 항체 중사슬 연결 영역 유전자의 동형 접합 결실(homozygous deletion)은 내인성 항체 생산의 완전한 억제를 초래하는 것이 기술된 바 있다. 이러한 생식선 돌연변이 마우스에서 인간 생식선 면역글로불린 유전자 배열(array)의 전달은 항원 유발(challenge)시에 인간 항체의 생산을 초래할 것이다. 또한, 인간 항체는 파지 디스플레이 라이브러리에서 생산될 수 있다.
항체는 약학적으로 허용 가능한 담체로 대상체에게 투여될 수 있다. 전형적으로, 제형을 등장성으로 만들기 위해 적절한 양의 약학적으로 허용 가능한 염이 제형에 사용된다.
약학적으로 허용 가능한 담체의 예는 식염수, 링거 용액 및 덱스트로스 용액을 포함한다. 항체를 함유하는 고체 소수성 고분자의 반투과성 매트릭스와 같은 지속 방출성 제제도 사용될 수 있다. 예를 들어, 투여 경로 및 투여되는 항체의 농도에 따라 특정 담체가 더 바람직할 수 있음은 당업자에 명백할 것이다.
항체는 주사(예를 들어, 정맥 내, 복강 내, 흉강 내, 피하, 근육 내)에 의해, 또는 유효한 형태로 혈류에 확실히 전달되도록 하는 주입(infusion)과 같은 다른 방법에 의해 대상체에게 투여될 수 있다. 또한, 항체는 국소적 및 전신적 치료 효과를 발휘할 수 있도록 종양 내(intratumoral) 또는 종양 주위(peritumoral) 경로에 의해 투여될 수 있다.
유효 투여량 및 항체 투여 스케쥴은 경험적으로 결정될 수 있으며, 이러한 결정을 내리는 것은 당해 분야의 기량 내에 있다. 당업자는 투여되어야 하는 항체의 투여량이 예를 들어, 항체를 투여할 대상체, 투여 경로, 사용되는 항체의 특정 유형 및 투여되는 다른 약물에 따라 달라질 수 있음을 이해할 것이다.
단독으로 사용되는 항체의 전형적인 1일 투여량은 하루에 약 1 μg/kg 내지 최대 100 mg/kg 체중 이상의 범위일 수 있다.
항체 투여 후, 항체의 효능은 당업자에게 공지된 다양한 방법으로 평가될 수 있다. 예를 들어, 치료를 받는 대상체에서의 암세포의 규모, 수 및/또는 분포가 모니터링될 수 있다. 항체를 투여하지 않을 때 발생하는 질병의 경과와 비교하여, 종양 성장을 정지시키고, 종양 수축(shrinkage)을 초래하고/하거나 새로운 종양의 발생을 방지하는, 치료적으로 투여되는 항체는 암 치료에 효과적인 항체이다.
본 발명에 따르면, 항체는 5T4 특이적 항체이다.
5T4 특이적 항체는 예를 들어, R&D Systems(미국 미네소타 주), LifeSpan BioSciences, Inc(미국 워싱턴 주) 및 Creative Biolabs(미국 뉴욕 주)로부터 상업적으로 이용 가능하다.
또한, 5T4 특이적 항체의 예는 WO 98/55607, WO2001/036486, WO2003/038098, WO2006/031653, US2006/0088522, US2016/0185859, WO2007/106744, WO2012/131527 및 WO2013/068874에 기술되어 있다.
또한, 단일 사슬 항-5T4 항체 및 치료 분자에 융합된 항-5T4 항체 서열을 포함하는 융합 단백질이 기술된 바 있다. 예를 들어, 인간 IgG1 불변 도메인 또는 쥣과 B7.1의 세포 외 도메인에 융합된 항-5T4 항체 서열은 5T4를 발현하는 종양 세포주의 세포 용해(cytolysis)를 유도한다(Myers et al. (2002) Cancer Gene Ther. 9: 884-96, Shaw et al. (2000) Biochim. Biophys. Acta. 1524: 238-46; 미국 특허출원 공개번호 2003/0018004). 유사하게는, 슈퍼항원(superantigen)에 융합된 단일 사슬 항-5T4 항체는 시험관 내에서 비소세포 폐 암종 세포의 T-세포 의존성 세포 용해를 자극할 수 있다(Forsberg et al. (2001) Br. J. Cancer 85: 129-36). 돌연변이된 슈퍼항원 스태필로코커스 엔테로사이토톡신 A(staphylococcal enterocytotoxin A, SEA)에 융합된 단일클론성 항체 5T4의 쥣과 Fab 단편인 PNU-214936을 이용한 1상 임상 시험은 제한된 세포독성 및 일부 항-종양 반응을 보여주었다(Cheng et al. (2004) J. Clin. Oncol. 22(4):602-609). 또한, 이 제품의 3상 임상 시험은 Hawkins et al. Clin Cancer Res. 2016 Jul 1;22(13):3172-81. doi: 10.1158/1078-0432.CCR-15-0580. Epub 2016 Feb 5에 공개되었다.
일 양태에서, 항체는 H8 항체(Hole and Stern 1988 Br. J. Cancer 57:239-246 참조), 또는 H8 항체를 기초로 한 항체일 수 있다. H8 항체는 5T4 항원의 입체형태(conformational) 에피토프(예를 들어, Shaw et al. (2002) Biochem. J. 363: 137-45, WO98/55607을 참조), 랫트 단일클론성 항체(Woods et al. (2002) Biochem. J. 366: 353-65) 및 5T4 마우스 단일클론성 항체(미국 특허번호 5,869,053)를 인식한다.
H8 5T4 특이적 항체는 예를 들어, R&D Systems로부터 상업적으로 이용 가능하다.
또 다른 양태에서, 5T4 항원과 결합하는 항체는 본 실시예에 기술된 바와 같은 2E4 항체 또는 2E4 항체를 기초로 한 항체일 수 있다.
2E4 항체의 서열은 서열번호 12에 기재되어 있다:
MEVQLQQSGPELVKPGASVKISCKASGYSFTGYYMHWVKQSHVKSLEWIGRINPYNGATTYNQDFKDKASLTVDKSSSTASMELHSLTSEDSAVYYCALSTMITTAWFAYWGQGTLVTVSPGGGGSGGGGTGGGGSNFVMTQTPKFLLASAGDRVTISCKASQSVSNDVGWYQQKPGQSPKLLIYFASNRYTGVPDRFIGSGYGTDFTFTISTVQAEDLAVYFCQQDYSSPFTFGSGTKLEIK
펩티드 및 백신
암 항원 또는 암 항원으로부터의 펩티드를 함유하는 암 백신이 제안되었다.
본 발명은 혈액암 치료 또는 예방에 사용하기 위한, 본원에 정의된 바와 같은 5T4 항원 또는 5T4 항원 펩티드를 포함하는 면역 조성물 또는 백신을 제공한다.
상기 논의된 바와 같이, 다양한 5T4 항원 분자의 서열이 당해 분야에 공지되어 있으며, 따라서 펩티드 또는 단백질이 본 발명에 따른 사용을 위하여 유래할 수 있다.
적합한 펩티드는 예를 들어, WO2000/029428, WO2006/120473, WO2007/034188, Mulryan et al. (2002) Mol. Cancer Ther. 1: 1129-37; 영국 특허출원 공개번호 2,370,571 및 2,378,704; EP 특허출원 공개번호 EP 1,160,323 및 1,152,060(이들은 본원에 참조로 포함됨)에 기재된 바와 같을 수 있다.
면역 조성물 또는 백신은 본 발명에 따른 혈액암의 치료 또는 예방을 위한 임의의 방법에 사용되거나 또는 본원에 기술된 바와 같이 사용될 수 있다. 따라서, 본 발명은 본 발명에 따른 면역 조성물 또는 백신을 투여하는 단계를 포함하는, 대상체에서 혈액암을 치료 또는 예방하는 방법을 포괄한다.
용어 "펩티드"는 전형적으로 인접한 아미노산의 α-아미노기 및 카복실기 사이의 펩티드 결합에 의하여 서로 연결되는 일련의 잔기, 전형적으로는 L-아미노산을 의미하는 통상적인 의미로 사용된다. 이 용어는 변형 펩티드 및 합성 펩티드 유사체를 포함한다.
펩티드는 화학적 방법을 이용하여 제조될 수 있다(Peptide Chemistry, A practical Textbook. Mikos Bodansky, Springer-Verlag, Berlin.). 예를 들어, 펩티드는 고체상 기술에 의해 합성되고(Roberge JY et al (1995) Science 269: 202-204), 수지로부터 분리되고, 분취 고성능 액체 크로마토그래피에 의해 정제될 수 있다(예를 들어, Creighton (1983) Proteins Structures And Molecular Principles, WH Freeman and Co, New York NY). 예를 들어, ABI 43 1 A 펩티드 합성기(Perkin Elmer)를 이용하여 제조사에 의해 제공된 설명서에 따라 자동화된 합성이 이루어질 수 있다.
이 펩티드는 대안적으로는 재조합 수단에 의해, 또는 항원이거나 항원을 포함하는 폴리펩티드로부터의 절단(cleavage)에 의해 제조될 수 있다. 펩티드의 구성은 아미노산 분석 또는 시퀀싱(예를 들어, Edman 분해 절차)에 의해 확인될 수 있다.
면역 조성물 또는 백신은 추가로 약학적으로 허용 가능한 담체, 희석제 또는 부형제를 포함하는 약학 조성물일 수 있다. 약학 조성물은 선택적으로 하나 이상의 추가의 약학적으로 활성인 폴리펩티드 및/또는 화합물을 포함할 수 있다. 이러한 제형은 예를 들어, 피부 내 또는 피하 투여, 또는 정맥 내, 또는 복강 내 주입에 적합한 형태일 수 있다. 예를 들어, 암 백신에 대한 논의는 Butterfield, BMJ. 2015 22;350를 참조.
조성물은 추가로 보조제를 포함할 수 있다. 보조제의 예는 알루미늄 염, 오일 에멀젼 및 박테리아 성분(예를 들어, LPS 및 리포솜)을 포함하나 이에 한정되지 않는다.
일 양태에서, 백신은 5T4 항원을 펩티드, 단백질, 또는 대안적으로는 이 펩티드 또는 단백질을 암호화하는 DNA 또는 RNA 분자의 형태로 포함할 수 있다.
또한, 5T4 항원 백신은 세포의 맥락에서 전달될 수 있다. 예를 들어, 5T4 항원 또는 펩티드는 세포, 예를 들어 항원 제시 세포(antigen presenting cell) 상에 발현(expressed), 노출(pulsed) 또는 로드(loaded)될 수 있으며, 세포는 그 후 대상체에게 투여된다.
이것의 한 예는 항원(들) 또는 펩티드(들)가 노출되거나 로드된, 또는 하나, 2개 이상의 항원을 발현하도록 (DNA 또는 RNA 전달을 통해) 유전자 변형된 수지상 세포(dendritic cell) 백신이다(예를 들어, 상기 Butterfield 2015 참조). 수지상 세포 백신의 제조 방법은 당해 분야에 공지되어 있다.
본원에 논의된 바와 같은 백신에 따른 세포는 항원 제시 세포, 바람직하게는 수지상 세포일 수 있다.
또한, 적합한 백신은 본원에 기술된 바와 같은 5T4 항원과 관련되는 DNA 또는 RNA 백신의 형태일 수 있다. 예를 들어, 5T4 항원을 암호화하는 DNA 또는 RNA, 또는 이로부터 유래한 펩티드 또는 단백질은 예를 들어, 대상체에게 직접 주사함으로써 백신으로서 사용될 수 있다. 하나 이상의 5T4 항원은 하나 이상의 항원을 암호화하는 DNA 또는 RNA 서열을 함유하는 박테리아 또는 바이러스 벡터를 통하여 전달될 수 있다.
본원에 설명되는 바와 같은 백신은 임의의 적합한 방식으로 투여될 수 있다. 예를 들어, 백신은 당해 분야에 공지된 임의의 적합한 전달 메커니즘에 의하여 전달될 수 있다. 백신은 벡터 전달 시스템의 사용을 수반할 수 있거나, 또는 벡터 전달 시스템은 필수적이지 않을 수 있다. 벡터는 바이러스 또는 박테리아 벡터일 수 있다. 적합한 바이러스 벡터는 레트로바이러스, 아데노바이러스, 렌티바이러스 또는 수두 바이러스로부터 유래할 수 있다. 리포솜은 전달 시스템으로서 사용될 수 있다. 또한, 리스테리아 백신 또는 전기천공법이 사용될 수 있다.
세포 기반 백신은 생체 외(ex vivo)에서 제조된 다음 대상체에게 투여될 수 있다.
또한, 본 발명은 표면에 5T4 펩티드와 같은 5T4 항원성 분자 또는 이의 일부를 발현하는 세포 또는 이의 집단을 제공하며, 세포는 혈액암을 치료 또는 예방하는데 사용하기 위한 본원의 임의의 방법에 의해 수득될 수 있다(또는 수득된다).
세포의 생체 내 투여를 위하여, 당해 분야에서 일반적이거나 표준적인 임의의 세포 집단의 투여 방식, 예를 들어 주사 또는 주입이 적절한 경로로 사용될 수 있다. 일 양태에서, 대상체 kg 당 1×104 내지 1×108개의 세포가 투여될 수 있다. 일 양태에서, 대상체 kg 당 약 107개 이하의 세포가 투여될 수 있다. 따라서, 예를 들어, 인간에서, 대상체 kg 당 0.1 내지 20×107개 세포의 용량이 복용량(dose)으로, 즉 용량당, 예를 들어 T 세포 또는 백신 접종 용량으로 투여될 수 있다. 일 양태에서, 대상체 kg 당 1×104 내지 1×105개 세포, 1×105 내지 1×106개 세포, 1×106 내지 1×107개 세포 또는 1×107 내지 1×108개의 세포가 투여될 수 있다. 백신 접종 적용을 위하여, 용량당 1 내지 20×106개 세포가 이용될 수 있다. 필요한 경우 이 용량은 나중에 반복될 수 있다.
또한, 백신은 5T4를 암호화하는 DNA 또는 RNA의 형태일 수 있고, 바이러스 벡터, 항원 제시 세포 및 전기천공법을 포함하나 이에 한정되지 않는 추가의 방법에 의하여 전달될 수 있다.
본원에 기술된 면역 조성물 또는 백신은 본 발명에 따른 방법에 사용될 수 있다. 즉, 본 발명은 5T4 펩티드와 같은 5T4 항원을 포함하는 면역 조성물을 투여하는 단계를 포함하는, 대상체에서 혈액암을 치료 또는 예방하는 방법을 포괄한다.
일 양태에서, 백신 접종은 치료적 백신 접종이다. 이 양태에서, 면역 조성물 또는 백신은 혈액암을 치료하기 위하여 혈액암에 걸린 대상체에게 투여된다.
추가의 양태에서, 백신 접종은 예방적 백신 접종이다. 이 양태에서, 면역 조성물은 혈액암 발생 위험이 있을 수 있는 대상체에게 투여된다.
일 양태에서, 백신은 이전에 혈액암을 앓았고 혈액암이 재발할 위험이 있는 대상체에게 투여된다.
면역 조성물에 사용되는 항원의 용량은 사용되는 항원에 따라 다를 수 있다. 단백질 항원의 생체 내 사용을 위하여, 용량은 0.5 내지 500 μg, 예를 들어 10 내지 100 μg 또는 10 내지 200 μg 범위일 수 있다. 펩티드 항원의 경우, 0.1 내지 4000 μg, 예를 들어 0.1 내지 2000 μg, 0.1 내지 1000 μg 또는 0.1 내지 500 μg, 예를 들어 0.1 내지 100 μg의 생체 내 용량이 사용될 수 있다.
본 발명에 따른 면역 조성물 또는 백신은 대상체에서 면역 반응의 생성을 초래할 수 있다. 생성될 수 있는 "면역 반응"은 체액성(humoral) 및/또는 세포 매개성(cell-mediated) 면역, 예를 들어 항체 생성의 자극, 또는 세포독성 또는 표면에 "외래(foreign)" 항원을 발현하는 세포를 인식하고 파괴(또는 제거)할 수 있는 살해 세포(killer cell)의 자극일 수 있다. 따라서, 용어 "면역 반응을 자극하는 것"은 모든 종류의 면역 반응 및 이를 자극하는 메커니즘을 포함하며, 본 발명의 바람직한 양태를 형성하는 CTL 자극을 포괄한다. 바람직하게는, 자극되는 면역 반응은 세포독성 CD8 T 세포 및 헬퍼(helper) CD4+ T 세포이다. 면역 반응의 정도는 면역 반응의 마커, 예를 들어 IL-2 또는 IFNγ와 같은 분비된 분자 또는 항원 특이적 T 세포의 생성에 의해 평가될 수 있다.
일 양태에서, 트로박스(TroVax®) 백신이 사용될 수 있다.
트로박스(Oxford BioMedica plc)는 변형된 백시니아 앙카라(Modified Vaccinia Ankara, MVA)로 일컫는 우두 바이러스(vaccinia virus, VV)의 고도로 약화된 균주로 구성되며, 변형된 프로모터 mH5의 조절 제어하에 인간 5T4 당단백질 유전자를 함유한다. (예를 들어, Amato et al. Clin Cancer Res; 16(22) November 15, 2010; Harrop et al. Cancer Immunol Immunother. 2012 Dec;61(12):2283-94; Harrop R et al. Cancer Immunol Immunother. 2013 Sep;62(9):1511-20, WO 2000/29428, WO 2010/007365, WO 2010/079339, 및 WO 2012/059750 참조.)
트로박스는 본원에 기술된 방법 및/또는 용도에 사용될 수 있다.
이종 프라임 부스트 백신 접종(heterologous prime boost vaccination) 계획이 WO 98/56919(CD8+ T 세포 에피토프의 공급원으로서 상이한 프라이머 및 부스터 조성물을 이용하는, 표적 항원에 대한 방어적 CD8+ T 세포 면역 반응의 생성) 또는 WO 2001/021201(프라이밍(priming) 조성물의 사전 투여 후, 개체에게 항원에 대한 CD8+ T 세포 면역 반응을 증폭시키기 위한 항원 또는 항원의 CD8+ T 세포 에피토프를 암호화하는 복제-결핍 아데노바이러스 벡터의 사용)에 기술된 바와 같이 사용될 수 있다. 프라이밍 조성물은 항원 또는 에피토프, 또는 항원 또는 에피토프를 암호화하는 핵산을 포함할 수 있고, DNA, Ty-LVP'S 또는 변형된 백시니아 앙카라(MVA)일 수 있으며, WO 2012/172277(면역 반응을 유발하거나 증폭시키기 위한 침팬지 아데노바이러스를 이용함)이 5T4를 표적화하는 백신의 투여를 위하여 사용될 수 있다.
세포 치료법
추가의 양태에서, 본 발명은 대상체에서 혈액암을 치료 또는 예방하는데 사용하기 위한 5T4를 인식하는 세포, 바람직하게는 T 세포 또는 자연 살해(Natural Killer, NK) 세포 또는 NK T 세포와 같은 면역 세포를 제공한다. 대안적으로, 본 발명은 대상체에서 혈액암을 치료 또는 예방하는데 사용하기 위한 약제의 제조에 있어서 5T4를 인식하는 T 세포, NK 세포 또는 NKT 세포와 같은 면역 세포의 용도를 제공한다. 추가의 대안에서, 본 발명은 대상체에서 혈액암을 치료 또는 예방하는데 있어서 5T4를 인식하는 면역 세포, 바람직하게는 T 세포의 용도를 제공한다. 일 양태에서, 이러한 5T4 표적화 세포는 종양 침윤성 림프구(tumour infiltrating lymphocyte, TIL)이다. 일 양태에서, 대상체는 포유동물, 바람직하게는 인간이다.
"면역 세포"에 대한 언급은 면역계의 세포, 예를 들어 T 세포, NK 세포, NKT 세포, B 세포 또는 수지상 세포를 포괄하고자 하는 것이다. 일 양태에서, 면역 세포는 T 세포이다. 추가의 양태에서, 면역 세포는 NK 세포 또는 NKT 세포이다.
일 양태에서, 본 발명은 대상체에서 혈액암을 치료 또는 예방하는데 사용하기 위한 5T4를 인식하는 세포의 집단을 제공한다. 대안적으로, 본 발명은 대상체에서 혈액암을 치료 또는 예방하는데 사용하기 위한 약제의 제조에 있어서 5T4를 인식하는 세포 집단의 용도를 제공한다. 추가의 대안에서, 본 발명은 대상체에서 혈액암을 치료 또는 예방하는데 있어서 5T4를 인식하는 세포 집단의 용도를 제공한다. 일 양태에서, 세포는 본원에 기술된 바와 같은 면역 세포이다. 바람직하게는, 세포는 T 세포, NK 세포 또는 NKT 세포이다.
세포 또는 세포 집단은 조성물, 예를 들어 본원에 기술된 바와 같은 약학 조성물의 형태일 수 있다. 일부 구현예에서, 약학 조성물은 다른 약학적 활성제 또는 약물, 예컨대 화학요법제, 예를 들어 아스파라기나아제(asparaginase), 부설판(busulfan), 카보플라틴(carboplatin), 시스플라틴(cisplatin), 다우노루비신(daunorubicin), 독소루비신(doxorubicin), 플루오로우라실(fluorouracil), 젬시타빈(gemcitabine), 하이드록시우레아(hydroxyurea), 메토트렉세이트(methotrexate), 파클리탁셀(paclitaxel), 리툭시맙(rituximab), 빈블라스틴(vinblastine), 빈크리스틴(vincristine) 등을 더 포함한다.
또한, 일부 양태에서 완충제가 조성물에 포함될 수 있다. 적합한 완충제는 예를 들어, 시트르산, 시트르산나트륨, 인산, 인산칼륨 및 다양한 기타 산 및 염을 포함한다. 일부 양태에서, 2종 이상의 완충제의 혼합물이 사용된다. 완충제 또는 이의 혼합물은 전형적으로 전체 조성물의 약 0.001 중량% 내지 약 4 중량%의 양으로 존재한다. 투여 가능한 약학 조성물의 제조 방법은 공지되어 있다. 예시적인 방법은 예를 들어, Remington: The Science and Practice of Pharmacy, Lippincott Williams & Wilkins; 21st ed. (May 1, 2005)에 더욱 상세히 기술되어 있다.
입양 세포 치료법을 위한 세포 투여 방법은 공지되어 있으며, 제공되는 방법 및 조성물과 연계하여 사용될 수 있다. 예를 들어, 입양 T 세포 치료방법은 예를 들어, Gruenberg 등의 미국 특허출원 공개번호 2003/0170238; Rosenberg의 미국 특허번호 4,690,915; Rosenberg (2011) Nat Rev Clin Oncol. 8(10):577-85)에 기술되어 있다. 예를 들어, Themeli et al. (2013) Nat Biotechnol. 31(10): 928-933; Tsukahara et al. (2013) Biochem Biophys Res Commun 438(1): 84-9; Davila et al. (2013) PLoS ONE 8(4): e61338 참조.
세포 치료법은 자가 이식(autologous transfer)에 의해 수행될 수 있으며, 이때 세포는 세포 치료법을 받을 대상체 또는 이러한 대상체로부터 유래한 샘플로부터 분리되고/되거나 제조된다. 따라서, 일 양태에서, 세포는 치료를 필요로 하는 대상체, 예를 들어 환자로부터 유래하며, 후에 분리 및 처리되어 동일한 대상체에게 투여된다.
대안적으로, 세포 치료법은 동종이계 이식(allogeneic transfer)에 의해 수행될 수 있으며, 이때 세포는 세포 치료법을 받을 대상체 또는 궁극적으로 세포 치료법을 받는 대상체, 예를 들어 제1 대상체 이외의 대상체로부터 분리되고/되거나 그렇지 않으면 제조된다. 이러한 구현예에서, 세포는 그 후 동일한 종의 상이한 대상체, 예를 들어 제2 대상체에게 투여된다. 일부 구현예에서, 제1 및 제2 대상체는 유전적으로 동일하다. 일부 구현예에서, 제1 및 제2 대상체는 유전적으로 유사하다. 일부 구현예에서, 제2 대상체는 제1 대상체와 동일한 HLA 클래스 또는 상위 유형(supertype)을 발현한다. 대안적인 구현예에서, 동종이계 T 세포는 기능적 T 세포 수용체(T cell receptor, TCR) 및/또는 HLA 클래스 I 및/또는 HLA 클래스 II와 같은 인간 백혈구 항원(human leukocyte antigen, HLA)이 결여될 수 있다.
일부 구현예에서 약학 조성물은 질병 또는 상태를 치료 또는 예방하는데 효과적인 양으로, 예컨대 치료학적 유효량 또는 예방적 유효량으로 세포를 포함한다. 일부 구현예에서 치료적 또는 예방적 효능은 치료되는 대상체의 주기적인 평가에 의해 모니터링 된다. 수일 이상에 걸친 반복된 투여의 경우, 상태에 따라, 원하는 질병 증상의 억제가 발생할 때까지 치료는 반복된다. 그러나 다른 투여 계획이 유용할 수 있으며 결정될 수 있다. 원하는 투여량은 조성물의 단일 볼루스 투여에 의해, 조성물의 다중 볼루스 투여에 의해, 또는 조성물의 연속적인 주입 투여에 의해 전달될 수 있다.
또한, 본 발명은 5T4를 표적으로 하는 세포 집단을 제공하는 방법을 제공하며, 상기 방법은
i) 대상체로부터 분리된 샘플로부터 세포를 분리하는 단계; 및
ii) 세포를 증식시켜 5T4를 표적으로 하는 세포 집단을 제공하는 단계
를 포함한다.
일 양태에서, 세포는 T 세포이다. 일 양태에서, 세포는 NK 또는 NKT 세포이다.
샘플은 대상체로부터의 종양, 혈액 또는 조직 샘플일 수 있다.
일 구현예에서, 세포가 분리되는 샘플은 혈액 샘플, 종양 샘플, 종양 관련 림프절 샘플 또는 전이 부위로부터의 샘플일 수 있다.
세포가 T 세포일 때, T 세포의 집단은 CD8+ T 세포, CD4+ T 세포 또는 CD8+ 및 CD4+ T 세포를 포함할 수 있다.
생성된 세포 집단에는 (예를 들어, 대상체로부터 분리된 샘플과 비교하여) 증가된 수의 5T4를 표적으로 하는 세포가 있을 수 있다.
T 세포는 예를 들어, 면역 조절 수용체(Lag 3, PD1, TIGIT, PD-L1, BTLA, CTLA4, TGF베타 수용체, IL10 수용체를 포함하나 이에 한정되지 않음)의 유전자 편집에 의해 면역 억제에 내성이 있게될 수 있다.
일 양태에서, 유전자 조작된 세포, 예컨대 표적 항원에 특이적으로 결합하는 유전자 조작된 항원 수용체를 포함하는 유전자 조작된 면역 세포인 세포가 사용될 수 있다. 변형에 적합한 세포는 대상체, 예컨대 인간 대상체를 포함하나 이에 한정되지 않는 포유동물 대상체로부터 얻을 수 있다. 세포는 말초 혈액 단핵구 세포(peripheral blood mononuclear cell), 골수(bone marrow), 림프절 조직(lymph node tissue), 제대혈(cord blood), 흉선 조직(thymus tissue), 감염 부위로부터의 조직, 복수(ascite), 흉막 삼출액(pleural effusion), 비장 조직(spleen tissue) 및 종양(tumour)을 포함하는, 당업자에게 공지된 다수의 공급원으로부터 얻을 수 있다. 적합한 세포로는 면역계의 세포, 예컨대 선천성(innate) 또는 적응성(adaptive) 면역계의 세포(예를 들어, 골수성, 또는 T 세포, NK 세포 또는 NKT 세포와 같은 림프구 세포를 포함하는 림프구성 세포)를 포함한다. 다른 적합한 세포로는 유도 만능 줄기세포(induced pluripotent stem cell, iPSC)를 포함하는 다분화능(multipotent) 및 만능 줄기세포와 같은 줄기세포를 포함한다. 일 양태에서, 세포는 대상체로부터 직접 분리되고/되거나 대상체로부터 분리되어 동결된 것과 같은, 일차 세포(primary cell)이다.
특정 양태에서, 적합한 세포는 Ficoll 분리법과 같은 당업자에게 공지된 다수의 기술을 이용하여 포유동물 대상체로부터 수집된 혈액 단위로부터 얻을 수 있다. 일 양태에서, 개체의 순환 혈액으로부터의 세포는 성분채집술(apheresis)에 의해 수득된다. 성분채집술 산물은 전형적으로 T 세포를 포함하는 림프구, 단핵구, 과립구, B 세포, 다른 유핵 백혈구, 적혈구 및 혈소판을 함유한다. 성분채집술에 의해 수집된 세포는 혈장 분획을 제거하기 위하여 세척될 수 있으며, 선택적으로 후속 처리 단계를 위하여 적절한 완충액 또는 매질에 있을 수 있다. 세포는 예를 들어, 인산 완충 식염수로 세척될 수 있다. 칼슘의 부존재는 T 세포의 활성화를 증가시킬 수 있으므로, 특정 구현예에서 세척액은 칼슘 및/또는 마그네슘이 없거나, 많은 또는 모든 2가 양이온이 없을 수 있다.
세포는 Miltenyi CD25 마이크로비드와 같은 당해 분야에 공지된 방법을 이용하여 T 조절 세포(CD25+ 세포)가 고갈될 수 있다. CD25+ 세포의 고갈은 성분채집술 이전에 또는 CAR 발현 세포(예를 들어, T 세포 또는 NK 세포)의 생산 중에 수행될 수 있다. 또한, CAR을 발현하는 세포의 증식 및/또는 기능에 부정적인 영향을 미치는 다른 세포 유형이 제거될 수 있다. 이러한 면역 억제 세포는 CD14, CD11b, CD33, CD15 또는 다른 면역 억제 세포의 마커를 발현하는 세포를 포함하고, 세포 표면 마커를 대상으로 하는 단일클론성 항체를 이용하는 자기 면역부착(magnetic immunoadherence) 또는 유세포 분석법(flow cytometry)과 같은 당업자에게 공지된 방법을 이용함으로써 세포의 집단으로부터 제거될 수 있다.
세포는 또한 하나 이상의 체크포인트 억제제(check-point inhibitor), 예를 들어 PD1, CD223 (LAG3), PD-L1 및 CTLA4, PD-L2, TIM3, CEACAM-1, CEACAM-3, CEACAM-5, VISTA, BTLA, TIGIT, LAIR1, CD160, 2B4, CD80, CD86, CD276(B7-H3), B7-H4(VTCN1), CD270(HVEM 또는 TNFRSF14), KIR, A2aR, MHC 클래스 I, MHC 클래스 II, GALS, 아데노신, TGF베타 수용체를 발현하는 세포가 고갈될 수 있다. 세포 집단은 T 조절 세포의 고갈과 동시에 하나 이상 체크포인트 억제제를 발현하는 세포가 고갈될 수 있다.
T 조절 세포, 면역 억제 세포 및 체크포인트 억제제를 발현하는 세포의 고갈은 예를 들어, 이러한 T 조절 세포, 면역 억제 세포 또는 체크포인트 억제제를 인식하는 여러 항체를 발현하는 비드 또는 이러한 항체를 발현하는 비드의 혼합물을 이용하여 동시에 수행될 수 있다. 예를 들어, 항-CD25 항체 또는 이의 단편, 또는 다른 결합 모이어티, 및 항-체크포인트 억제제 항체 또는 이의 단편, 또는 다른 결합 모이어티는 동시(simultaneous) 고갈을 위해 동일한 비드 또는 개별적인 비드의 혼합물에 부착될 수 있다. 대안적으로, 특정 세포 유형의 고갈은 순차적으로 수행될 수 있다.
일 양태에서, 세포는 예를 들어, 항-CD3/항-CD28이 컨쥬게이트된 비드(예를 들어, Dynabeads® Human T-Activator CD3/CD28) 또는 다른 적합한 시약과의 항온처리에 의하여 적극적으로(positively) 선택될 수 있다.
일부 양태에서, 친화도 기반 선택(affinity-based selection)은 자기 활성화 세포 분류법(magnetic-activated cell sorting, MACS)(Miltenyi Biotec, 미국 캘리포니아 주 오번)을 통해서 이루어진다. MACS 시스템은 자성 입자가 부착된 세포를 고순도로 선택할 수 있다. MACS는 외부 자기장의 인가(application) 후 표적 및 비표적 세포가 순차적으로 용리되는 방식으로 작동할 수 있다. 비부착된 세포가 용리되는 동안 자성 입자에 부착된 세포는 유지되고, 그 후 자기장에 유지되었던 세포가 또한 용리될 수 있다. 특정 양태에서, 폐사슬 시스템은 예를 들어, 취급을 줄이기 위해 분리(isolation), 세포 제조, 분리(separation), 처리, 항온처리, 배양 및/또는 제형화 중 하나 이상을 수행하는데 사용된다. 폐사슬 시스템은 WO 2009/070003 또는 WO 2009/072003에 기술되어 있다.
면역세포는 예를 들어, WO 01/62895, WO 2016/196388, EP1586655, US 5,199,942, US 6,352,694, US 7,144,575, US 7,067,318, US 7,172,869, US 7,572,631에 기술된 바와 같은 당해 분야에 공지된 방법에 의해 생체 외 또는 시험관 내에서 활성화되고 증식될 수 있다. 말초 혈액 채취물 또는 골수 이식물로부터 포유동물의 CD34+ 조혈 줄기세포 및 전구체 세포(progenitor cell)의 수집 후, 이러한 세포는 특정 성장 인자의 존재하에 생체 외에서 증식될 수 있다. WO 92/21402에 기술된 성장 인자 이외에도, flt3-L, IL-1, IL-3 및 c-kit 리간드와 같은 다른 인자도 세포 배양 및 증식에 사용될 수 있다.
면역세포의 집단은 표면에 부착되는 작용제(agent) 및/또는 리간드, 예를 들어 항원 제시 세포에 의해 제시되는 것과 같은 5T4 항원과의 접촉에 의해 증식될 수 있다. 대안적으로, 이러한 작용제는 신호와 관련된 CD3/TCR 복합체를 자극할 수 있고, 리간드는 세포 표면에 존재하는 공동자극 분자를 자극할 수 있다. 일 양태에서, T 세포 집단은 항-CD3 항체 또는 이의 항원 결합 단편, 또는 표면에 고정된 항-CD2 항체와의 접촉에 의해, 또는 칼슘 이온운반체(ionophore)와 함께 단백질 키나아제 C 활성화제(예를 들어, 브리오스타틴)과의 접촉에 의해 자극될 수 있다. T 세포 표면상의 보조 분자(accessory molecule)의 공동자극을 위하여, 보조 분자와 결합하는 리간드가 사용된다. 예를 들어, T 세포 집단은 T 세포의 증식을 자극하기에 적절한 조건하에서 항-CD3 항체 및 항-CD28 항체와 접촉될 수 있다. CD4+ T 세포 또는 CD8+ T 세포의 증식을 자극하기 위하여, 항-CD3 항체 및 항-CD28 항체가 사용될 수 있다.
특정 양태에서, 면역 세포(예컨대, PBMC 또는 T 세포)는 세포를 항-CD3 항체 및 IL-2 중 하나에 접촉시킴으로써 증식되며 자극된다. 세포는 항-CD3 또는 항-CD28 비드 없이 증식될 수 있다.
일 양태에서, 2개의 작용제는 동일한 비드 또는 별개의 비드 중 어느 하나의 비드상에 고정된다. 예로서, 1차 활성화 신호를 제공하는 작용제는 항-CD3 항체 또는 이의 항원-결합 단편이고, 공동자극 신호를 제공하는 작용제는 항-CD28 항체 또는 이의 항원-결합 단편이며; 두 작용제는 동일한 비드에 동시에 고정화된다. 일 양태에서, 동등한 분자량(qeuivalent molecular amount)의 각 항체가 비드에 결합되어 CD4+ T 세포 증식 및 T 세포 성장을 자극한다. 특정 양태에서, CD3:CD28 항체의 비율은 이러한 항체를 1:1의 비율로 이용하여 관찰되는 증식과 비교하여 T 세포 증식의 증가가 관찰되도록 비드에 결합된다. 일 양태에서, 비드에 결합된 CD3:CD28 항체의 비율은 100:1 내지 1:100의 범위이다. 일 양태에서, 항-CD3 항체보다 더 많은 항-CD28 항체가 사용된다.
추가의 양태에서, T 세포, NK 세포 또는 NK-T 세포와 같은 세포는 작용제가 코팅된 비드와 결합되며, 비드와 세포가 나중에 분리된 다음, 세포가 배양된다. 대안적으로, 배양 전에 작용제가 코팅된 비드와 세포는 함께 배양된다. 대안적으로, 비드와 세포는 먼저 세포 표면 마커의 결합을 증가시키는 자기력(magnetic force)과 같은 힘의 적용에 의해 농축되어 세포 자극을 유도한다. 특정 양태에서, 비드는 상자성 비드(paramagnetic bead)(예컨대, Dynabeads 또는 MACS 비드)이다.
일부 양태에서, 분리 및/또는 다른 단계는 CliniMACS 시스템(Miltenyi Biotec)을 이용하여 수행된다.
일 양태에서, CAR을 암호화하는 핵산을 포함하는 세포가 증식된다. 세포는 몇 시간 내지 약 14일의 기간 동안 배양액에서 증식될 수 있다. 특정 양태에서, 특히 여러 사이클의 자극이 수행되는 경우, 세포는 14일을 초과하여 증식될 수 있다.
세포 배양에 적합한 조건은 당업자에게 공지될 것이며, 적합한 배양 배지(예를 들어, 최소 필수 배지(minimal essential medium, MEM), DMEM, α-MEM, F12, RPMI 1640, X-vivo 15, X-vivo 20, Optimzer, AIM-V, TexMACs)의 사용을 포함할 것이다. 배양 배지는 혈청(인간 혈청 또는 소 태아 혈청), IL-2, 인슐린, IFN-γ, IL-4, IL-7, GM-CSF, IL-10, IL-12, IL-15, TGFβ, TNF-α, 또는 세포의 증식 및 생존능력을 증가시키는 것으로 당업자에 의해 공지된 임의의 다른 이러한 첨가제와 같은, 세포의 증식 및 생존능력을 향상시키는 인자를 함유할 수 있다. 세포는 성장을 지지하는 데 필수적인 조건, 예를 들어 적절한 온도(예를 들어, 37℃) 및 분위기(예를 들어, 공기 플러스 5% CO2) 하에 유지될 것이다.
본원에 기술된 세포는 5T4와 특이적으로 결합하는 키메라 항원 수용체(CAR) 또는 T 세포 수용체(TCR), 또는 5T4와 특이적으로 결합하는 친화도 증진된(affinity-enhanced) TCR을 발현할 수 있다. 따라서, 세포는 5T4 특이적인 CAR 또는 TCR을 발현하도록 조작될 수 있다.
일 양태에서, 조작된 세포의 항원-결합 모이어티는 키메라 T 세포 수용체(TCR)이다. 이러한 TCR은 재조합 TCR 또는 자연 발생적인 T 세포로부터 클로닝된 TCR일 수 있다.
따라서 5T4 표적화를 위한 추가의 옵션은 5T4에 대해 특이적인 CAR 또는 TCR을 발현하는 세포, 예컨대 T 세포, NK 세포 또는 NKT 세포의 사용을 수반한다.
세포는 특정 항원에 특이적이도록 생체 외에서 유전자 조작될 수 있으며, 자가 항원 특이적 세포가 대상체에게 투여된다.
CAR 및 TCR은 아래에서 더욱 상세히 논의되지만, 세포 내로의 유전자 성분(예컨대, CAR 또는 TCR)의 도입을 위한 다양한 방법이 당해 분야에 잘 알려져 있다. 예시적인 방법은 예를 들어, 레트로바이러스 또는 렌티바이러스 벡터를 이용하는 바이러스 형질도입, 트랜스포존, 전기천공법, 및 징크 핑거 단백질(zinc finger protein)과 같은 DNA 표적화 단백질, 엔도뉴클레아제와 같은 이펙터 단백질에 융합된 전사 활성화 인자 유사 단백질(transcription activator-like protein)(예를 들어, TALE 및 TALENS)을 포함한다(June et al. 2009 Nature Reviews Immunology 9.10; 704-716).
일부 양태에서, 유전자 전달(gene transfer)은 세포 성장 및/또는 활성화를 먼저 자극한 다음, 세포 형질도입 후에 이어 변형된 세포를 임상 적용에 충분한 수로 증식시킴으로써 달성된다.
재조합 핵산은 재조합 감염성 바이러스 입자를 이용하여 세포 내로 전달될 수 있다. 렌티바이러스와 같은 레트로바이러스로부터 유래된 벡터는 전이 유전자(transgene)의 장기적인 안정한 통합(integration) 및 딸 세포에서의 이의 전파(propagation)를 가능하게 하므로, 장기적인 유전자 전달을 달성하기에 적합하다. 또한, 렌티바이러스로부터 유래된 벡터는 비-분화(non-dividing) 세포를 형질도입할 수 있다.
적합한 레트로바이러스 벡터는 쥣과 백혈병 바이러스(Murine Leukaemia Virus, MLV), 비장 병소 형성 바이러스(Spleen-Focus Forming Virus, SFFV)와 같은 γ-레트로바이러스(γ-retrovirus), 인간 T 세포 백혈병 바이러스(human T-cell leukaemia virus, HTLV), 마우스 유방 종양 바이러스(mouse mammary tumour virus, MMTV), 라우스 육종 바이러스(Rous sarcoma virus, RSV), 후지나미 육종 바이러스(Fujinami sarcoma virus, FuSV), 몰로니 쥣과 백혈병 바이러스(Moloney murine leukaemia virus, Mo MLV), FBR 쥣과 골육종 바이러스(FBR murine osteosarcoma virus, FBR MSV), 몰로니 쥣과 육종 바이러스(Moloney murine sarcoma virus, Mo-MSV), 아벨슨 쥣과 백혈병 바이러스(Abelson murine leukaemia virus, A-MLV), 조류 골수구종증 바이러스-29(Avian myelocytomatosis virus-29, MC29) 및 조류 적아세포증 바이러스(Avian erythroblastosis virus, AEV) 및 골수증식성 육종 바이러스(Myelopoliferative Sarcoma Virus, MPSV)로부터 유래하는 것들을 포함한다. 레트로바이러스의 상세한 목록은 Coffin et al. (1997) "Retroviruses", Cold Spring Harbour Laboratory Press Eds: JM Coffin, SM Hughes, HE Varmus pp 758-763에서 찾아볼 수 있다. 적합한 렌티바이러스 벡터는 HIV-1, HIV-2, SIV, FIV, BIV, EIAV, CAEV 또는 비스나 렌티바이러스(visna lentivirus)로부터 유래할 수 있고, US 6,924,123, US 7,056,699, WO 98/17815, WO 99/32646, WO 01/79518, WO 03/064665, US 6,969,598에 기술되어 있다.
또한, 벡터는 벡터 생산 중에 전이 유전자의 발현을 방지하는, WO 2015/092440에 기술된 TRiP 시스템을 포함할 수 있다.
본원에 기술된 세포를 형질도입하는데 적합한 다른 벡터는 시미안 바이러스 40(simian virus 40, SV40), 아데노바이러스(adenovirus), 아데노 관련 바이러스(adeno-associated virus, AVV)로부터 유래하는 벡터를 포함한다. (예를 들어, Koste et al. (2014) Gene Therapy 2014 Apr 3. doi: 10.1038/gt.2014.25; Carlens et al. (2000) Exp Hematol 28(10): 1137-46; Alonso-Camino et al. (2013) Mol Ther Nucl Acids 2, e93; Park et al., Trends Biotechnol. 2011 November ; 29(11): 550-557 참조).
재조합 핵산은 전기천공법(electroporation) 또는 전위법(transposition)을 통해 본원에 기술된 세포 내로 전달될 수 있다. 면역세포에 유전 물질을 도입하고 발현시키는 방법으로는 인산칼슘 형질감염(calcium phosphate transfection)(예를 들어, Current Protocols in Molecular Biology, John Wiley & Sons, New York. N.Y.에서 기술된 바와 같음), 원형질체 융합(protoplast fusion), 양이온성 리포솜 매개 형질감염(cationic liposome-mediated transfection); 텅스텐 입자-촉진 미세입자 충격법(tungsten particle-facilitated microparticle bombardment)(Johnston, Nature, 346: 776-777 (1990)); 및 인산스트론튬 DNA 공동침전법(strontium phosphate DNA co- precipitation)(Brash et al., Mol. Cell Biol., 7: 2031-2034 (1987))을 포함한다.
또한, 유전자 조작된 세포를 생산하기 위한 방법, 핵산, 조성물 및 키트가 제공된다. 유전자 조작은 유전자 조작된 성분, 또는 유전자 교란 단백질(gene-disruption protein) 또는 핵산을 암호화하는 성분을 암호화하는 핵산과 같은 세포 내 도입을 위한 다른 성분의 도입을 수반할 수 있다.
TCR 및 친화도 증진 TCR을 생성하는 방법은 당해 분야에 공지되어 있다. 친화도 증진 TCR은 펩티드-MHC 복합체에 대한 친화도가 증진된(예를 들어, 환자 샘플(예를 들어, 환자 말초 혈액 또는 TIL)로부터의 TCR을 암호화하는 TCR 유전자의 분리 및 TCR 서열의 변형(예를 들어, 시험관 내 돌연변이 유발 및 증진된 친화도(또는 친화도 성숙) TCR의 선별에 의함)을 통한 펩티드-MHC 복합체에 대한 TCR 친화도의 향상을 포함함) TCR이다. 이러한 TCR 유전자를 세포(예컨대, T 세포, NK 세포 또는 NKT 세포) 내로 도입하는 방법은 당해 분야에 공지되어 있다. 다양한 인간 TCR 레퍼토리를 가지고 있는 항원-음성 인간화 형질전환 마우스(예를 들어, ABabDII 마우스와 같은 TCR/MHC 인간화 마우스)의 항원으로의 면역화 및 이러한 면역화된 형질전환 마우스로부터의 항원 특이적 TCR의 분리를 포함하는 최적 친화도(optimal-affinity) TCR의 식별 방법 또한 당해 분야에 공지되어 있다(예를 들어, Obenaus M et al., Nat Biotechnol. 33(4):402-7, 2015 참조). 일부 양태에서, 예를 들어 WO 2004/044004에 기술된 방법 또는 당업자에게 공지된 다른 방법에 의해 고친화성 TCR이 생성된다.
본원에 기술되는 본 발명에 따른 특정 양태에서, 세포 또는 세포 집단 또는 조성물은 예를 들어, T 세포, NK 세포 또는 NKT 세포와 같은 세포의 분리 및 증식 후에 대상체 내로 재주입된다. 이를 달성하기에 적합한 방법은 본원에 기술되어 있으며, 당업자에게도 공지될 것이다. 예를 들어, T 세포의 생성, 선별 및 증식 방법은 예를 들어, Dudley J Immunother. 2003; 26(4): 332-342, 및 Rosenberg et al. 2011 Clin Cancer Res:17(13):4550-7을 참조한다. T 세포 재주입 방법은 Dudley et al. Clin Cancer Res. 2010 Dec 15; 16(24): 6122-6131 및 Rooney et al. Blood. 1998 Sep 1;92(5):1549-55에 기술되어 있다.
일 양태에서, 본 발명은 대상체에게 본원에 기술된 바와 같은 세포 조성물을 투여하는 단계를 포함하는, 대상체에서 혈액암을 치료하는 방법에 관한 것이다. 세포 조성물은 T 세포, NK 세포 또는 NKT 세포 조성물일 수 있다.
방법은 다음 단계를 포함할 수 있다:
(i) 대상체로부터의 샘플을 함유하는 세포를 분리하는 단계;
(ii) 5T4를 표적으로 하는 세포 집단을 증식시키는 단계; 및
(iii) 단계 (ii)로부터의 세포를 대상체에게 투여하는 단계.
세포는 예를 들어, 5T4 특이적 CAR 또는 TCR을 이용하여, 본원에 기술된 바와 같이 5T4를 표적화하도록 조작될 수 있다.
따라서, 방법은 다음 단계를 포함할 수 있다:
(i) 샘플을 함유하는 세포를 분리하는 단계;
(ii) 세포를 5T4를 인식하는 CAR 또는 TCR을 발현하도록 조작하여 5T4를 표적화하는 세포 집단을 제공하는 단계;
(iii) 조작된 세포를 증식시키는 단계; 및
(iv) 단계 (ii) 또는 (iii)으로부터의 세포를 대상체에게 투여하는 단계.
방법은 단계 (ii) 이전에 선택적인 증식 단계를 포함할 수 있다.
또한, 본 발명은 혈액암에 걸린 환자를 치료하는 방법을 제공하며, 상기 방법은 다음을 포함한다:
(i) 혈액암에 걸린 환자를 식별하는 단계; 및
(ii) 선택적으로 이러한 환자의 혈액암 세포가 5T4 항원을 발현하는지 여부를 결정하는 단계; 및
(iii) 본원에 정의된 바와 같은 세포 또는 세포 집단(또는 임의의 5T4 표적화제)를 상기 환자에게 투여하는 단계.
T 세포가 사용되는 경우, 5T4 반응성 T 세포의 증식된 집단은 예를 들어, 5T4 펩티드를 사용하여 증식되지 않은 T 세포의 집단보다 높은 활성을 가질 수 있다. "활성"에 대한 언급은 5T4 펩티드, 또는 항원, 예를 들어 증식에 사용되는 펩티드에 상응하는 펩티드로의 재자극에 대한 T 세포 집단의 반응을 나타낼 수 있다. 적합한 반응 분석 방법은 당해 분야에 공지되어 있다. 예를 들어, 사이토카인 생성이 측정될 수 있다(예를 들어, IL2 또는 IFNγ 생성이 측정될 수 있음). "더 높은 활성"에 대한 언급은 예를 들어, 1 내지 5배, 5 내지 10배, 10 내지 20배, 20 내지 50배, 50 내지 100배, 100 내지 500배, 500 내지 1000배의 활성의 증가를 포함한다.
친화도 증진 TCR은 원하는 표적 특이성을 갖는 TCR α 및 β 사슬이 클로닝되는 T 세포 클론을 확인함으로써 생성될 수 있다. 그 후, 후보 TCR은 α 및 β 사슬의 상보성 결정 영역에서 PCR 특이적 돌연변이 유발(PCR directed mutagenesis)을 거친다. 각 CDR 영역의 돌연변이를 스크리닝하여 비변성(native) TCR에 비해 증진된 친화도를 갖는 돌연변이체를 선별한다. 완료 시, 리드 후보를 벡터 내로 클로닝하여 친화도 증진 TCR을 발현하는 T 세포에서의 기능적 시험을 가능하게 한다.
CAR은 통상적인 형식으로, 단일클론성 항체(mAb)의 특이성을 T 세포의 효과기 기능에 접목하는 단백질이다. 이들의 통상적인 형태는 항원 인식 아미노 말단(antigen recognizing amino terminus), 스페이서(spacer), 막관통 도메인(transmembrane domain)이 모두 T 세포 생존 및 활성화 신호를 전달하는 화합물 엔도도메인(endodomain)에 연결된 I형 막관통 도메인 단백질의 형태이다.
이들 분자의 가장 일반적인 형태는 표적 항원을 인식하기 위하여 단일클론성 항체로부터 유래하는 단일-사슬 가변 단편(single-chain variable fragment, scFv)을 사용한다. scFv는 스페이서 및 막관통 도메인을 통해 신호전달 엔도도메인에 융합된다. 이러한 분자는 세포의 활성화를 초래하며, 여기서 이들은 그 표적의 scFv에 의한 인식에 반응하여 발현된다. 세포가 이러한 CAR을 발현할 때, 이들은 표적 항원을 발현하는 표적 세포를 인식하고 살해한다. 종양 관련 항원에 대해 여러 CAR이 개발되었으며, 이러한 CAR 발현 세포를 이용하는 입양 이식 접근법이 현재 다양한 암 치료를 위하여 임상 시험 중에 있다. CAR은 예를 들어, WO 2014/031687에 기술되어 있다.
일부 양태에서, 재조합 수용체(예를 들어, CAR)의 항체 부분은 힌지 영역, 예를 들어 IgG4 힌지 영역과 같은 면역글로불린 불변 영역의 적어도 일부, 및/또는 CH1/CL 및/또는 Fc 영역을 더 포함한다. 일부 양태에서, 불변 영역의 일부는 항원 인식 성분, 예를 들어 scFv, 및 막관통 도메인 사이에서 스페이서 영역으로서 작용한다. 스페이서는 스페이서 부존재 시의 반응성과 비교하여, 항원 결합 후에 세포 반응성을 증가시키는 길이일 수 있다. 예시적인 스페이서는 WO 2014/031687에 기술된 스페이서를 포함한다. 스페이서는 약 10 내지 200개 아미노산 길이로 다양할 수 있다.
항원 인식 도메인은 일반적으로 예컨대 CAR의 경우, TCR 복합체와 같은 항원 수용체 복합체 및 선택적으로 관련된 공동자극 신호, 및/또는 또 다른 세포 표면 수용체를 통한 신호를 통해 활성화를 모방하는 신호전달 성분과 같은 하나 이상의 세포 내 신호전달 성분에 연결된다. 따라서, 일부 양태에서, 항원-결합 성분은 하나 이상의 막관통 및 세포 내 신호전달 도메인에 연결된다. 일부 양태에서, 막관통 도메인은 세포 외 도메인에 융합된다. 일 양태에서, 수용체의 도메인 중 하나와 자연적으로 연결되어 있는 막관통 도메인이 사용된다. 일부 예에서, 막관통 도메인은 아미노산 치환에 의해 선택되거나 변형되어, 이러한 도메인이 동일하거나 상이한 표면 막 단백질의 막관통 도메인에 결합하는 것을 방지하여, 수용체 복합체의 다른 구성원과의 상호 작용을 최소화한다.
일부 구현예에서, 막관통 도메인은 천연 공급원으로부터 또는 합성 공급원으로부터 유래한다. 공급원이 천연인 경우, 일부 양태의 도메인은 임의의 막결합 또는 막관통 단백질로부터 유래한다. 막관통 영역은 T 세포 수용체의 알파, 베타 또는 제타 사슬, CD28, CD3 엡실론(epsilon), CD45, CD4, CD5, CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD86, CD134, CD137, CD154로부터 유래하는 것들을 포함한다. 대안적으로, 막관통 도메인은 합성 도메인일 수 있다. 일부 양태에서, 합성 막관통 도메인은 주로 류신 및 발린과 같은 소수성 잔기를 포함한다. 일부 양태에서, 페닐알라닌, 트립토판 및 발린의 트리플렛(triplet)이 합성 막관통 도메인의 각 말단에서 발견될 것이다. 일부 양태에서, 결합은 링커, 스페이서 및/또는 막관통 도메인을 통해 이루어진다.
재조합 수용체의 적합한 세포 내 신호전달 도메인은 천연 항원 수용체를 통한 신호(예를 들어, CD3 신호), 공동자극 수용체와 조합된 이러한 수용체를 통한 신호(예를 들어, CD3/CD28 신호) 및/또는 공동자극 수용체 단독을 통한 신호를 모방하거나 이와 비슷한 것들을 포함한다. 일부 양태에서, 짧은 올리고펩티드 또는 폴리펩티드 링커가 존재하며, 이는 막관통 도메인 및 CAR과 같은 재조합 수용체의 세포질 신호전달 도메인 사이에 결합을 형성한다.
CAR과 같은 재조합 수용체는 일반적으로 적어도 하나의 세포 내 신호전달 성분 또는 성분들을 포함한다. 일부 양태에서, 수용체는 T 세포 활성화 및 세포독성을 매개하는 TCR CD3 사슬, 예컨대 CD3 제타 사슬과 같은 TCR 복합체의 세포 내 성분을 포함한다. 따라서, 일부 양태에서, 항원-결합 부분은 하나 이상의 세포 신호전달 도메인에 연결된다. 일부 양태에서, 세포 신호전달 도메인은 CD3 막관통, CD3 세포 내 신호전달 도메인 및/또는 다른 CD 막관통 도메인을 포함한다. 일부 구현예에서 수용체는 하나 이상의 추가의 분자, 예컨대 Fc 수용체 γ CD8, CD4, CD25 또는 CD16의 일부를 더 포함한다. 예를 들어, 일부 양태에서, 키메라 수용체는 CD3-제타(CD3-ζ) 또는 FC 수용체 γ 및 CD8, CD4, CD25 또는 CD16 사이에 키메라 분자를 포함한다.
일부 양태에서, CAR 또는 다른 키메라 수용체의 결합 시, 수용체의 세포질 도메인 또는 세포 내 신호전달 도메인은 적어도 하나의 정상적인 효과기 기능 또는 면역세포의 반응, 예컨대, 세포용해 활성 또는 T-헬퍼 활성, 예컨대 사이토카인 또는 다른 인자의 분비를 활성화한다. 일부 양태에서, 항원 수용체 성분 또는 공동자극 분자의 세포 내 신호전달 도메인의 절단된 부분은 예를 들어, 그것이 효과기 기능 신호를 전달하는 경우, 온전한 면역자극 사슬 대신에 사용된다. 일부 양태에서, 세포 내 신호전달 도메인 또는 도메인들은 T 세포 수용체(TCR)의 세포질 서열을 포함하며, 일부 양태에서는, 자연스러운 맥락에서 항원 수용체 결합(engagement) 후 신호 전달을 개시하기 위해 이러한 수용체와 협력하여 공동 수용체의 세포질 서열도 포함한다.
천연 TCR의 경우, 완전한 활성화는 일반적으로 TCR을 통한 신호전달뿐만 아니라 공동자극 신호 또한 요구한다. 따라서, 일부 양태에서, 완전한 활성화를 촉진하기 위하여, 제2 또는 공동자극 신호를 생성하기 위한 성분이 또한 CAR에 포함된다. 다른 양태에서, CAR은 공동자극 신호를 생성하기 위한 성분을 포함하지 않는다. 일부 양태에서, 추가의 CAR은 동일한 세포에서 발현되며, 제2 또는 공동자극 신호를 생성하기 위한 성분을 제공한다.
T 세포 활성화는 일부 양태에서, 2가지 부류의 세포질 신호전달 서열에 의해 매개되는 것으로 기술된다: TCR을 통한 항원-의존성 1차 활성화를 개시하는 서열(1차 세포질 신호전달 서열) 및 항원-비의존성 방식으로 작용하여 제2 또는 공동자극 신호를 제공하는 서열(2차 세포질 신호전달 서열). 일부 양태에서, CAR은 이러한 신호전달 성분 중 하나 또는 둘 다를 포함한다.
일부 양태에서, CAR은 TCR 복합체의 1차 활성화를 조절하는 1차 세포질 신호전달 서열을 포함한다. 자극성 방식으로 작용하는 1차 세포질 신호전달 서열은 면역수용체 티로신-기반 활성화 모티프(immunoreceptor tyrosine-based activation motifs, ITAMs)라 알려져 있는 신호전달 모티프를 함유할 수 있다. TCR 제타, FcR 감마, GcR 베타, CD3 감마, CD3 델타, CD3 엡실론, CDS, CD22, CD79a, CD79b 및 CD66d는 ITAM을 함유하는 1차 세포질 신호전달 서열의 예이다. 특정 양태에서, CAR의 세포질 신호전달 도메인은 CD3 제타로부터 유래하는 서열을 포함한다.
특정 양태에서, CAR은 CD28, 4-1BB, OX40, DAP10 및 ICOS와 같은 신호전달 도메인 및/또는 막관통 부분를 포함한다. 일부 양태에서, 동일한 CAR은 활성화 성분 및 공동자극 성분 둘 다를 포함한다.
일부 양태에서, 활성화 도메인은 하나의 CAR 내에 포함되는 반면, 공동자극 성분은 상이한 항원을 인식하는 또 다른 CAR에 의해 제공된다. 일부 양태에서, CAR은 동일한 세포상에서 발현되는 활성화 또는 자극성 CAR, 공동자극 CAR을 포함한다(WO 2014/055668 참조). 일부 양태에서, 세포는 하나 이상의 자극성 또는 활성화 CAR 및/또는 공동자극 CAR을 포함한다. 다른 양태에서, 세포는 질병 또는 상태와 관련되고/되거나 이에 특이적인 항원 이외의 항원을 인식하는 것에 의해 질병 표적화 CAR을 통해 전달된 활성화 신호가, 예를 들어 표적-외(off-target) 효과를 감소시키기 위해, 억제성 CAR의 리간드에 대한 결합에 의해 감소되거나 억제되는 CAR과 같은 억제성 CAR을 더 포함한다(iCAR, Fedorov et al 2013, Sci Transl Med. 5: 215 참조).
특정 양태에서, 세포 내 신호전달 도메인은 CD3(예를 들어, CD3-제타) 세포 내 도메인에 연결된 CD28 막관통 및 신호전달 도메인을 포함한다. 일부 양태에서, 세포 내 신호전달 도메인은 CD3 제타 세포 내 도메인에 연결된 키메라 CD28 및 CD137(4-1BB/TNFRSF9) 공동자극 도메인을 포함한다.
일부 양태에서, CAR은 하나 이상의 공동자극 도메인 및 활성화 도메인, 예를 들어 세포질 부분의 1차 활성화 도메인을 포괄한다. 예시적인 CAR은 CD3 제타, CD28 및 4-1BB를 포함한다.
특정 양태에서, CAR은 항체 또는 항체 단편을 함유하는 세포 외 부분을 포함한다. 일부 양태에서, 키메라 항원 수용체는 항체 또는 단편을 함유하는 세포 외 부분 및 세포 내 신호전달 도메인을 포함한다. 일부 양태에서, 항체 또는 단편은 scFv를 포함하며, 세포 내 도메인은 ITAM을 함유한다. 일부 양태에서, 세포 내 신호전달 도메인은 CD3-제타 사슬의 제타 사슬의 신호전달 도메인을 포함한다. 일부 양태에서, CAR은 세포 외 도메인 및 세포 내 신호전달 도메인을 연결하는 막관통 도메인을 포함한다. 일부 양태에서, 막관통 도메인은 CD28의 막관통 부분을 함유한다. 일부 양태에서, CAR은 T 세포 공동자극 분자의 세포 내 도메인을 함유한다. 일부 양태에서, T 세포 공동자극 분자는 CD28 또는 4-1BB이다.
본원에 사용되는 용어 "T 세포 수용체(T cell receptor)" 또는 "TCR"은 항원 제시에 반응하여 T 세포의 활성화에 참여하는 막 단백질의 복합체를 지칭한다. TCR은 주요 조직적합성 복합체 분자에 결합되는 항원을 인식하는 역할을 한다. TCR은 알파(a) 및 베타(β) 사슬의 이종이량체(heterodimer)로 구성되지만, 일부 세포에서 TCR은 감마 및 델타(γ/δ) 사슬로 구성된다. TCR은 알파/베타 및 감마/델타 형태로 존재할 수 있으며, 이는 구조적으로 유사하지만 뚜렷한 해부학적 위치 및 기능을 갖는다. 각 사슬은 가변 및 불변 도메인인 2개의 세포 외 도메인으로 구성된다. TCR은 예를 들어, 헬퍼 T 세포, 세포독성 T 세포, 기억 T 세포, 조절 T 세포, 자연 살해 T 세포 및 감마 델타 T 세포를 포함하는 TCR을 포함하는 임의의 세포에서 변형될 수 있다.
TCR은 내인성(endogenous) TCR, 즉 내인성이거나 T 세포에 고유한(native)(자연 발생적인) TCR일 수 있다. 이러한 경우에, 내인성 TCR을 포함하는 T 세포는 특정 항원을 발현하는 것으로 알려져 있는 포유동물로부터 분리되는 T 세포일 수 있다. T 세포는 예를 들어, 암에 걸린 대상체로부터 분리된 1차 T 세포일 수 있다. T 세포는 대상체로부터 분리되는 종양 침윤 림프구(tumour infiltrating lymphocyte, TIL) 또는 말초 혈액 림프구일 수 있다. 대안적으로, 내인성 항원 특이적 TCR을 포함하는 T 세포는 포유동물로부터 분리되는 세포의 혼합 집단 내의 T 세포일 수 있고, 혼합 집단은 시험관 내에서 배양되는 동안 내인성 TCR에 의해 인식되는 항원에 노출될 수 있다. 항원을 인식하는 TCR을 포함하는 T 세포는 시험관 내에서 증식(expand or proliferate)하여, 내인성 항원 특이적 수용체를 갖는 T 세포의 수가 증가한다.
항원 특이적 TCR, 예를 들어 본 발명에 따른 5T4 특이적 TCR은 외인성(exogenous) TCR, 즉 T 세포에 고유하지 않은(자연적으로 발생하지 않은) 항원 특이적 TCR일 수 있다. 재조합 TCR은 하나 이상의 외인성 TCR α-, β-, γ- 및/또는 δ-사슬 암호화 유전자의 재조합 발현을 통해 생성되는 TCR이다. 재조합 TCR은 전적으로 단일 포유동물 종으로부터 유래하는 폴리펩티드 사슬를 포함할 수 있거나, 항원 특이적 TCR은 2종의 상이한 포유동물 종으로부터의 TCR로부터 유래하는 아미노산 서열로 구성되는 키메라 또는 하이브리드(hybrid) TCR일 수 있다. 예를 들어, 항원 특이적 TCR은 쥣과 TCR로부터 유래하는 가변 영역, 및 TCR이 "인간화"되도록 하는 인간 TCR의 불변 영역을 포함할 수 있다. 재조합 TCR의 제조 방법은 당해 분야에 공지되어 있다. 예를 들어, 미국 특허 7,820,174; 8,785,601; 8,216,565; 및 미국 특허출원 공개번호 2013/0274203 참조.
본원에 기술되는 본 발명의 T 세포는 내인성 항원 특이적 TCR을 포함할 수 있고, 외인성(재조합) TCR 또는 다른 재조합 키메라 수용체를 암호화하는 하나 이상의 핵산으로 형질전환, 예를 들어 형질도입 또는 형질감염될 수도 있다. 이러한 외인성 키메라 수용체, 예를 들어 키메라 TCR은 내인성 TCR이 자연 발생적으로 특이성을 나타내는 항원 이외에도 형질전환된 T 세포에 대해 추가 항원에 대한 특이성을 부여할 수 있다.
본 발명의 일 양태에서, 기술된 바와 같은 임의의 항원-결합 모이어티는 다중-특이적(multi-specific)일 수 있으며, 즉 이는 하나를 초과하는 항원을 인식한다. 일 양태에서, 항원-결합 모이어티는 이중-특이적 또는 삼중-특이적 항체이다. 다중특이적 항체 생성을 위한 다수의 방법이 당해 분야에 존재하며, 당업자에게 공지될 것이다.
또한, 일 양태에서, 항원-결합 모이어티는 분화 항원(예컨대, 멜라닌 세포 분화 항원), 돌연변이 항원(예컨대, p53), 과발현된 세포 항원(예컨대, HER2), 바이러스 항원(예컨대, 인간 유두종 바이러스 단백질), 및 고환 및 난소의 생식 세포에서 발현되지만 정상적인 체세포에서는 발현되지 않는 암/고환(cancer/testis, CT) 항원(예컨대, MAGE 및 NY-ESO-1)을 포함하나 이에 한정되지 않는 종양 관련 항원과 결합할 수 있다.
5T4 특이적 CAR
또한, 본 발명은 단일클론성 항-5T4 항체로부터의 중쇄(VH) 및 경쇄(VL) 가변 단편을 포함하는 세포 외 리간드 결합 도메인, 링커, 힌지, 막관통 도메인 및 신호전달 도메인과 공동자극 도메인을 포함하는 세포질 도메인을 포함하는 5T4 특이적 CAR을 제공한다. 본 발명에 따른 CAR은 본원에 기술된 바와 같은 임의의 본 발명의 방법 또는 용도에 사용될 수 있다.
다음의 표는 CAR의 다양한 성분의 예시적인 서열을 기재한 것이다:
일 양태에서, 본 발명에 따른 5T4 특이적 CAR은 서열번호 3에 대해 적어도 70, 75, 80, 85, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99 또는 100% 서열 동일성(identity)을 갖는 "항-5T4" 도메인 또는 세포 외 리간드 결합 도메인을 포함한다. 항-5T4 도메인은 본원에 논의된 바와 같은 마우스 단일클론성 H8 항체로부터 유래할 수 있다. 일 양태에서, 항-5T4 도메인은 서열번호 3에 대해 적어도 95%, 바람직하게는 적어도 98% 또는 더욱 바람직하게는 적어도 99% 서열 동일성을 갖는다.
또 다른 양태에서, 항-5T4 도메인은 2E4 항체로부터 유래할 수 있다. 2E4 항체는 본 실시예에 기술되어 있다.
일 양태에서, 세포 외 리간드 결합 도메인은 H8 단일클론성 항체로부터의 CDR을 포함하는 VH 사슬 및 마우스 단일클론성 H8 항체로부터의 CDR을 포함하는 VL 사슬를 포함한다. 이들 서열은 당해 분야에 공지되어 있다 - 예를 들어 WO2016/034666 참조.
세포 외 리간드 결합 도메인은 본원에서 논의된 바와 같이 인간화된 VH 및 VL 사슬를 포함할 수 있다.
일 양태에서, 본 발명에 따른 5T4 특이적 CAR은 서열번호 11에 대해 적어도 70, 75, 80, 85, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99 또는 100% 서열 동일성을 갖는 "항-5T4" 도메인 또는 세포 외 리간드 결합 도메인을 포함한다. 항-5T4 도메인은 본원에 논의된 바와 같은 2E4 항체로부터 유래할 수 있다. 일 양태에서, 항-5T4 도메인은 서열번호 11에 대해 적어도 95%, 바람직하게는 적어도 98% 또는 더욱 바람직하게는 적어도 99% 서열 동일성을 갖는다.
일 양태에서, 본 발명에 따른 5T4 특이적 CAR은 서열번호 4에 대해 적어도 70, 75, 80, 85, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99 또는 100% 서열 동일성을 갖는 "링커" 도메인을 포함한다. 일 양태에서, 링커 도메인은 서열번호 4에 대해 적어도 95%, 바람직하게는 적어도 98% 또는 더욱 바람직하게는 적어도 99% 서열 동일성을 갖는다.
일 양태에서, 본 발명에 따른 5T4 특이적 CAR은 서열번호 5에 대해 적어도 70, 75, 80, 85, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99 또는 100% 서열 동일성을 갖는 "CD8 힌지" 도메인을 포함한다. 일 양태에서, CD8 힌지 도메인은 서열번호 5에 대해 적어도 95%, 바람직하게는 적어도 98% 또는 더욱 바람직하게는 적어도 99% 서열 동일성을 갖는다.
일 양태에서, 본 발명에 따른 5T4 특이적 CAR은 서열번호 6에 대해 적어도 70, 75, 80, 85, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99 또는 100% 서열 동일성을 갖는 "CD8 막관통" 도메인을 포함한다. 일 양태에서, CD8 막관통 도메인은 서열번호 6에 대해 적어도 95%, 바람직하게는 적어도 98% 또는 더욱 바람직하게는 적어도 99% 서열 동일성을 갖는다.
일 양태에서, 본 발명에 따른 5T4 특이적 CAR은 서열번호 7에 대해 적어도 70, 75, 80, 85, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99 또는 100% 서열 동일성을 갖는 "41BB 공동자극" 도메인을 포함한다. 일 양태에서, 41BB 공동자극 도메인은 서열번호 7에 대해 적어도 95%, 바람직하게는 적어도 98% 또는 더욱 바람직하게는 적어도 99% 서열 동일성을 갖는다.
일 양태에서, 본 발명에 따른 5T4 특이적 CAR은 서열번호 8에 대해 적어도 70, 75, 80, 85, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99 또는 100% 서열 동일성을 갖는 "CD3 제타 자극" 도메인을 포함한다. 일 양태에서, CD3 제타 자극 도메인은 서열번호 8에 대해 적어도 95%, 바람직하게는 적어도 98% 또는 더욱 바람직하게는 적어도 99% 서열 동일성을 갖는다.
일 양태에서, 본 발명은 서열번호 1에 기재된 서열 또는 서열번호 1에 대해 적어도 92% 동일성을 갖는 서열을 갖는 5T4 특이적 CAR을 제공한다.
서열번호 1:
MGVLLTQRTLLSLVLALLFPSMASMEVQLQQSGPDLVKPGASVKISCKASGYSFTGYYMHWVKQSHGKSLEWIGRINPNNGVTLYNQKFKDKAILTVDKSSTTAYMELRSLTSEDSAVYYCARSTMITNYVMDYWGQVTSVTVSSGGGGSGGGGTGGGGSSIVMTQTPTFLLVSAGDRVTITCKASQSVSNDVAWYQQKPGQSPTLLISYTSSRYAGVPDRFIGSGYGTDFTFTISTLQAEDLAVYFCQQDYNSPPTFGGGTKLEIKRAAALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCKRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCELLRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR
일 양태에서, CAR은 서열번호 1의 서열을 갖는다.
일 양태에서, CAR은 서열번호 1에 대해 적어도 92, 93, 94, 95, 96, 97, 98 또는 99% 동일한 서열을 갖는다.
일 양태에서, 본 발명은 서열번호 13에 기재된 서열 또는 서열번호 13에 대해 적어도 70% 동일성을 갖는 서열을 갖는 5T4 특이적 CAR을 제공한다.
서열번호 13:
MGVLLTQRTLLSLVLALLFPSMASMEVQLQQSGPELVKPGASVKISCKASGYSFTGYYMHWVKQSHVKSLEWIGRINPYNGATTYNQDFKDKASLTVDKSSSTASMELHSLTSEDSAVYYCALSTMITTAWFAYWGQGTLVTVSPGGGGSGGGGTGGGGSNFVMTQTPKFLLASAGDRVTISCKASQSVSNDVGWYQQKPGQSPKLLIYFASNRYTGVPDRFIGSGYGTDFTFTISTVQAEDLAVYFCQQDYSSPFTFGSGTKLEIKAAALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCKRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCELLRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR
일 양태에서, CAR은 서열번호 13의 서열을 갖는다.
일 양태에서, CAR은 서열번호 13에 대해 적어도 70, 71, 72, 73, 74 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98 또는 99% 동일한 서열을 갖는다.
서열 동일성은 임의의 편리한 방법에 의해 평가될 수 있다. 그러나 서열 사이의 서열 동일성의 정도를 결정하기 위해서는, 서열을 다중 정렬하는 컴퓨터 프로그램, 예를 들어 Clustal W(Thompson et al., (1994) Nucleic Acids Res., 22: 4673-4680)가 유용하다. 또한, ALIGN(Myers et al., (1988) CABIOS, 4: 1-17), FASTA(Pearson et al., (1988) PNAS, 85:2444-2448; Pearson (1990), Methods Enzymol., 183: 63-98) 및 갭(gapped) BLAST(Altschul et al., (1997) Nucleic Acids Res., 25: 3389-3402) 같은 서열의 쌍을 비교하고 정렬하는 프로그램이 이 목적을 위하여 유용하다.
나아가, 유럽 바이오인포매틱스 연구소(European Bioinformatics institute)의 Dali 서버는 단백질 서열의 구조 기반 정렬을 제공한다(Holm (1993) J. Mol. Biol., 233: 123-38; Holm (1995) Trends Biochem. Sci., 20: 478-480; Holm (1998) Nucleic Acid Res., 26: 316-9).
다중 서열 정렬 및 퍼센트 동일성 계산은 표준적인 BLAST 파라미터(이용 가능한 모든 유기체로부터의 서열, 매트릭스 Blosum 62, 갭 코스트(gap costs): 존재(existence) 11, 연장(extension) 1을 이용함)를 이용하여 결정될 수 있다.
대안적으로, 다음의 프로그램 및 파라미터가 이용될 수 있다: 프로그램: Align Plus 4, 버전 4.10(Sci Ed Central Clone Manager Professional Suite). DNA 비교: Global comparison, Standard Linear Scoring matrix, 미스매치 패널티 = 2, 오픈 갭 패널티 = 4, 익스텐드 갭 패널티 = 1. 아미노산 비교: Global comparison, BLOSUM 62 Scoring matrix.
따라서, 변이체가 모체(parent)의 기능적 활성을 유지하는 한, 즉 변이체가 기능적으로 동등한 한, 다시 말해서 변이체가 예를 들어, CAR 구조의 맥락에서 모체의 활성을 갖거나 나타내는 한, 언급되거나 또는 주어진 서열의 변이체는 본 발명의 범위에 포함된다. 이러한 변이체는 모 서열(parent sequence)과 비교하여 하나 이상의 아미노산의 아미노산 치환, 부가 또는 결실을 포함할 수 있다.
주어진 아미노산 서열의 "변이체(varient)"는 예를 들어, 하나 또는 두 개의 아미노산 잔기의 측쇄가 펩티드가 그것이 유래하는 모 펩티드의 기능적 활성을 유지하도록 (예를 들어, 이들을 또 다른 자연 발생적인 아미노산 잔기의 측쇄 또는 일부 다른 측쇄로 치환함으로써) 변경될 수 있음을 의미하는 것으로 의도된다.
변이체는 알라닌, 아르기닌, 아스파라긴, 아스파르트산, 시스테인, 글루탐산, 글루타민, 글리신, 히스티딘, 이소류신, 류신, 리신, 메티오닌, 페닐알라닌, 프롤린, 세린, 트레오닌, 트립토판, 티로신 및 발린의 잔기로부터 선택되는 하나 이상의 아미노산 잔기로의 아미노산 잔기의 치환을 포함할 수 있다.
이러한 변이체는 상동성 치환(homologous substitution), 즉 염기성을 염기성으로, 산성을 산성으로, 극성을 극성으로 등과 같은, 같은 부류(like-for-like)/보존적(conservative) 치환으로부터 발생할 수 있다. 또한, 비상동성 치환은 또한 즉, 한 부류의 잔기에서 다른 부류로, 또는 대안적으로 오르니틴, 디아미노부티르산, 노르류신, 피리딜알라닌, 티에닐알라닌, 나프틸알라닌 및 페닐글리신과 같은 비천연 아미노산의 포함을 수반하여 발생할 수 있다.
치환은 보존적 치환일 수 있다. 본원에서 사용되는 "보존적 치환(conservative substitution)"은 주어진 위치에서 아미노산 동일성을 변화시켜 대략 동등한 크기, 전하 및/또는 극성의 아미노산으로 대체하는 것을 지칭한다. 아미노산의 자연 발생적인 보존적 치환의 예는 다음의 8개의 치환기를 포함한다(종래의 1문자 코드로 나타냄): (1) M, I, L, V; (2) F, Y, W; (3) K, R, (4) A, G; (5) S, T; (6) Q, N; (7) E, D; 및 (8) C, S. 또한, 하나 이상의 아미노산이 화학적으로 유도체화된, 예를 들어 화학 기로 치환된, 기능적으로 동등한 유도체가 포함된다. 기능적으로 동등한 유도체는 펩티드의 합성 전 또는 후에 특정 아미노산과 반응시킴으로써 화학적으로 변형될 수 있다. 예를 들어, R. Lundblad, Chemical Reagents for Protein Modification, 3rd ed. CRC Press, 2004 (Lundblad, 2004)에 기술된 바와 같이, 예가 당해 분야에 공지되어 있다. 아미노산의 화학적 변형은 이에 제한되지 않지만, 아실화, 아미드화, 리신의 피리독실화, 환원성 알킬화, 아미노 기의 2,4,6-트리니트로벤젠 설폰산(TNBS)으로의 트리니트로벤질화에 의한 변형, 카복실 기의 아미드 변형 및 시스테인의 과산화포름산 산화에 의한 시스테산으로의 설프하이드릴 변형, 수은 유도체의 형성, 다른 티올 화합물과의 혼합된 이황화물의 형성, 말레이미드와의 반응, 요오드아세트산 또는 요오드아세트아미드와의 카복시메틸화 및 알칼리 pH에서의 시안산염과의 카바모일화를 포함하나, 이에 한정되지 않는다.
핵산 및 벡터
또한, 본 발명은 서열번호 1의 아미노산 서열 또는 서열번호 1에 대해 적어도 92% 동일성을 갖는 서열을 암호화하는 뉴클레오티드 서열을 갖는 핵산 분자를 포함한다. 핵산 분자는 서열번호 1에 대해 92, 93, 94, 95, 96, 97, 98, 99 또는 100% 서열 동일성을 갖는 아미노산 서열을 암호화할 수 있다. 일 양태에서, 핵산 분자는 서열번호 1의 서열로 구성되는 아미노산 서열을 암호화한다.
일 양태에서, 핵산 분자는 서열번호 2, 3, 4, 5, 6, 7 및/또는 8 중 어느 하나의 아미노산 서열을 암호화하는 서열, 및/또는 이에 대해 적어도 70, 75, 80, 85, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99 또는 100% 서열 동일성을 갖는 서열 또는 서열들을 갖는다. 일 양태에서, 서열 동일성의 레벨은 적어도 95% 또는 바람직하게는 98%이다.
일 양태에서, 핵산 분자는 서열번호 2, 3, 4, 5, 6, 7 및 8의 아미노산 서열을 암호화하는 서열을 갖는다.
본원에서 언급되는 바와 같이 "핵산 분자"는 자연 발생적 또는 합성 DNA 또는 RNA, 또는 이의 임의의 조합일 수 있다. 5T4 특이적 CAR을 암호화하는 핵산은 숙주 유기체의 세포의 기구에 의해 번역될 수 있는 방식으로 구성될 수 있다. 따라서, 천연 핵산은 예를 들어, 이의 안정성을 증가시키기 위하여 변형될 수 있다. DNA 및/또는 RNA, 그러나 특히 RNA는 뉴클레아제 저항성을 향상시키기 위하여 변형될 수 있다.
예를 들어, 리보뉴클레오티드에 대한 공지된 변형은 2'-O-메틸, 2'-플루오로, 2'-NH2 및 2'-O-알릴을 포함한다. 변형된 핵산은 핵산의 생체 내 안정성을 증가시키거나, 이의 전달을 증진시키거나 매개하거나, 또는 신체로부터의 청소율을 감소시키기 위하여 이루어진 화학적 변형을 포함할 수 있다. 이러한 변형의 예는 주어진 RNA 서열의 리보오스 및/또는 인산염 및/또는 염기 위치에서의 화학적 치환을 포함한다. 예를 들어, WO 92/03568; U.S. 5,118,672; Hobbs et al., (1973) Biochemistry 12:5138; Guschlbauer et al., (1977) Nucleic Acids Res. 4:1933; Schibaharu et al., (1987) Nucleic Acids Res. 15:4403; Pieken et al., (1991) Science 253:314 참조.
또한, 본 발명은 높은, 중간 또는 낮은 엄격성(stringency)의 조건하에서 예를 들어, 서열번호 1의 아미노산 서열 또는 서열번호 1에 대해 적어도 92% 동일성을 갖는 서열을 암호화하는 뉴클레오티드 서열을 갖는, 본원에 기술된 바와 같은 핵산 분자에 혼성화하는 핵산 분자를 포함한다. 일 양태에서, 조건은 높은 엄격성 조건이다.
혼성화의 엄격성은 폴리핵산 하이브리드가 안정한 조건을 지칭한다. 이러한 조건은 당해 분야의 당업자에게 명백하다. 당업자에게 알려져 있는 바와 같이, 하이브리드의 안정성은 하이브리드의 용융 온도(Tm)에 반영되며, 이는 서열 상동성이 1% 감소할 때마다 대략 1 내지 1.5℃ 감소한다. 일반적으로, 하이브리드의 안정성은 나트륨 이온 농도 및 온도의 함수이다. 전형적으로, 혼성화 반응은 보다 엄격한 조건 하에 수행되고, 이어서 다양한 엄격도의 세척이 수행된다.
본원에서 사용되는 바와 같이, 높은 엄격성은 65 내지 68℃에서 1 M Na +에서 안정적인 하이브리드를 형성하는 핵산 서열만의 혼성화를 허용하는 조건을 지칭한다. 예를 들어, 6× SSC, 5× 덴하르트(Denhardt's), 1% SDS(나트륨 도데실 설페이트), 0.1 Na+ 피로포스페이트 및 비특이적 경쟁자로서 0.1 mg/ml 변성 연어 정자 DNA를 함유하는 수용액에서 혼성화함으로써, 높은 엄격성 조건을 제공할 수 있다. 혼성화 후, 0.2 내지 0.1× SSC, 0.1 % SDS에서 혼성화 온도에서 최종 세척(약 30분)으로, 높은 엄격성의 세척이 여러 단계로 수행될 수 있다.
중간 엄격성은 상기 기술된 용액 중에서의 혼성화와 동등하지만, 약 60 내지 62℃에서의 조건을 지칭한다. 이 경우, 최종 세척은 1× SSC, 0.1% SDS에서 혼성화 온도에서 수행된다.
낮은 엄격성은 상기 기술된 용액 중에서의 혼성화와 동등하지만, 약 50 내지 52℃에서의 조건을 지칭한다. 이 경우, 최종 세척은 2× SSC, 0.1% SDS에서 혼성화 온도에서 수행된다.
이들 조건은 다양한 완충액, 예를 들어 포름아미드 기반의 완충액, 및 온도를 이용하여 조정 및 재현될 수 있는 것으로 알려져 있다. 덴하르트 용액 및 SSC는 다른 적합한 혼성화 완충액처럼 당업자에게 잘 알려져 있다(예를 들어, Sambrook, et al., eds. (1989) Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory Press, New York 또는 Ausubel, et al., eds. (1990) Current Protocols in Molecular Biology, John Wiley & Sons, Inc. 참조). 프로브의 길이 및 GC 함량도 역할을 하므로, 최적 혼성화 조건은 경험적으로 결정되어야 한다.
또한, 본 발명은 서열번호 1의 아미노산 서열 또는 서열번호 1에 대해 적어도 92% 동일성을 갖는 서열을 암호화하는 뉴클레오티드 서열을 갖는 핵산 분자를 포함하는 벡터를 포함한다. 일 양태에서, 핵산 분자는 서열번호 9에 기재된 바와 같은 서열을 갖는다.
핵산 분자는 프로모터에 작동 가능하게 연결될 수 있다. 일 양태에서, EF1α 프로모터가 사용된다(서열번호 10 참조).
핵산은 발현 카세트 또는 발현 벡터(예를 들어, 박테리아 숙주 세포 내로의 도입을 위한 플라스미드, 또는 바이러스 벡터, 또는 포유동물 숙주 세포의 형질감염을 위한 렌티바이러스와 같은 플라스미드 또는 바이러스 벡터) 내에 존재할 수 있다. 적합한 렌티바이러스 벡터는 HIV-1, HIV-2, SIV, FIV, BIV, EIAV, CAEV 또는 비스나 렌티바이러스로부터 유래할 수 있고, US 6,924,123, US 7,056,699, WO1998/055607, WO 1998/17815, WO 1999/32646, WO 2001/79518, WO 2003/064665, US 6,969,598에 기술되어 있다.
본 발명에서 사용되는 "벡터"는 숙주 세포 내에서 핵산을 전달하거나 유지할 수 있는 임의의 작용제일 수 있고, 바이러스 벡터, 플라스미드, 네이키드 핵산, 폴리펩티드 또는 다른 분자와 복합체를 이룬 핵산 및 고체상 입자에 고정화된 핵산을 포함한다.
본원에서 논의되는 바와 같이, 본 발명은 생체 외에서 상기 면역세포 내로 본 발명의 핵산 분자 또는 벡터를 도입하는 단계를 포함하는, 면역요법을 위한 면역세포를 제공하는 방법을 포괄한다.
일 양태에서, 상기 핵산 분자는 렌티바이러스 벡터 내에 포함된다. 추가의 양태에서, 렌티바이러스 벡터는 HIV 또는 EIAV로부터 유래된다.
암 치료 또는 예방
본 발명의 5T4 특이적 CAR은 치료에, 즉 약제로 사용될 수 있다.
특히, 본 발명의 5T4 특이적 CAR은 암의 치료 또는 예방에 사용될 수 있다.
본 발명은 본 발명의 5T4 특이적 CAR을 대상체에게 투여하는 단계를 포함하는, 대상체에서 암을 치료 또는 예방하는 방법을 제공한다.
또한, 암의 치료 또는 예방에 사용하기 위한 약제의 제조에 있어서 본 발명의 5T4 특이적 CAR의 용도, 및 암의 치료 또는 예방에 있어서 5T4 특이적 CAR의 용도가 제공된다.
본 발명의 5T4 특이적 CAR은 5T4 항원을 발현하는 암의 치료 또는 예방에 사용될 수 있다.
예를 들어, 이러한 암은 고형 종양, 예컨대 담관 종양, 뼈 종양, 방광 종양, 뇌/CNS 종양, 유방 종양, 결장직장 종양, 자궁경부 종양, 자궁내막 종양, 위 종양, 두경부 종양, 간 종양, 폐 종양, 근육 종양, 중피종, 신경 종양, 식도 종양, 난소 종양, 췌장 종양, 흉막/복막 종양, 전립선 종양, 신장 종양, 피부 종양, 고환 종양, 갑상선 종양, 태반 종양, 자궁 종양 및 외음부 종양을 포함할 수 있으나, 이에 한정되지 않는다.
일 양태에서, 암은 고형 종양을 수반하지 않으며, 본원에 기술된 바와 같은 혈액암이다.
일 양태에서, 암은 난소암이다.
일 양태에서, 암은 중피종이다.
일 양태에서, 암은 골수종이다.
일 양태에서, 암은 만성 림프구성 백혈병, 급성 골수성 백혈병, 다발성 골수종, B 세포 급성 림프아구성 백혈병, 만성 골수성 백혈병 또는 T 세포 급성 림프아구성 백혈병이다.
일 양태에서, 암은 프리-B 급성 림프아구성 백혈병, 예를 들어 소아 프리-B 급성 림프아구성 백혈병이다.
면역세포
조작된 면역 또는 면역자극 세포와 같은 세포뿐만 아니라, 입양 요법에서와 같이 세포를 생산하고 이용하는 방법, 및 세포를 함유하는 약학 조성물과 같은 조성물이 제공된다.
따라서, 본 발명은 본원에 기술된 바와 같은 5T4 특이적 CAR을 발현하는 면역세포를 제공한다. 이러한 세포의 집단 또한 제공된다.
일 양태에서, 본 발명은 생체 외에서 세포 내로 본원에 정의된 바와 같은 핵산 또는 벡터를 도입하는 단계를 포함하는, T 세포, NK 세포 또는 NKT 세포와 같은 면역 세포를 제공하는 방법을 제공한다.
일 양태에서, 세포 또는 세포 집단은 치료에서, 즉 약제로서 사용될 수 있다.
세포 또는 세포 집단은 암 치료 또는 예방에 사용될 수 있다.
일 양태에서, 암은 골수종이다.
일 양태에서, 세포는 유전적으로 변형되어 동종 이식에 더 적합해질 수 있다.
세포는 예를 들어, WO 2013/176915에 기술된 바와 같은 T 세포 수용체(TCR)의 하나 이상의 성분을 발현하는 적어도 하나의 유전자를 불활성화시킴으로써 동종이계로 만들어질 수 있으며, 이는 HLA 또는 β2ITI 단백질을 암호화하는 유전자 또는 HLA 또는 β2ITI 단백질 발현을 조절하는 유전자의 불활성화와 조합될 수 있다. 이식편 대 숙주 증후군(graft versus host syndrome) 및 이식편 거부(graft rejection) 위험은 감소될 수 있다.
면역세포는 예를 들어, 5T4 양성 악성 종양 세포를 치료하기 위한 표준 치료법으로서 사용되는 면역억제 약물 또는 화학요법 치료제에 대한 내성을 개선하기 위하여 추가로 유전자 조작될 수 있다. 예를 들어, 캄파스(알렘투주무맙) 및 글루코코르티코이드 치료제의 약물 표적인 CD52 및 글루코코르티코이드 수용체(G)는 불활성화시켜 세포를 이들 치료에 내성을 나타내게 하여, 특이적인 5T4 CAR이 부여되지 않은 내인성 T 세포에 비해 이들 세포에 경쟁적인 장점을 제공할 수 있다. 또한, CD3 유전자의 발현을 억제하거나 감소시켜 또 다른 면역억제 약물인 테플리주맙에 대한 내성을 부여할 수 있다. 또한, HPRT의 발현을 억제하거나 감소시켜 화학요법에 일반적으로 사용되는 세포증식억제제인 6-티오구아닌에 대한 내성을 부여할 수 있다.
PDCD1 또는 CTLA-4와 같은, T 세포 활성화의 조절 인자로서 작용하는 "면역 체크포인트"로 작용하는 단백질을 암호화하는 유전자 또한 불활성화될 수 있다.
일 양태에서, 세포는 또 다른 항원에 특이적으로 결합하며 공동자극 신호를 세포에 유도할 수 있는 공동자극 수용체, 예컨대 키메라 공동자극 수용체와 같은 또 다른 유전자 조작된 항원 수용체를 포함할 수 있다. 일부 양태에서, 이러한 또 다른 표적 항원 및 제1 수용체에 의해 인식되는 제1 표적 항원은 구분된다.
투여
본 발명에 따른 세포 또는 세포 집단은 약학 조성물과 같은 조성물의 형태로 투여될 수 있고, 이는 세포 또는 세포 집단 및 하나 이상의 약학적으로 허용 가능한 부형제를 포함할 수 있다.
세포 또는 세포 집단 또는 조성물의 투여는 임의의 적합한 수단, 예를 들어 주사(injection), 섭취(ingestion), 삽입(implantation), 이식(transplantation) 또는 흡입(inhalation) 또는 수혈(transfusion)에 의할 수 있다.
투여는 임의의 적합한 경로, 예를 들어 국소 또는 전신 투여에 의할 수 있다.
일 양태에서, 투여는 정맥 내, 복강 내, 피하, 피부 내, 종양 내 또는 근육 내일 수 있다.
일 양태에서, 투여는 국소 투여, 예를 들어 복강 내 또는 흉강 내 투여이다. 일 양태에서, 암은 난소암 또는 중피종이고, 투여는 복강 내(난소암) 또는 흉강 내(중피종)이다.
일 양태에서, 투여는 전신성이며, 암은 골수종이다.
투여되는 세포의 수는 1 × 105 내지 1 × 1010개의 세포/체중 kg의 범위일 수 있다. 일부 양태에서, 투여되는 세포의 수는 약 1 × 106 내지 2 × 107개의 세포/체중 kg이다. 일부 양태에서, 투여되는 세포의 수는 1 × 107 내지 1 × 1011 세포의 범위이다. 세포는 상기 기술된 범위 내에서 1회 또는 수차례, 그리고 면역요법에서 일반적으로 공지되어 있는 주입 기술을 이용하여 투여될 수 있다(예를 들어, Rosenberg et al 1998 New Eng. J. Med. 319; 1676 참조). 특정 양태에서, 세포는 복강 내 또는 흉강 내 경로를 통해 투여될 수 있다. 일 양태에서, 암은 난소암 또는 중피종이다.
특정 양태에서, 세포(예컨대, T 세포, NK 세포 또는 NK-T 세포)를 대상체에게 투여한 다음, 이후에 혈액을 다시 채취하고(또는 성분채집술을 수행하고), 세포를 활성화시켜 활성화 및/또는 증식된 세포를 대상체에게 다시 주입하는 것이 바람직할 수 있다.
환자에게 투여되는 세포의 수는 치료될 상태의 정확한 속성 및 환자의 상태에 따라 다를 것이다. 환자에게 투여하기 위한 용량의 규모 조절(scaling)은 당해 분야에 기술된 허용되는 방법에 따라 수행될 수 있다.
특정 양태에서, 림프구 제거법(lymphodepletion)이 예를 들어, CAR 또는 TCR을 발현하는 세포(예컨대, T 세포, NK 세포 또는 NKT 세포)의 투여 전에 대상체에서 수행된다. 림프구 제거법은 멜팔란(melphalan), 싸이톡산(cytoxan), 시클로포스파미드(cyclophosphamide), 및 플루다라빈(fludarabine) 또는 림프구 제거법에 적합하다고 당업자에게 알려져 있는 유사한 작용제 중 하나 이상을 투여하는 것을 포함한다.
병용 요법(combination therapy)
본 발명에 따른 5T4 표적화제, 예를 들어 5T4 특이적 CAR T 세포는 단독요법으로 또는 예를 들어, 암, 예컨대 혈액암의 치료를 위한 표준 치료(standard of care)와 조합하여 사용될 수 있다.
'조합하여(in combination)'는 본 발명에 따른 임의의 양태의 투여 전에, 투여와 동시에, 또는 투여 후의 추가의 치료제의 투여를 지칭할 수 있다.
따라서, 암 치료 방법은 이를 필요로 하는 환자에게 유효량의 본 발명의 5T4 표적화제, 예컨대 5T4 특이적 CAR T 세포를 단독요법으로서, 또는 추가의 항암제 또는 암의 증상을 완화시키는 다른 작용제와 조합하여 투여하는 단계를 포함한다.
예를 들어, 5T4 표적화제는 체크포인트 차단 요법, 공동자극 항체, 화학요법 및/또는 방사선요법, 표적 요법 또는 단일클론성 항체 요법과 조합하여 투여될 수 있다.
일 양태에서, 5T4 표적화제는 면역 체크포인트 단백질의 억제제와 조합하여 투여될 수 있다. 억제성 면역체크포인트 단백질의 예는 PD-1, CTLA-4, BTLA, KIR, LAG3, TIGIT, CD155, B7H3, B7H4, VISTA 및 TIM3을 포함하나, 이에 한정되지 않는다. 활성(activatory) 면역 체크포인트 단백질의 예는 GITR, OX40, 4-1BB, ICOS, HVEM을 포함하나, 이에 한정되지 않는다. 또한, 면역 체크포인트 단백질은 억제 또는 활성 방식으로 면역반응을 조절하는 다른 면역 체크포인트 단백질에 결합하는 단백질을 지칭할 수 있다. 이러한 단백질은 PD-L1, PD-L2, CD80, CD86, HVEM, GAL9, ICOS-리간드, OX-40 리간드, GITR-리간드, 4-1BB-리간드를 포함하나, 이에 한정되지 않는다.
일 양태에서, 5T4 표적화제는 사이토카인 요법과 조합하여 투여될 수 있다. 사이토카인 요법은 IFN-α, IL-2, IFN-γ, IL-1, IL-3, GM-CSF/IL-3 융합 단백질, IL-4, IL-5, IL-7, IL-10, IL-12, IL-18, IL-21, 및 TNF-α 요법을 포함하나, 이에 한정되지 않는다.
본원에 사용된 바와 같은 화학요법 실체(entity)는 세포를 파괴하는 실체, 즉 실체가 세포의 생존능력을 감소시는 실체를 지칭한다. 화학요법 실체는 세포독성 약물일 수 있다. 고려되는 화학요법제는 제한 없이, 알킬화제(alkylating agent), 안트라사이클린(anthracycline), 에포틸론(epothilone), 니트로소우레아(nitrosourea), 에틸렌이민/메틸멜라민(ethylenimines/methylmelamine), 알킬 설포네이트(alkyl sulfonate), 알킬화제(alkylating agent), 항대사물질(antimetabolite), 피리미딘 유사체(pyrimidine analog), 에피포도필로톡신(epipodophylotoxin), L-아스파라기나아제(L-asparaginase)와 같은 효소; IFNα, IL-2, G-CSF 및 GM-CSF와 같은 생물 반응 조절제(biological response modifier); 시스플라틴(cisplatin), 옥살리플라틴(oxaliplatin) 및 카보플라틴(carboplatin)과 같은 백금 배위 착물(platinum coordination complex), 안트라세네디온(anthracenedione), 하이드록시우레아(hydroxyurea)와 같은 치환된 우레아(substituted urea), N-메틸하이드라진(N-methylhydrazine, MIH) 및 프로카바진(procarbazine)을 포함하는 메틸하이드라진 유도체(methylhydrazine derivative), 미토탄(mitotane)(o,p'-DDD) 및 아미노글루테티미드(aminoglutethimide)와 같은 부신피질 억제제(adrenocortical suppressant); 프레드니손(prednisone) 및 등가물, 덱사메타손(dexamethasone) 및 아미노글루테티미드(aminoglutethimide)와 같은 부신피질 스테로이드 길항제(adrenocorticosteroid antagonist)를 포함하는 호르몬 및 길항제; 하이드록시프로게스테론 카프로에이트(hydroxyprogesterone caproate), 메드록시프로게스테론 아세테이트(medroxyprogesterone acetate) 및 메게스트롤 아세테이트(megestrol acetate)와 같은 프로게스틴(progestin); 디에틸스틸베스트롤(diethylstilbestrol) 및 에티닐 에스트라디올 등가물(ethinyl estradiol equivalent)과 같은 에스트로겐(estrogen); 타목시펜(tamoxifen)과 같은 항에스트로겐(antiestrogen); 테스토스테론 프로피오네이트(testosterone propionate) 및 플루옥시메스테론(fluoxymesterone)/등가물을 포함하는 안드로겐(androgen); 플루타미드(flutamide), 생식선 자극 호르몬 분비 호르몬 유사체(gonadotropin-releasing hormone analog) 및 류프롤라이드(leuprolide)와 같은 항안드로겐(antiandrogen); 및 플루타미드와 같은 비스테로이드성 항안드로겐(non-steroidal antiandrogen)을 포함한다.
비제한적인 예로, 일 양태에서, 5T4 표적화제는 다발성 골수종 치료에 사용되는 프로테아솜 억제제(proteasome inhibitor)인 카르필조밉(예를 들어, 키프롤리스(KYPROLIS®))와 조합하여 투여될 수 있다(Siegel DS et al. Blood 2012; 120:2817-2825 참조). 카르필조밉은 정맥 내/IV 주입으로서 투여될 수 있다. 카르필조밉은 다발성 골수종을 치료하기 위하여 다양한 추가 작용제와 병용되었다. 예를 들어, 카르필조밉은 레날리도마이드 및/또는 덱사메타손 및/또는 포말리도마이드와 병용되었다. 일 양태에서, 카르필조밉은 레날리도마이드 또는 포말리도마이드, 덱사메타손 및 5T4 표적화제와의 병용 요법으로 투여될 수 있다.
또한, 카르필조밉은 파노비노스타트와 병용되었다(Berdeja JG et al. Haematologica 2015; 100:670-676 참조). 일 양태에서, 카르필조밉은 파노비노스타트 및 5T4 표적화제와의 병용 요법으로 투여된다.
병용 요법을 위한 또 다른 예시적인 작용제는 CD38(다발성 골수종 세포에서 고도로 발현되는 당단백질)과 결합하는 인간 단일클론성 항체인 다라투무맙(예를 들어, 다잘렉스(DARZALEX™))이다. 다라투무맙은 다발성 골수종을 치료하기 위하여 정맥 내 주입에 의하여 환자에 투여될 수 있다(Lokhorst HM et al. N Engl J Med 2015; 373:1207-1219 참조).
일 양태에서, 5T4 표적화제는 CD319, 또는 악성 다발성 골수종 세포의 마커인 신호전달 림프구 활성화 분자 F7(signaling lymphocytic activation molecule F7, SLAMF7)에 결합하는 단일클론성 항체인 엘로투주맙(예를 들어, 엠플리시티(EMPLICITI™))과 조합될 수 있다. 엘로투주맙은 다발성 골수종을 치료하기 위하여 정맥 내 주입에 의하여 환자에게 투여될 수 있다(Zonder JA et al. Blood 2012; 120: 552-559 참조).
대안적으로, 병용 요법은 다발성 골수종을 치료하기 위하여 환자에게 제공되는 면역조절제인 레날리도마이드(예를 들어, 레블리미드(REVLIMID®))를 포함할 수 있다.
병용 요법을 위한 또 다른 예시적인 작용제는 다발성 골수종 및 외투세포 림프종(mantle cell lymphoma)을 치료하기 위하여 환자에게 제공되는 프로테아솜 억제제인 보르테조밉(예를 들어, 벨케이드(VELCADE®))이다. 보르테조밉은 정맥 내 주사를 통해 환자에게 투여될 수 있다.
병용 요법을 위한 또 다른 예시적인 작용제는 암(다른 것 중에서도 다발성 골수종, 급성 골수성 백혈병, 호지킨 및 비호지킨 림프종, 유방암 및 폐암을 포함) 치료에 사용되는 알킬화제인 시클로포스파미드(예를 들어, 싸이톡산(CYTOXAN®))이다.
알킬화제인 멜팔란 또한 암(다발성 골수종 및 난소암 포함) 치료를 위한 병용 요법에 사용될 수 있다. 멜팔란은 주사 또는 주입액으로서 경구로 투여될 수 있다.
병용 요법을 위한 다른 예시적인 작용제는 다발성 골수종 치료에 사용되는 면역조절제인 포말리도마이드(예를 들어, 포말리스트(POMALYST®)) 및 암(다발성 골수종 포함) 치료에 사용되는 프로테아솜 억제제인 익사조밉(닌라로(NINLARO®))을 포함한다.
약물
컨쥬게이트
본원에 논의되는 바와 같이, 추가의 양태에서, 본 발명에 따른 5T4 표적화제는 그 자체가 암세포, 예를 들어 혈액암 세포에 예를 들어, 독성 분자를 선택적으로 전달하는 운반자(carrier)로서 작용할 수 있다. 즉, 예를 들어 항체/CAR의 특이성은 5T4를 발현하는 세포에 대한 독성 페이로드의 선택적인 전달을 달성할 수 있다.
예로서, 5T4 특이적 항체 또는 CAR/CAR T 세포의 특이성은 혈액 세포와 같은 암세포에, 연결된 세포독성제를 전달하기 위해 이용될 수 있다.
일 양태에서, 항체-약물 컨쥬게이트 또는 CAR T 세포-약물 컨쥬게이트가 사용될 수 있다.
적합한 컨쥬게이트 및 컨쥬게이션 방법은 당해 분야에 공지되어 있다 - 예를 들어, Parslow et al. Biomedicines 2016, 4:14의 리뷰를 참조.
도 1: 5T4-CAR-T 구조체의 개략도. 이들은 α-5T4 scFv(H8 또는 2E4); 공동자극 도메인(CD28 또는 4-1BB); 또는 프로모터 영역(CMV 또는 EF1α)에 있어서의 변형을 포함한다.
도 2: CAR-5T4 구조체의 인간 T 세포로의 형질도입 및 이후의 성장.
도 3: 5T4 양성 종양 세포에 대한 노출 후 5T4 CAR-T 세포에 의한 시험관 내(in vitro) IFNγ 분비.
도 4: 인간 중피종 세포주 NCI-H226(5T4 고 발현자) 및 결장직장 세포주 LS174T(5T4 저 발현자)에 대한 시험관 내에서의 5T4 CAR 구조체 H8-EF1α-CD3ζ/4-1BB 및 2E4-EF1α-CD3ζ/4-1BB의 활성.
도 5: 5T4 특이적 단일 클론 항체/5T4 단백질을 이용한 시험관 내에서의 5T4 차단에 대한 5T4 CAR 구조체(H8-EF1α-CD3ζ/4-1BB 및 2E4-EF1α-CD3ζ/4-1BB)의 특이성.
도 6: 난소암 세포와 공 배양 시 CAR-T 세포 기능성의 시험관 내 평가에 대한 개략도.
도 7: 건강한 공여자와 비교한, 난소암 환자로부터의 PBMC로의 5T4 CAR 구조체의 형질도입.
도 8: 난소암 환자로부터 회수된 종양 분해물(disaggregate) 상에서의 5T4 발현.
도 9: 자가 난소 종양 분해물과 공동 배양된 CAR-T 5T4 세포에 의한 IFNγ 분비.
도 10: 난소암 모델에 대한 5T4 CAR-T 세포의 생체 내(in vivo) 효능을 보여주는 생존 곡선; 구조체: CMV-H8-CAR-CD3ζ/4-1BB 및 CMV-H8-CAR-CD3ζ/CD28; 마우스: NSG(군 당 3마리); 세포 용량/경로: 2 × 107개 총 T 세포, IV 투여.
도 11: 난소암 모델에 대한 5T4 CAR-T 세포의 최소 유효 용량을 보여주는 생존 곡선; 구조체: CMV-H8-CAR-CD3ζ/4-1BB 및 CMV-H8-CAR-CD3ζ/CD28; 종양 세포: SKOV-3 난소암(2.5 × 106개 IP 투여 유발검사) CAR-T 세포: IV 투여를 통해 전달된 1 × 107, 0.3 × 107, 0.1 × 107, 0.03 × 107개 CAR-T 세포.
도 12: 난소암 유발검사에 대한 IP 또는 IV 투여를 통한 CAR-T 투여 효능 간의 비교를 보여주는 생물발광 이미지; 종양 세포: SKOV-3 난소암(2.5 × 106개 IP 투여 유발검사); CAR-T 세포: IP 또는 IV 투여 경로를 통한 1 × 107 또는 1 × 106 CAR T 세포.
도 13: 상이한 α-5T4 ScFv를 이용한 난소암 모델에 대한 5T4 CAR-T 세포의 생체 내 효능을 보여주는 생존 곡선; 구조체: (H8-EF1α-CD3ζ/4-1BB 및 2E4-EF1α-CD3ζ/4-1BB); 시험 세포: 1 × 107개 CAR T 세포; 종양 세포: SKOV-3 난소암.
도 14: 상이한 α-5T4 ScFv를 이용한 난소암 모델에 대한 5T4 CAR-T 세포의 생체 내 효능을 보여주는 생존 곡선; 구조체: (H8-EF1α-CD3ζ/4-1BB 및 2E4-EF1α-CD3ζ/4-1BB); 종양 세포: NCI-H929 골수종 세포.
도 15: 3종의 골수종 세포주에서 5T4 발현의 FACS 분석; A: 양성 대조군(유방 [MCF7] 세포주); B: 음성 대조군(DLBCL); C: H929 골수종 세포주; D: JJN3 골수종 세포주; E: RPMI-8226 세포주.
도 16: 5T4 염색의 면역조직화학 이미지; A: CHO 세포(음성 대조군); B: 5T4로 형질감염된 CHO 세포(양성 대조군); C: MCF7(유방) 세포; D: H929(골수종) 세포
도 17: 다발성 골수종 환자 4명으로부터 채취된 골수종 샘플 상의 5T4 염색의 면역조직화학 이미지.
도 18: 암 치료에서 암 줄기세포의 박멸(eradication)의 중요성.
기존의 화학요법(표준 요법)은 빠르게 증식하는 세포를 제거하여 대부분의 고형 종양을 제거하지만, 막에 위치한 약물 운반체로 인하여 요법에 더욱 저항성을 나타낼 가능성이 있는 암 줄기세포(cancer stem cell, CSC)는 놓치며, 이는 재발을 초래할 수 있는 것으로 상정하였다. 수술 이외에, 종양을 제거하기 위한 최적의 치료 계획은 벌크 종양 세포 및 종양 내의 암 줄기세포 둘 다를 표적화하는 것(예를 들어, 5T4 표적화 치료법)이라고 주장될 수 있다.
도 19: 고형 종양의 암 줄기세포 상에서의 5T4 발현. 이 도면은 OVCAR-3(난소), MCF7(유방), HCT116(결장직장), HT29(결장직장), U251(교아세포종) 및 A549(폐) 세포주에서 '벌크' 종양 세포(단일층) 또는 암 줄기세포(구체(sphere)) 상에서의 5T4 발현의 수준을 보여준다.
도 2: CAR-5T4 구조체의 인간 T 세포로의 형질도입 및 이후의 성장.
도 3: 5T4 양성 종양 세포에 대한 노출 후 5T4 CAR-T 세포에 의한 시험관 내(in vitro) IFNγ 분비.
도 4: 인간 중피종 세포주 NCI-H226(5T4 고 발현자) 및 결장직장 세포주 LS174T(5T4 저 발현자)에 대한 시험관 내에서의 5T4 CAR 구조체 H8-EF1α-CD3ζ/4-1BB 및 2E4-EF1α-CD3ζ/4-1BB의 활성.
도 5: 5T4 특이적 단일 클론 항체/5T4 단백질을 이용한 시험관 내에서의 5T4 차단에 대한 5T4 CAR 구조체(H8-EF1α-CD3ζ/4-1BB 및 2E4-EF1α-CD3ζ/4-1BB)의 특이성.
도 6: 난소암 세포와 공 배양 시 CAR-T 세포 기능성의 시험관 내 평가에 대한 개략도.
도 7: 건강한 공여자와 비교한, 난소암 환자로부터의 PBMC로의 5T4 CAR 구조체의 형질도입.
도 8: 난소암 환자로부터 회수된 종양 분해물(disaggregate) 상에서의 5T4 발현.
도 9: 자가 난소 종양 분해물과 공동 배양된 CAR-T 5T4 세포에 의한 IFNγ 분비.
도 10: 난소암 모델에 대한 5T4 CAR-T 세포의 생체 내(in vivo) 효능을 보여주는 생존 곡선; 구조체: CMV-H8-CAR-CD3ζ/4-1BB 및 CMV-H8-CAR-CD3ζ/CD28; 마우스: NSG(군 당 3마리); 세포 용량/경로: 2 × 107개 총 T 세포, IV 투여.
도 11: 난소암 모델에 대한 5T4 CAR-T 세포의 최소 유효 용량을 보여주는 생존 곡선; 구조체: CMV-H8-CAR-CD3ζ/4-1BB 및 CMV-H8-CAR-CD3ζ/CD28; 종양 세포: SKOV-3 난소암(2.5 × 106개 IP 투여 유발검사) CAR-T 세포: IV 투여를 통해 전달된 1 × 107, 0.3 × 107, 0.1 × 107, 0.03 × 107개 CAR-T 세포.
도 12: 난소암 유발검사에 대한 IP 또는 IV 투여를 통한 CAR-T 투여 효능 간의 비교를 보여주는 생물발광 이미지; 종양 세포: SKOV-3 난소암(2.5 × 106개 IP 투여 유발검사); CAR-T 세포: IP 또는 IV 투여 경로를 통한 1 × 107 또는 1 × 106 CAR T 세포.
도 13: 상이한 α-5T4 ScFv를 이용한 난소암 모델에 대한 5T4 CAR-T 세포의 생체 내 효능을 보여주는 생존 곡선; 구조체: (H8-EF1α-CD3ζ/4-1BB 및 2E4-EF1α-CD3ζ/4-1BB); 시험 세포: 1 × 107개 CAR T 세포; 종양 세포: SKOV-3 난소암.
도 14: 상이한 α-5T4 ScFv를 이용한 난소암 모델에 대한 5T4 CAR-T 세포의 생체 내 효능을 보여주는 생존 곡선; 구조체: (H8-EF1α-CD3ζ/4-1BB 및 2E4-EF1α-CD3ζ/4-1BB); 종양 세포: NCI-H929 골수종 세포.
도 15: 3종의 골수종 세포주에서 5T4 발현의 FACS 분석; A: 양성 대조군(유방 [MCF7] 세포주); B: 음성 대조군(DLBCL); C: H929 골수종 세포주; D: JJN3 골수종 세포주; E: RPMI-8226 세포주.
도 16: 5T4 염색의 면역조직화학 이미지; A: CHO 세포(음성 대조군); B: 5T4로 형질감염된 CHO 세포(양성 대조군); C: MCF7(유방) 세포; D: H929(골수종) 세포
도 17: 다발성 골수종 환자 4명으로부터 채취된 골수종 샘플 상의 5T4 염색의 면역조직화학 이미지.
도 18: 암 치료에서 암 줄기세포의 박멸(eradication)의 중요성.
기존의 화학요법(표준 요법)은 빠르게 증식하는 세포를 제거하여 대부분의 고형 종양을 제거하지만, 막에 위치한 약물 운반체로 인하여 요법에 더욱 저항성을 나타낼 가능성이 있는 암 줄기세포(cancer stem cell, CSC)는 놓치며, 이는 재발을 초래할 수 있는 것으로 상정하였다. 수술 이외에, 종양을 제거하기 위한 최적의 치료 계획은 벌크 종양 세포 및 종양 내의 암 줄기세포 둘 다를 표적화하는 것(예를 들어, 5T4 표적화 치료법)이라고 주장될 수 있다.
도 19: 고형 종양의 암 줄기세포 상에서의 5T4 발현. 이 도면은 OVCAR-3(난소), MCF7(유방), HCT116(결장직장), HT29(결장직장), U251(교아세포종) 및 A549(폐) 세포주에서 '벌크' 종양 세포(단일층) 또는 암 줄기세포(구체(sphere)) 상에서의 5T4 발현의 수준을 보여준다.
본 발명은 이제 실시예에 의해 추가로 설명될 것이며, 이는 본 발명을 수행하는 데 당업자에게 도움을 주기 위한 것으로, 어떠한 방식으로도 본 발명의 범위를 제한하려는 것은 아니다.
실시예
실시예
1.
2E4
항체의 생산 및 5T4 CAR 구조체의 설계
2E4
항체의 생산
컬럼 크로마토그래피(니켈 비드)를 이용하여 CHO 세포로부터 정제된, C 말단 엔테로키나아제 절단 서열을 갖는 5T4의 세포 외 도메인, myc 에피토프 및 6개의 히스티딘 태그를 포함하는 재조합 단백질을 면역원(immunogen)으로서 사용하였다. Immuno-Precise(캐나다) 신속 프라임 프로토콜을 사용하여(3마리의 마우스를 면역화시킨 후 4회의 신속한 부스트(boost)), 마우스에서 mAb를 제조하였다.
공여자의 비장 세포를 SP2/0 골수종 IgG 하이브리도마와 융합시켰다. mAb를 재조합 단백질에 대해 스크리닝하고, ELISA에 의해 동일한 C 말단 태그를 갖는 상이한 류신 풍부 단백질의 세포 외 도메인에 대해 카운터-스크리닝하였다. 10개의 상청액을 추가 연구를 위하여 선별하였다.
세포 용해물에서 추가의 밴드가 일부 상청액에 의해 검출되었지만, 모든 상청액은 웨스턴 블롯에 의해 재조합 인간 5T4를 인식하였다. 웨스턴 블롯 상에서 감소되거나 감소되지 않은 5T4 단백질의 인식 강도를 이용하여, 단백질 G 컬럼 정제를 위한 4개의 mAb를 선별하였다. 시퀀싱, 및 웨스턴 블롯과 ELISA에 의한 추가 분석은 4개의 mAb 각각이 고유하다는 것을 입증하였다.
2E4 항체를 추가 연구를 위하여 선별하였다.
5T4 CAR 구조체
도 1B에서 기술된 바와 같이, EF1α-H8-4-1BB/CD3ζ 5T4 구조체(pRKh- EF1α-H8-4-1BB)를 생성하였고; 5T4-CAR 단백질을 암호화하는 코돈 최적화(condon-optimised) 서열(서열번호 9)(H8 scFv 항원 결합 도메인, CD8 힌지 및 막관통 도메인, 4-1BB 공동자극 도메인 및 CD3ζ 자극 도메인으로 구성됨)을 드 노보(de novo) DNA 합성에 의해 생성하였다. 합성된 5T4-CAR 카세트를 HIV-1 GFP 게놈 플라스미드(pRKHVCG)에 삽입하여 GFP 유전자를 대체하고, 내부 거대세포 바이러스(cytomegalovirus, CMV) 프로모터의 하류에 5T4-CAR 전이 유전자를 위치시켜 pRKh5T4CD8 플라스미드를 생성하였다. 마지막으로, CMV 프로모터를 신장 인자 1α(elongation factor 1α, EF1α) 프로모터로 치환하여 pRKh-EF1α-H8-4-1BB를 생성하였으며; EF1α 서열(서열번호 10)은 pEF1α-coTRAP-Puro 플라스미드로부터 유래하였다.
일련의 분자 클로닝 실험을 통해 pRKh-EF1α-H8-4-1BB 플라스미드를 제작하였다. 지향성 결찰(directional ligation)을 용이하게 하기 위하여, pRKHVCG 및 pUC57-h5T4-CD8(pRKHVCG에서 또한 발견되는 것에 상응하는 2개의 제한 부위가 측면에 있는, 5T4-CAR 단백질을 암호화하는 서열을 가짐) 모(parental) 구조체를 2개의 별개의 제한 효소로 분해하여 상보적인 점착성 말단을 생성하였다. pRKHVCG 벡터 백본 및 5T4-CAR 암호화-단편을 겔 전기영동법 및 이후의 겔 정제에 의하여 분리하였다. 전자의 단편을 알칼리 인산가수분해효소 단계로 처리하여 자가 결찰을 못하도록 하였다. 두 선형 단편을 DNA 리가아제의 도움으로 결찰하고, 생성된 pRKh5T4CD8 구조체를 통상적인 DH5α 대장균 균주에서 증식시켰다. 프로모터 서열의 치환은 위에 기술된 방법과 유사한 방법을 통하여 달성하였다.
서열번호 9 - H8-CD8-4-1BB-CD3ζ (코돈 최적화 서열)
ATGGGAGTGCTGCTGACCCAGAGAACCCTGCTGTCTCTGGTGCTGGCCCTGCTGTTCCCTAGCATGGCCAGCATGGAAGTGCAGCTGCAGCAGAGCGGCCCTGACCTCGTGAAACCTGGCGCCTCCGTGAAGATCAGCTGCAAGGCCAGCGGCTACAGCTTCACCGGCTACTACATGCACTGGGTCAAGCAGAGCCACGGCAAGAGCCTGGAATGGATCGGCCGGATCAACCCCAACAACGGCGTGACCCTGTACAACCAGAAGTTCAAGGACAAGGCCATCCTGACCGTGGACAAGAGCAGCACCACCGCCTACATGGAACTGCGGAGCCTGACCAGCGAGGACAGCGCCGTGTACTACTGCGCCCGGTCCACCATGATCACCAACTACGTGATGGACTACTGGGGCCAAGTGACCAGCGTGACCGTGTCTAGCGGAGGCGGAGGATCTGGCGGCGGAGGAACAGGCGGAGGGGGATCTAGCATCGTGATGACCCAGACCCCCACCTTCCTGCTGGTGTCTGCCGGCGACAGAGTGACCATCACATGCAAGGCCTCCCAGAGCGTGTCCAACGACGTGGCCTGGTATCAGCAGAAGCCTGGCCAGAGCCCCACCCTGCTGATTAGCTACACCAGCTCCAGATATGCCGGCGTGCCCGACAGATTCATCGGCAGCGGCTATGGCACCGACTTCACCTTCACCATCAGCACACTGCAGGCCGAGGACCTGGCTGTGTACTTCTGTCAGCAAGACTACAACAGCCCCCCTACCTTCGGCGGAGGCACCAAGCTGGAAATCAAGAGAGCCGCCGCTCTGAGCAACAGCATCATGTACTTCAGCCACTTCGTGCCCGTGTTTCTGCCCGCCAAGCCTACCACAACCCCTGCCCCTAGACCTCCTACCCCAGCCCCTACAATCGCCAGCCAGCCTCTGTCTCTGAGGCCCGAGGCTTGTAGACCTGCTGCTGGCGGAGCCGTGCACACCAGAGGACTGGATTTCGCCTGCGACATCTACATCTGGGCCCCTCTGGCCGGCACATGTGGCGTGCTGCTGCTGAGCCTCGTGATCACCCTGTACTGCAAGCGGGGCAGAAAGAAGCTGCTGTACATCTTCAAGCAGCCCTTCATGCGGCCCGTGCAGACCACCCAGGAAGAGGACGGCTGCTCCTGCAGATTCCCCGAGGAAGAAGAAGGCGGCTGCGAGCTGCTGAGAGTGAAGTTCAGCAGATCCGCCGACGCCCCTGCCTACCAGCAGGGACAGAATCAGCTGTACAACGAGCTGAACCTGGGCAGACGGGAAGAGTACGACGTGCTGGACAAGCGGAGAGGCAGGGACCCTGAGATGGGCGGCAAGCCCAGAAGAAAGAACCCCCAGGAAGGCCTGTATAACGAACTGCAGAAAGACAAGATGGCCGAGGCCTACAGCGAGATCGGAATGAAGGGCGAGCGGAGAAGAGGCAAGGGCCACGATGGACTGTACCAGGGCCTGAGCACCGCCACCAAGGACACCTATGACGCCCTGCACATGCAGGCTCTGCCCCCCAGATGA
서열번호 10 - EF1α 프로모터
GGCTCCGGTGCCCGTCAGTGGGCAGAGCGCACATCGCCCACAGTCCCCGAGAAGTTGGGGGGAGGGGTCGGCAATTGAACCGGTGCCTAGAGAAGGTGGCGCGGGGTAAACTGGGAAAGTGATGTCGTGTACTGGCTCCGCCTTTTTCCCGAGGGTGGGGGAGAACCGTATATAAGTGCAGTAGTCGCCGTGAACGTTCTTTTTCGCAACGGGTTTGCCGCCAGAACACAGGTAAGTGCCGTGTGTGGTTCCCGCGGGCCTGGCCTCTTTACGGGTTATGGCCCTTGCGTGCCTTGAATTACTTCCACCTGGCTGCAGTACGTGATTCTTGATCCCGAGCTTCGGGTTGGAAGTGGGTGGGAGAGTTCGAGGCCTTGCGCTTAAGGAGCCCCTTCGCCTCGTGCTTGAGTTGAGGCCTGGCCTGGGCGCTGGGGCCGCCGCGTGCGAATCTGGTGGCACCTTCGCGCCTGTCTCGCTGCTTTCGATAAGTCTCTAGCCATTTAAAATTTTTGATGACCTGCTGCGACGCTTTTTTTCTGGCAAGATAGTCTTGTAAATGCGGGCCAAGATCTGCACACTGGTATTTCGGTTTTTGGGGCCGCGGGCGGCGACGGGGCCCGTGCGTCCCAGCGCACATGTTCGGCGAGGCGGGGCCTGCGAGCGCGGCCACCGAGAATCGGACGGGGGTAGTCTCAAGCTGGCCGGCCTGCTCTGGTGCCTGGCCTCGCGCCGCCGTGTATCGCCCCGCCCTGGGCGGCAAGGCTGGCCCGGTCGGCACCAGTTGCGTGAGCGGAAAGATGGCCGCTTCCCGGCCCTGCTGCAGGGAGCTCAAAATGGAGGACGCGGCGCTCGGGAGAGCGGGCGGGTGAGTCACCCACACAAAGGAAAAGGGCCTTTCCGTCCTCAGCCGTCGCTTCATGTGACTCCACGGAGTACCGGGCGCCGTCCAGGCACCTCGATTAGTTCTCGAGCTTTTGGAGTACGTCGTCTTTAGGTTGGGGGGAGGGGTTTTATGCGATGGAGTTTCCCCACACTGAGTGGGTGGAGACTGAAGTTAGGCCAGCTTGGCACTTGATGTAATTCTCCTTGGAATTTGCCCTTTTTGAGTTTGGATCTTGGTTCATTCTCAAGCCTCAGACAGTGGTTCAAAGTTTTTTTCTTCCATTTCAGGTGTCGTGA
EF1α-2E4-4-1BB/CD3ζ 5T4 구조체(pRKh- EF1α-2E4-4-1BB)를 도 1C에 기술된 바와 같이 생성하였고; 2E4 항원 결합 모이어티를 암호화하는 서열(서열번호 11)을 합성하고, pRKh-EF1α-H8-4-1BB 내로 삽입하여 H8 도메인 서열을 대체하였다.
서열번호 14 - 2E4 항원 결합 모이어티
ATGGAAGTGCAGCTGCAGCAGTCTGGCCCCGAGCTCGTGAAACCTGGCGCCTCCGTGAAGATCAGCTGCAAGGCCAGCGGCTACAGCTTCACCGGCTACTACATGCACTGGGTCAAGCAGAGCCACGTGAAGTCCCTGGAATGGATCGGCCGGATCAACCCCTACAACGGCGCCACCACCTACAACCAGGACTTCAAGGACAAGGCCTCCCTGACCGTGGACAAGAGCAGCAGCACCGCCAGCATGGAACTGCACAGCCTGACCAGCGAGGACAGCGCCGTGTACTACTGTGCCCTGAGCACCATGATCACCACCGCTTGGTTTGCCTACTGGGGCCAGGGCACACTCGTGACCGTGTCTCCAGGAGGCGGAGGATCTGGCGGCGGAGGAACAGGCGGAGGGGGATCTAACTTCGTGATGACCCAGACCCCCAAGTTCCTGCTGGCCTCTGCCGGCGACAGAGTGACCATCAGCTGCAAGGCCAGCCAGAGCGTGTCCAACGACGTGGGCTGGTATCAGCAGAAGCCCGGCCAGAGCCCCAAGCTGCTGATCTACTTCGCCAGCAACCGGTACACCGGCGTGCCCGACAGATTCATCGGCAGCGGCTACGGCACCGACTTCACCTTCACCATCAGCACCGTGCAGGCCGAGGACCTGGCCGTGTACTTCTGTCAGCAAGACTACAGCAGCCCTTTCACCTTCGGCTCCGGCACCAAGCTGGAAATCAAGG
실시예
2. CAR-5T4 T 세포의 시험관 내 활성 - 도 2 내지 4
종양 세포주:
조사된 종양 세포주는 NCI-H226(중피종, ATCC; 영국 미들섹스), SKOV-3(난소 선암종, ATCC; 영국 미들섹스), BT20(유방암종, ATCC; 영국 미들섹스), OVCAR-3(난소 선암종, ATCC; 영국 미들섹스), LS174T(결장직장 선암종, ATCC; 영국 미들섹스), DLD-1(결장직장, ATCC; 영국 미들섹스) 및 NCI-H929(골수종, ATCC; 영국 미들섹스)였다.
각 세포주를 배양하는 데 다음과 같은 배지를 사용하였다: NCI-H226 배지: RPMI 1640(SIGMA, 영국 도싯), 1% 글루타민(SIGMA, 영국 도싯), 1% HEPES(Gibco; 영국 페이즐리), 1% 피루브산 나트륨(SIGMA, 영국 도싯) 및 10% FBS(SeraLabs; 영국 웨스트서식스). SKOV-3 배지: McCoys 5a 배지(Life Technologies; 미국 캘리포니아 주 칼스배드; 미국 캘리포니아 주 칼스배드), 1% 글루타민(SIGMA, 영국 도싯), 10% FBS(SeraLabs; 영국 웨스트서식스). BT20 배지: 이글 최소 필수 배지(SIGMA, 영국 도싯), 10% FBS(SeraLabs; 영국 웨스트서식스), 1% 글루타민(SIGMA, 영국 도싯). OVCAR-3 배지: RPMI 1640(SIGMA, 영국 도싯), 1% 글루타민(SIGMA, 영국 도싯), 1% HEPES(Gibco; 영국 페이즐리), 1% 피루브산 나트륨(SIGMA, 영국 도싯), 1% 인슐린(SIGMA, 영국 도싯) 및 20% FBS(SeraLabs; 영국 웨스트서식스) LS174T 배지: 이글 최소 필수 배지(SIGMA, 영국 도싯), 10% FBS(SeraLabs; 영국 웨스트서식스), 1% 글루타민(SIGMA, 영국 도싯). NCI-H929: RPMI1640(SIGMA, 영국 도싯), 10% FBS(SeraLabs; 영국 웨스트서식스) 및 1% 글루타민(SIGMA, 영국 도싯).
세포를 T75 플라스크에서 성장시키고, >80% 컨플루언시(confluency)에 이를 때까지 표준적인 세포 배양 프로토콜에 따라 계대 배양하였다. 세포를 37℃ 및 5% CO2의 인큐베이터(Panasonic; 영국 러프버러)에서 배양하였다. NCI-H226, SKOV-3 및 NCI-H929 세포를 1:10으로 희석하여 매주 2회 계대 배양하였다. BT20, OVCAR-3 및 LS174T 세포 또한 1:10으로 희석하여 매주 1회 계대 배양하였다. 부착 세포주를 PBS(SIGMA, 영국 도싯)로 세척하고, 37℃에서 5분 동안 TrypLE Express™(GIBCO; 영국 페이즐리)를 이용하여 플라스크로부터 분리시키고, 동일한 부피의 배지로 중화하고, 원심분리하고, 추가 세포 배양을 위하여 또는 사이토카인 방출 분석 또는 WST-1 분석에 사용하기 위하여 적절한 부피의 배지에, 또는 유세포 분석을 위하여 PBS에 재현탁시켰다. 비부착 세포주(NCI-H929)는 배양물로부터 제거하고, 원심분리하고, 추가의 세포 배양에 사용하기 전에 배지에 재현탁시키거나 유세포 분석을 위하여 PBS에 재현탁시켰다. 세포는 즉시 통상적인 조직 배양을 제외하고, 얼음에 저장하였다.
이 통상적인 배양을 위하여, 세포를 1:10으로 희석하고 배지에 첨가하여 T75 플라스크에 총 부피 25 ml이 되게 하였다. 사이토카인 방출 분석 및 WST-1 분석에 사용된 세포는 얼음 위에서 다루었으며, Guava PCA(Millipore; 영국 왓퍼드)를 이용하여 계수하고, 펠릿화하여, 배지에 각각 1×105개 세포/ml 및 1×104개 세포/ml의 농도로 재현탁시켰다.
PBMC 및 T 세포 활성화:
PBMC는 CTL(독일 본)으로부터 구입하거나, Covance(영국 메이든헤드)로부터 구입한 혈액으로부터 이전에 생성하였다. T 세포를 PBMC의 바이알로부터 활성화시켜, 다음으로 구성된 T 세포 배지에 배양하였다: X-Vivo 15(Sartorius; 영국 서리), 인간 AB 혈청(Akron Biotech; 미국 플로리다 주), GlutaMax(Life Technologies; 미국 캘리포니아 주 칼스배드), HEPES(Gibco; 영국 페이즐리; 영국 페이즐리), N-아세틸시스테인(APP Pharmaceuticals; 미국 일리노이 주), 피루브산 나트륨(SIGMA, 영국 도싯), MEM 이글 비타민 믹스(Lonza; 영국 슬라우) 및 rhIL-2(R&D Systems; 영국 어빙돈). 간략하게는, 냉동 PBMC 바이알을 37℃로 설정된 수조에서 부드럽게 해동시켜 되살리고, 이를 미리 가온된 배지에 서서히 첨가하였다. Guava PCA를 이용하여 세포의 분취액(eliquot)을 계수하였다. 세포를 스핀 다운시키고, 배지에 재현탁시켜 5×105개 세포/ml을 수득하였다. 3:1의 비드 대 세포 비로 CD3/CD8 팽창 비드(GIBCO; 영국 페이즐리)를 이용하여 T 세포를 활성화시켰다. 비드를 세척하고 PBS에 재현탁시킨 후, 4×106개 세포와 1.2×107개 비드 및 500 μl의 배지를 24웰 플레이트에 첨가하였다.
T 세포 형질도입/CAR T 세포의 생성
상기 기술된 바와 같이, T 세포 활성화를 위하여 PBMC를 제조하였다. 그 후, 연속 일(0일, 활성화 직후 및 1일)에 250 μl의 적절히 희석된 벡터 CAR-T 5T4 구조체(H8 및 2E4)를 첨가하여 세포를 2회 형질도입시켰다. 바이러스 입자 대 감수성 세포의 비율을 나타내는 감염 다중도(Multiplicity of Infection, MOI) 1, 0.33 및 0.11로 벡터를 세포에 형질도입하였다. 음성 대조군으로, PBMC를 활성화시켰지만, 벡터는 첨가하지 않았다. 형질도입 후, 세포를 MM + IL-2 중에 5×105의 농도로 유지시켰다. 세포를 유지하기 위하여. 웰을 부드럽게 피펫팅하여 완전히 재현탁시키고, Guava PCA를 이용하여 3일, 6일, 9일, 10일 및 14일에 계수를 위하여 분취액을 제거하였다. MM + IL2를 세포에 첨가하여 5×105개 세포/ml의 농도로 유지하고, 필요에 따라 증식된 배양물을 T25 및 T75 플라스크로 옮겼다. 10일째에, 배지에 IL-2를 보충하지 않았다. 사이토카인 방출 분석 및 세포 살해(WST-1) 분석에 의해 기능성을 평가할 때, 14일까지 세포를 배양하였다.
사이토카인 방출 분석
제조사의 설명서에 따라 사이토카인 방출 분석을 수행하였다. 43 μl의 완충액에 시험 샘플(7 μl)을 첨가하였다. 프로토콜에 따라 CBA 플렉스 세트(Flex Set)(BD Biosciences; 영국 옥스포드)를 이용하여 CBA 분석을 수행하였다. FCAP 어레이 소프트웨어(BD Biosciences; 영국 옥스포드)에서 데이터를 분석하였다.
WST-1/세포 살해 분석
표적 세포(NCI-H226 또는 LS174T)를 평편 바닥 96-웰 플레이트의 각 웰에 첨가하였다(1×104). 0.5:1, 1:1, 10:1 및 30:1의 E:T 비율로 T 세포를 첨가하였다. 표적 세포 단독 및 T 세포 단독 대조군을 또한 제조하였다. 세포를 18 내지 24시간 동안 37℃의 5% CO2 분위기에서 항온처리하였다.
다음날, 50 μl WST-1 시약을 PBS로 1:10으로 희석하여 세포에 첨가하고, 630 nm 기준 파장과 함께 440 nm에서 흡광 플레이트 판독기를 이용하여 매시간 플레이트를 판독하였다. 세포 살해의 백분율을 다음 식에 의해 계산하였다:
([실험 흡광도)-(대조 흡광도)[/([최대 흡광도)-(대조 흡광도])×100
실시예
3. CAR-5T4 T 세포의 특이성 - 도 5
5T4 특이적 단일클론성 항체 또는 가용성 5T4 단백질을 종양 세포주 및 CAR-5T4 T 세포와 함께 항온처리한 차단 실험에 의해, 5T4 CAR 구조체의 특이성을 결정하였다. 모든 차단제를 적정하고, IFNγ 분비에 미치는 영향을 평가하였다.
종양 세포주
조사한 종양 세포주는 NCI-H226(중피종, ATCC; 영국 미들섹스) 및 LS174T(결장직장 선암종, ATCC; 영국 미들섹스)였다. NCI-H226 세포를 배양하는 데 사용된 배지는 다음과 같았다: RPMI 1640(SIGMA, 영국 도싯), 1% 글루타민(SIGMA, 영국 도싯), 1% HEPES(Gibco; 영국 페이즐리), 1% 피루브산 나트륨(SIGMA, 영국 도싯) 및 10% FBS(SeraLabs; 영국 웨스트서식스). LS174T 세포를 배양하는 데 사용된 배지는 다음과 같았다: 이글 최소 필수 배지(SIGMA, 영국 도싯), 10% FBS(SeraLabs; 영국 웨스트서식스), 1% 글루타민(SIGMA, 영국 도싯). NCI-H929: RPMI1640(SIGMA, 영국 도싯), 10% FBS(SeraLabs; 영국 웨스트서식스) 및 1% 글루타민(SIGMA, 영국 도싯).
세포를 T75 플라스크에서 성장시키고, >80% 컨플루언시에 이를 때까지 표준 세포 배양 프로토콜에 따라 계대배양 하였다. 세포를 37℃ 및 5% CO2의 인큐베이터(Panasonic; 영국 러프버러)에서 배양하였다. 부착 세포주를 PBS(SIGMA, 영국 도싯)로 세척하고, 37℃에서 5분 동안 TrypLE Express™(GIBCO; 영국 페이즐리)를 이용하여 플라스크로부터 분리시키고, 동일한 부피의 배지로 중화하여 원심분리하고, 추가 세포 배양을 위하여 또는 사이토카인 방출 분석 또는 WST-1(세포 살해) 분석에 사용하기 위하여 적절한 부피의 배지에, 또는 유세포 분석을 위하여 PBS에 재현탁시켰다.
PBMC
및 T 세포 활성화:
PBMC는 CTL(독일 본)으로부터 구입하였거나, Covance(영국 메이든헤드)로부터 구입한 혈액으로부터 이전에 생성하였다. T 세포를 PBMC의 바이알로부터 활성화시켜, 다음으로 구성된 T 세포 배지에 배양하였다: X-Vivo 15(Sartorius; 영국 서리), 인간 AB 혈청(Akron Biotech; 미국 플로리다 주), GlutaMax(Life Technologies; 미국 캘리포니아 주 칼스배드), HEPES(Gibco; 영국 페이즐리; 영국 페이즐리), N-아세틸시스테인(APP Pharmaceuticals; 미국 일리노이 주), 피루브산 나트륨(SIGMA, 영국 도싯), MEM 이글 비타민 믹스(Lonza; 영국 슬라우) 및 rhIL-2(R&D Systems; 영국 어빙돈). 간략하게는, 냉동 PBMC 바이알을 37℃로 설정된 수조에서 부드럽게 해동시켜 되살리고, 세포를 미리 가온된 배지에 서서히 첨가하였다. Guava PCA를 이용하여 세포 분취액을 계수하였다. 세포를 스핀 다운시키고, 배지에 재현탁시켜 5×105개 세포/ml을 수득하였다. 3:1의 비드 대 세포 비로 CD3/CD8 팽창 비(GIBCO; 영국 페이즐리)를 이용하여 T 세포를 활성화시켰다. 비드를 세척하고 PBS에 재현탁시킨 후, 4×106개 세포와 1.2×107개 비드 및 500μl 배지를 24웰 플레이트에 첨가하였다.
T 세포 형질도입/CAR T 세포의 생성
상기 기술된 바와 같이, T 세포 활성화를 위하여 PBMC를 제조하였다. 그 후, 연속 일(0일, 활성화 직후 및 1일)에 250 μl의 적절히 희석된 벡터 CAR-T 5T4 구조체(H8 및 2E4)를 첨가하여 세포를 2회 형질도입시켰다. 바이러스 입자 대 감수성 세포의 비율을 나타내는 감염 다중도(MOI) 1, 0.33 및 0.11로 벡터를 세포에 형질도입하였다. 음성 대조군으로, PBMC를 활성화시켰지만, 벡터는 첨가하지 않았다. 형질도입 후, 세포를 MM + IL-2 중에 5×105의 농도로 유지시켰다. 세포를 유지하기 위하여. 웰을 부드럽게 피펫팅하여 완전히 재현탁시키고, Guava PCA를 이용하여 3일, 6일, 9일, 10일 및 14일에 계수를 위하여 분취액을 제거하였다. MM + IL2를 세포에 첨가하여 5×105개 세포/ml의 농도로 유지하고, 필요에 따라 증식된 배양물을 T25 및 T75 플라스크로 옮겼다. 10일째에, 배지에 IL-2를 보충하지 않았다. 사이토카인 방출 분석 및 세포 살해(WST-1) 분석에 의해 기능성을 평가할 때, 14일까지 세포를 배양하였다.
사이토카인 방출 분석:
차단하지 않음
T 세포 및 표적 세포를 WST-1 세포 살해 분석에서와 같이 준비하였다. WST-1 첨가 전에, 상청액의 분취액(50μL)을 제거하고, 다른 플레이트로 옮겨, 사이토카인 방출 분석에 의한 분석 전에 -20℃에서 보관하였다.
5T4 단백질을 이용한 차단
T 세포를 단계별로 희석한 재조합 5T4 단백질과 항온처리한 후, 1시간 동안 항온처리하였다. T 세포를 둥근 바닥 96-웰 플레이트에 1:1의 E:T 비율(1×105개 세포)로 종양 세포에 첨가하고, 5% CO2 분위기 하 37℃에서 18 내지 24시간 동안 항온처리한 후, 상청액을 제거하고, 다른 플레이트로 옮겨, 사이토카인 방출 분석에 의한 분석 전에 -20℃에서 보관하였다.
5T4-특이적 단일클론성 항체 2E4를 이용한 차단
종양 세포 NCI-H226 및 LS174T를 1시간 동안 200 μg/ml의 항-5T4 항체 2E4의 출발 농도로 단계별 희석물(1:10)과 함께 항온처리하였다. T 세포를 둥근 바닥 96-웰 플레이트에 1:1의 E:T 비율(1×105개 세포)로 2E4 항체와 함께 항온처리된 종양 세포에 첨가하고, 5% CO2 분위기 하 37℃에서 18 내지 24시간 동안 항온처리한 후, 상청액을 제거하고, 다른 플레이트로 옮겨, 사이토카인 방출 분석에 의한 분석 전에 -20℃에서 보관하였다.
제조사의 설명서에 따라, 사이토카인 방출 분석을 수행하였다. 43 μl의 완충액에 시험 샘플(7 μl)을 첨가하였다. 프로토콜에 따라 CBA 플렉스 세트(Flex Set)(BD Biosciences; 영국 옥스포드)를 이용하여 CBA 분석을 수행하였다. FCAP 어레이 소프트웨어(BD Biosciences; 영국 옥스포드)에서 데이터를 분석하였다.
실시예
4. 암 환자로부터의 T 세포의 형질도입 및 CAR-T 세포 기능성
다음의 재조합 렌티바이러스 벡터를 본 연구에 사용하였다:
*TU = 형질전환 단위
시험 물질 벡터를 20mM 트리스, 100 mM NaCl, 10 mg/mL 수크로오스, 10 mg/mL 만니톨을 함유하는 TSSM 제제 완충액, pH 7.3에 현탁시켰다. TSSM 완충액은 Oxford BioMedica(영국)에서 공급하였고, 냉동 보관하였다.
연구를 4부분으로 나누었다:
1. 대략 15명의 난소암 환자로부터 매치된 종양 및 말초 혈액 단핵구 세포의 수집
2. 면역조직화학을 이용한 포르말린 고정 파라핀 포매(formalin fixed paraffin embedded, FFPE) 난소 종양 절편(section)에서의 5T4 발현 평가
3. 유세포 분석을 이용한 분해된 종양 세포에서의 5T4 발현 평가
4. 난소암 세포와 공동 배양 시, 사이토카인 방출에 의해 측정된 CAR-T 세포 기능성 평가(도 6에서 강조됨).
매치된 종양 및 혈액 샘플 수집
영국 맨체스터 세인트 메리 병원에서 난소암 수술을 받는 환자로부터 고형 종양 생검을 수집하였다. 적절한 윤리적 승인(Ref: 14/NW/1260) 및 사전 동의와 함께 센트럴 맨체스터 대학교 병원 NHS 재단 트러스트 바이오뱅크를 통해 샘플을 수집하였다. MACS 조직 저장 용액(Miltenyi Biotec, 독일)을 함유하는 멸균 유니버설에 고형 종양 생검을 수집하고, 처리를 위해 실험실로 바로 수송하거나 처리 전 최대 24시간 동안 4℃에서 보관하였다. 20 내지 30 ml의 혈액을 EDTA를 함유하는 BD Vacutainer 혈액 수집 튜브(BD Biosciences, 영국 옥스포드)에 수집하였다. 혈액 샘플을 실온에 저장하고, 수집 24시간 이내에 처리하였다. 분석에 사용 가능한 샘플을 표 1에 열거하였다.
표 1: 난소암 환자로부터의 매치된 종양 및 혈액 샘플.
이 표는 종양 조직 및 말초 혈액 단핵구 세포를 분석에 이용할 수 있는 환자를 열거한 것이다. 이 표는 샘플 ID, 질병 병기(stage), 외과적 중재의 유형, 종양 조직학 및 포르말린 고정 파라핀 포매(FFPE) 종양 조직의 이용 가능성을 열거한다. [*이 환자는 고등급 장액성 난소암(high grade serous ovarian ancer)을 앓았으며, 수술 전에 선행 화학요법(neoadjuvant chemotherapy)을 받았다. 그녀는 수술 전에 전이성 병변으로 생각되는 덩어리가 간에 있음을 알게 되었다. 그녀는 화학요법에 대해 매우 양호한 반응을 보였으며, 수술 당시 유일하게 중요한 질병은 생검된 간 병변이었고, 이것은 나중에 간의 양성 혈관종(benign haemangioma)인 것으로 밝혀졌다.]
분해된 종양 세포에서의 5T4 발현의 평가
종양 분해(
disaggregation
)
난소 종양 샘플을 제조사의 프로토콜에 따라 상업적인 기계적/효소적 분해 키트(GentleMACS, Miltenyi Biotec, 독일)를 사용하여 단일 세포 현탁액으로 분리하였다. 간략하게는, 종양 생검을 멸균 메스를 사용하여 2 내지 4 mm3 단편으로 절단하고, RPMI-1640(Lonza, 영국 슬라우) 및 적절한 양의 효소 H, R 및 A(Human Tumour Dissociation Kit, Miltenyi Biotec, 독일)가 있는 C-튜브(Miltenyi Biotec, 독일)로 옮겼다. 그런 다음, C-튜브를 GentleMACS 분리기에 거꾸로 놓고, 3가지의 36초 기계적 분리 프로그램(h_tumour_01, h_tumour_02 및 h_tumour_03)을 수행하였다. 이는 제1 및 제2 분리 프로그램 후에 수행된, MACSmix 튜브 회전기(Miltenyi Biotec, 독일)를 이용한 연속적인 회전하에 37℃에서 두 차례의 30분 항온처리에 의해 주입되었다. 분리 후, 현탁액을 100 μm 여과기를 통해 20 ml의 T 세포 배지가 들어 있는 50 ml 팔콘 내로 통과시키고, 400 G에서 5분 동안 원심분리하였다. 상청액을 버리고, 나머지 세포 펠릿을 충분히 재현탁시켜 세포를 계수하였다. 그런 다음, 세포를 1 내지 2×107개 세포/ml의 밀도로 90% FCS/10% DMSO에 동결 보존하였다.
유세포 분석
종양 분해로부터 수득된 세포를 T 세포 배지 중에 1 × 106개 세포/ml의 농도로 재현탁시켰다. 세포 현탁액의 100 μl 분취액(1 × 105개 세포)을 96-웰 U-바닥 플레이트의 적절한 수의 웰로 옮겼다. 세포를 FACS 완충액으로 1회 세척하고, 4℃의 암소에서 30분 동안 FACS 완충액 중 1:100으로 희석된 EpCAM(PE, 클론 9C4, Biolegend) 및 5T4(클론 H8 및 2E4) 항체로 염색하였다. 그 후, 세포를 FACS 완충액으로 1회 세척한 후, PBS 중 1% 파라-포름알데히드(PFA)(Sigma-Aldrich, 영국) 200 μl에 재현탁시켰다. 고정된 세포를 FACS 튜브로 옮겼다. LSR Fortessa(BD Biosciences, 영국)에서 분석을 수행하였다. FlowJo v. 7.6.2 소프트웨어(Tree Star Inc, 미국 오레곤 주 애실랜드)를 이용하여 데이터를 분석하였다. 단일 염색 대조군을 이용하여 수동으로 보정(compensation)을 수행하였다.
도 8은 시험된 대부분의 종양 분해물이 큰 백분율(> 50%)의 5T4 양성 세포를 함유함을 보여준다. 이 그래프는 또한 H8 또는 2E4 5T4 특이적 단일클론성 항체를 이용한 종양 분해물의 염색이 비슷한 결과를 가져옴을 보여준다.
4.3. T 세포 형질도입 및 CAR-T 기능성
투여 조제물(dose preparation)
벡터는 TSSM 제제 완충액으로 미리 제형화되어 공급되었다. 벡터 바이알을 젖은 얼음(wet ice) 상에서 해동시켰다. 필요한 경우, 벡터 바이알을 실온에서 잠시(몇 분) 해동시켰다. 일단 해동되면, 바이알을 마이크로퓨지(microfuge)에서 잠시 펄싱(5 내지 10초, 13,000 rpm)하여 임의의 벡터 물품이 뚜껑/캡 내부에서 확실히 수집되게 하고, 약 3회 아래위로 피펫팅하여 부드럽게 혼합하여 현탁시켰다. 해동 후, 해동된 벡터를 젖은 얼음 위에 유지시키고, 냉동 보관으로부터 제거하고 3시간 이내에 사용하였다. 벡터의 모든 희석액은 세포 배양 배지로 만들었다.
T 세포 형질도입 및 증식
말초 혈액 단핵구 세포(PBMC)를 난소암 환자로부터 피콜 밀도 원심분리에 의해 수집하고, 분취액으로 동결시켰다. 분취액 해동 시, PBMC로부터의 T 세포를 음성 분리(negative isolation)(Miltenyl Blotec)에 의해 농축하고, 적절한 렌티바이러스 벡터, 항-CD3/CD28 다이나비드(Invitrogen, 영국) 및 IL-2(100 IU/mL; Novartis)와 혼합하였다. T 세포는 신선한 배지를 사용하여 다음 7 내지 14일 동안 수적으로 증가하였으며, IL-2는 필요에 따라(보통 2 내지 3일마다) 첨가하였다. 다이나비드를 자성 분리에 의해 3 내지 5일 후에 배양물로부터 제거하였다. 1 내지 7일에는 300 IU/mL의 IL2가, 나머지 날에 100 IU/mL로 감소하였다. 배양 종료 시, 세포를 원심분리에 의해 수거하고, 피콜 밀도 원심분리에 의해 죽은 세포를 제거하고, 트립판 블루 배제 및 혈구 계수기 계수에 의해 생존 세포 수를 결정하였다.
도 7에 도시된 바와 같이, 난소암 환자로부터 유래된 PBMC의 형질도입 수준은 H8 또는 2E4 CAR 구조체를 사용할 때 건강한 공여자의 형질도입과 비슷하다.
CAR-T 세포 기능성의 평가
시험관 내 기능성 분석은 96웰 플레이트의 개별 웰의 200 μL의 배지에서 1:1 비로 CAR-T 세포 집단 및 매치된 표적 종양 세포의 공동 배양을 포함하였다. 동시에, CAR-T 세포를 단독으로 배양하고(음성 대조군), 50 ng/mL PMA 및 1 μg/mL 이오노마이신과 함께 배양하였다(양성 대조군). 37℃에서 24시간의 항온처리 후, 상청액을 수집하고, 사이토카인 생성을 측정하였다. 제조사의 설명서에 따라 IFNγ 및 IL-2 ELISA 키트(둘 모두 Diaclone, 프랑스)를 이용하여, IFNγ 및 IL-2 생성을 측정할 수 있다.
도 9는 환자의 CAR-T 5T4 세포가 SKOV-3 및 OVCAR-3 세포주뿐만 아니라 그들 자신의 (자가) 종양 분해물과의 공동 배양에 반응하여 IFNγ를 분비함을 보여준다.
실시예
5. 난소암 모델에 대한 생체 내 효능
다음 실시예는 NSG 마우스에서 확립된 SKOV-3 종양에 대한 5T4 특이적 CAR 시험에 초점을 맞추었다. NHSBT로부터 수득한 백혈구 연층(buffy coat)을 말초 혈액 단핵구 세포(PBMC)의 공급원으로 사용하였다. CD3+ T 세포를 음성 분리(Miltenyi Biotec)에 의해 분리하고, 다이나비드로 활성화시키고, 사전에 시험된 양의 항-5T4(H8).CD28.CD3ζ(5T4.CD28ζ) 또는 항-5T4(H8).4-1BB.CD3ζ(5T4.4-1BBζ) CAR을 암호화하는 렌티바이러스 벡터로 형질도입시켰다. 이어서, 형질도입된 세포를 CAR 발현 및 시험관 내 기능에 대한 분석 전에 시험관 내에서 증식시킨 후, 확립된 SKOV-3.Luc 종양을 갖는 NSG 마우스에 정맥 내 주입하였다. 이는 아래에서 더 상세히 설명한다.
CAR T 세포의 시험관 내 생성.
백혈구 연층(BC) 92 및 102를 사용하여 T 세포를 공급하였다. BC92로부터, T 세포 분리는 CD14+ 골수 세포(14에서 2.4%) 및 CD19+ B 세포(12.3에서 0.7%)의 빈도는 감소시키면서, CD3+ T 세포 빈도를 53%에서 83%로 증가시켰다. BC108로부터, CD3+ T 세포는 36.6에서 81.5%로 농축되었고, CD14+ 골수 세포 및 CD19+ B 세포 각각은 1% 미만의 상대적 빈도로 감소되었다(CD14+ 28.3에서 0.9%; CD19+ 22.7에서 0.5%).
대략 1 내지 1.5×106 CD3+ T 세포를 사용하여 다이나비드(1:1 비율), IL-2(100 IU/mL) 및 렌티바이러스 벡터를 포함하는 초기 형질도입 배양물을 확립하였다. 7일 후, 배양물로부터 다이나비드를 제거하고, 세포를 계수하고, 대략 0.5×106개의 세포를 2주 동안 빠른 증식을 위해 사용하였다(배양 7일 후 3개의 동종 공여체(allo-donor), 항-CD3, 항-CD28 및 300 IU/mL의 IL-2로부터 조사된(irradiated) 피더 세포(feeder cell)로 배양하여 100 IU/mL로 감소됨). 이 시점에서, T 세포를 수집하고, 피콜처리하고, 세척하여 계수하였다. 각각의 경우에, 각각의 배양물(모의(Mock), 5T4.CD28ζ, 5T4.4-1BBζ)에 대해 최소 200배의 증식이 관찰되었고, > 108개의 총 세포가 생성되었다.
5T4 CAR T 세포의 생체 내 시험
5T4 CAR의 초기 생체 내 시험은 다른 CAR/TCR 모델을 위해 이전에 본 그룹에서 사용된 설계를 따랐다. 간략하게는, 대략 2.5×106 SKOV3.Luc 세포를 수용자 NSG(NOD/SCID IL-2Rγ-/-) 마우스에 복강 내 경로로 주사하고, 7일 후 CAR-T 세포를 IV 경로로 주입하였다(대략 총 2×107개 세포). 동물은 6일째(T 세포 이식 1일 전)에 이어서 마우스를 희생시킨 대략 60일까지 그 이후에 정기적으로 Bruker 시스템으로 이미지화하였다. 이 시점은 본 발명자들의 이전 연구에서 NSG 마우스가 인간 T 세포가 마우스 조직 항원을 인식한 결과 인간 T 세포 이식 후 약 50 내지 60일 후 이종 이식편 대 숙주병(xGvHD)의 증상이 나타나기 시작함을 보여주었기 때문에 선택되었다.
Bruker 이미지화는 동일한 백혈구 연층으로부터 식염수 또는 2×107 대조군, 형질도입되지 않은 모의 T 세포를 받는 마우스가 발광 수준의 증가를 나타냄을 명백히 보여주었다. 이는 식염수 및 모의 T 세포 처리 동물이 모두 종양 투여 45일 이내에 종양에 굴복한(succumbing) 것과 상관관계가 있었다. 한 세트의 샘플에서, 5T4 CAR-T 세포 그룹 둘 다에 대해 발광 증가가 관찰되지 않았으며, 이들 마우스는 모두 종양의 증거 없이 60일 말까지 생존하였다. 또 다른 세트의 샘플에서는, 5T4.CD28ζ CAR-T 세포와 비교하여 5T4.4-1BBζ CAR-T 세포를 받는 마우스에서 약간의 발광 증가가 있는 것으로 나타났고, 5T4.4-1BBζ 종양 그룹의 한 마리는 60일 말 이전에 종양으로 사망하였다. 5T4.CD28ζ CAR 처리군에서는 종양으로 사망한 동물이 전혀 없었다.
도 10은 식염수 또는 모의 형질도입된 T 세포를 받은 대조군과 비교하여 5T4 CAR T 세포로 처리된 NSG 마우스의 생존을 나타낸다.
모든 실험의 생존을 조합하면, 5T4.CAR T 세포 처리군 둘 다 식염수 및 모의 처리된 동물과 비교할 때 생존에 있어서 매우 유의미한 차이가 있었다(p <0.001, 로그 순위 검정).
실시예
6. 난소암 모델에 대한 최소 용량 및 전달 경로 요건
본 연구는 (상기 나타낸 바와 같은) 난소(SKOV-3) 종양 세포주를 가지고 있는 쥣과 NSG 마우스 모델에서 효능을 입증하는 데 요구되는 5T4-CAR 형질도입 T 세포의 최소 용량을 추정하고자 설계되었다.
또한, 본 연구는 CAR-T 세포 전달의 정맥 내 경로를 복강 내 경로와 비교하였다.
형질도입
다음의 벡터를 본 연구에 사용하였다.
형질도입은 상기 기술된 프로토콜과 유사하게 수행하였다. 간략하게는, 정상적인 건강한 공여자(NHS BT 또는 지원자로부터의 헌혈로부터 공급된 버피 콘(buffy cone))로부터의 피콜 밀도 원심분리에 의해 말초 혈액 단핵구 세포(PBMC)를 수집하고, 분취액으로 냉동시켰다. 분취액 해동 시, PBMC로부터의 T 세포를 음성 분리(Miltenyl Biotec)에 의해 농축하고, 적절한 렌티바이러스 벡터, 항-CD3/CD28 다이나비드(Invitrogen, 영국) 및 IL-2(100 IU/mL; Novartis)와 혼합하였다. T 세포를 다음 7 내지 14일에 걸쳐 신선한 배지로 증식시키고, 필요에 따라(보통 2 내지 3일마다) IL-2를 첨가하였다. 다이나비드를 자성 분리에 의해 3 내지 5일 후에 배양물로부터 제거하였다. 더 많은 수의 T 세포가 필요한 경우, 빠른 증식 프로토콜은 조사된 피더 세포(동결된 동종이계 NHSBT 버피 콘으로부터의 3개의 공여 PBMC를 모아 조사함(25 Gy, 패터슨 빌딩 X선 공급원))를 피더 세포 100: CART 세포 1의 비율로 CART 세포와 함께 배양하고, 30 ng/ml의 항-CD3(OKT3; 오르토클론, Janssen Cilag) 및 CD28(R&D systems) 항체에 더하여 IL-2(Chiron, 네덜란드 암스테르담)로 유사분열적으로(mitogenically) 자극하고, 14일 동안 이틀마다 IL-2 공급하는 단계를 포함한다. 1 내지 7일에는 300 IU/mL의 IL-2가, 나머지 기간 동안 100 IU/ml로 감소하였다. 배양 종료 시, 세포를 원심분리에 의해 수거하고, 피콜 밀도 원심분리에 의해 죽은 세포를 제거하고, 트립판 블루 배제 및 혈구 계수기 계수에 의해 생존 세포 수를 결정하였다.
최소 용량 연구군
최소 용량 평가를 위한 연구 프로토콜
1. 0일: 100 μL 식염수 중 2.5×106 SKOV-3 Luc 세포를 복강 내(IP) 주사함.
2. 7일: 100 μL 식염수 중 5T4 CAR-T 세포를 정맥 내(IV) 경로에 의해 주입함(용량은 상기 표를 참조; 대조군 동물은 2×107 모의 형질도입 세포 및 식염수만을 처리함)
3. 6, 13, 20, 27, 34, 41 및 48일: Lumina 시스템을 이용한 종양의 IVIS 이미지화
4. 14, 21, 28 및 60일: T 세포 생착(engraftment) 분석을 위한 꼬리 채혈.
60일: 실험 종점. 가능한 경우, 종양이 발생한 동물로부터 조직을 수집할 것임.
연구 그룹의 투여 경로
투여 경로의 평가를 위한 연구 프로토콜
1. 0일: 1001-11 식염수 중 2.5×106 SKOV-3 Luc 세포를 i.p 주사함.
2. 7일: 5T4 CART 세포를 복강 내(i.p.) 또는 i.v. 경로로 주입함(용량 세부사항에 대해서는 표 3을 참조; 대조군 동물은 2×107 모의 형질도입 세포 및 식염수만을 처리함)
3. 6, 13, 20, 27, 34, 41 및 48일: Lumina 시스템을 이용한 종양의 IVIS 이미지화
4. 14, 21, 28 및 60일: T 세포 생착 분석을 위한 꼬리 채혈.
5. 60일: 조직을 수집하고, 5T4 발현을 결정하고 또한 5T4 CAR을 조사(interrogate)하기 위한 IHC에 이용할 수 있음. 말단 혈액(terminal bleed)을 수집하고, 5T4 CAR-T 세포에 대한 유세포 분석에 의해 분석함. CAR-T 세포가 충분한 수로 존재하는 경우, 생착된 CAR-T 세포 기능의 시험관 내 평가를 사이토카인 생성에 대하여 5T4+ 및 5T4- 표적 세포와의 시험관 내 공동 배양에 의해 평가함(배양물 상청액의 ELISA 또는 세포 내 유세포 분석법에 의함).
최소 효능 용량에 대한 결과
이 실험에서, SKOV3.Luc 종양 보유 NSG 마우스는 종양 성장에 대항하여 2.2×105 CAR-T 세포의 용량과 같은 0.1×107 T 세포의 용량까지 5T4.CD28ζ CAR-T 세포의 용량에 의해 효과적으로 보호된다는 것이 생물발광으로부터 분명해졌다. 또한, 5T4.4-1BBζ CART 세포군의 모든 마우스가 실험 종료 시점까지 종양이 발생하였다는 것 또한 분명하였다.
식염수 및 모의 T 세포군에서 마우스의 평균 생존은, 0.3×107 5T4.CD28ζ CART 세포군이 비종양 관련 사건에 의해 영향을 받았지만, 5T4.CD28ζ CART 세포군에서 가장 낮은 T 세포 용량의 경우 95일 및 0.3×107 5T4.CD28ζ CART 세포군에서 86일과 비교하여, 둘 다 56일이었다. 나머지 5T4.CD28ζ CART 세포군에 대한 평균 생존은 이들 실험군 각각에서 높은 생존율로 인해 결정할 수 없었다(도 11). 이에 비해, 가장 높은 5T4.4-1BBζ T 세포 용량(7.6×105 CAR-T 세포와 동등한 107 T 세포)은 실험 종료 시 상당한 종양 부하(tumor load)를 나타내었으나 살아남은 한 마리가 116일의 평균 생존을 달성하여, 대조군에 비해 개선된 생존 수준을 보여주었다. 0.3×107 T 세포군(2.3×105 CART 세포; 평균 생존 78일)에서 종양 성장 지연이 관찰되었지만, 2개의 가장 낮은 CAR-T 세포군(7.6×104 CAR-T 세포와 동등한 0.1×107 총 세포 및 2.3x104 CAR-T 세포와 동등한 0.03×107 총 세포)에서는 효과적인 항종양 반응이 관찰되지 않았다.
종합하면, 이 실험은 2.2×105 5T4.CD28ζ CAR-T 세포만이 유의미한 생체 내 항종양 효과를 전달함을 입증하였다. 이 용량의 CART 세포가 이 특정 실험에서 모든 종양을 근절시키지는 못했지만, 확립된 SKOV-3 종양을 갖는 마우스의 생존은 7.6×105 5T4.4-1BBζ CAR-T 세포로의 치료법에 의해 증진되었다.
투여 경로에 대한 결과
생물발광 이미지(도 12)는 IV 또는 IP 경로에 의해 고용량의 5T4.CD28ζ CAR-T 세포를 투여 받은 마우스에서 SKOV3-Luc 종양 성장이 제어됨을 보여주었다(6.5×105 CAR+ T 세포와 동등한 1×107 총 T 세포). 106 5T4.CD28ζ CAR-T 세포(6.5×104 CAR+ T 세포와 동등함)를 투여 받은 IV 및 IP 처리된 동물 모두에서 종양 성장의 명백한 지연이 있었지만, 종양은 이들 동물에서 발생하여 실험 종료 전에 각 군에서 사망을 초래하였다(6.5×105 CAR+ T 세포와 동등한 1×107 총 T 세포). 5T4.4-1BBζ CAR-T 세포를 투여 받은 동물의 경우, 모든 동물에서 종양 성장을 막을 수 없는 최고 용량의 CAR-T 세포(2.6 x 105 CAR+ T 세포와 동등한 1×107 총 T 세포)로 종양 성장에 대한 보호 수준이 감소되었다. 대조군 동물은 모두 74일 이내에 종양 성장에 굴복하였다.
조합된 그룹 발광 분석은, 28일까지는 IP 및 IV 106 5T4.CD28ζ CAR-T 세포군 둘 다에서의 종양 성장의 수준은 동등한 것으로 보이지만, 106 5T4.CD28ζ CAR-T 세포의 국소 IP 주입에 의한 일시적인 반응의 암시와 함께, 어느 경로에 의해 주어진 107 5T4.CD28ζ CAR-T 세포의 항종양 효능을 명확하게 보여준다.
중요하게는, 모든 5T4.CD28ζ CAR T 세포군은 대조군과 비교하여 통계적으로 유의미한 정도의 종양 성장을 보여주었지만, 치료군 간에는 통계적 차이가 없었으며, 이는 이러한 원리 증명 실험의 군 규모가 작기 때문일 것이다. 대조적으로, 최고 용량의 5T4.4-1BBζ CAR-T 세포만이 28일까지 종양 성장의 증거가 나타나기 전에 대략 3주 동안, 종양 성장의 명백한 감소와 함께 SKOV-3-Luc 종양 성장에 유의미한 영향을 미쳤다. 그러나 개별적인 종양 성장 곡선은 종양 성장이 제어되고, 실제로 한 마리의 동물이 약 80일경에 도태(cull)되는 종양을 명백하게 발생시키는 나중 시점에서 두 마리의 동물에서 종양 성장이 감소된 전체 개체군과 비교하여 약간 더 복잡한 이야기를 그린다. CD28 기반의 CAR의 상대적으로 신속한 항종양 활성과 비교하여 4-1BBζ CAR 활성의 이러한 지연된 항종양 동역학은 Sadelain Lab의 최근 간행물에 기술된 바 있다(Zhao et al. (2015) Cancer Cell 28(4): 415-428).
CD28ζ 기반의 CAR에 의해 매개된 항종양 효과에 대한 이러한 관찰은 대조군 동물에 비하여 개선된 생존율로 해석되는 한편, 더 높은 용량의 IP 군에서 한 마리의 손실이 이 실험의 생존율 분석에 영향을 미쳤지만, 오로지 106 5T4.4-1BBζ IP만이 대조군에 비해 생존율에 유의미한 개선을 보여주었다.
종합하면, 이 연구는 IP 또는 IV 투여 경로 중 어느 하나에 의해 주입된 CAR-T 세포가 동등한 상대적 효능을 나타냄을 시사한다.
실시예
7. H8 및
2E4
α-5T4 항체를 가지는 CAR-T 세포 간의 비교
SKOV-3 난소암 모델에서 상이한 5T4 scFv(EF1α-H8-CAR-CD3ζ/4-1BB 또는 EF1α-2E4-CAR-CD3ζ/4-1BB)를 이용하는 구조체를 비교할 때, 우수한 효능의 증거가 존재하는지를 결정하고자 본 연구를 수행하였다.
본 연구에 사용된 벡터를 아래에 나타내었다.
T 세포 형질도입은 상기 기술된 바와 같이 수행하였다.
SKOV-3/NSG 종양 모델에 대한 처리군
결과
각 세포 집단의 5T4 특이적 반응을 SKOV-3 종양 세포와의 공동 배양에 의해 평가하였다. 모든 5T4-CAR T 세포 집단은 모의 형질도입 T 세포의 사이토카인 생산의 백그라운드(background) 이상으로 IFNγ 및 IL-2를 생산하였다. 게다가, CMV 프로모터에 비해 EF1α 프로모터를 함유하는 구조체는 더 높은 사이토카인 수준을 초래한 것으로 나타났다. 그러나 CMV 군에 대한 표현형 데이터의 부족으로 인해, CAR+ T 세포의 수가 EF1α 군과 비교하여 CMV 군에서 더 낮을 가능성이 적어서, 사이토카인 분비가 더 낮다고 할 가능성을 배제할 수 없다. 2E4 형질도입 T 세포의 백분율(29%)은 H8 구조체에 대한 것(12.9%)보다 더 높지만, 사이토카인 분비 수준은 더 낮은 H8과 2E4 구조체의 비교에 대해서는 동일한 설명이 적용되지 않는다.
SKOV-3 세포 접종(challenge)에 대한 5T4 CAR-T 세포 효능 평가를 이후에 NSG 마우스(상기 열거된 처리군)에서 생체 내 시험하였다. 생물발광은 SKOV3 종양 부하가 7일째(CAR-T 세포 투여일)에 군 전체에 걸쳐 비슷하였고, 종양 성장 지연이 EF1α-2E4-CAR-CD3ζ/4-1BB(2E4-EF1α) 및 EF1α-H8-CAR-CD3ζ/4-1BB(H8-EF1α) 처리된 동물에서 나타났으나 CMV-H8-CAR-CD3ζ/4-1BB 군에서는 그렇지 않았음을 보여주었다.
종합하면, 도 13에서 강조된 바와 같이, EF1α-2E4-CAR-CD3ζ/4-1BB T 세포와 비교하여 EF1α-H8-CAR-CD3ζ/4-1BB T 세포에서 통계적으로 유의미한 생존율 증가가 있었다(P=0.008, 로그 순위, Mantel-Cox 검정). 표 5에 보고된 형질도입 효율을 기반으로, 107 표적 용량의 T 세포는 EF1α-2E4-CAR-CD3ζ/4-1BB로 형질도입된 2.9×106 CAR+ 세포 및 EF1α-H8-CAR-CD3ζ/4-1BB로 형질도입된 1.29×106 CAR+ 세포를 함유하였다. 따라서, H8 구조체에서 나타난 우수한 효능은 CAR+ T 세포 용량 단독을 기반으로는 예상되지 않았으며, 구조체 그 자체가 이 모델에서 2E4-CAR-CD3ζ/4-1BB 균등물보다 더 강력함을 시사하였다.
실시예
8: 골수종 암 모델에 대한 생체 내 효능
골수종 세포주에 대한 5T4 CAR-T 세포 효능 평가를 위한 처리군
결과
상기 표에 상술된 바와 같이, NSG 마우스에 I.P. 또는 I.V. 투여 경로를 통하여 2×106 NCI-H929 세포를 접종하였다. 종양 접종 7일 후, 마우스를 I.V. 투여 경로를 통해 1×107 CAR-T 세포로 처리하였다. 형질도입된 T 세포의 표현형에 기초하여, EF1α-H8-CAR-CD3ξ/4-1BB로 형질도입된 5.98×106 CAR+ T 세포 용량이 전달되었고, EF1α-2E4-CAR-CD3ξ/4-1BB로 형질도입된 3.86×106 CAR+ T 세포가 전달되었다.
(낮은 수준의 5T4를 발현하는) NCI-H929 골수종 세포주를 이용한 IV 접종 후, EF1α-H8-CAR-CD3ζ/4-1BB 형질도입 T 세포로 처리된 마우스는 모의 형질도입 T 세포 또는 EF1α-2E4-CAR-CD3ζ/4-1BB 형질도입 T 세포로 처리된 동물에 비해 통계적으로 유의미한 생존율 개선을 보여주었다(각각 P=0.0018 및 P=0.034; 도 14 참조).
실시예 9 - 골수종 세포에서 5T4의 발현
Oxford BioMedica의 항-5T4 H8 단일클론성 항체를 이용한 FACS에 의해 5T4 발현을 조사하였으며, 다음 방법에 따라 R&D Systems의 항-5T4 항체를 이용하여 면역조직화학을 수행하였다:
유세포
분석에 의한 5T4 발현의 평가
종양 세포 유세포 분석을 위해 사용된 항체는 항-5T4 H8 쥣과 단일클론성 항체였다; 이것을 직접적으로 PE-컨쥬게이션된 항체로서 사용하였다. 항체를 적정하여 종양 세포주 상에서 5T4의 세포 표면 발현의 검출을 위한 최적 농도를 결정하였다. 사용된 농도는 25 μg/ml 내지 0.5μg/ml 범위였다. 항체를 FACS 완충액(BD Biosciences; 영국 옥스포드)으로 희석하였다. 마우스 IgG1 이소형 대조군(BD; 영국 옥스포드; 적절하게 컨쥬게이션됨)을 음성 대조군으로 사용하였다.
계수 후, 세포를 PBS에 1×106개 세포/ml의 농도로 재현탁시켰다. 500 μl의 세포 현탁액을 각각의 FACS 튜브에 첨가하고, 세포를 4 ml의 총 부피의 PBS로 세척하였다. 그런 다음, 희석된 항체를 펠릿화된 세포에 첨가하고, +4℃에서 30분 동안 항온처리하였다. 2차 항체가 첨가되는 경우, 세포를 상기와 같이 PBS로 세척하고, 항체를 첨가하고, 세포를 +4℃에서 30분 동안 항온처리하였다. 그런 다음, 세포를 다시 1 ml PBS로 세척하고, Cytofix(BD Biosciences; 영국 옥스포드)로 고정시켰다. 데이터를 BD FACSVerse(BD Biosciences; 영국 옥스포드)에서 획득하고, FACSuite 소프트웨어(BD Biosciences; 영국 옥스포드)에서 분석하였다.
5T4 염색을 위한 최적 항체 농도는 2.5 μg/mL인 것으로 나타났으며; 이 농도를 모든 후속 실험에서 사용하였다.
면역조직화학에 의한 5T4 발현의 평가
가열된 수조에서 95℃에서 30분 동안 1X 항원 회수 용액(antigen retrieval solution)(Dako)에서 절편을 먼저 항온처리한 다음, 실온에서 20분 동안 신선한 1X 항원 회수 용액에서 항온처리하여 항원을 회수하였다.
FACS 결과를 도 15에 나타내었다. 시험한 5종의 다발성 골수종 세포주 중 3종에서 FACS에 의해 5T4 발현이 검출되었다: 골수종 세포주 JJN3, RPMI-8229 및 H929는 5T4 발현에 대해 양성이었다. U266 및 THEIL 세포주는 FACS에 의해 음성이었다. MFC7 유방암 세포를 양성 대조군으로 사용하였다.
면역조직화학적 염색을 이용하여 5T4 발현을 JJN3, RPMI-8226 및 H929 골수종 세포주에서 검출하였다. H929를 상기 기술된 연구에서 사용하였다.
결과를 도 16에 나타내었다. 도 16A 및 16B는 각각 음성(5T4에 대해 염색된 CHO 세포) 및 양성(안정적으로 5T4를 발현하며 5T4 발현에 대해 염색된 CHO 세포) 대조군을 나타낸다. 도 16C는 5T4 발현에 대해 염색된 MCF7 유방암 세포를 나타낸다. 도 16D는 5T4 발현에 대해 염색된 H929 골수종 세포를 나타낸다.
실시예 10 - 인간 골수종 샘플에서 5T4의 발현
다음의 방법에 따른 R&D Systems으로부터의 항-5T4 항체를 이용한 면역조직화학에 의해, 환자로부터 회수된 골수종 샘플에서 5T4 발현을 조사하였다.
Leica 마이크로톰을 이용하여 결장, 태반 및 다발성 골수종의 FFPE 블록으로부터 절편(4μm)을 준비하였다. 달리 언급되지 않는 한, 사용된 모든 시약은 EnVision™ FLEX+ 키트(Dako, K8012)의 일부였다.
Envision™ FLEX 표적 회수 용액을 이용하여, 20분 동안 97℃의 Dako PT Link 챔버에서 pH 6.1에서 절편의 항원을 회수하였다. pH 6.1에서 항원 회수 후, 5분 동안 절편을 Envision Flex 세척 완충액(pH 7.6, Dako, #K8007) 중에 둔 후, Dako Autostainer Plus에 로딩하였다. 그런 다음, 절편을 5분 동안 Envision Flex 퍼옥시다아제 차단 시약과 함께 항온처리한 다음, Flex 세척 완충액으로 2회 세척하였다. 이후, 절편을 무혈청 단백질 차단 시약(Dako, # X0909)과 함께 10분 동안 항온처리하고, 무혈청 단백질 차단 시약을 공기 분사(air-jet)로 제거하였다.
모든 절편을 1차 항체와 함께 또는 1차 항체의 부재하에 30분 동안 항온처리하였다. 항-5T4 항체를 3.125 μg/ml으로 사용하고, 농도 및 종을 매치시킨 비면역 마우스 IgG1을 이소형 대조 항체로 사용하였다. 팬사이토케라틴(pancytokeratin, PCK)에 대한 항체와 함께 결장 절편을 항온처리함으로써 분석 시약을 검사하였다.
1차 항체와 함께 항온처리한 후, 절편을 Flex 세척 완충액으로 2회 세척하고, Flex HRP 고분자와 함께 20분 동안 항온처리한 다음, Flex 세척 완충액으로 2회 세척하였다. 그런 다음, 모든 절편을 10분 동안 디아미노벤지딘(DAB) 기질과 항온처리한 다음, 증류수로 세척하였다.
절편을 헤마톡실린으로 대조염색하고, 농도를 점차 증가시킨 에탄올(90 내지 99%)에서 탈수시키고, 세 번의 자일렌 교체로 제거하고, DePeX 하에서 커버슬립을 덮었다. Aperio 스캔스코프 AT 터보 디지털 스캐너를 이용하여 디지털 이미지를 캡쳐하고, 연구진과 자문 병리학자가 분석하여 5T4 면역반응성을 평가하였다.
5T4 발현에 대해 평가된 16개의 샘플 중 2개는 때때로 약한 5T4 면역반응성 골수종 세포를 나타내었다. 한 샘플은 약한 내지 중간 정도의 면역염색을 보여주었고, 네 번째 샘플은 세포질 및 종양 세포의 원형질막에서 중간 정도의 면역염색을 나타내었. 전체적으로 4개의 샘플이 5T4 면역 반응성을 나타내었고(도 17), 나머지 12개 샘플은 5T4에 대해 음성이었고 5T4에 대해 25% 양성을 나타내었다.
실시예 11 - 혈액암에서 5T4의 발현
재료 및 방법
혈액 악성 종양에 대한 5T4 발현의 평가
아래 기술된 바와 같이 FACS 기계를 이용한 유세포 분석에 의해 혈액학적 악성 종양에 대한 5T4 발현을 평가하였다.
액형(liquid) 종양 샘플
다음의 혈액학적 악성 종양 환자로부터 골수 세포 또는 말초 혈액 단핵구 세포(PBMC) 샘플을 선별하였다:
i. 다발성 골수종,
ii. 만성 골수성 백혈병(CML)
iii. 만성 림프구성 백혈병(CLL)
iv. 급성 골수성 백혈병(AML)
v. B 세포 급성 림프아구성 백혈병(B-ALL)
vi. T 세포 급성 림프아구성 백혈병(T-ALL)
vii. 급성 전골수구성 골수성 백혈병(APML).
이들 샘플은 Tissue Solutions Ltd., Histologix Ltd. 및 맨체스터 암 연구센터(MCRC) 바이오뱅크로부터 입수하였다.
혈액 악성 종양에 대한 5T4 발현의 평가: 염색 프로토콜 및
게이팅
전략(gating strategy)
세포 바이알을 해동시키고, 10% FBS, 5 mM L-글루타민, 100 U/mL 페니실린/100 μg/mL 스트렙토마이신이 보충된 RPMI-1640 배지에 재현탁시켰다. 이어서, 세포를 세척하고, PBS에 재현탁시켰다. 세포를 분석 대상 샘플에 대해 적절한 수의 FACS 튜브에 동일하게 나누었다. 이어서, 세포를 제조사의 프로토콜에 따라 Zombie Aqua™와 함께 항온처리하였다. 항온처리 후, 세포를 BD FACS 염색 완충제(카탈로그 번호 554656)로 세척하였다. 모든 환자 샘플을 APS로부터 얻어진 맞춤형 컨쥬게이션(custom conjugated) 5T4-PE 항체를 사용하여 염색하고, +2℃ 내지 +8℃에서 30분 내지 1시간 동안 아래의 각각의 섹션에 기재된 다양한 종양 마커로 염색하였다. 항온처리 후 세포를 염색 완충액으로 2회 세척하고, 제조사의 프로토콜에 따라 BD CytoFix(554655)에 재현탁시켰다. 이어서 세포를 펠릿화하고, PBS에 재현탁시켰다.
FACSVerse 유세포 분석기(BD Biosciences)에서 획득을 수행하였다. 각각의 경우에, 라이브 셀 게이트에서 10,000개의 이벤트가 획득되었다. FlowJo 버전 10을 사용하여 데이터 분석을 수행하였다.
존재하는 경우, 죽은 세포를 배제하기 위하여, Zombie Aqua™ 고정 생존 키트(BioLegend)를 사용하였다. FSC/SSC(Forward versus Side scatter)를 기초로 하여 세포 찌꺼기(debris)를 추가로 배제하였다.
결과
CLL, 다발성 골수종, B-ALL, AML, CML, APML 및 T-ALL 환자로부터 회수된 말초 혈액 및 골수 샘플을 유세포 분석에 의해 5T4 발현에 대해 평가하였다. 샘플에 존재하는 다른 비악성 세포 중에서 악성 세포 종류의 확인을 돕기 위한 몇몇 계통의 세포 표면 마커 및 암 줄기세포 표현형을 나타내는 마커를 이용하였다.
전체적인 연구 결과를 아래 표에 요약하였다. 5T4 발현이 상이한 혈액 악성 종양에서 나타남을 볼 수 있다.
CD34는 5T4가 CSC 상에서 발현되는지를 결정하기 위한 1차 표현형 마커로서 사용되었다. 아래 표에 나타난 바와 같이, 5T4는 다수의 암 줄기세포에서 발현되는 것으로 나타났다.
표: 혈액 악성 종양에서의 5T4 발현. 표는 5T4 양성인 것으로 결정된 샘플의 백분율 및 암 줄기세포에서의 발현이 검출되었는지 여부와 함께 FACS에 의해 5T4 발현에 대해 분석된 환자 샘플의 수를 나타낸다.
실시예
12 - 고형 종양 세포주의 암 줄기세포 상에서의 5T4 발현의 평가
고형 종양 세포주
단일층(monolayer)으로서의 배양(표준 세포 배양 조건) 후 또는 구체(sphere) 형성(CSC에 대해 농축됨) 후 5T4 발현에 대하여 다음의 세포주를 평가하였다:
i. OVCAR-3(난소암)
ii. MCF7(유방암)
iii. HCT116(결장직장암)
iv. HT29(결장직장암)
v. A549(폐암)
vi. U251(교아세포종)
단일층 세포 배양
HCT116, HT29, MCF7 및 A549 세포를 10% 소 태아 혈청(FBS), 2 mM L-글루타민 및 50 μg/ml 페니실린-스트렙토마이신을 함유하는 DMEM 배지에서 배양하였다. OVCAR3 세포는 20% FBS, 10 μg/ml 인간 인슐린, 2 mM L-글루타민 및 50 μg/ml 페니실린-스트렙토마이신을 함유하는 RPMI 배지에서 배양하였다. U251 세포는 10% FBS, 1% 피루브산 나트륨, 1% 비필수 아미노산, 2 mM L-글루타민 및 50 μg/ml 페니실린-스트렙토마이신을 함유하는 MEM 배지에서 배양하였다. 모든 세포는 95% 상대 습도의 37℃, 5% CO2/95% 공기 분위기에서 배양하였다.
구체 세포 배양
구체 배양을 위한 방법은 Farnie et al. (2007) Journal of the National Cancer Institute 99, 616-627로부터 조정하였다. 폴리-HEMA를 95% 에탄올에 용해시키고, 세포 배양 플라스크에 첨가한 다음, 에탄올을 밤새 증발시켰다. HCT116 및 HT29 세포를 기본 구체 배지(DMEM/F12, 100 IU/ml 페니실린, 100 μg/ml 스트렙토마이신, 1x B27 보충)에서 배양하였다; MCF7, U251 및 A549 세포는 맘모스피어 배지(기본 구체 플러스 10 ng/ml hEGF, 5 μg/ml 인슐린, 0.5 μg/ml 하이드로코르티손)에서 배양하였고, OVCAR3 세포는 난소 구체 배지(기본 구체 플러스 20 ng/ml hEGF, 5 μg/ml 인슐린, 15 ng/ml hbFGF 및 0.4% FBS)에서 배양하였다.
실험 세포 배양 및 유세포 분석
각 세포주를 단일층 조건에서 2개의 T75 플라스크 및 상기 기술된 바와 같이 구체 조건에서 4개의 T175 플라스크에서 cm2 당 2000개의 세포로 배양하였다. 24시간 후, 각 세포주의 3개의 구형 플라스크 및 하나의 단일층 플라스크를 단일 세포 현탁액으로 수거하고, CD133-APC(시험당 5 μl, eBioscience™, cat # 17-1338-42) 또는 CD117-APC(시험당 5 μl, eBioscience™, cat # 17-1178-42)와 함께 또는 없이 5T4-PE(시험당 5 μl)로 라벨링하였다. 각각의 세포주 및 조건에 대해 상응하는 이소형 라벨링를 수행하였다(IgG1-PE, 시험당 12.5 μl; 및 IgG1-APC, 시험당 5 μl, eBioscience™, cat # 17-4714-82). 96 웰 플레이트에서 얼음 상에서 30분 동안 FACS 완충액(PBS, 5% FCS, 100IU/ml 페니실린, 100 μg/ml 스트렙토마이신)에서 항체 라벨링을 수행한 후, 웰을 FACS 완충액 중에서 2회 세척하였다. MACSQuant Analyzer 10에서 유세포 분석을 수행하였고, FlowJo V10을 사용하여 분석을 수행하였다.
나머지 단일층 플라스크는 세포가 적어도 60% 컨플루언시에 도달할 때까지('벌크 세포(bulk cell)') 배양하면서 유지하였고, 나머지 구형 플라스크는 유세포 분석을 위해 단일 세포 현탁액으로 수거하기 전에 7일 동안 배양하였다. 항체 라벨링은 기술된 바와 같이 수행하였다.
결과
결과를 도 19에 나타내었다. 이 연구의 데이터는 5T4가 연구된 세포주에 대한 암 줄기세포 상에서 발현됨을 입증한다. 또한, MFI의 일관된 증가는 암 줄기세포에서 세포 당 5T4의 잠재적으로 더 높은 발현을 시사한다.
본원에서 언급된 모든 문서는 참조되는 대상에 대한 특별한 주의와 함께, 그 전체가 참조로 포함된다. 기술된 본 발명의 방법 및 시스템의 다양한 수정 및 변형은 본 발명의 범위 및 사상을 벗어나지 않고 당업자에게 명백할 것이다.
본 발명은 특정 바람직한 구현예와 관련하여 설명되었지만, 청구된 본 발명은 이러한 특정 구현예에 과도하게 한정되어서는 안 된다는 점을 이해하여야 한다. 실제로, 분자 생물학, 세포 면역학 또는 관련 분야의 당업자에게 명백한, 본 발명을 실시하기 위한 기술된 방식의 다양한 변형은 하기 청구범위의 범위 내에 있는 것으로 의도된다.
SEQUENCE LISTING
<110> Oxford BioMedica (UK) Limited
<120> METHOD
<130> P19-080-INP-DYOUNG
<150> GB 1704084.1
<151> 2017-03-15
<150> GB 1721603.7
<151> 2017-12-21
<160> 14
<170> PatentIn version 3.5
<210> 1
<211> 515
<212> PRT
<213> Artificial Sequence
<220>
<223> 5T4-specific CAR sequence
<400> 1
Met Gly Val Leu Leu Thr Gln Arg Thr Leu Leu Ser Leu Val Leu Ala
1 5 10 15
Leu Leu Phe Pro Ser Met Ala Ser Met Glu Val Gln Leu Gln Gln Ser
20 25 30
Gly Pro Asp Leu Val Lys Pro Gly Ala Ser Val Lys Ile Ser Cys Lys
35 40 45
Ala Ser Gly Tyr Ser Phe Thr Gly Tyr Tyr Met His Trp Val Lys Gln
50 55 60
Ser His Gly Lys Ser Leu Glu Trp Ile Gly Arg Ile Asn Pro Asn Asn
65 70 75 80
Gly Val Thr Leu Tyr Asn Gln Lys Phe Lys Asp Lys Ala Ile Leu Thr
85 90 95
Val Asp Lys Ser Ser Thr Thr Ala Tyr Met Glu Leu Arg Ser Leu Thr
100 105 110
Ser Glu Asp Ser Ala Val Tyr Tyr Cys Ala Arg Ser Thr Met Ile Thr
115 120 125
Asn Tyr Val Met Asp Tyr Trp Gly Gln Val Thr Ser Val Thr Val Ser
130 135 140
Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Thr Gly Gly Gly Gly Ser
145 150 155 160
Ser Ile Val Met Thr Gln Thr Pro Thr Phe Leu Leu Val Ser Ala Gly
165 170 175
Asp Arg Val Thr Ile Thr Cys Lys Ala Ser Gln Ser Val Ser Asn Asp
180 185 190
Val Ala Trp Tyr Gln Gln Lys Pro Gly Gln Ser Pro Thr Leu Leu Ile
195 200 205
Ser Tyr Thr Ser Ser Arg Tyr Ala Gly Val Pro Asp Arg Phe Ile Gly
210 215 220
Ser Gly Tyr Gly Thr Asp Phe Thr Phe Thr Ile Ser Thr Leu Gln Ala
225 230 235 240
Glu Asp Leu Ala Val Tyr Phe Cys Gln Gln Asp Tyr Asn Ser Pro Pro
245 250 255
Thr Phe Gly Gly Gly Thr Lys Leu Glu Ile Lys Arg Ala Ala Ala Leu
260 265 270
Ser Asn Ser Ile Met Tyr Phe Ser His Phe Val Pro Val Phe Leu Pro
275 280 285
Ala Lys Pro Thr Thr Thr Pro Ala Pro Arg Pro Pro Thr Pro Ala Pro
290 295 300
Thr Ile Ala Ser Gln Pro Leu Ser Leu Arg Pro Glu Ala Cys Arg Pro
305 310 315 320
Ala Ala Gly Gly Ala Val His Thr Arg Gly Leu Asp Phe Ala Cys Asp
325 330 335
Ile Tyr Ile Trp Ala Pro Leu Ala Gly Thr Cys Gly Val Leu Leu Leu
340 345 350
Ser Leu Val Ile Thr Leu Tyr Cys Lys Arg Gly Arg Lys Lys Leu Leu
355 360 365
Tyr Ile Phe Lys Gln Pro Phe Met Arg Pro Val Gln Thr Thr Gln Glu
370 375 380
Glu Asp Gly Cys Ser Cys Arg Phe Pro Glu Glu Glu Glu Gly Gly Cys
385 390 395 400
Glu Leu Leu Arg Val Lys Phe Ser Arg Ser Ala Asp Ala Pro Ala Tyr
405 410 415
Gln Gln Gly Gln Asn Gln Leu Tyr Asn Glu Leu Asn Leu Gly Arg Arg
420 425 430
Glu Glu Tyr Asp Val Leu Asp Lys Arg Arg Gly Arg Asp Pro Glu Met
435 440 445
Gly Gly Lys Pro Arg Arg Lys Asn Pro Gln Glu Gly Leu Tyr Asn Glu
450 455 460
Leu Gln Lys Asp Lys Met Ala Glu Ala Tyr Ser Glu Ile Gly Met Lys
465 470 475 480
Gly Glu Arg Arg Arg Gly Lys Gly His Asp Gly Leu Tyr Gln Gly Leu
485 490 495
Ser Thr Ala Thr Lys Asp Thr Tyr Asp Ala Leu His Met Gln Ala Leu
500 505 510
Pro Pro Arg
515
<210> 2
<211> 24
<212> PRT
<213> Artificial Sequence
<220>
<223> Oncostatin M leader
<400> 2
Met Gly Val Leu Leu Thr Gln Arg Thr Leu Leu Ser Leu Val Leu Ala
1 5 10 15
Leu Leu Phe Pro Ser Met Ala Ser
20
<210> 3
<211> 244
<212> PRT
<213> Artificial Sequence
<220>
<223> H8 anti5T4 domain
<400> 3
Met Glu Val Gln Leu Gln Gln Ser Gly Pro Asp Leu Val Lys Pro Gly
1 5 10 15
Ala Ser Val Lys Ile Ser Cys Lys Ala Ser Gly Tyr Ser Phe Thr Gly
20 25 30
Tyr Tyr Met His Trp Val Lys Gln Ser His Gly Lys Ser Leu Glu Trp
35 40 45
Ile Gly Arg Ile Asn Pro Asn Asn Gly Val Thr Leu Tyr Asn Gln Lys
50 55 60
Phe Lys Asp Lys Ala Ile Leu Thr Val Asp Lys Ser Ser Thr Thr Ala
65 70 75 80
Tyr Met Glu Leu Arg Ser Leu Thr Ser Glu Asp Ser Ala Val Tyr Tyr
85 90 95
Cys Ala Arg Ser Thr Met Ile Thr Asn Tyr Val Met Asp Tyr Trp Gly
100 105 110
Gln Val Thr Ser Val Thr Val Ser Ser Gly Gly Gly Gly Ser Gly Gly
115 120 125
Gly Gly Thr Gly Gly Gly Gly Ser Ser Ile Val Met Thr Gln Thr Pro
130 135 140
Thr Phe Leu Leu Val Ser Ala Gly Asp Arg Val Thr Ile Thr Cys Lys
145 150 155 160
Ala Ser Gln Ser Val Ser Asn Asp Val Ala Trp Tyr Gln Gln Lys Pro
165 170 175
Gly Gln Ser Pro Thr Leu Leu Ile Ser Tyr Thr Ser Ser Arg Tyr Ala
180 185 190
Gly Val Pro Asp Arg Phe Ile Gly Ser Gly Tyr Gly Thr Asp Phe Thr
195 200 205
Phe Thr Ile Ser Thr Leu Gln Ala Glu Asp Leu Ala Val Tyr Phe Cys
210 215 220
Gln Gln Asp Tyr Asn Ser Pro Pro Thr Phe Gly Gly Gly Thr Lys Leu
225 230 235 240
Glu Ile Lys Arg
<210> 4
<211> 3
<212> PRT
<213> Artificial Sequence
<220>
<223> linker
<400> 4
Ala Ala Ala
1
<210> 5
<211> 65
<212> PRT
<213> Artificial Sequence
<220>
<223> CD8 hinge
<400> 5
Leu Ser Asn Ser Ile Met Tyr Phe Ser His Phe Val Pro Val Phe Leu
1 5 10 15
Pro Ala Lys Pro Thr Thr Thr Pro Ala Pro Arg Pro Pro Thr Pro Ala
20 25 30
Pro Thr Ile Ala Ser Gln Pro Leu Ser Leu Arg Pro Glu Ala Cys Arg
35 40 45
Pro Ala Ala Gly Gly Ala Val His Thr Arg Gly Leu Asp Phe Ala Cys
50 55 60
Asp
65
<210> 6
<211> 24
<212> PRT
<213> Artificial Sequence
<220>
<223> CD8 transmembrane region
<400> 6
Ile Tyr Ile Trp Ala Pro Leu Ala Gly Thr Cys Gly Val Leu Leu Leu
1 5 10 15
Ser Leu Val Ile Thr Leu Tyr Cys
20
<210> 7
<211> 42
<212> PRT
<213> Artificial Sequence
<220>
<223> 41BB costimulatory domain
<400> 7
Lys Arg Gly Arg Lys Lys Leu Leu Tyr Ile Phe Lys Gln Pro Phe Met
1 5 10 15
Arg Pro Val Gln Thr Thr Gln Glu Glu Asp Gly Cys Ser Cys Arg Phe
20 25 30
Pro Glu Glu Glu Glu Gly Gly Cys Glu Leu
35 40
<210> 8
<211> 113
<212> PRT
<213> Artificial Sequence
<220>
<223> CD3 zeta stimulatory domain
<400> 8
Leu Arg Val Lys Phe Ser Arg Ser Ala Asp Ala Pro Ala Tyr Gln Gln
1 5 10 15
Gly Gln Asn Gln Leu Tyr Asn Glu Leu Asn Leu Gly Arg Arg Glu Glu
20 25 30
Tyr Asp Val Leu Asp Lys Arg Arg Gly Arg Asp Pro Glu Met Gly Gly
35 40 45
Lys Pro Arg Arg Lys Asn Pro Gln Glu Gly Leu Tyr Asn Glu Leu Gln
50 55 60
Lys Asp Lys Met Ala Glu Ala Tyr Ser Glu Ile Gly Met Lys Gly Glu
65 70 75 80
Arg Arg Arg Gly Lys Gly His Asp Gly Leu Tyr Gln Gly Leu Ser Thr
85 90 95
Ala Thr Lys Asp Thr Tyr Asp Ala Leu His Met Gln Ala Leu Pro Pro
100 105 110
Arg
<210> 9
<211> 1548
<212> DNA
<213> Artificial Sequence
<220>
<223> codon-optimised sequence encoding the 5T4-CAR protein
<400> 9
atgggagtgc tgctgaccca gagaaccctg ctgtctctgg tgctggccct gctgttccct 60
agcatggcca gcatggaagt gcagctgcag cagagcggcc ctgacctcgt gaaacctggc 120
gcctccgtga agatcagctg caaggccagc ggctacagct tcaccggcta ctacatgcac 180
tgggtcaagc agagccacgg caagagcctg gaatggatcg gccggatcaa ccccaacaac 240
ggcgtgaccc tgtacaacca gaagttcaag gacaaggcca tcctgaccgt ggacaagagc 300
agcaccaccg cctacatgga actgcggagc ctgaccagcg aggacagcgc cgtgtactac 360
tgcgcccggt ccaccatgat caccaactac gtgatggact actggggcca agtgaccagc 420
gtgaccgtgt ctagcggagg cggaggatct ggcggcggag gaacaggcgg agggggatct 480
agcatcgtga tgacccagac ccccaccttc ctgctggtgt ctgccggcga cagagtgacc 540
atcacatgca aggcctccca gagcgtgtcc aacgacgtgg cctggtatca gcagaagcct 600
ggccagagcc ccaccctgct gattagctac accagctcca gatatgccgg cgtgcccgac 660
agattcatcg gcagcggcta tggcaccgac ttcaccttca ccatcagcac actgcaggcc 720
gaggacctgg ctgtgtactt ctgtcagcaa gactacaaca gcccccctac cttcggcgga 780
ggcaccaagc tggaaatcaa gagagccgcc gctctgagca acagcatcat gtacttcagc 840
cacttcgtgc ccgtgtttct gcccgccaag cctaccacaa cccctgcccc tagacctcct 900
accccagccc ctacaatcgc cagccagcct ctgtctctga ggcccgaggc ttgtagacct 960
gctgctggcg gagccgtgca caccagagga ctggatttcg cctgcgacat ctacatctgg 1020
gcccctctgg ccggcacatg tggcgtgctg ctgctgagcc tcgtgatcac cctgtactgc 1080
aagcggggca gaaagaagct gctgtacatc ttcaagcagc ccttcatgcg gcccgtgcag 1140
accacccagg aagaggacgg ctgctcctgc agattccccg aggaagaaga aggcggctgc 1200
gagctgctga gagtgaagtt cagcagatcc gccgacgccc ctgcctacca gcagggacag 1260
aatcagctgt acaacgagct gaacctgggc agacgggaag agtacgacgt gctggacaag 1320
cggagaggca gggaccctga gatgggcggc aagcccagaa gaaagaaccc ccaggaaggc 1380
ctgtataacg aactgcagaa agacaagatg gccgaggcct acagcgagat cggaatgaag 1440
ggcgagcgga gaagaggcaa gggccacgat ggactgtacc agggcctgag caccgccacc 1500
aaggacacct atgacgccct gcacatgcag gctctgcccc ccagatga 1548
<210> 10
<211> 1179
<212> DNA
<213> Artificial Sequence
<220>
<223> EF1alpha promoter sequence
<400> 10
ggctccggtg cccgtcagtg ggcagagcgc acatcgccca cagtccccga gaagttgggg 60
ggaggggtcg gcaattgaac cggtgcctag agaaggtggc gcggggtaaa ctgggaaagt 120
gatgtcgtgt actggctccg cctttttccc gagggtgggg gagaaccgta tataagtgca 180
gtagtcgccg tgaacgttct ttttcgcaac gggtttgccg ccagaacaca ggtaagtgcc 240
gtgtgtggtt cccgcgggcc tggcctcttt acgggttatg gcccttgcgt gccttgaatt 300
acttccacct ggctgcagta cgtgattctt gatcccgagc ttcgggttgg aagtgggtgg 360
gagagttcga ggccttgcgc ttaaggagcc ccttcgcctc gtgcttgagt tgaggcctgg 420
cctgggcgct ggggccgccg cgtgcgaatc tggtggcacc ttcgcgcctg tctcgctgct 480
ttcgataagt ctctagccat ttaaaatttt tgatgacctg ctgcgacgct ttttttctgg 540
caagatagtc ttgtaaatgc gggccaagat ctgcacactg gtatttcggt ttttggggcc 600
gcgggcggcg acggggcccg tgcgtcccag cgcacatgtt cggcgaggcg gggcctgcga 660
gcgcggccac cgagaatcgg acgggggtag tctcaagctg gccggcctgc tctggtgcct 720
ggcctcgcgc cgccgtgtat cgccccgccc tgggcggcaa ggctggcccg gtcggcacca 780
gttgcgtgag cggaaagatg gccgcttccc ggccctgctg cagggagctc aaaatggagg 840
acgcggcgct cgggagagcg ggcgggtgag tcacccacac aaaggaaaag ggcctttccg 900
tcctcagccg tcgcttcatg tgactccacg gagtaccggg cgccgtccag gcacctcgat 960
tagttctcga gcttttggag tacgtcgtct ttaggttggg gggaggggtt ttatgcgatg 1020
gagtttcccc acactgagtg ggtggagact gaagttaggc cagcttggca cttgatgtaa 1080
ttctccttgg aatttgccct ttttgagttt ggatcttggt tcattctcaa gcctcagaca 1140
gtggttcaaa gtttttttct tccatttcag gtgtcgtga 1179
<210> 11
<211> 243
<212> PRT
<213> Artificial Sequence
<220>
<223> 2E4 anti5T4 domain
<400> 11
Met Glu Val Gln Leu Gln Gln Ser Gly Pro Glu Leu Val Lys Pro Gly
1 5 10 15
Ala Ser Val Lys Ile Ser Cys Lys Ala Ser Gly Tyr Ser Phe Thr Gly
20 25 30
Tyr Tyr Met His Trp Val Lys Gln Ser His Val Lys Ser Leu Glu Trp
35 40 45
Ile Gly Arg Ile Asn Pro Tyr Asn Gly Ala Thr Thr Tyr Asn Gln Asp
50 55 60
Phe Lys Asp Lys Ala Ser Leu Thr Val Asp Lys Ser Ser Ser Thr Ala
65 70 75 80
Ser Met Glu Leu His Ser Leu Thr Ser Glu Asp Ser Ala Val Tyr Tyr
85 90 95
Cys Ala Leu Ser Thr Met Ile Thr Thr Ala Trp Phe Ala Tyr Trp Gly
100 105 110
Gln Gly Thr Leu Val Thr Val Ser Pro Gly Gly Gly Gly Ser Gly Gly
115 120 125
Gly Gly Thr Gly Gly Gly Gly Ser Asn Phe Val Met Thr Gln Thr Pro
130 135 140
Lys Phe Leu Leu Ala Ser Ala Gly Asp Arg Val Thr Ile Ser Cys Lys
145 150 155 160
Ala Ser Gln Ser Val Ser Asn Asp Val Gly Trp Tyr Gln Gln Lys Pro
165 170 175
Gly Gln Ser Pro Lys Leu Leu Ile Tyr Phe Ala Ser Asn Arg Tyr Thr
180 185 190
Gly Val Pro Asp Arg Phe Ile Gly Ser Gly Tyr Gly Thr Asp Phe Thr
195 200 205
Phe Thr Ile Ser Thr Val Gln Ala Glu Asp Leu Ala Val Tyr Phe Cys
210 215 220
Gln Gln Asp Tyr Ser Ser Pro Phe Thr Phe Gly Ser Gly Thr Lys Leu
225 230 235 240
Glu Ile Lys
<210> 12
<211> 243
<212> PRT
<213> Artificial Sequence
<220>
<223> 2E4 antibody sequence
<400> 12
Met Glu Val Gln Leu Gln Gln Ser Gly Pro Glu Leu Val Lys Pro Gly
1 5 10 15
Ala Ser Val Lys Ile Ser Cys Lys Ala Ser Gly Tyr Ser Phe Thr Gly
20 25 30
Tyr Tyr Met His Trp Val Lys Gln Ser His Val Lys Ser Leu Glu Trp
35 40 45
Ile Gly Arg Ile Asn Pro Tyr Asn Gly Ala Thr Thr Tyr Asn Gln Asp
50 55 60
Phe Lys Asp Lys Ala Ser Leu Thr Val Asp Lys Ser Ser Ser Thr Ala
65 70 75 80
Ser Met Glu Leu His Ser Leu Thr Ser Glu Asp Ser Ala Val Tyr Tyr
85 90 95
Cys Ala Leu Ser Thr Met Ile Thr Thr Ala Trp Phe Ala Tyr Trp Gly
100 105 110
Gln Gly Thr Leu Val Thr Val Ser Pro Gly Gly Gly Gly Ser Gly Gly
115 120 125
Gly Gly Thr Gly Gly Gly Gly Ser Asn Phe Val Met Thr Gln Thr Pro
130 135 140
Lys Phe Leu Leu Ala Ser Ala Gly Asp Arg Val Thr Ile Ser Cys Lys
145 150 155 160
Ala Ser Gln Ser Val Ser Asn Asp Val Gly Trp Tyr Gln Gln Lys Pro
165 170 175
Gly Gln Ser Pro Lys Leu Leu Ile Tyr Phe Ala Ser Asn Arg Tyr Thr
180 185 190
Gly Val Pro Asp Arg Phe Ile Gly Ser Gly Tyr Gly Thr Asp Phe Thr
195 200 205
Phe Thr Ile Ser Thr Val Gln Ala Glu Asp Leu Ala Val Tyr Phe Cys
210 215 220
Gln Gln Asp Tyr Ser Ser Pro Phe Thr Phe Gly Ser Gly Thr Lys Leu
225 230 235 240
Glu Ile Lys
<210> 13
<211> 514
<212> PRT
<213> Artificial Sequence
<220>
<223> 5T4-specific CAR sequence
<400> 13
Met Gly Val Leu Leu Thr Gln Arg Thr Leu Leu Ser Leu Val Leu Ala
1 5 10 15
Leu Leu Phe Pro Ser Met Ala Ser Met Glu Val Gln Leu Gln Gln Ser
20 25 30
Gly Pro Glu Leu Val Lys Pro Gly Ala Ser Val Lys Ile Ser Cys Lys
35 40 45
Ala Ser Gly Tyr Ser Phe Thr Gly Tyr Tyr Met His Trp Val Lys Gln
50 55 60
Ser His Val Lys Ser Leu Glu Trp Ile Gly Arg Ile Asn Pro Tyr Asn
65 70 75 80
Gly Ala Thr Thr Tyr Asn Gln Asp Phe Lys Asp Lys Ala Ser Leu Thr
85 90 95
Val Asp Lys Ser Ser Ser Thr Ala Ser Met Glu Leu His Ser Leu Thr
100 105 110
Ser Glu Asp Ser Ala Val Tyr Tyr Cys Ala Leu Ser Thr Met Ile Thr
115 120 125
Thr Ala Trp Phe Ala Tyr Trp Gly Gln Gly Thr Leu Val Thr Val Ser
130 135 140
Pro Gly Gly Gly Gly Ser Gly Gly Gly Gly Thr Gly Gly Gly Gly Ser
145 150 155 160
Asn Phe Val Met Thr Gln Thr Pro Lys Phe Leu Leu Ala Ser Ala Gly
165 170 175
Asp Arg Val Thr Ile Ser Cys Lys Ala Ser Gln Ser Val Ser Asn Asp
180 185 190
Val Gly Trp Tyr Gln Gln Lys Pro Gly Gln Ser Pro Lys Leu Leu Ile
195 200 205
Tyr Phe Ala Ser Asn Arg Tyr Thr Gly Val Pro Asp Arg Phe Ile Gly
210 215 220
Ser Gly Tyr Gly Thr Asp Phe Thr Phe Thr Ile Ser Thr Val Gln Ala
225 230 235 240
Glu Asp Leu Ala Val Tyr Phe Cys Gln Gln Asp Tyr Ser Ser Pro Phe
245 250 255
Thr Phe Gly Ser Gly Thr Lys Leu Glu Ile Lys Ala Ala Ala Leu Ser
260 265 270
Asn Ser Ile Met Tyr Phe Ser His Phe Val Pro Val Phe Leu Pro Ala
275 280 285
Lys Pro Thr Thr Thr Pro Ala Pro Arg Pro Pro Thr Pro Ala Pro Thr
290 295 300
Ile Ala Ser Gln Pro Leu Ser Leu Arg Pro Glu Ala Cys Arg Pro Ala
305 310 315 320
Ala Gly Gly Ala Val His Thr Arg Gly Leu Asp Phe Ala Cys Asp Ile
325 330 335
Tyr Ile Trp Ala Pro Leu Ala Gly Thr Cys Gly Val Leu Leu Leu Ser
340 345 350
Leu Val Ile Thr Leu Tyr Cys Lys Arg Gly Arg Lys Lys Leu Leu Tyr
355 360 365
Ile Phe Lys Gln Pro Phe Met Arg Pro Val Gln Thr Thr Gln Glu Glu
370 375 380
Asp Gly Cys Ser Cys Arg Phe Pro Glu Glu Glu Glu Gly Gly Cys Glu
385 390 395 400
Leu Leu Arg Val Lys Phe Ser Arg Ser Ala Asp Ala Pro Ala Tyr Gln
405 410 415
Gln Gly Gln Asn Gln Leu Tyr Asn Glu Leu Asn Leu Gly Arg Arg Glu
420 425 430
Glu Tyr Asp Val Leu Asp Lys Arg Arg Gly Arg Asp Pro Glu Met Gly
435 440 445
Gly Lys Pro Arg Arg Lys Asn Pro Gln Glu Gly Leu Tyr Asn Glu Leu
450 455 460
Gln Lys Asp Lys Met Ala Glu Ala Tyr Ser Glu Ile Gly Met Lys Gly
465 470 475 480
Glu Arg Arg Arg Gly Lys Gly His Asp Gly Leu Tyr Gln Gly Leu Ser
485 490 495
Thr Ala Thr Lys Asp Thr Tyr Asp Ala Leu His Met Gln Ala Leu Pro
500 505 510
Pro Arg
<210> 14
<211> 730
<212> DNA
<213> Artificial Sequence
<220>
<223> sequence encoding the 2E4 antigen binding moiety
<400> 14
atggaagtgc agctgcagca gtctggcccc gagctcgtga aacctggcgc ctccgtgaag 60
atcagctgca aggccagcgg ctacagcttc accggctact acatgcactg ggtcaagcag 120
agccacgtga agtccctgga atggatcggc cggatcaacc cctacaacgg cgccaccacc 180
tacaaccagg acttcaagga caaggcctcc ctgaccgtgg acaagagcag cagcaccgcc 240
agcatggaac tgcacagcct gaccagcgag gacagcgccg tgtactactg tgccctgagc 300
accatgatca ccaccgcttg gtttgcctac tggggccagg gcacactcgt gaccgtgtct 360
ccaggaggcg gaggatctgg cggcggagga acaggcggag ggggatctaa cttcgtgatg 420
acccagaccc ccaagttcct gctggcctct gccggcgaca gagtgaccat cagctgcaag 480
gccagccaga gcgtgtccaa cgacgtgggc tggtatcagc agaagcccgg ccagagcccc 540
aagctgctga tctacttcgc cagcaaccgg tacaccggcg tgcccgacag attcatcggc 600
agcggctacg gcaccgactt caccttcacc atcagcaccg tgcaggccga ggacctggcc 660
gtgtacttct gtcagcaaga ctacagcagc cctttcacct tcggctccgg caccaagctg 720
gaaatcaagg 730
Claims (45)
- 대상체에서의 혈액암의 치료 또는 예방에 사용하기 위한 5T4-표적화제를 포함하는 약학 조성물로서,
상기 혈액암은 만성 림프구성 백혈병(chronic lymphocytic leukaemia), 골수종(myeloma), 급성 골수성 백혈병(acute myeloid leukaemia), B 세포 급성 림프아구성 백혈병(B cell acute lymphoblastic leukaemia), 만성 골수성 백혈병(chronic myeloid leukaemia) 및 T 세포 급성 림프아구성 백혈병(T cell acute lymphoblastic leukaemia)으로부터 선택되는 것이고,
상기 5T4-표적화제는:
(i) 단일클론성 항체 또는 이의 생물학적 활성 단편으로서, 상기 단일클론성 항체는 H8 5T4-특이적 항체를 기반으로 하고, H8 5T4-특이적 항체는 서열번호 3에 기재된 아미노산 서열을 포함하는 것; 또는
(ii) 5T4-특이적 키메라 항원 수용체(chimeric antigen receptor, CAR) 또는 5T4에 특이적인 T 세포 수용체(T cell receptor, TCR)를 포함하는 면역세포로서, 상기 5T4-특이적 키메라 항원 수용체(CAR) 또는 T 세포 수용체(TCR)는 서열번호 3에 기재된 아미노산 서열을 포함하는 것인, 약학 조성물. - 제1항에 있어서,
상기 항체는 항체-약물 컨쥬게이트(conjugate)의 형태인 것인, 약학 조성물. - 제1항에 있어서,
상기 면역세포는 T 세포, NK 세포 또는 NKT 세포인 것인, 약학 조성물. - 제3항에 있어서,
상기 면역세포는 T 세포인 것인, 약학 조성물. - 제1항에 있어서,
상기 5T4-표적화제는 정맥 내 투여를 통해 투여되는 것인, 약학 조성물. - 제1항에 있어서,
상기 대상체는 포유동물 대상체인 것인, 약학 조성물. - 제6항에 있어서,
상기 대상체는 인간 대상체인 것인, 약학 조성물. - 제1항에 있어서,
상기 5T4-표적화제는 동시적으로 또는 순차적으로 추가의 암 치료제와 병용하여 투여되는 것인, 약학 조성물. - 제1항에 있어서,
상기 대상체는 5T4 발현에 대해 사전 스크리닝되거나 사전 스크리닝되었던 적이 있는 것인, 약학 조성물. - 삭제
- 삭제
- 삭제
- 삭제
- 삭제
- 삭제
- 삭제
- 삭제
- 삭제
- 삭제
- 삭제
- 삭제
- 삭제
- 삭제
- 삭제
- 삭제
- 삭제
- 삭제
- 삭제
- 삭제
- 삭제
- 삭제
- 삭제
- 삭제
- 삭제
- 삭제
- 삭제
- 삭제
- 삭제
- 삭제
- 삭제
- 삭제
- 삭제
- 삭제
- 삭제
- 삭제
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
KR1020237040460A KR20230166145A (ko) | 2017-03-15 | 2018-03-14 | 방법 |
Applications Claiming Priority (5)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
GB1704084.1 | 2017-03-15 | ||
GBGB1704084.1A GB201704084D0 (en) | 2017-03-15 | 2017-03-15 | Method |
GB1721603.7 | 2017-12-21 | ||
GBGB1721603.7A GB201721603D0 (en) | 2017-12-21 | 2017-12-21 | Method |
PCT/GB2018/050652 WO2018167486A1 (en) | 2017-03-15 | 2018-03-14 | Method |
Related Child Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
KR1020237040460A Division KR20230166145A (ko) | 2017-03-15 | 2018-03-14 | 방법 |
Publications (2)
Publication Number | Publication Date |
---|---|
KR20190129861A KR20190129861A (ko) | 2019-11-20 |
KR102609624B1 true KR102609624B1 (ko) | 2023-12-05 |
Family
ID=61868533
Family Applications (2)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
KR1020197026693A KR102609624B1 (ko) | 2017-03-15 | 2018-03-14 | 방법 |
KR1020237040460A KR20230166145A (ko) | 2017-03-15 | 2018-03-14 | 방법 |
Family Applications After (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
KR1020237040460A KR20230166145A (ko) | 2017-03-15 | 2018-03-14 | 방법 |
Country Status (8)
Country | Link |
---|---|
US (2) | US11427645B2 (ko) |
EP (1) | EP3595705A1 (ko) |
JP (2) | JP7277388B2 (ko) |
KR (2) | KR102609624B1 (ko) |
CN (1) | CN110678197A (ko) |
AU (2) | AU2018235130B2 (ko) |
CA (1) | CA3056542A1 (ko) |
WO (1) | WO2018167486A1 (ko) |
Families Citing this family (10)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US11126040B2 (en) | 2012-09-30 | 2021-09-21 | Optica Amuka (A.A.) Ltd. | Electrically-tunable lenses and lens systems |
AU2018250641A1 (en) | 2017-04-11 | 2019-10-31 | Inhibrx, Inc. | Multispecific polypeptide constructs having constrained CD3 binding and methods of using the same |
CN111971298A (zh) | 2018-03-12 | 2020-11-20 | 健玛保 | 抗体 |
JP2022504802A (ja) * | 2018-10-11 | 2022-01-13 | インヒブルクス インコーポレイテッド | 5t4シングルドメイン抗体およびその治療組成物 |
WO2021046500A1 (en) * | 2019-09-05 | 2021-03-11 | Bluebird Bio, Inc. | Transduction efficiency assay |
CA3152623A1 (en) * | 2019-10-11 | 2021-04-15 | Richard D. Cummings | Anti-tn antibodies and uses thereof |
MX2022010936A (es) * | 2020-03-05 | 2022-11-16 | Neotx Therapeutics Ltd | ³métodos y composiciones para el tratamiento del cáncer con células inmunológicas. |
KR20230173179A (ko) * | 2021-05-14 | 2023-12-26 | 카이트 파마 인코포레이티드 | 키메라 항원 수용체 t세포 요법 |
CN117069849B (zh) * | 2023-03-21 | 2024-02-23 | 武汉奥科博泰生物科技有限公司 | 识别nag的单克隆抗体及其应用 |
CN117074674B (zh) * | 2023-03-23 | 2024-01-23 | 武汉勖瑞生物科技有限责任公司 | 检测N-乙酰-β-D氨基葡萄糖苷酶的胶体金试纸及其制备方法 |
Citations (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2016034666A1 (en) * | 2014-09-04 | 2016-03-10 | Cellectis | Trophoblast glycoprotein (5t4, tpbg) specific chimeric antigen receptors for cancer immunotherapy |
Family Cites Families (60)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US4690915A (en) | 1985-08-08 | 1987-09-01 | The United States Of America As Represented By The Department Of Health And Human Services | Adoptive immunotherapy as a treatment modality in humans |
US5869053A (en) | 1988-03-04 | 1999-02-09 | Cancer Research Campaign Technology, Ltd. | 5T4 antigen from human trophoblasts |
EP0403559A1 (en) | 1988-03-04 | 1990-12-27 | Cancer Research Campaign Technology Limited | Improvements relating to antigens |
US6534055B1 (en) | 1988-11-23 | 2003-03-18 | Genetics Institute, Inc. | Methods for selectively stimulating proliferation of T cells |
US6352694B1 (en) | 1994-06-03 | 2002-03-05 | Genetics Institute, Inc. | Methods for inducing a population of T cells to proliferate using agents which recognize TCR/CD3 and ligands which stimulate an accessory molecule on the surface of the T cells |
US5118672A (en) | 1989-07-10 | 1992-06-02 | University Of Georgia Research Foundation | 5'-diphosphohexose nucleoside pharmaceutical compositions |
CA2089376C (en) | 1990-08-13 | 2010-05-04 | Phillip Dan Cook | Sugar modified oligonucleotides that detect and modulate gene expression |
US5199942A (en) | 1991-06-07 | 1993-04-06 | Immunex Corporation | Method for improving autologous transplantation |
ES2108460T3 (es) | 1993-06-03 | 1997-12-16 | Therapeutic Antibodies Inc | Fragmentos de anticuerpos en terapeutica. |
US7067318B2 (en) | 1995-06-07 | 2006-06-27 | The Regents Of The University Of Michigan | Methods for transfecting T cells |
US6692964B1 (en) | 1995-05-04 | 2004-02-17 | The United States Of America As Represented By The Secretary Of The Navy | Methods for transfecting T cells |
CN1195863C (zh) | 1996-10-17 | 2005-04-06 | 牛津生物医学(英国)有限公司 | 逆转录病毒载体 |
US6924123B2 (en) | 1996-10-29 | 2005-08-02 | Oxford Biomedica (Uk) Limited | Lentiviral LTR-deleted vector |
WO1998055607A2 (en) | 1997-06-04 | 1998-12-10 | Oxford Biomedica (Uk) Limited | Tumor targeted vector |
GB9711957D0 (en) | 1997-06-09 | 1997-08-06 | Isis Innovation | Methods and reagents for vaccination |
EP1042493A1 (en) | 1997-12-22 | 2000-10-11 | Oxford Biomedica (UK) Limited | Equine infectious anaemia virus (eiav) based retroviral vectors |
GB2370571B (en) | 1998-11-18 | 2003-05-07 | Oxford Biomedica Ltd | A modified 5t4 antigen |
GB9825303D0 (en) * | 1998-11-18 | 1999-01-13 | Oxford Biomedica Ltd | Vector |
ATE293690T1 (de) | 1998-11-18 | 2005-05-15 | Oxford Biomedica Ltd | Verwendung vom krebs-assoziierten antigen 5t4 zur immuntherapie |
GB2378704B (en) | 1998-11-18 | 2003-05-07 | Oxford Biomedica Ltd | Uses of 5t4 antigen |
GB9922361D0 (en) | 1999-09-21 | 1999-11-24 | Isis Innovation | Generating an immune response to an antigen |
CN1423660A (zh) | 1999-11-18 | 2003-06-11 | 牛津生物医学(英国)有限公司 | 抗体 |
US7572631B2 (en) | 2000-02-24 | 2009-08-11 | Invitrogen Corporation | Activation and expansion of T cells |
AU4328801A (en) | 2000-02-24 | 2001-09-03 | Xcyte Therapies Inc | Simultaneous stimulation and concentration of cells |
GB0009760D0 (en) | 2000-04-19 | 2000-06-07 | Oxford Biomedica Ltd | Method |
WO2002038612A2 (en) | 2000-11-13 | 2002-05-16 | Oxford Biomedica (Uk) Limited | Canine and feline tumour-associated antigen 5t4 |
CA2344208A1 (en) | 2001-04-30 | 2002-10-30 | Oxford Biomedica (Uk) Limited | Method |
GB0126378D0 (en) | 2001-11-02 | 2002-01-02 | Oxford Biomedica Ltd | Antigen |
JP4598398B2 (ja) | 2002-02-01 | 2010-12-15 | オックスフォード バイオメディカ (ユーケー) リミテッド | ウイルスベクター |
US20030170238A1 (en) | 2002-03-07 | 2003-09-11 | Gruenberg Micheal L. | Re-activated T-cells for adoptive immunotherapy |
US7662625B2 (en) * | 2002-07-02 | 2010-02-16 | Cancer Research Technology Limited | Methods for detecting the differentiation status of cells using 5T4 antigen expression |
GB0215287D0 (en) * | 2002-07-02 | 2002-08-14 | Oxford Biomedica Ltd | 5T4 antigen expression |
DK1558643T3 (da) | 2002-11-09 | 2009-09-07 | Immunocore Ltd | Cellereceptorpr sentation |
PE20100251A1 (es) * | 2004-09-10 | 2010-04-10 | Wyeth Corp | Anticuerpos anti-5t4 humanizados y conjugados anticuerpo anti-5t4/calicheamicina |
WO2006120473A2 (en) | 2005-05-13 | 2006-11-16 | Oxford Biomedica (Uk) Limited | Mhc class i and ii peptide antigens derived from tumour antigen 5t4 |
GB0519303D0 (en) | 2005-09-21 | 2005-11-02 | Oxford Biomedica Ltd | Chemo-immunotherapy method |
US7820174B2 (en) | 2006-02-24 | 2010-10-26 | The United States Of America As Represented By The Department Of Health And Human Services | T cell receptors and related materials and methods of use |
CN101437850B (zh) | 2006-03-10 | 2013-10-09 | 惠氏公司 | 抗5t4抗体及其用途 |
CA2674445C (en) | 2007-01-12 | 2016-06-07 | Government Of The United States Of America, Represented By The Secretary, Department Of Health And Human Services | Gp100-specific t cell receptors and related materials and methods of use |
WO2009070003A2 (en) | 2007-11-30 | 2009-06-04 | Mimos Berhad | An analog read out interface circuit for ion sensor |
EP2227334B1 (en) | 2007-12-07 | 2011-10-12 | Miltenyi Biotec GmbH | A centrifuge for separating a sample into at least two components |
WO2010007365A1 (en) | 2008-07-15 | 2010-01-21 | Oxford Biomedica (Uk) Ltd | Immunotherapeutic method |
EP3517961B1 (en) | 2009-01-09 | 2020-12-30 | Oxford BioMedica (UK) Limited | Factors |
US8785601B2 (en) | 2009-01-28 | 2014-07-22 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | T cell receptors and related materials and methods of use |
WO2010111659A1 (en) * | 2009-03-27 | 2010-09-30 | Wyeth Llc | Tumor-initiating cells and methods for using same |
GB0918383D0 (en) * | 2009-10-20 | 2009-12-02 | Cancer Rec Tech Ltd | Prognostic,screening and treatment methods and agents for treatment of metastasis and inflammation |
US9345748B2 (en) | 2010-09-21 | 2016-05-24 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Anti-SSX-2 T cell receptors and related materials and methods of use |
GB201018480D0 (en) | 2010-11-02 | 2010-12-15 | Oxford Biomedica Ltd | Factors |
CN105288644A (zh) * | 2011-04-01 | 2016-02-03 | 惠氏有限责任公司 | 抗体-药物缀合物 |
GB201108879D0 (en) | 2011-05-25 | 2011-07-06 | Isis Innovation | Vector |
WO2013068874A1 (en) | 2011-11-11 | 2013-05-16 | Pfizer Inc. | Antibody-drug conjugates |
BR112014029417B1 (pt) | 2012-05-25 | 2023-03-07 | Cellectis | Método ex vivo para a preparação de células t para imunoterapia |
EP3824905A1 (en) | 2012-08-20 | 2021-05-26 | Fred Hutchinson Cancer Research Center | Method and compositions for cellular immunotherapy |
CN112430580A (zh) | 2012-10-02 | 2021-03-02 | 纪念斯隆-凯特琳癌症中心 | 用于免疫疗法的组合物和方法 |
RU2016117810A (ru) * | 2013-10-11 | 2017-11-17 | Асана Биосайенсис, Ллк | Конъюгаты белок-полимер-лекарственное средство |
GB201322798D0 (en) | 2013-12-20 | 2014-02-05 | Oxford Biomedica Ltd | Production system |
WO2015155345A1 (en) * | 2014-04-11 | 2015-10-15 | Medimmune Limited | Antibodies and antibody-drug conjugates |
WO2016022939A1 (en) * | 2014-08-08 | 2016-02-11 | The United States Of America, As Represented By The Secretary, Department Of Health & Human Services | Human monoclonal antibodies specific for 5t4 and methods of their use |
MA43344A (fr) | 2015-05-29 | 2018-04-11 | Juno Therapeutics Inc | Composition et procédés de régulation des interactions inhibitrices dans les cellules génétiquement modifiées |
EP3655439A1 (en) * | 2017-07-20 | 2020-05-27 | Aptevo Research and Development LLC | Antigen binding proteins binding to 5t4 and 4-1bb and related compositions and methods |
-
2018
- 2018-03-14 KR KR1020197026693A patent/KR102609624B1/ko active IP Right Grant
- 2018-03-14 CA CA3056542A patent/CA3056542A1/en active Pending
- 2018-03-14 AU AU2018235130A patent/AU2018235130B2/en not_active Expired - Fee Related
- 2018-03-14 EP EP18715065.1A patent/EP3595705A1/en not_active Withdrawn
- 2018-03-14 WO PCT/GB2018/050652 patent/WO2018167486A1/en unknown
- 2018-03-14 US US16/490,972 patent/US11427645B2/en active Active
- 2018-03-14 JP JP2019571809A patent/JP7277388B2/ja active Active
- 2018-03-14 KR KR1020237040460A patent/KR20230166145A/ko active Search and Examination
- 2018-03-14 CN CN201880018043.9A patent/CN110678197A/zh active Pending
-
2022
- 2022-07-27 US US17/815,531 patent/US20230084645A1/en not_active Abandoned
-
2023
- 2023-05-08 JP JP2023076631A patent/JP2023103318A/ja not_active Withdrawn
- 2023-11-29 AU AU2023274115A patent/AU2023274115A1/en not_active Withdrawn
Patent Citations (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2016034666A1 (en) * | 2014-09-04 | 2016-03-10 | Cellectis | Trophoblast glycoprotein (5t4, tpbg) specific chimeric antigen receptors for cancer immunotherapy |
Non-Patent Citations (2)
Title |
---|
Castro F.V. et al, Leukemia 26(7):pp.1487~1498 (2013. 1. 1.)* |
Sapra P. et al, Mol Cancer Ther 12(1):pp.38~47 (2013. 1.)* |
Also Published As
Publication number | Publication date |
---|---|
US20200010560A1 (en) | 2020-01-09 |
AU2023274115A1 (en) | 2023-12-21 |
WO2018167486A1 (en) | 2018-09-20 |
CA3056542A1 (en) | 2018-09-20 |
EP3595705A1 (en) | 2020-01-22 |
KR20230166145A (ko) | 2023-12-06 |
CN110678197A (zh) | 2020-01-10 |
JP2020510704A (ja) | 2020-04-09 |
JP7277388B2 (ja) | 2023-05-18 |
JP2023103318A (ja) | 2023-07-26 |
US11427645B2 (en) | 2022-08-30 |
US20230084645A1 (en) | 2023-03-16 |
AU2018235130A1 (en) | 2019-08-29 |
AU2018235130B2 (en) | 2023-12-07 |
KR20190129861A (ko) | 2019-11-20 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
KR102609624B1 (ko) | 방법 | |
US10961288B2 (en) | Isolated B7-H4 specific compositions and methods of use thereof | |
CN111629734A (zh) | 用于共刺激的新型平台、新型car设计以及过继性细胞疗法的其他增强 | |
US20210038646A1 (en) | Chimeric antigen receptors targeting the tumor microenvironment | |
Berezhnoy et al. | Development and preliminary clinical activity of PD-1-guided CTLA-4 blocking bispecific DART molecule | |
US20090202544A1 (en) | Methods of Treating Diseases by Targeting Silt3 | |
EP3328994A1 (en) | Antigen-binding proteins targeting cd56 and uses thereof | |
KR20200108278A (ko) | 조작된 t 세포의 조성물을 제조하는 방법 | |
JP2022500011A (ja) | 固形腫瘍を治療するためのキメラ抗原受容体細胞 | |
JP2023534808A (ja) | 養子細胞療法のための標的共刺激を提供する受容体 | |
JP2021512637A (ja) | サイクリンa1特異的t細胞受容体およびその使用 | |
KR20230020421A (ko) | Cd70 특이적 융합 단백질을 사용하는 tcr 재프로그래밍을 위한 조성물 및 방법 | |
JP2023537799A (ja) | Cd28hドメイン含有キメラ抗原受容体および使用方法 | |
WO2023093811A1 (zh) | 分子开关调控型嵌合抗原受体细胞和抗体的组合及其应用 | |
AU2016329542C1 (en) | TCR and uses thereof | |
CN116284385A (zh) | 靶向bcma的p329g抗体及其与嵌合抗原受体细胞的组合和应用 | |
EP3356396A1 (en) | Tcr and uses thereof |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
A201 | Request for examination | ||
E902 | Notification of reason for refusal | ||
AMND | Amendment | ||
E601 | Decision to refuse application | ||
X091 | Application refused [patent] | ||
AMND | Amendment | ||
X701 | Decision to grant (after re-examination) | ||
GRNT | Written decision to grant |