KR102533290B1 - 전압개폐 칼륨이온채널 억제 활성능을 갖는 펩타이드 - Google Patents
전압개폐 칼륨이온채널 억제 활성능을 갖는 펩타이드 Download PDFInfo
- Publication number
- KR102533290B1 KR102533290B1 KR1020220046057A KR20220046057A KR102533290B1 KR 102533290 B1 KR102533290 B1 KR 102533290B1 KR 1020220046057 A KR1020220046057 A KR 1020220046057A KR 20220046057 A KR20220046057 A KR 20220046057A KR 102533290 B1 KR102533290 B1 KR 102533290B1
- Authority
- KR
- South Korea
- Prior art keywords
- cys
- peptide
- seq
- potassium ion
- lys
- Prior art date
Links
- 108090000765 processed proteins & peptides Proteins 0.000 title claims abstract description 80
- 108020001213 potassium channel Proteins 0.000 title claims abstract description 32
- 102000004257 Potassium Channel Human genes 0.000 title claims abstract description 29
- 230000002401 inhibitory effect Effects 0.000 title description 10
- 208000023275 Autoimmune disease Diseases 0.000 claims abstract description 23
- 241000242583 Scyphozoa Species 0.000 claims abstract description 11
- 231100000611 venom Toxicity 0.000 claims abstract description 7
- 239000002435 venom Substances 0.000 claims abstract description 6
- 210000001048 venom Anatomy 0.000 claims abstract description 6
- 102100034355 Potassium voltage-gated channel subfamily A member 3 Human genes 0.000 claims description 22
- 239000000203 mixture Substances 0.000 claims description 15
- 239000008194 pharmaceutical composition Substances 0.000 claims description 14
- 230000000694 effects Effects 0.000 claims description 10
- 201000004681 Psoriasis Diseases 0.000 claims description 8
- 208000006673 asthma Diseases 0.000 claims description 7
- 206010067584 Type 1 diabetes mellitus Diseases 0.000 claims description 6
- 208000006386 Bone Resorption Diseases 0.000 claims description 5
- 230000024279 bone resorption Effects 0.000 claims description 5
- 206010025135 lupus erythematosus Diseases 0.000 claims description 5
- 230000001404 mediated effect Effects 0.000 claims description 5
- 201000006417 multiple sclerosis Diseases 0.000 claims description 5
- 206010039073 rheumatoid arthritis Diseases 0.000 claims description 5
- 235000013376 functional food Nutrition 0.000 claims description 4
- 230000002757 inflammatory effect Effects 0.000 claims description 4
- 201000004624 Dermatitis Diseases 0.000 claims description 3
- 206010016654 Fibrosis Diseases 0.000 claims description 3
- 206010018364 Glomerulonephritis Diseases 0.000 claims description 3
- 208000009329 Graft vs Host Disease Diseases 0.000 claims description 3
- 206010020751 Hypersensitivity Diseases 0.000 claims description 3
- 208000022559 Inflammatory bowel disease Diseases 0.000 claims description 3
- 201000001263 Psoriatic Arthritis Diseases 0.000 claims description 3
- 208000036824 Psoriatic arthropathy Diseases 0.000 claims description 3
- 206010039710 Scleroderma Diseases 0.000 claims description 3
- 208000021386 Sjogren Syndrome Diseases 0.000 claims description 3
- 201000009594 Systemic Scleroderma Diseases 0.000 claims description 3
- 206010042953 Systemic sclerosis Diseases 0.000 claims description 3
- 206010052779 Transplant rejections Diseases 0.000 claims description 3
- 208000026935 allergic disease Diseases 0.000 claims description 3
- 230000007815 allergy Effects 0.000 claims description 3
- 230000004761 fibrosis Effects 0.000 claims description 3
- 208000024908 graft versus host disease Diseases 0.000 claims description 3
- 208000037803 restenosis Diseases 0.000 claims description 3
- 125000003275 alpha amino acid group Chemical group 0.000 claims 1
- 102000004196 processed proteins & peptides Human genes 0.000 abstract description 30
- 210000001744 T-lymphocyte Anatomy 0.000 abstract description 12
- 230000002265 prevention Effects 0.000 abstract description 3
- 230000003213 activating effect Effects 0.000 abstract description 2
- 210000004027 cell Anatomy 0.000 description 32
- 238000000034 method Methods 0.000 description 12
- 239000004480 active ingredient Substances 0.000 description 10
- 150000001413 amino acids Chemical group 0.000 description 10
- 239000000243 solution Substances 0.000 description 10
- 108091028043 Nucleic acid sequence Proteins 0.000 description 7
- 238000009472 formulation Methods 0.000 description 7
- 238000002360 preparation method Methods 0.000 description 7
- OKKJLVBELUTLKV-UHFFFAOYSA-N Methanol Chemical compound OC OKKJLVBELUTLKV-UHFFFAOYSA-N 0.000 description 6
- 235000018417 cysteine Nutrition 0.000 description 6
- 239000003814 drug Substances 0.000 description 6
- 230000014509 gene expression Effects 0.000 description 6
- 230000005764 inhibitory process Effects 0.000 description 6
- 239000000546 pharmaceutical excipient Substances 0.000 description 6
- 231100000614 poison Toxicity 0.000 description 6
- 239000002574 poison Substances 0.000 description 6
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 description 5
- 101001104199 Homo sapiens Retinitis pigmentosa 9 protein Proteins 0.000 description 5
- 101001104198 Mus musculus Retinitis pigmentosa 9 protein homolog Proteins 0.000 description 5
- 102100040073 Retinitis pigmentosa 9 protein Human genes 0.000 description 5
- 108090000623 proteins and genes Proteins 0.000 description 5
- JJAWGNIQEOFURP-UHFFFAOYSA-N psora 4 Chemical compound C1=2C=COC=2C=C2OC(=O)C=CC2=C1OCCCCC1=CC=CC=C1 JJAWGNIQEOFURP-UHFFFAOYSA-N 0.000 description 5
- 239000011347 resin Substances 0.000 description 5
- 229920005989 resin Polymers 0.000 description 5
- 208000027930 type IV hypersensitivity disease Diseases 0.000 description 5
- 239000013598 vector Substances 0.000 description 5
- KINMYBBFQRSVLL-UHFFFAOYSA-N 4-(4-phenoxybutoxy)furo[3,2-g]chromen-7-one Chemical compound C1=2C=COC=2C=C2OC(=O)C=CC2=C1OCCCCOC1=CC=CC=C1 KINMYBBFQRSVLL-UHFFFAOYSA-N 0.000 description 4
- 108020004414 DNA Proteins 0.000 description 4
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 4
- 238000010511 deprotection reaction Methods 0.000 description 4
- 239000003937 drug carrier Substances 0.000 description 4
- HQKMJHAJHXVSDF-UHFFFAOYSA-L magnesium stearate Chemical compound [Mg+2].CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O HQKMJHAJHXVSDF-UHFFFAOYSA-L 0.000 description 4
- 238000005259 measurement Methods 0.000 description 4
- 210000003071 memory t lymphocyte Anatomy 0.000 description 4
- 210000002484 nematocyst Anatomy 0.000 description 4
- 238000010647 peptide synthesis reaction Methods 0.000 description 4
- 210000005259 peripheral blood Anatomy 0.000 description 4
- 239000011886 peripheral blood Substances 0.000 description 4
- 239000003826 tablet Substances 0.000 description 4
- 102000008102 Ankyrins Human genes 0.000 description 3
- 108010049777 Ankyrins Proteins 0.000 description 3
- 108091003079 Bovine Serum Albumin Proteins 0.000 description 3
- 241000243321 Cnidaria Species 0.000 description 3
- 206010012442 Dermatitis contact Diseases 0.000 description 3
- 241000699666 Mus <mouse, genus> Species 0.000 description 3
- 102100037883 Phospholipase B1, membrane-associated Human genes 0.000 description 3
- DNIAPMSPPWPWGF-UHFFFAOYSA-N Propylene glycol Chemical compound CC(O)CO DNIAPMSPPWPWGF-UHFFFAOYSA-N 0.000 description 3
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 3
- 229930006000 Sucrose Natural products 0.000 description 3
- LYGKYFKSZTUXGZ-ZDLURKLDSA-N Thr-Cys-Gly Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CS)C(=O)NCC(O)=O LYGKYFKSZTUXGZ-ZDLURKLDSA-N 0.000 description 3
- 235000001014 amino acid Nutrition 0.000 description 3
- 210000004899 c-terminal region Anatomy 0.000 description 3
- 239000002775 capsule Substances 0.000 description 3
- 238000009795 derivation Methods 0.000 description 3
- 239000000839 emulsion Substances 0.000 description 3
- 239000012091 fetal bovine serum Substances 0.000 description 3
- -1 for example Substances 0.000 description 3
- 239000008187 granular material Substances 0.000 description 3
- 230000036541 health Effects 0.000 description 3
- 230000006872 improvement Effects 0.000 description 3
- 239000003112 inhibitor Substances 0.000 description 3
- CMWYAOXYQATXSI-UHFFFAOYSA-N n,n-dimethylformamide;piperidine Chemical compound CN(C)C=O.C1CCNCC1 CMWYAOXYQATXSI-UHFFFAOYSA-N 0.000 description 3
- 201000001245 periodontitis Diseases 0.000 description 3
- 239000000843 powder Substances 0.000 description 3
- 239000007790 solid phase Substances 0.000 description 3
- 239000005720 sucrose Substances 0.000 description 3
- 239000000725 suspension Substances 0.000 description 3
- 238000012360 testing method Methods 0.000 description 3
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 3
- 239000000080 wetting agent Substances 0.000 description 3
- JKMHFZQWWAIEOD-UHFFFAOYSA-N 2-[4-(2-hydroxyethyl)piperazin-1-yl]ethanesulfonic acid Chemical compound OCC[NH+]1CCN(CCS([O-])(=O)=O)CC1 JKMHFZQWWAIEOD-UHFFFAOYSA-N 0.000 description 2
- 241000242759 Actiniaria Species 0.000 description 2
- 208000004476 Acute Coronary Syndrome Diseases 0.000 description 2
- 102100033312 Alpha-2-macroglobulin Human genes 0.000 description 2
- GUBGYTABKSRVRQ-XLOQQCSPSA-N Alpha-Lactose Chemical compound O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@H]1O[C@@H]1[C@@H](CO)O[C@H](O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-XLOQQCSPSA-N 0.000 description 2
- 101001077186 Androctonus mauritanicus mauritanicus Potassium channel toxin alpha-KTx 3.1 Proteins 0.000 description 2
- 241000242757 Anthozoa Species 0.000 description 2
- 108010039627 Aprotinin Proteins 0.000 description 2
- IJGRMHOSHXDMSA-UHFFFAOYSA-N Atomic nitrogen Chemical compound N#N IJGRMHOSHXDMSA-UHFFFAOYSA-N 0.000 description 2
- 208000032116 Autoimmune Experimental Encephalomyelitis Diseases 0.000 description 2
- 102100036301 C-C chemokine receptor type 7 Human genes 0.000 description 2
- 101100512078 Caenorhabditis elegans lys-1 gene Proteins 0.000 description 2
- VTYYLEPIZMXCLO-UHFFFAOYSA-L Calcium carbonate Chemical compound [Ca+2].[O-]C([O-])=O VTYYLEPIZMXCLO-UHFFFAOYSA-L 0.000 description 2
- 235000014653 Carica parviflora Nutrition 0.000 description 2
- 108091006146 Channels Proteins 0.000 description 2
- 241000242741 Cubozoa Species 0.000 description 2
- RTZKZFJDLAIYFH-UHFFFAOYSA-N Diethyl ether Chemical compound CCOCC RTZKZFJDLAIYFH-UHFFFAOYSA-N 0.000 description 2
- 102100025012 Dipeptidyl peptidase 4 Human genes 0.000 description 2
- 239000006144 Dulbecco’s modified Eagle's medium Substances 0.000 description 2
- 102000016675 EF-hand domains Human genes 0.000 description 2
- 108050006297 EF-hand domains Proteins 0.000 description 2
- 108010010803 Gelatin Proteins 0.000 description 2
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 2
- 239000007995 HEPES buffer Substances 0.000 description 2
- 101000716065 Homo sapiens C-C chemokine receptor type 7 Proteins 0.000 description 2
- 108010074328 Interferon-gamma Proteins 0.000 description 2
- GUBGYTABKSRVRQ-QKKXKWKRSA-N Lactose Natural products OC[C@H]1O[C@@H](O[C@H]2[C@H](O)[C@@H](O)C(O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@H]1O GUBGYTABKSRVRQ-QKKXKWKRSA-N 0.000 description 2
- 208000005777 Lupus Nephritis Diseases 0.000 description 2
- LCPUWQLULVXROY-RHYQMDGZSA-N Met-Lys-Thr Chemical compound CSCC[C@H](N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H]([C@@H](C)O)C(O)=O LCPUWQLULVXROY-RHYQMDGZSA-N 0.000 description 2
- 241001465754 Metazoa Species 0.000 description 2
- 241000699670 Mus sp. Species 0.000 description 2
- 102000035195 Peptidases Human genes 0.000 description 2
- 108091005804 Peptidases Proteins 0.000 description 2
- KHGNFPUMBJSZSM-UHFFFAOYSA-N Perforine Natural products COC1=C2CCC(O)C(CCC(C)(C)O)(OC)C2=NC2=C1C=CO2 KHGNFPUMBJSZSM-UHFFFAOYSA-N 0.000 description 2
- 108010058864 Phospholipases A2 Proteins 0.000 description 2
- 108010015078 Pregnancy-Associated alpha 2-Macroglobulins Proteins 0.000 description 2
- 229940122055 Serine protease inhibitor Drugs 0.000 description 2
- 101710102218 Serine protease inhibitor Proteins 0.000 description 2
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 2
- 229920002472 Starch Polymers 0.000 description 2
- UGFSAPWZBROURT-IXOXFDKPSA-N Thr-Phe-Cys Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CS)C(=O)O)N)O UGFSAPWZBROURT-IXOXFDKPSA-N 0.000 description 2
- 206010053613 Type IV hypersensitivity reaction Diseases 0.000 description 2
- 230000004913 activation Effects 0.000 description 2
- 239000000654 additive Substances 0.000 description 2
- 238000010171 animal model Methods 0.000 description 2
- 239000000427 antigen Substances 0.000 description 2
- 108091007433 antigens Proteins 0.000 description 2
- 102000036639 antigens Human genes 0.000 description 2
- 239000003125 aqueous solvent Substances 0.000 description 2
- RASZIXQTZOARSV-BDPUVYQTSA-N astacin Chemical compound CC=1C(=O)C(=O)CC(C)(C)C=1/C=C/C(/C)=C/C=C/C(/C)=C/C=C/C=C(C)C=CC=C(C)C=CC1=C(C)C(=O)C(=O)CC1(C)C RASZIXQTZOARSV-BDPUVYQTSA-N 0.000 description 2
- 230000000903 blocking effect Effects 0.000 description 2
- 239000000872 buffer Substances 0.000 description 2
- 239000003795 chemical substances by application Substances 0.000 description 2
- 239000002299 complementary DNA Substances 0.000 description 2
- 238000012790 confirmation Methods 0.000 description 2
- 208000010247 contact dermatitis Diseases 0.000 description 2
- 238000007796 conventional method Methods 0.000 description 2
- 238000005859 coupling reaction Methods 0.000 description 2
- 150000001945 cysteines Chemical class 0.000 description 2
- 230000001419 dependent effect Effects 0.000 description 2
- 239000003085 diluting agent Substances 0.000 description 2
- 201000010099 disease Diseases 0.000 description 2
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 2
- 125000002228 disulfide group Chemical group 0.000 description 2
- 229940079593 drug Drugs 0.000 description 2
- 239000012636 effector Substances 0.000 description 2
- 238000005516 engineering process Methods 0.000 description 2
- 239000003623 enhancer Substances 0.000 description 2
- 208000012997 experimental autoimmune encephalomyelitis Diseases 0.000 description 2
- 235000003599 food sweetener Nutrition 0.000 description 2
- 229920000159 gelatin Polymers 0.000 description 2
- 239000008273 gelatin Substances 0.000 description 2
- 235000019322 gelatine Nutrition 0.000 description 2
- 235000011852 gelatine desserts Nutrition 0.000 description 2
- 238000010353 genetic engineering Methods 0.000 description 2
- NOESYZHRGYRDHS-UHFFFAOYSA-N insulin Chemical compound N1C(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(NC(=O)CN)C(C)CC)CSSCC(C(NC(CO)C(=O)NC(CC(C)C)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CCC(N)=O)C(=O)NC(CC(C)C)C(=O)NC(CCC(O)=O)C(=O)NC(CC(N)=O)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CSSCC(NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2C=CC(O)=CC=2)NC(=O)C(CC(C)C)NC(=O)C(C)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2NC=NC=2)NC(=O)C(CO)NC(=O)CNC2=O)C(=O)NCC(=O)NC(CCC(O)=O)C(=O)NC(CCCNC(N)=N)C(=O)NCC(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC(O)=CC=3)C(=O)NC(C(C)O)C(=O)N3C(CCC3)C(=O)NC(CCCCN)C(=O)NC(C)C(O)=O)C(=O)NC(CC(N)=O)C(O)=O)=O)NC(=O)C(C(C)CC)NC(=O)C(CO)NC(=O)C(C(C)O)NC(=O)C1CSSCC2NC(=O)C(CC(C)C)NC(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CC(N)=O)NC(=O)C(NC(=O)C(N)CC=1C=CC=CC=1)C(C)C)CC1=CN=CN1 NOESYZHRGYRDHS-UHFFFAOYSA-N 0.000 description 2
- VRARWAGTAUYUOO-UHFFFAOYSA-N kaliotoxin Chemical compound N1C(=O)C(CCCNC(N)=N)NC(=O)C(CCSC)NC(=O)CNC(=O)C(C)NC(=O)C(CC(O)=O)NC(=O)C(CCCCN)NC(=O)C(NC(=O)C2CCCN2C(=O)C(CCCCN)NC(=O)C(CC(C)C)NC2=O)CSSCC(C(=O)NC(C(C)O)C(=O)N3C(CCC3)C(=O)NC(CCCCN)C(O)=O)NC(=O)C(CC=3N=CNC=3)NC(=O)C(NC(=O)C(CCCCN)NC(=O)C(CCCNC(N)=N)NC(=O)C(CC(N)=O)NC(=O)C(CCSC)NC3=O)CSSCC2NC(=O)C(CCC(N)=O)NC(=O)C2CCCN2C(=O)C(CO)NC(=O)CNC(=O)C(CO)NC(=O)C(NC(=O)C(CCCCN)NC(=O)C(C(C)C)NC(=O)C(CC(N)=O)NC(=O)C(NC(=O)C(CCC(O)=O)NC(=O)C(NC(=O)CN)C(C)C)C(C)CC)CSSCC3NC(=O)C(CCCCN)NC(=O)CNC(=O)C1CC1=CC=CC=C1 VRARWAGTAUYUOO-UHFFFAOYSA-N 0.000 description 2
- 239000008101 lactose Substances 0.000 description 2
- 239000000314 lubricant Substances 0.000 description 2
- 239000006166 lysate Substances 0.000 description 2
- 235000019359 magnesium stearate Nutrition 0.000 description 2
- 239000012528 membrane Substances 0.000 description 2
- 238000010369 molecular cloning Methods 0.000 description 2
- 210000004897 n-terminal region Anatomy 0.000 description 2
- 210000002569 neuron Anatomy 0.000 description 2
- 238000007911 parenteral administration Methods 0.000 description 2
- 229930192851 perforin Natural products 0.000 description 2
- 239000013641 positive control Substances 0.000 description 2
- 239000003755 preservative agent Substances 0.000 description 2
- 230000035755 proliferation Effects 0.000 description 2
- 235000019833 protease Nutrition 0.000 description 2
- 235000018102 proteins Nutrition 0.000 description 2
- 102000004169 proteins and genes Human genes 0.000 description 2
- 239000003001 serine protease inhibitor Substances 0.000 description 2
- 239000007787 solid Substances 0.000 description 2
- 239000008107 starch Substances 0.000 description 2
- 235000019698 starch Nutrition 0.000 description 2
- 239000000829 suppository Substances 0.000 description 2
- 239000000375 suspending agent Substances 0.000 description 2
- 239000003765 sweetening agent Substances 0.000 description 2
- 238000003786 synthesis reaction Methods 0.000 description 2
- 230000002194 synthesizing effect Effects 0.000 description 2
- 239000006188 syrup Substances 0.000 description 2
- 235000020357 syrup Nutrition 0.000 description 2
- 239000000454 talc Substances 0.000 description 2
- 229910052623 talc Inorganic materials 0.000 description 2
- 235000012222 talc Nutrition 0.000 description 2
- 229940124597 therapeutic agent Drugs 0.000 description 2
- 230000001225 therapeutic effect Effects 0.000 description 2
- 230000005951 type IV hypersensitivity Effects 0.000 description 2
- PFWOJTLVNOZSGQ-RIMJLNMDSA-N (1R,2aS,4S,7S,10S,13S,19S,22S,25S,28S,31R,36R,39S,45R,48S,51S,54S,57R,60S,63S,66S,69S,72S,75S,78S,81S,84S,87S,90R,93S,96S,99S)-10,51,87-tris(4-aminobutyl)-31-[[(2S)-2-[[(2S)-2-amino-5-carbamimidamidopentanoyl]amino]-3-hydroxypropanoyl]amino]-75-(aminomethyl)-93-(3-amino-3-oxopropyl)-60,96-dibenzyl-19,28-bis[(2S)-butan-2-yl]-4,54,69-tris(3-carbamimidamidopropyl)-25-(carboxymethyl)-2a,22,39,48-tetrakis[(1R)-1-hydroxyethyl]-7,63,81-tris(hydroxymethyl)-72-[(4-hydroxyphenyl)methyl]-84-(1H-imidazol-5-ylmethyl)-99-methyl-66-(2-methylpropyl)-78-(2-methylsulfanylethyl)-1a,3,4a,6,9,12,18,21,24,27,30,38,41,44,47,50,53,56,59,62,65,68,71,74,77,80,83,86,89,92,95,98-dotriacontaoxo-6a,7a,10a,11a,33,34-hexathia-a,2,3a,5,8,11,17,20,23,26,29,37,40,43,46,49,52,55,58,61,64,67,70,73,76,79,82,85,88,91,94,97-dotriacontazatetracyclo[55.47.4.445,90.013,17]dodecahectane-36-carboxylic acid Chemical compound CC[C@H](C)[C@@H]1NC(=O)[C@H](CSSC[C@H](NC(=O)[C@@H](NC(=O)CNC(=O)[C@@H]2CSSC[C@@H]3NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](Cc4ccccc4)NC(=O)[C@H](C)NC(=O)[C@@H](NC(=O)[C@H](CSSC[C@H](NC(=O)[C@H](Cc4ccccc4)NC(=O)[C@H](CO)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](Cc4ccc(O)cc4)NC(=O)[C@H](CN)NC(=O)[C@H](CCSC)NC(=O)[C@H](CO)NC(=O)[C@H](Cc4cnc[nH]4)NC(=O)[C@H](CCCCN)NC3=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H]([C@@H](C)O)C(=O)N2)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CO)NC(=O)[C@H](CCCCN)NC(=O)[C@@H]2CCCN2C(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@H](CC(O)=O)NC1=O)[C@@H](C)O)[C@@H](C)CC)[C@@H](C)O)[C@@H](C)O)C(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CCCNC(N)=N PFWOJTLVNOZSGQ-RIMJLNMDSA-N 0.000 description 1
- OVJBOPBBHWOWJI-FYNXUGHNSA-N (2S)-2-[[(2S)-1-[(2S)-2-[[(aS,1R,3aS,4S,10S,16S,19R,22S,25S,28S,34S,37S,40R,45R,48S,51S,57S,60S,63S,69S,72S,75S,78S,85R,88S,91R,94S)-40-[[(2S)-6-amino-2-[[(2S)-2-[[(2S)-4-amino-2-[[(2S,3S)-2-[[(2S,3S)-2-[[(2S,3R)-2-amino-3-hydroxybutanoyl]amino]-3-methylpentanoyl]amino]-3-methylpentanoyl]amino]-4-oxobutanoyl]amino]-3-methylbutanoyl]amino]hexanoyl]amino]-25,48,78,88,94-pentakis(4-aminobutyl)-a-(2-amino-2-oxoethyl)-22,63,72-tris(3-amino-3-oxopropyl)-69-benzyl-37-[(1R)-1-hydroxyethyl]-34,60-bis(hydroxymethyl)-51,57,75-trimethyl-16-(2-methylpropyl)-3a-(2-methylsulfanylethyl)-2a,3,5a,9,15,18,21,24,27,33,36,39,47,50,53,56,59,62,65,68,71,74,77,80,87,90,93,96,99-nonacosaoxo-7a,8a,42,43,82,83-hexathia-1a,2,4a,8,14,17,20,23,26,32,35,38,46,49,52,55,58,61,64,67,70,73,76,79,86,89,92,95,98-nonacosazahexacyclo[43.35.25.419,91.04,8.010,14.028,32]nonahectane-85-carbonyl]amino]-3-(4-hydroxyphenyl)propanoyl]pyrrolidine-2-carbonyl]amino]-3-(1H-imidazol-5-yl)propanoic acid Chemical compound CC[C@H](C)[C@H](NC(=O)[C@@H](N)[C@@H](C)O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@H]1CSSC[C@@H]2NC(=O)[C@H](CCCCN)NC(=O)[C@H](C)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CCC(N)=O)NC(=O)CNC(=O)[C@H](Cc3ccccc3)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](C)NC(=O)[C@H](CCCCN)NC(=O)[C@@H]3CSSC[C@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](CSSC[C@H](NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@@H]4CCCN4C(=O)[C@H](CO)NC(=O)[C@@H](NC1=O)[C@@H](C)O)C(=O)N[C@@H](CC(C)C)C(=O)N1CCC[C@H]1C(=O)N1CCC[C@H]1C(=O)N3)NC(=O)[C@H](CCCCN)NC(=O)CNC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCSC)NC2=O)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N1CCC[C@H]1C(=O)N[C@@H](Cc1cnc[nH]1)C(O)=O OVJBOPBBHWOWJI-FYNXUGHNSA-N 0.000 description 1
- LNAZSHAWQACDHT-XIYTZBAFSA-N (2r,3r,4s,5r,6s)-4,5-dimethoxy-2-(methoxymethyl)-3-[(2s,3r,4s,5r,6r)-3,4,5-trimethoxy-6-(methoxymethyl)oxan-2-yl]oxy-6-[(2r,3r,4s,5r,6r)-4,5,6-trimethoxy-2-(methoxymethyl)oxan-3-yl]oxyoxane Chemical compound CO[C@@H]1[C@@H](OC)[C@H](OC)[C@@H](COC)O[C@H]1O[C@H]1[C@H](OC)[C@@H](OC)[C@H](O[C@H]2[C@@H]([C@@H](OC)[C@H](OC)O[C@@H]2COC)OC)O[C@@H]1COC LNAZSHAWQACDHT-XIYTZBAFSA-N 0.000 description 1
- 102100022464 5'-nucleotidase Human genes 0.000 description 1
- FHVDTGUDJYJELY-UHFFFAOYSA-N 6-{[2-carboxy-4,5-dihydroxy-6-(phosphanyloxy)oxan-3-yl]oxy}-4,5-dihydroxy-3-phosphanyloxane-2-carboxylic acid Chemical compound O1C(C(O)=O)C(P)C(O)C(O)C1OC1C(C(O)=O)OC(OP)C(O)C1O FHVDTGUDJYJELY-UHFFFAOYSA-N 0.000 description 1
- ORILYTVJVMAKLC-UHFFFAOYSA-N Adamantane Natural products C1C(C2)CC3CC1CC2C3 ORILYTVJVMAKLC-UHFFFAOYSA-N 0.000 description 1
- PCIFXPRIFWKWLK-YUMQZZPRSA-N Ala-Gly-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)CNC(=O)[C@H](C)N PCIFXPRIFWKWLK-YUMQZZPRSA-N 0.000 description 1
- JSHVMZANPXCDTL-GMOBBJLQSA-N Arg-Asp-Ile Chemical compound [H]N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H]([C@@H](C)CC)C(O)=O JSHVMZANPXCDTL-GMOBBJLQSA-N 0.000 description 1
- QAODJPUKWNNNRP-DCAQKATOSA-N Arg-Glu-Arg Chemical compound NC(N)=NCCC[C@H](N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCN=C(N)N)C(O)=O QAODJPUKWNNNRP-DCAQKATOSA-N 0.000 description 1
- NMRHDSAOIURTNT-RWMBFGLXSA-N Arg-Leu-Pro Chemical compound CC(C)C[C@@H](C(=O)N1CCC[C@@H]1C(=O)O)NC(=O)[C@H](CCCN=C(N)N)N NMRHDSAOIURTNT-RWMBFGLXSA-N 0.000 description 1
- FAEFJTCTNZTPHX-ACZMJKKPSA-N Asn-Gln-Ala Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](C)C(O)=O FAEFJTCTNZTPHX-ACZMJKKPSA-N 0.000 description 1
- AWXDRZJQCVHCIT-DCAQKATOSA-N Asn-Pro-Lys Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)[C@@H]1CCCN1C(=O)[C@@H](N)CC(N)=O AWXDRZJQCVHCIT-DCAQKATOSA-N 0.000 description 1
- KYQJHBWHRASMKG-ZLUOBGJFSA-N Asn-Ser-Cys Chemical compound NC(=O)C[C@H](N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CS)C(O)=O KYQJHBWHRASMKG-ZLUOBGJFSA-N 0.000 description 1
- FIRWLDUOFOULCA-XIRDDKMYSA-N Asp-Trp-Lys Chemical compound C1=CC=C2C(=C1)C(=CN2)C[C@@H](C(=O)N[C@@H](CCCCN)C(=O)O)NC(=O)[C@H](CC(=O)O)N FIRWLDUOFOULCA-XIRDDKMYSA-N 0.000 description 1
- 102000034498 Astacin Human genes 0.000 description 1
- 108090000658 Astacin Proteins 0.000 description 1
- 240000005220 Bischofia javanica Species 0.000 description 1
- 235000010893 Bischofia javanica Nutrition 0.000 description 1
- 206010065687 Bone loss Diseases 0.000 description 1
- 241000283690 Bos taurus Species 0.000 description 1
- 102100035875 C-C chemokine receptor type 5 Human genes 0.000 description 1
- 101710149870 C-C chemokine receptor type 5 Proteins 0.000 description 1
- 101000724917 Calliophis bivirgatus Delta-elapitoxin-Cb1a Proteins 0.000 description 1
- 241000282472 Canis lupus familiaris Species 0.000 description 1
- 102000013392 Carboxylesterase Human genes 0.000 description 1
- 108010051152 Carboxylesterase Proteins 0.000 description 1
- 101000997261 Centruroides margaritatus Potassium channel toxin alpha-KTx 2.2 Proteins 0.000 description 1
- 241000239282 Centruroides suffusus Species 0.000 description 1
- 241000282693 Cercopithecidae Species 0.000 description 1
- 102000008186 Collagen Human genes 0.000 description 1
- 108010035532 Collagen Proteins 0.000 description 1
- VKDXHXWBOARFPD-IHWRNOMOSA-N Correolide Chemical compound C([C@H]12)=CC(=O)OC[C@]1(C(C)OC(C)=O)[C@@H](OC(C)=O)[C@@H](OC(C)=O)[C@H]1[C@@]2(C)CC[C@H]2[C@]3(O)CC(=C)[C@H]4O[C@@]4(C(=O)OC)[C@]3(C)[C@@H](OC(C)=O)[C@@H](OC(C)=O)[C@@]21C VKDXHXWBOARFPD-IHWRNOMOSA-N 0.000 description 1
- NLCZGISONIGRQP-DCAQKATOSA-N Cys-Arg-Lys Chemical compound C(CCN)C[C@@H](C(=O)O)NC(=O)[C@H](CCCN=C(N)N)NC(=O)[C@H](CS)N NLCZGISONIGRQP-DCAQKATOSA-N 0.000 description 1
- DCXGXDGGXVZVMY-GHCJXIJMSA-N Cys-Asn-Ile Chemical compound CC[C@H](C)[C@@H](C(O)=O)NC(=O)[C@H](CC(N)=O)NC(=O)[C@@H](N)CS DCXGXDGGXVZVMY-GHCJXIJMSA-N 0.000 description 1
- YMBAVNPKBWHDAW-CIUDSAMLSA-N Cys-Asp-Lys Chemical compound C(CCN)C[C@@H](C(=O)O)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CS)N YMBAVNPKBWHDAW-CIUDSAMLSA-N 0.000 description 1
- DVIHGGUODLILFN-GHCJXIJMSA-N Cys-Ile-Asp Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CC(=O)O)C(=O)O)NC(=O)[C@H](CS)N DVIHGGUODLILFN-GHCJXIJMSA-N 0.000 description 1
- LHMSYHSAAJOEBL-CIUDSAMLSA-N Cys-Lys-Asn Chemical compound [H]N[C@@H](CS)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(O)=O LHMSYHSAAJOEBL-CIUDSAMLSA-N 0.000 description 1
- VXLXATVURDNDCG-CIUDSAMLSA-N Cys-Lys-Asp Chemical compound C(CCN)C[C@@H](C(=O)N[C@@H](CC(=O)O)C(=O)O)NC(=O)[C@H](CS)N VXLXATVURDNDCG-CIUDSAMLSA-N 0.000 description 1
- CIVXDCMSSFGWAL-YUMQZZPRSA-N Cys-Lys-Gly Chemical compound C(CCN)C[C@@H](C(=O)NCC(=O)O)NC(=O)[C@H](CS)N CIVXDCMSSFGWAL-YUMQZZPRSA-N 0.000 description 1
- KGIHMGPYGXBYJJ-SRVKXCTJSA-N Cys-Lys-Lys Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](N)CS KGIHMGPYGXBYJJ-SRVKXCTJSA-N 0.000 description 1
- LWYKPOCGGTYAIH-FXQIFTODSA-N Cys-Met-Asp Chemical compound CSCC[C@@H](C(=O)N[C@@H](CC(=O)O)C(=O)O)NC(=O)[C@H](CS)N LWYKPOCGGTYAIH-FXQIFTODSA-N 0.000 description 1
- HMWBPUDETPKSSS-DCAQKATOSA-N Cys-Pro-Lys Chemical compound C1C[C@H](N(C1)C(=O)[C@H](CS)N)C(=O)N[C@@H](CCCCN)C(=O)O HMWBPUDETPKSSS-DCAQKATOSA-N 0.000 description 1
- NRVQLLDIJJEIIZ-VZFHVOOUSA-N Cys-Thr-Ala Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](C)C(=O)O)NC(=O)[C@H](CS)N)O NRVQLLDIJJEIIZ-VZFHVOOUSA-N 0.000 description 1
- 102000002123 Cystatin domains Human genes 0.000 description 1
- 108050009472 Cystatin domains Proteins 0.000 description 1
- 101710169171 Cysteine-rich secretory protein Proteins 0.000 description 1
- 101710195240 Cysteine-rich venom protein Proteins 0.000 description 1
- FBPFZTCFMRRESA-FSIIMWSLSA-N D-Glucitol Natural products OC[C@H](O)[C@H](O)[C@@H](O)[C@H](O)CO FBPFZTCFMRRESA-FSIIMWSLSA-N 0.000 description 1
- FBPFZTCFMRRESA-KVTDHHQDSA-N D-Mannitol Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-KVTDHHQDSA-N 0.000 description 1
- FBPFZTCFMRRESA-JGWLITMVSA-N D-glucitol Chemical compound OC[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-JGWLITMVSA-N 0.000 description 1
- 102000006665 DNA/RNA non-specific endonuclease Human genes 0.000 description 1
- 108020004781 DNA/RNA non-specific endonuclease Proteins 0.000 description 1
- 101001123109 Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) Phosphatase/phosphodiesterase DR_1281 Proteins 0.000 description 1
- FMKGDHLSXFDSOU-BDPUVYQTSA-N Dienon-Astacin Natural products CC(=C/C=C/C=C(C)/C=C/C=C(C)/C=C/C1=C(C)C(=O)C(=CC1(C)C)O)C=CC=C(/C)C=CC2=C(C)C(=O)C(=CC2(C)C)O FMKGDHLSXFDSOU-BDPUVYQTSA-N 0.000 description 1
- 108010067722 Dipeptidyl Peptidase 4 Proteins 0.000 description 1
- 101800001224 Disintegrin Proteins 0.000 description 1
- 102000012545 EGF-like domains Human genes 0.000 description 1
- 108050002150 EGF-like domains Proteins 0.000 description 1
- LVGKNOAMLMIIKO-UHFFFAOYSA-N Elaidinsaeure-aethylester Natural products CCCCCCCCC=CCCCCCCCC(=O)OCC LVGKNOAMLMIIKO-UHFFFAOYSA-N 0.000 description 1
- 241000283086 Equidae Species 0.000 description 1
- 239000004386 Erythritol Substances 0.000 description 1
- UNXHWFMMPAWVPI-UHFFFAOYSA-N Erythritol Natural products OCC(O)C(O)CO UNXHWFMMPAWVPI-UHFFFAOYSA-N 0.000 description 1
- 108010074860 Factor Xa Proteins 0.000 description 1
- 241000282326 Felis catus Species 0.000 description 1
- 102000008946 Fibrinogen Human genes 0.000 description 1
- 108010049003 Fibrinogen Proteins 0.000 description 1
- 241000287828 Gallus gallus Species 0.000 description 1
- 101000930822 Giardia intestinalis Dipeptidyl-peptidase 4 Proteins 0.000 description 1
- ZFADFBPRMSBPOT-KKUMJFAQSA-N Gln-Arg-Phe Chemical compound N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCN=C(N)N)C(=O)N[C@@H](Cc1ccccc1)C(O)=O ZFADFBPRMSBPOT-KKUMJFAQSA-N 0.000 description 1
- LURQDGKYBFWWJA-MNXVOIDGSA-N Gln-Lys-Ile Chemical compound CC[C@H](C)[C@@H](C(=O)O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCC(=O)N)N LURQDGKYBFWWJA-MNXVOIDGSA-N 0.000 description 1
- QOXDAWODGSIDDI-GUBZILKMSA-N Glu-Ser-Lys Chemical compound C(CCN)C[C@@H](C(=O)O)NC(=O)[C@H](CO)NC(=O)[C@H](CCC(=O)O)N QOXDAWODGSIDDI-GUBZILKMSA-N 0.000 description 1
- BBTCXWTXOXUNFX-IUCAKERBSA-N Gly-Met-Arg Chemical compound CSCC[C@H](NC(=O)CN)C(=O)N[C@@H](CCCN=C(N)N)C(O)=O BBTCXWTXOXUNFX-IUCAKERBSA-N 0.000 description 1
- QVDGHDFFYHKJPN-QWRGUYRKSA-N Gly-Phe-Cys Chemical compound NCC(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](CS)C(O)=O QVDGHDFFYHKJPN-QWRGUYRKSA-N 0.000 description 1
- 229920000084 Gum arabic Polymers 0.000 description 1
- JBCLFWXMTIKCCB-UHFFFAOYSA-N H-Gly-Phe-OH Natural products NCC(=O)NC(C(O)=O)CC1=CC=CC=C1 JBCLFWXMTIKCCB-UHFFFAOYSA-N 0.000 description 1
- CNHSMSFYVARZLI-YJRXYDGGSA-N His-His-Thr Chemical compound [H]N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H]([C@@H](C)O)C(O)=O CNHSMSFYVARZLI-YJRXYDGGSA-N 0.000 description 1
- WPUAVVXYEJAWIV-KKUMJFAQSA-N His-Phe-Cys Chemical compound C1=CC=C(C=C1)C[C@@H](C(=O)N[C@@H](CS)C(=O)O)NC(=O)[C@H](CC2=CN=CN2)N WPUAVVXYEJAWIV-KKUMJFAQSA-N 0.000 description 1
- BFOGZWSSGMLYKV-DCAQKATOSA-N His-Ser-Met Chemical compound CSCC[C@@H](C(=O)O)NC(=O)[C@H](CO)NC(=O)[C@H](CC1=CN=CN1)N BFOGZWSSGMLYKV-DCAQKATOSA-N 0.000 description 1
- 241000282412 Homo Species 0.000 description 1
- 101000619708 Homo sapiens Peroxiredoxin-6 Proteins 0.000 description 1
- 101001095266 Homo sapiens Prolyl endopeptidase Proteins 0.000 description 1
- 108010003272 Hyaluronate lyase Proteins 0.000 description 1
- 102000001974 Hyaluronidases Human genes 0.000 description 1
- 241000243328 Hydridae Species 0.000 description 1
- DURWCDDDAWVPOP-JBDRJPRFSA-N Ile-Cys-Ser Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CS)C(=O)N[C@@H](CO)C(=O)O)N DURWCDDDAWVPOP-JBDRJPRFSA-N 0.000 description 1
- 102100023915 Insulin Human genes 0.000 description 1
- 108090001061 Insulin Proteins 0.000 description 1
- 102100037850 Interferon gamma Human genes 0.000 description 1
- 102000008070 Interferon-gamma Human genes 0.000 description 1
- FADYJNXDPBKVCA-UHFFFAOYSA-N L-Phenylalanyl-L-lysin Natural products NCCCCC(C(O)=O)NC(=O)C(N)CC1=CC=CC=C1 FADYJNXDPBKVCA-UHFFFAOYSA-N 0.000 description 1
- 108090001090 Lectins Proteins 0.000 description 1
- 102000004856 Lectins Human genes 0.000 description 1
- XXXXOVFBXRERQL-ULQDDVLXSA-N Leu-Pro-Phe Chemical compound CC(C)C[C@H](N)C(=O)N1CCC[C@H]1C(=O)N[C@H](C(O)=O)CC1=CC=CC=C1 XXXXOVFBXRERQL-ULQDDVLXSA-N 0.000 description 1
- IWMJFLJQHIDZQW-KKUMJFAQSA-N Leu-Ser-Phe Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](CO)C(=O)N[C@H](C(O)=O)CC1=CC=CC=C1 IWMJFLJQHIDZQW-KKUMJFAQSA-N 0.000 description 1
- 102000004882 Lipase Human genes 0.000 description 1
- 108090001060 Lipase Proteins 0.000 description 1
- 239000004367 Lipase Substances 0.000 description 1
- GUYHHBZCBQZLFW-GUBZILKMSA-N Lys-Gln-Cys Chemical compound C(CCN)C[C@@H](C(=O)N[C@@H](CCC(=O)N)C(=O)N[C@@H](CS)C(=O)O)N GUYHHBZCBQZLFW-GUBZILKMSA-N 0.000 description 1
- GCMWRRQAKQXDED-IUCAKERBSA-N Lys-Glu-Gly Chemical compound [NH3+]CCCC[C@H]([NH3+])C(=O)N[C@@H](CCC([O-])=O)C(=O)NCC([O-])=O GCMWRRQAKQXDED-IUCAKERBSA-N 0.000 description 1
- PINHPJWGVBKQII-SRVKXCTJSA-N Lys-Leu-Cys Chemical compound CC(C)C[C@@H](C(=O)N[C@@H](CS)C(=O)O)NC(=O)[C@H](CCCCN)N PINHPJWGVBKQII-SRVKXCTJSA-N 0.000 description 1
- UQRZFMQQXXJTTF-AVGNSLFASA-N Lys-Lys-Glu Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(O)=O)C(O)=O UQRZFMQQXXJTTF-AVGNSLFASA-N 0.000 description 1
- WQDKIVRHTQYJSN-DCAQKATOSA-N Lys-Ser-Arg Chemical compound C(CCN)C[C@@H](C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCN=C(N)N)C(=O)O)N WQDKIVRHTQYJSN-DCAQKATOSA-N 0.000 description 1
- MGKFCQFVPKOWOL-CIUDSAMLSA-N Lys-Ser-Asp Chemical compound C(CCN)C[C@@H](C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(=O)O)C(=O)O)N MGKFCQFVPKOWOL-CIUDSAMLSA-N 0.000 description 1
- TVOOGUNBIWAURO-KATARQTJSA-N Lys-Thr-Cys Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CS)C(=O)O)NC(=O)[C@H](CCCCN)N)O TVOOGUNBIWAURO-KATARQTJSA-N 0.000 description 1
- ZVZRQKJOQQAFCF-ULQDDVLXSA-N Lys-Tyr-Arg Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O ZVZRQKJOQQAFCF-ULQDDVLXSA-N 0.000 description 1
- 108020002496 Lysophospholipase Proteins 0.000 description 1
- 229930195725 Mannitol Natural products 0.000 description 1
- 108010052285 Membrane Proteins Proteins 0.000 description 1
- 102000018697 Membrane Proteins Human genes 0.000 description 1
- 101000822346 Mesobuthus martensii Alpha-like toxin BmK M1 Proteins 0.000 description 1
- 229920000168 Microcrystalline cellulose Polymers 0.000 description 1
- 102000043368 Multicopper oxidase Human genes 0.000 description 1
- YBAFDPFAUTYYRW-UHFFFAOYSA-N N-L-alpha-glutamyl-L-leucine Natural products CC(C)CC(C(O)=O)NC(=O)C(N)CCC(O)=O YBAFDPFAUTYYRW-UHFFFAOYSA-N 0.000 description 1
- XZFYRXDAULDNFX-UHFFFAOYSA-N N-L-cysteinyl-L-phenylalanine Natural products SCC(N)C(=O)NC(C(O)=O)CC1=CC=CC=C1 XZFYRXDAULDNFX-UHFFFAOYSA-N 0.000 description 1
- AFCARXCZXQIEQB-UHFFFAOYSA-N N-[3-oxo-3-(2,4,6,7-tetrahydrotriazolo[4,5-c]pyridin-5-yl)propyl]-2-[[3-(trifluoromethoxy)phenyl]methylamino]pyrimidine-5-carboxamide Chemical compound O=C(CCNC(=O)C=1C=NC(=NC=1)NCC1=CC(=CC=C1)OC(F)(F)F)N1CC2=C(CC1)NN=N2 AFCARXCZXQIEQB-UHFFFAOYSA-N 0.000 description 1
- AJHCSUXXECOXOY-UHFFFAOYSA-N N-glycyl-L-tryptophan Natural products C1=CC=C2C(CC(NC(=O)CN)C(O)=O)=CNC2=C1 AJHCSUXXECOXOY-UHFFFAOYSA-N 0.000 description 1
- 101100022915 Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) cys-11 gene Proteins 0.000 description 1
- 241000283973 Oryctolagus cuniculus Species 0.000 description 1
- 108010058846 Ovalbumin Proteins 0.000 description 1
- 102000004316 Oxidoreductases Human genes 0.000 description 1
- 108090000854 Oxidoreductases Proteins 0.000 description 1
- 238000012408 PCR amplification Methods 0.000 description 1
- 208000002193 Pain Diseases 0.000 description 1
- 241001494479 Pecora Species 0.000 description 1
- 102100022239 Peroxiredoxin-6 Human genes 0.000 description 1
- VUYCNYVLKACHPA-KKUMJFAQSA-N Phe-Asp-His Chemical compound C1=CC=C(C=C1)C[C@@H](C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CC2=CN=CN2)C(=O)O)N VUYCNYVLKACHPA-KKUMJFAQSA-N 0.000 description 1
- ZFVWWUILVLLVFA-AVGNSLFASA-N Phe-Gln-Cys Chemical compound C1=CC=C(C=C1)C[C@@H](C(=O)N[C@@H](CCC(=O)N)C(=O)N[C@@H](CS)C(=O)O)N ZFVWWUILVLLVFA-AVGNSLFASA-N 0.000 description 1
- FXYXBEZMRACDDR-KKUMJFAQSA-N Phe-His-Asp Chemical compound [H]N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC(O)=O)C(O)=O FXYXBEZMRACDDR-KKUMJFAQSA-N 0.000 description 1
- 239000002202 Polyethylene glycol Substances 0.000 description 1
- 208000037062 Polyps Diseases 0.000 description 1
- ZLMJMSJWJFRBEC-UHFFFAOYSA-N Potassium Chemical compound [K] ZLMJMSJWJFRBEC-UHFFFAOYSA-N 0.000 description 1
- MRYUJHGPZQNOAD-IHRRRGAJSA-N Pro-Leu-Lys Chemical compound CC(C)C[C@@H](C(=O)N[C@@H](CCCCN)C(=O)O)NC(=O)[C@@H]1CCCN1 MRYUJHGPZQNOAD-IHRRRGAJSA-N 0.000 description 1
- KHRLUIPIMIQFGT-AVGNSLFASA-N Pro-Val-Leu Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(C)C)C(O)=O KHRLUIPIMIQFGT-AVGNSLFASA-N 0.000 description 1
- 206010036790 Productive cough Diseases 0.000 description 1
- 102000056251 Prolyl Oligopeptidases Human genes 0.000 description 1
- 102220543961 RBPJ-interacting and tubulin-associated protein 1_M12A_mutation Human genes 0.000 description 1
- AUNGANRZJHBGPY-SCRDCRAPSA-N Riboflavin Chemical compound OC[C@@H](O)[C@@H](O)[C@@H](O)CN1C=2C=C(C)C(C)=CC=2N=C2C1=NC(=O)NC2=O AUNGANRZJHBGPY-SCRDCRAPSA-N 0.000 description 1
- MIJWOJAXARLEHA-WDSKDSINSA-N Ser-Gly-Glu Chemical compound OC[C@H](N)C(=O)NCC(=O)N[C@H](C(O)=O)CCC(O)=O MIJWOJAXARLEHA-WDSKDSINSA-N 0.000 description 1
- LLSLRQOEAFCZLW-NRPADANISA-N Ser-Val-Gln Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(N)=O)C(O)=O LLSLRQOEAFCZLW-NRPADANISA-N 0.000 description 1
- 241000242730 Stichodactyla helianthus Species 0.000 description 1
- 241000282887 Suidae Species 0.000 description 1
- 101150006914 TRP1 gene Proteins 0.000 description 1
- 244000299461 Theobroma cacao Species 0.000 description 1
- 235000005764 Theobroma cacao ssp. cacao Nutrition 0.000 description 1
- 235000005767 Theobroma cacao ssp. sphaerocarpum Nutrition 0.000 description 1
- YJCVECXVYHZOBK-KNZXXDILSA-N Thr-Ile-Pro Chemical compound CC[C@H](C)[C@@H](C(=O)N1CCC[C@@H]1C(=O)O)NC(=O)[C@H]([C@@H](C)O)N YJCVECXVYHZOBK-KNZXXDILSA-N 0.000 description 1
- 102100029887 Translationally-controlled tumor protein Human genes 0.000 description 1
- 101710157927 Translationally-controlled tumor protein Proteins 0.000 description 1
- LVTKHGUGBGNBPL-UHFFFAOYSA-N Trp-P-1 Chemical compound N1C2=CC=CC=C2C2=C1C(C)=C(N)N=C2C LVTKHGUGBGNBPL-UHFFFAOYSA-N 0.000 description 1
- 108090000631 Trypsin Proteins 0.000 description 1
- 102000004142 Trypsin Human genes 0.000 description 1
- 229940122618 Trypsin inhibitor Drugs 0.000 description 1
- 101710162629 Trypsin inhibitor Proteins 0.000 description 1
- FFCRCJZJARTYCG-KKUMJFAQSA-N Tyr-Cys-Lys Chemical compound C1=CC(=CC=C1C[C@@H](C(=O)N[C@@H](CS)C(=O)N[C@@H](CCCCN)C(=O)O)N)O FFCRCJZJARTYCG-KKUMJFAQSA-N 0.000 description 1
- CTDPLKMBVALCGN-JSGCOSHPSA-N Tyr-Gly-Val Chemical compound [H]N[C@@H](CC1=CC=C(O)C=C1)C(=O)NCC(=O)N[C@@H](C(C)C)C(O)=O CTDPLKMBVALCGN-JSGCOSHPSA-N 0.000 description 1
- 241000567851 Vaejovis smithi Species 0.000 description 1
- ISERLACIZUGCDX-ZKWXMUAHSA-N Val-Asp-Ala Chemical compound C[C@@H](C(=O)O)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](C(C)C)N ISERLACIZUGCDX-ZKWXMUAHSA-N 0.000 description 1
- 102000005789 Vascular Endothelial Growth Factors Human genes 0.000 description 1
- 108010019530 Vascular Endothelial Growth Factors Proteins 0.000 description 1
- 101710099833 Venom protein Proteins 0.000 description 1
- 101710087237 Whey acidic protein Proteins 0.000 description 1
- TVXBFESIOXBWNM-UHFFFAOYSA-N Xylitol Natural products OCCC(O)C(O)C(O)CCO TVXBFESIOXBWNM-UHFFFAOYSA-N 0.000 description 1
- 101710204001 Zinc metalloprotease Proteins 0.000 description 1
- 101000779569 Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) Alkaline phosphatase PhoD Proteins 0.000 description 1
- 239000000205 acacia gum Substances 0.000 description 1
- 235000010489 acacia gum Nutrition 0.000 description 1
- 230000009471 action Effects 0.000 description 1
- 210000001642 activated microglia Anatomy 0.000 description 1
- KOXLLJFKLFSCAF-UHFFFAOYSA-N adwx 1 Chemical compound N1C(=O)C(CCCNC(N)=N)NC(=O)C(CCSC)NC(=O)CNC(=O)C(C)NC(=O)C(CC(O)=O)NC(=O)C(CCCCN)NC(=O)C(NC(=O)C2CCCN2C(=O)C(CCCCN)NC(=O)C(CC(C)C)NC2=O)CSSCC(C(=O)NC(C(C)O)C(=O)N3C(CCC3)C(=O)NC(CCCCN)C(O)=O)NC(=O)C(CC=3N=CNC=3)NC(=O)C(NC(=O)C(CCCCN)NC(=O)CNC(=O)C(CC(N)=O)NC(=O)C(NC3=O)C(C)O)CSSCC2NC(=O)C(CCC(N)=O)NC(=O)C(CCCNC(N)=N)NC(=O)C(CO)NC(=O)C(CC=2N=CNC=2)NC(=O)C(CCCCN)NC(=O)C(NC(=O)C(CCCCN)NC(=O)C(C(C)C)NC(=O)C(CC(N)=O)NC(=O)C(NC(=O)CNC(=O)C(N)C(C)C)C(C)CC)CSSCC3NC(=O)C(CCCCN)NC(=O)CNC(=O)C1CC1=CC=CC=C1 KOXLLJFKLFSCAF-UHFFFAOYSA-N 0.000 description 1
- 239000000443 aerosol Substances 0.000 description 1
- 229940072056 alginate Drugs 0.000 description 1
- 235000010443 alginic acid Nutrition 0.000 description 1
- 229920000615 alginic acid Polymers 0.000 description 1
- 239000013566 allergen Substances 0.000 description 1
- 208000002029 allergic contact dermatitis Diseases 0.000 description 1
- 238000004458 analytical method Methods 0.000 description 1
- 239000012736 aqueous medium Substances 0.000 description 1
- 239000007864 aqueous solution Substances 0.000 description 1
- 108010001271 arginyl-glutamyl-arginine Proteins 0.000 description 1
- 206010003246 arthritis Diseases 0.000 description 1
- 235000003676 astacin Nutrition 0.000 description 1
- 201000004995 autoimmune glomerulonephritis Diseases 0.000 description 1
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 1
- 239000011230 binding agent Substances 0.000 description 1
- 210000004369 blood Anatomy 0.000 description 1
- 239000008280 blood Substances 0.000 description 1
- 235000014121 butter Nutrition 0.000 description 1
- 235000001046 cacaotero Nutrition 0.000 description 1
- 239000011575 calcium Substances 0.000 description 1
- 229910000019 calcium carbonate Inorganic materials 0.000 description 1
- 239000001506 calcium phosphate Substances 0.000 description 1
- 229910000389 calcium phosphate Inorganic materials 0.000 description 1
- 229960001714 calcium phosphate Drugs 0.000 description 1
- 235000011010 calcium phosphates Nutrition 0.000 description 1
- 239000000378 calcium silicate Substances 0.000 description 1
- 229910052918 calcium silicate Inorganic materials 0.000 description 1
- 229960003340 calcium silicate Drugs 0.000 description 1
- 235000012241 calcium silicate Nutrition 0.000 description 1
- OYACROKNLOSFPA-UHFFFAOYSA-N calcium;dioxido(oxo)silane Chemical compound [Ca+2].[O-][Si]([O-])=O OYACROKNLOSFPA-UHFFFAOYSA-N 0.000 description 1
- 239000000969 carrier Substances 0.000 description 1
- 210000000170 cell membrane Anatomy 0.000 description 1
- 230000004663 cell proliferation Effects 0.000 description 1
- 239000001913 cellulose Substances 0.000 description 1
- 235000010980 cellulose Nutrition 0.000 description 1
- 229920002678 cellulose Polymers 0.000 description 1
- 239000002738 chelating agent Substances 0.000 description 1
- 238000006243 chemical reaction Methods 0.000 description 1
- 235000013330 chicken meat Nutrition 0.000 description 1
- 238000004587 chromatography analysis Methods 0.000 description 1
- 208000037976 chronic inflammation Diseases 0.000 description 1
- 230000006020 chronic inflammation Effects 0.000 description 1
- WDQPAMHFFCXSNU-BGABXYSRSA-N clofazimine Chemical compound C12=CC=CC=C2N=C2C=C(NC=3C=CC(Cl)=CC=3)C(=N/C(C)C)/C=C2N1C1=CC=C(Cl)C=C1 WDQPAMHFFCXSNU-BGABXYSRSA-N 0.000 description 1
- 229960004287 clofazimine Drugs 0.000 description 1
- 238000010367 cloning Methods 0.000 description 1
- 229920001436 collagen Polymers 0.000 description 1
- 230000000295 complement effect Effects 0.000 description 1
- 238000009833 condensation Methods 0.000 description 1
- 230000005494 condensation Effects 0.000 description 1
- VKDXHXWBOARFPD-UHFFFAOYSA-N correolide Natural products C12C=CC(=O)OCC2(C(C)OC(C)=O)C(OC(C)=O)C(OC(C)=O)C2C1(C)CCC1C3(O)CC(=C)C4OC4(C(=O)OC)C3(C)C(OC(C)=O)C(OC(C)=O)C12C VKDXHXWBOARFPD-UHFFFAOYSA-N 0.000 description 1
- 108010016616 cysteinylglycine Proteins 0.000 description 1
- 108010060199 cysteinylproline Proteins 0.000 description 1
- 230000016396 cytokine production Effects 0.000 description 1
- 230000006378 damage Effects 0.000 description 1
- 239000008121 dextrose Substances 0.000 description 1
- 239000007884 disintegrant Substances 0.000 description 1
- 239000002270 dispersing agent Substances 0.000 description 1
- 238000004090 dissolution Methods 0.000 description 1
- 239000002552 dosage form Substances 0.000 description 1
- 239000003995 emulsifying agent Substances 0.000 description 1
- 235000019414 erythritol Nutrition 0.000 description 1
- UNXHWFMMPAWVPI-ZXZARUISSA-N erythritol Chemical compound OC[C@H](O)[C@H](O)CO UNXHWFMMPAWVPI-ZXZARUISSA-N 0.000 description 1
- 229940009714 erythritol Drugs 0.000 description 1
- 150000002148 esters Chemical class 0.000 description 1
- LVGKNOAMLMIIKO-QXMHVHEDSA-N ethyl oleate Chemical compound CCCCCCCC\C=C/CCCCCCCC(=O)OCC LVGKNOAMLMIIKO-QXMHVHEDSA-N 0.000 description 1
- 229940093471 ethyl oleate Drugs 0.000 description 1
- 230000029142 excretion Effects 0.000 description 1
- 230000001747 exhibiting effect Effects 0.000 description 1
- 238000002474 experimental method Methods 0.000 description 1
- 239000013604 expression vector Substances 0.000 description 1
- 239000000284 extract Substances 0.000 description 1
- 229940012952 fibrinogen Drugs 0.000 description 1
- 239000000945 filler Substances 0.000 description 1
- 239000000796 flavoring agent Substances 0.000 description 1
- 235000013305 food Nutrition 0.000 description 1
- 235000013355 food flavoring agent Nutrition 0.000 description 1
- 239000012634 fragment Substances 0.000 description 1
- 239000013505 freshwater Substances 0.000 description 1
- 230000006870 function Effects 0.000 description 1
- 229940014259 gelatin Drugs 0.000 description 1
- 229940050410 gluconate Drugs 0.000 description 1
- 108010089804 glycyl-threonine Proteins 0.000 description 1
- 108010085325 histidylproline Proteins 0.000 description 1
- 229960002773 hyaluronidase Drugs 0.000 description 1
- NPZTUJOABDZTLV-UHFFFAOYSA-N hydroxybenzotriazole Substances O=C1C=CC=C2NNN=C12 NPZTUJOABDZTLV-UHFFFAOYSA-N 0.000 description 1
- 230000028993 immune response Effects 0.000 description 1
- 238000000338 in vitro Methods 0.000 description 1
- 238000001727 in vivo Methods 0.000 description 1
- 230000028709 inflammatory response Effects 0.000 description 1
- 238000002347 injection Methods 0.000 description 1
- 239000007924 injection Substances 0.000 description 1
- 238000003780 insertion Methods 0.000 description 1
- 230000037431 insertion Effects 0.000 description 1
- 229940125396 insulin Drugs 0.000 description 1
- 102000028416 insulin-like growth factor binding Human genes 0.000 description 1
- 108091022911 insulin-like growth factor binding Proteins 0.000 description 1
- 229960003130 interferon gamma Drugs 0.000 description 1
- 238000010255 intramuscular injection Methods 0.000 description 1
- 239000007927 intramuscular injection Substances 0.000 description 1
- 239000007928 intraperitoneal injection Substances 0.000 description 1
- 238000010253 intravenous injection Methods 0.000 description 1
- 108010027338 isoleucylcysteine Proteins 0.000 description 1
- 231100000859 kill neurons Toxicity 0.000 description 1
- 230000002147 killing effect Effects 0.000 description 1
- 238000011813 knockout mouse model Methods 0.000 description 1
- VMPHSYLJUKZBJJ-UHFFFAOYSA-N lauric acid triglyceride Natural products CCCCCCCCCCCC(=O)OCC(OC(=O)CCCCCCCCCCC)COC(=O)CCCCCCCCCCC VMPHSYLJUKZBJJ-UHFFFAOYSA-N 0.000 description 1
- 239000002523 lectin Substances 0.000 description 1
- 235000019421 lipase Nutrition 0.000 description 1
- 239000007788 liquid Substances 0.000 description 1
- 229940057995 liquid paraffin Drugs 0.000 description 1
- 239000007791 liquid phase Substances 0.000 description 1
- 210000005210 lymphoid organ Anatomy 0.000 description 1
- 108010003700 lysyl aspartic acid Proteins 0.000 description 1
- 108010064235 lysylglycine Proteins 0.000 description 1
- 239000000845 maltitol Substances 0.000 description 1
- 235000010449 maltitol Nutrition 0.000 description 1
- VQHSOMBJVWLPSR-WUJBLJFYSA-N maltitol Chemical compound OC[C@H](O)[C@@H](O)[C@@H]([C@H](O)CO)O[C@H]1O[C@H](CO)[C@@H](O)[C@H](O)[C@H]1O VQHSOMBJVWLPSR-WUJBLJFYSA-N 0.000 description 1
- 229940035436 maltitol Drugs 0.000 description 1
- 239000000594 mannitol Substances 0.000 description 1
- 235000010355 mannitol Nutrition 0.000 description 1
- 238000004519 manufacturing process Methods 0.000 description 1
- 239000000463 material Substances 0.000 description 1
- HEBKCHPVOIAQTA-UHFFFAOYSA-N meso ribitol Natural products OCC(O)C(O)C(O)CO HEBKCHPVOIAQTA-UHFFFAOYSA-N 0.000 description 1
- 229920000609 methyl cellulose Polymers 0.000 description 1
- 239000001923 methylcellulose Substances 0.000 description 1
- 235000010981 methylcellulose Nutrition 0.000 description 1
- LXCFILQKKLGQFO-UHFFFAOYSA-N methylparaben Chemical compound COC(=O)C1=CC=C(O)C=C1 LXCFILQKKLGQFO-UHFFFAOYSA-N 0.000 description 1
- 235000019813 microcrystalline cellulose Nutrition 0.000 description 1
- 239000008108 microcrystalline cellulose Substances 0.000 description 1
- 229940016286 microcrystalline cellulose Drugs 0.000 description 1
- 210000000274 microglia Anatomy 0.000 description 1
- 239000002480 mineral oil Substances 0.000 description 1
- 235000010446 mineral oil Nutrition 0.000 description 1
- 238000002156 mixing Methods 0.000 description 1
- 238000010172 mouse model Methods 0.000 description 1
- 108700020788 multicopper oxidase Proteins 0.000 description 1
- 210000000663 muscle cell Anatomy 0.000 description 1
- 229910052757 nitrogen Inorganic materials 0.000 description 1
- 239000003921 oil Substances 0.000 description 1
- 235000019198 oils Nutrition 0.000 description 1
- 235000008390 olive oil Nutrition 0.000 description 1
- 239000004006 olive oil Substances 0.000 description 1
- 210000000056 organ Anatomy 0.000 description 1
- 229940092253 ovalbumin Drugs 0.000 description 1
- 230000001575 pathological effect Effects 0.000 description 1
- 230000007170 pathology Effects 0.000 description 1
- 239000012071 phase Substances 0.000 description 1
- 239000006187 pill Substances 0.000 description 1
- 229920001223 polyethylene glycol Polymers 0.000 description 1
- 229920000136 polysorbate Polymers 0.000 description 1
- 239000001267 polyvinylpyrrolidone Substances 0.000 description 1
- 235000013855 polyvinylpyrrolidone Nutrition 0.000 description 1
- 229920000036 polyvinylpyrrolidone Polymers 0.000 description 1
- 239000011591 potassium Substances 0.000 description 1
- 229910052700 potassium Inorganic materials 0.000 description 1
- 239000002243 precursor Substances 0.000 description 1
- 244000062645 predators Species 0.000 description 1
- 230000002335 preservative effect Effects 0.000 description 1
- 230000003449 preventive effect Effects 0.000 description 1
- QELSKZZBTMNZEB-UHFFFAOYSA-N propylparaben Chemical compound CCCOC(=O)C1=CC=C(O)C=C1 QELSKZZBTMNZEB-UHFFFAOYSA-N 0.000 description 1
- 229960003415 propylparaben Drugs 0.000 description 1
- 108010043671 prostatic acid phosphatase Proteins 0.000 description 1
- 230000001185 psoriatic effect Effects 0.000 description 1
- 230000002285 radioactive effect Effects 0.000 description 1
- 108020003175 receptors Proteins 0.000 description 1
- 102000005962 receptors Human genes 0.000 description 1
- 238000003259 recombinant expression Methods 0.000 description 1
- 230000001105 regulatory effect Effects 0.000 description 1
- 238000011160 research Methods 0.000 description 1
- 230000019254 respiratory burst Effects 0.000 description 1
- 230000036390 resting membrane potential Effects 0.000 description 1
- 238000012552 review Methods 0.000 description 1
- 230000035945 sensitivity Effects 0.000 description 1
- 230000011664 signaling Effects 0.000 description 1
- 206010040882 skin lesion Diseases 0.000 description 1
- 231100000444 skin lesion Toxicity 0.000 description 1
- 239000011780 sodium chloride Substances 0.000 description 1
- 239000000600 sorbitol Substances 0.000 description 1
- 235000010356 sorbitol Nutrition 0.000 description 1
- 210000003802 sputum Anatomy 0.000 description 1
- 208000024794 sputum Diseases 0.000 description 1
- 239000003381 stabilizer Substances 0.000 description 1
- 238000010561 standard procedure Methods 0.000 description 1
- 238000010254 subcutaneous injection Methods 0.000 description 1
- 239000007929 subcutaneous injection Substances 0.000 description 1
- 239000004094 surface-active agent Substances 0.000 description 1
- 230000002459 sustained effect Effects 0.000 description 1
- 210000001179 synovial fluid Anatomy 0.000 description 1
- 210000005222 synovial tissue Anatomy 0.000 description 1
- 210000001519 tissue Anatomy 0.000 description 1
- 230000000451 tissue damage Effects 0.000 description 1
- 231100000827 tissue damage Toxicity 0.000 description 1
- 230000001256 tonic effect Effects 0.000 description 1
- 231100000765 toxin Toxicity 0.000 description 1
- 239000003053 toxin Substances 0.000 description 1
- 108700012359 toxins Proteins 0.000 description 1
- 238000001890 transfection Methods 0.000 description 1
- 230000009466 transformation Effects 0.000 description 1
- 238000002054 transplantation Methods 0.000 description 1
- QORWJWZARLRLPR-UHFFFAOYSA-H tricalcium bis(phosphate) Chemical compound [Ca+2].[Ca+2].[Ca+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O QORWJWZARLRLPR-UHFFFAOYSA-H 0.000 description 1
- 239000012588 trypsin Substances 0.000 description 1
- 239000002753 trypsin inhibitor Substances 0.000 description 1
- 235000015112 vegetable and seed oil Nutrition 0.000 description 1
- 239000008158 vegetable oil Substances 0.000 description 1
- 238000005406 washing Methods 0.000 description 1
- 239000000811 xylitol Substances 0.000 description 1
- 235000010447 xylitol Nutrition 0.000 description 1
- HEBKCHPVOIAQTA-SCDXWVJYSA-N xylitol Chemical compound OC[C@H](O)[C@@H](O)[C@H](O)CO HEBKCHPVOIAQTA-SCDXWVJYSA-N 0.000 description 1
- 229960002675 xylitol Drugs 0.000 description 1
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/43504—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from invertebrates
- C07K14/43595—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from invertebrates from coelenteratae, e.g. medusae
-
- A—HUMAN NECESSITIES
- A23—FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
- A23L—FOODS, FOODSTUFFS, OR NON-ALCOHOLIC BEVERAGES, NOT COVERED BY SUBCLASSES A21D OR A23B-A23J; THEIR PREPARATION OR TREATMENT, e.g. COOKING, MODIFICATION OF NUTRITIVE QUALITIES, PHYSICAL TREATMENT; PRESERVATION OF FOODS OR FOODSTUFFS, IN GENERAL
- A23L33/00—Modifying nutritive qualities of foods; Dietetic products; Preparation or treatment thereof
- A23L33/10—Modifying nutritive qualities of foods; Dietetic products; Preparation or treatment thereof using additives
- A23L33/17—Amino acids, peptides or proteins
- A23L33/18—Peptides; Protein hydrolysates
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/55—Protease inhibitors
- A61K38/57—Protease inhibitors from animals; from humans
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
-
- A—HUMAN NECESSITIES
- A23—FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
- A23V—INDEXING SCHEME RELATING TO FOODS, FOODSTUFFS OR NON-ALCOHOLIC BEVERAGES AND LACTIC OR PROPIONIC ACID BACTERIA USED IN FOODSTUFFS OR FOOD PREPARATION
- A23V2002/00—Food compositions, function of food ingredients or processes for food or foodstuffs
-
- A—HUMAN NECESSITIES
- A23—FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
- A23V—INDEXING SCHEME RELATING TO FOODS, FOODSTUFFS OR NON-ALCOHOLIC BEVERAGES AND LACTIC OR PROPIONIC ACID BACTERIA USED IN FOODSTUFFS OR FOOD PREPARATION
- A23V2200/00—Function of food ingredients
- A23V2200/30—Foods, ingredients or supplements having a functional effect on health
- A23V2200/324—Foods, ingredients or supplements having a functional effect on health having an effect on the immune system
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Engineering & Computer Science (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Medicinal Chemistry (AREA)
- Public Health (AREA)
- Pharmacology & Pharmacy (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Gastroenterology & Hepatology (AREA)
- Animal Behavior & Ethology (AREA)
- Zoology (AREA)
- Immunology (AREA)
- Veterinary Medicine (AREA)
- Molecular Biology (AREA)
- Epidemiology (AREA)
- Mycology (AREA)
- Nutrition Science (AREA)
- Polymers & Plastics (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Food Science & Technology (AREA)
- Tropical Medicine & Parasitology (AREA)
- Toxicology (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Genetics & Genomics (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Peptides Or Proteins (AREA)
Abstract
본 발명은 노무라입깃해파리에서 독액에서 유래한 ShK domain 유사 펩타이드에 관한 것으로, 본 발명의 서열번호 1 내지 서열번호 3 펩타이드는 초기 단계의 T 림프구 활성화에 중요한 역할을 하는 hKv1.3 칼륨이온채널을 억제하여 자가면역질환의 예방 또는 치료에 유용하게 이용될 수 있다.
Description
본 발명은 노무라입깃해파리에서 독액에서 유래한 ShK domain 유사 펩타이드에 관한 것이다.
전압 개폐 칼륨이온채널은 세포막에 존재하면서 막 전압에 따라 열리고 닫히면서 칼륨을 통과시키는 막 단백질이다. 신경세포와 근육세포등 흥분성세포의 막에 주로 존재하면서 활동전압을 소멸시킨다.
인간 T세포에서 Kv1.3 칼륨이온채널은 휴지막 전위와 Ca2+ 신호 전달을 조절하는 데 필수적인 역할을 한다. 자가면역질환 관련 CCR7 반응기(effector) 기억 T 세포가 염증 부위에서 활성화되면 이들 세포에서 Kv1.3 채널의 발현이 세포당 250개 채널에서 약 1,500개 내지 2,000개 채널로 크게 증가한다. 이러한 Kv1.3 채널 단백질의 증가는 림프기관에 있는 중추 기억 T 세포 또는 나이브(naive) T 세포에서는 일어나지 않는다. 이러한 연구 결과는 특정 Kv1.3 억제제로 반응기 기억 T 세포를 선택적으로 억제하면 질병을 완화하기 위해 면역 반응을 효율적으로 억제할 수 있다. 또한 Kv1.3 채널 차단의 치료 효과는 시험관내 분석 및 다발성 경화증, 제1형 당뇨병, 류머티스 성 관절염, 건선, 천식, 루푸스 신염, 급성관상동맥증후군, 지연형 과민증, 치주염 후 뼈 흡수, 접촉 피부염 및 피부 이식과 같은 T세포 매개 자가면역질환의 체내 동물 모델에 의해 검증되었다(Chandy, KG and Norton, RS, 2017. Peptide blockers of Kv1.3 channels in T cells as therapeutics for autoimmune disease. Curr. Opin. Chem. Biol., 38:97-107.).
대표적인 전압개폐 칼륨이온채널 억제하는 펩타이드로는 ShK domain이 있다. ShK domain은 말미잘 Stichodactyla helianthus에서 추출한 35개 잔기의 염기성 펩타이드로 다수의 칼륨 채널을 차단한다.
상기 ShK domain 유사 펩타이드에 대한 연구는 다양한 방면으로 이루어지고 있는데, 대한민국 등록특허 제10-1524517호에서는 멕시코 전갈 Vaejovis mexicanus smithi의 독으로부터 분리된 펩타이드 (Vm23 및 Vm24)가 칼륨이온채널(Kv1.3)을 억제하여 자가면역질환의 치료용도로 사용할 수 있다는 것을 개시하였다. WO 2010/108154에서는 ShK, HmK 및 AETX-K와 관련된 독소 펩타이드 유사체가 칼륨이온채널(Kv1.3)을 억제하여 자가면역질환의 치료용도로 사용할 수 있다는 것을 개시하였고, 대한민국 공개특허 제10-2014-0038501호에서는 ShK domain에 방사성동의원소 및 킬레이터를 부착시켜 기존 ShK domain보다 우수한 칼륨이온채널(Kv1.3) 억제효과를 개시하였다.
본 발명자는 노무라입깃해파리의 유전체 정보를 분석하였으며, 분석한 gene set을 Tox-Prot 데이터베이스 와 비교하여, 52종의 독 관련 domain을 얻었고, 이들중 hKv1.3 칼륨이온채널을 억제하는 펩타이드를 확인함으로써, 본 발명을 완성하였다.
본 발명은 서열번호 1 내지 서열번호 3으로 구성되는 군으로부터 선택되는 아미노산 서열을 포함하는 펩타이드를 제공하는 것으로서 이들 펩타이드는 hKv1.3 칼륨이온채널을 억제하므로 자가면역질환의 개선, 예방 또는 치료에 사용될 수 있다.
본 발명은 서열번호 1 내지 서열번호 3으로 구성된 군으로부터 선택되는 아미노산 서열을 포함하는, 펩타이드를 제공한다.
본 발명은 상기 펩타이드를 유효성분으로 함유하는 Kv1.3 칼륨이온채널 억제용 조성물을 제공한다.
본 발명은 상기 펩타이드를 유효성분으로 함유하는 자가면역질환의 예방 또는 치료용 약학적 조성물을 제공한다.
본 발명은 상기 펩타이드를 유효성분으로 함유하는 자가면역질환의 예방 또는 건강기능식품 조성물을 제공한다.
본 발명의 서열번호 1 내지 서열번호 3 펩타이드는 초기 단계의 T 림프구 활성화에 중요한 역할을 하는 hKv1.3 칼륨이온채널을 억제하여 자가면역질환의 예방 또는 치료에 유용하게 이용될 수 있다.
도 1은 서열번호 1 내지 서열번호 3 펩타이드의 서열을 나타낸 것이다.
도 2는 서열번호 1 내지 서열번호 3 펩타이드의 6개 시스테인에 의해 형성되는 3개의 이황화결합을 나타낸 것이다.
도 3은 hKv1.3 칼륨이온채널에서 Psora4의 전압 클램프(voltage clamp) 결과를 나타낸 그래프이다.
도 4은 hKv1.3 칼륨이온채널에서 g5156.t1-3 펩타이드의 전압 클램프 결과를 나타낸 그래프이다.
도 5은 hKv1.3 칼륨이온채널에서 g7640.t1-1 펩타이드의 전압 클램프 결과를 나타낸 그래프이다.
도 6은 hKv1.3 칼륨이온채널에서 g5156.t1-2 펩타이드의 전압 클램프 결과를 나타낸 그래프이다.
도 7은 hKv1.3 칼륨이온채널에서 CBRV1_05766-1 펩타이드의 전압 클램프 결과를 나타낸 그래프이다.
도 2는 서열번호 1 내지 서열번호 3 펩타이드의 6개 시스테인에 의해 형성되는 3개의 이황화결합을 나타낸 것이다.
도 3은 hKv1.3 칼륨이온채널에서 Psora4의 전압 클램프(voltage clamp) 결과를 나타낸 그래프이다.
도 4은 hKv1.3 칼륨이온채널에서 g5156.t1-3 펩타이드의 전압 클램프 결과를 나타낸 그래프이다.
도 5은 hKv1.3 칼륨이온채널에서 g7640.t1-1 펩타이드의 전압 클램프 결과를 나타낸 그래프이다.
도 6은 hKv1.3 칼륨이온채널에서 g5156.t1-2 펩타이드의 전압 클램프 결과를 나타낸 그래프이다.
도 7은 hKv1.3 칼륨이온채널에서 CBRV1_05766-1 펩타이드의 전압 클램프 결과를 나타낸 그래프이다.
이하, 본 발명을 상세히 설명한다.
본 발명은 서열번호 1 내지 서열번호 3으로 구성된 군으로부터 선택되는 아미노산 서열을 포함하는 펩타이드를 제공한다.
상기 서열번호 1은 Cys-Lys-Asp-His-His-Thr-Tyr-Gly-Val-Tyr-Cys-Lys-Asp-Trp-Lys-Ser-Ser-Gly-Glu-Cys-Lys-Lys-Asn-Pro-Lys-Gly-Met-Arg-His-Phe-Cys-Arg-Lys-Thr-Cys-Gly-Phe-Cys이다.
상기 서열번호 2는 Cys-Met-Asp-Arg-Glu-Arg-Glu-Ser-Lys-Ala-Gly-Leu-Cys-Lys-Gly-Trp-Gln-Lys-Ile-Asn-Ser-Cys-Phe-Asp-His-Pro-Val-Leu-Met-Lys-Thr-Tyr-Cys-Pro-Lys-Thr-Cys-Gly-Phe-Cys이다.
상기 서열번호 3은 Cys-Lys-Asn-Lys-Glu-Gly-Thr-Phe-Cys-Gln-Arg-Phe-Lys-Ser-Asp-Cys-Phe-His-Asp-Arg-Leu-Pro-Ser-Val-Gln-Met-Lys-Thr-Ile-Cys-Ser-Glu-Thr-Cys-Gly-Ile-Cys이다.
상기 서열번호 1 내지 서열번호 3은 표 1 및 도 1에 나타내었다.
| 서열번호 | 펩타이드 명 | 서열 |
| 서열번호 1 | g5156.t1-3 | CKDHHTYGVYCKDWKSSGECKKNPKGMRHFCRKTCGFC |
| 서열번호 2 | g7640.t1-1 | CMDRERESKAGLCKGWQKINSCFDHPVLMKTYCPKTCGFC |
| 서열번호 3 | g5156.t1-2 | CKNKEGTFCQRFKSDCFHDRLPSVQMKTICSETCGIC |
상기 서열번호 1 내지 서열번호 3 펩타이드는 6개의 시스테인을 포함하며, 모두 3개의 이황화결합을 포함한다.상기 이황화결합은 첫번째 Cys와 여섯번째 Cys, 두번째 Cys와 네번째 Cys 및 세번째 Cys와 다섯번째 Cys이 각각 이황화결합한다. 구체적으로 살펴보면, 서열번호 1의 펩타이드는 1번 Cys과 38번 Cys, 11번 Cys과 31번 Cys 및 20번 Cys과 35번 Cys이 각각 이황화결합하고, 서열번호 2의 펩타이드는 1번 Cys과 40번 Cys, 13번 Cys과 33번 Cys 및 22번 Cys과 37번 Cys이 각각 이황화결합하고, 서열번호 3의 펩타이드는 1번 Cys과 37번 Cys, 9번 Cys과 30번 Cys 및 16번 Cys과 34번 Cys이 각각 이황화결합한다(도 2).
상기 펩타이드를 합성하기 위한 방법으로 당업계의 통상적인 펩타이드의 화학적 합성 방법(W H Freeman and Co, Proteins; structures and molecular principles, 1983)으로 합성하는 것이 바람직하며, 구체적으로는 액상 펩타이드 합성법(Solution Phase Peptide synthesis), 고상 펩타이드 합성법(solid-phase peptide syntheses), 단편 응축법 및 F-moc 또는 T-BOC 화학법으로 합성하는 것이 보다 바람직하고, 더욱 구체적으로는 고상 펩타이드 합성법으로 합성하는 것이 가장 바람직하다.
본 발명의 펩타이드는 하기와 같은 유전공학적 방법에 의해 제조될 수 있다. 우선, 통상적인 방법에 따라 상기 펩타이드를 코딩하는 DNA 서열을 작제한다. DNA 서열은 적절한 프라이머를 사용하여 PCR 증폭함으로써 제작할 수 있다.
다른 방법으로 당업계에 공지된 표준 방법에 의해, 예컨대, 자동 DNA 합성기(예를 들면, Biosearch 또는 Applied iosystems사의 제품)를 사용하여 DNA 서열을 합성할 수도 있다. 상기 DNA 서열은 이에 작동가능하게 연결되어 DNA 서열의 발현을 조절하는 하나 또는 그 이상의 발현 조절 서열(예: 프로모터, 인핸서 등)을 포함하는 벡터에 삽입하고, 이로부터 형성된 재조합 발현 벡터로 숙주세포를 형질전환한 다음, 생성된 형질전환체를 상기 DNA 서열이 발현되도록 하기에 적절한 배지 및 조건 하에서 배양하여, 배양물로부터 상기 DNA 서열에 의해 코딩된 실질적으로 순수한 펩타이드를 당업계에 공지된 방법 (예컨대, 크로마토그래피)을 이용하여 회수한다.
상기 '실질적으로 순수한 펩타이드'라 함은 본 발명에 따른 펩타이드가 숙주로부터 유래된 어떠한 다른 단백질도 실질적으로 포함하지 않는 것을 의미한다. 본 발명의 펩타이드 합성을 위한 유전공학적 방법은 다음의 문헌을 참고할 수 있다: Maniatis et al, MolecularCloning; A laboratory Manual, Cold Spring Harbor laboratory, 1982; Sambrook et al, Molecular Cloning: A Laboratory Manual, ColdSpring Harbor Press, NY, Second(1998) and Third(2000) Edition; Gene Expression Technology, Method in Enzymology, Genetics and Molecular Biology, Method in Enzymology, Guthrie & Fink (eds), Academic Press, San Diego, Calif, 1991; 및 Hitzeman et al, J Biol Chem, 255:12073-12080, 1990.
상기 펩타이드는 노무라입깃해파리에서 독액(venom)의 구성물이다. 본 발명자는 노무라입깃해파리의 유전체 정보(Kim et al. The genome of the giant Nomura's jellyfish sheds lights on the early evolution of active predation. BMC Biology. 2019, 17: 28)를 분석하였으며, 분석한 gene set를 Tox-Prot 데이터베이스 (Jungo F, Bougueleret L, Xenarios I, Poux S. The UniProtKB/Swiss-Prot Tox-Prot program: a central hub of integrated venom protein data. Toxicon. (2012) 60(4): 551-7)과 비교하여, 52종의 독 관련 domain을 얻었다(표 3).
상기 독 관련 domain 52종을 자포동물에서 발견된 ShK 및 그 유사 펩타이드들의 아미노산 서열들이 갖는 하기 실시예 1의 3가지 공통점과 비교하여, ShK domain과 아미노산 서열의 구조가 유사한 서열번호 1 내지 서열번호 3의 펩타이드(g5156.t1-3, g7640.t1-1 및 g5156.t1-2)를 얻었다(표 4).
상기 자포동물은 후생동물에 속하는 하나의 문(phylum)으로 이배엽성 동물이며, 산호류들을 포함해서 말미잘, 히드라, 해파리 등이 포함되어 있다. 몸은 방사대칭이고 머리는 없으며 체벽은 두 세포층으로 되어 있다. 주머니 모양의 강장에는 하나의 입이 있다. 뚜렷한 조직으로 되어 있으나 기관은 형성하지 않는다. 몸 표면에 자세포(cnidocyte)가 있고 이 자세포 안에는 자포(cnidae)라는 쏘는 세포내주머니를 가지고 있기 때문에 자포동물이라 부르며, 주로 바다에 살고 일부는 담수에 산다. 자포(cnidae)는 여러 가지 형태가 있는데, 가장 흔한 자포는 자사포(nematocyst)로 독이 있는 용수철 모양의 자사(filament)가 있어, 먹이나 포식자 등의 외부 물체와 접촉하면 자사를 발사해서 죽이거나 해를 입힌다. 말미잘, 산호와 같이 바닥에 붙어서 고착생활을 하는 폴립(polyp) 형과 해파리와 같이 자유롭게 수중을 유영하며 돌아다니는 해파리형 (또는 메두사 medusa)이 있다.
본 발명은 서열번호 1 내지 서열번호 3의 펩타이드를 유효성분으로 함유하는 Kv1.3 칼륨이온채널 억제용 조성물을 제공한다.
상기 서열번호 1의 펩타이드는 +50mV에서 중간 값 기준 hKV1.3의 활성을 약 54% 억제하고, 서열번호 2의 펩타이드는 약 40% 억제하고, 서열번호 3의 펩타이드는 약 27% 억제하는 것을 확인하였다(도 4 내지 도 6).
본 발명은 서열번호 1 내지 서열번호 3의 펩타이드를 유효성분으로 함유하는 자가면역질환의 예방 또는 치료용 약학적 조성물을 제공한다.
상기 자가면역질환은 다발성 경화증, 류마티스 관절염, 제1형 당뇨병, 건선, 염증성 장질환, 접촉매개성 피부염, 건선성 관절염, 천식, 알레르기, 재협착증, 전신 경화증, 섬유증, 경피증, 사구체신염, 쇼그렌 증후군, 염증성 골흡수, 이식거부, 이식편대숙주병, 및 루푸스로 이루어진 군에서 선택되는 하나 이상을 포함할 수 있다.
Kv1.3 채널 억제제는 effector memory T cells (TEM cells)의 활성화를 감소시켜 T cell에 의한 조직손상을 막음으로써, 자가면역질환을 억제하는 것으로 알려져 있다 (Beeton et al., 2006. Kv1.3 channels are a therapeutic target for T cell-mediated autoimmune diseases. PNAS, 103: 17414-17419). 또한 활성화된microglia의 respiratory burst를 막음으로써, 이에 의한 뉴런의 이차 손상을 방지하여 자가면역질환의 염증 반응을 감소시키는 것으로 알려져 있다 (Fordyce et al., 2005. Microglia Kv1.3 channels contribute to their ability to kill neurons. J. Neurosci., 25:7139 -7149). 최근의 리뷰에 의하면, Kv1.3 차단제는 자가면역질환과 만성 염증 치료에 있어 최선의 약제로 부각되고 있다(Perez-Verdaguer et al., 2015. The voltage-gated potassium channel Kv1.3 is a promising multitherapeutic target against human pathologies. Expert Opin. Ther. Targets, 20:5, 577-591). 또한, 많은 실험에서 Kv 1.3 차단 펩타이드의 자가면역질환 치료제로서 검증되었다(표 2, Chandy, KG and Norton, RS, 2017. Peptide blockers of Kv1.3 channels in T cells as therapeutics for autoimmune disease. Curr. Opin. Chem. Biol., 38:97-107).
| 질병명 | 세포모델 | 동물모델 | 차단제 또는 녹아웃 모델 |
| 다발성 경화증 | 환자의 말초 혈액에서 MBP 특이적 Kv1.3 high TEM 세포. Kv1.3 차단제는 상기 세포의 항원 유도 증식을 억제한다. |
실험적 자가면역 뇌척수염(쥐) | ShK; ShK-Dap22; ShK-186; ShK-192; 20 kDa PEG-ShK; 20 kDa PEG-[Lys16]ShK; ADWX-1 |
| 사후 뇌의 MS 플라크에서 Kv1.3 CCR7+CCR5 T+EM 세포. | 실험적 자가면역 뇌척수염(마우스) | Kv1.3 녹아웃 마우스 | |
| 제1형 당뇨병 | 환자의 말초 혈액에서 GAD65 및 인슐린 특이적 Kv1.3 high TEM 세포. | 실험적 자가면역 당뇨병(쥐) | PAP-1 |
| ShK-186은 상기 세포의 항원 유도 증식을 억제한다. | |||
| 류마티스성 관절염 | 환자의 활액 Kv1.3 high TEM 세포 | 프리스탄 유발 관절염(쥐) | ShK-186 |
| 활막 조직의 CD3CCR7+Kv1.3 T 세포+ | |||
| 건선 | 건선 피부 병변의 Kv1.3high TEM 세포. | 인간의 건선 피부를 마우스에 이식한 SCID-Hu 마우스 모델 | PAP-1 |
| 주 2회 ShK-186 60μg 용량은 판상 건선 환자 9/10에서 건선 면적 및 중증도 지수(PASI)의 개선을 야기하였다. 치료 중단 후 4주 동안 개선이 지속되었다. |
|||
| 천식 | 천식 환자의 가래에서 Kv1.3 high Th2TEM 세포. | 오발부민 유발 천식 모델(쥐) | ShK-186 |
| ShK-186은 환자의 말초 혈액에서 알레르겐(allergen)으로 자극된 Th2T 세포의 증식과 사이토카인 생성을 억제했습니다. | |||
| 루푸스 신염 | 활성 SLE 환자의 혈액 내 TEM 세포는 비활성 SLE 또는 대조군보다 Kv1.3이 더 높다. | 실험적 자가면역 사구체신염(쥐) | Psora4, ShK-186 |
| ShK-186은 비활성 루푸스 또는 대조군의 T 세포보다 활성 루푸스의 TEM 세포에 의한 IL-17 및 IFN-γ 생성을 억제한다. | |||
| 급성관상동맥증후군 | 환자의 말초 혈액에서 Kv1.3 high TEM 세포. | - | - |
| PAP-1은 TEM 세포에 의해 인터페론-γ와 퍼포린을 억제하였다. | |||
| 지연형 과민증 | - | DTH(돼지) | 마가톡신(margatoxin)과 코레올라이드(correolide) |
| KV261-HSA-34(DTH를 억제하지 않았지만 배수 LN의 세포성을 감소시킴). | |||
| DTH(쥐) | 칼리오톡신(Kaliotoxin); ShK; ShK-186; PAP-1; ShK-192; Vm24; AcK1; BmK1; BmKTX-D33H; Syn-Vm24-CDR3L; Fc-ShK | ||
| 치주염 후 골흡수 | - | 실험적 치주염(쥐) | 칼리오톡신(Kaliotoxin) |
| 접촉 피부염 | - | 알레르기 접촉 피부염(쥐) | PAP-1, Psora4 |
| 피부 이식 | - | 피부 동종이식(마우스) | 클로파지민(Clofazimine) |
특히, 본 발명의 양성대조군으로 사용한 Psora4 또한 자가면역질환 치료제로서 검증되었다(표2).
본 발명자들은 초기 단계의 T 림프구 활성화에 중요한 역할을 하는 hKv1.3 칼륨이온채널을 억제시킴으로써, 자가면역질환의 예방 또는 치료에 이용될 수 있음을 확인하였다(도 4 내지 도 6).
본 발명에 따른 약학적 조성물은 조성물 전체 중량에 대하여 유효성분인 서열번호 1 내지 서열번호 3의 펩타이드를 10 내지 95 중량%로 포함할 수 있다.
또한, 본 발명의 약학적 조성물은 상기 유효성분 이외에 추가로 동일 또는 유사한 기능을 나타내는 유효성분을 1종 이상 추가로 포함할 수 있다.
본 발명의 약학적 조성물은 약학적으로 허용되는 첨가물을 추가로 포함할 수 있다.
상기 첨가물은 약학적 조성물의 제조에 통상적으로 사용되는 적절한 담체, 부형제 및 희석제를 더 포함할 수 있다.
본 발명의 약학적 조성물은 약제학적으로 허용되는 담체를 포함할 수 있다. 상기 약제학적으로 허용되는 담체는 제제시에 통상적으로 이용되는 것으로서, 락토스, 덱스트로스, 수크로스, 솔비톨, 만니톨, 자일리톨, 에리스리톨, 말티톨, 전분, 아카시아 고무, 인산 칼슘, 알기네이트, 젤라틴, 규산 칼슘, 미세결정성 셀룰로스, 폴리비닐피롤리돈, 셀룰로스, 물, 시럽, 메틸 셀룰로스, 메틸히드록시벤조에이트, 프로필히드록시벤조에이트, 활석, 스테아르산 마그네슘 및 미네랄 오일 등을 포함하나, 이에 한정되는 것은 아니다.
본 발명의 약학적 조성물은 각각 통상의 방법에 따라, 산제, 과립제, 정제, 캡슐제, 현탁액, 에멀젼, 시럽, 에어로졸 등의 경구형 제형, 외용제, 좌제 또는 멸균 주사용액의 형태로 제형화하여 사용할 수 있다. 상세하게는 제형화할 경우 통상 사용하는 충진제, 중량제, 결합제, 습윤제, 붕해제, 계면활성제 등의 희석제 또는 부형제를 사용하여 조제될 수 있다.
경구투여를 위한 고형 제제로는 정제, 환제, 산제, 과립제, 캡슐제 등을 포함하나, 이에 한정되는 것은 아니다. 이러한 고형 제제는 상기 유효성분 외에 적어도 하나 이상의 부형제, 예를 들면, 전분, 칼슘 카보네이트, 수크로오스, 락토오스, 젤라틴 등을 섞어 조제될 수 있다. 또한, 단순한 부형제 이외에 마그네슘 스테아레이트, 탈크 같은 윤활제들도 사용될 수 있다. 경구를 위한 액상물, 리퀴드 파라핀 이외에 여러 가지 부형제, 예를 들면 습윤제, 감미제, 방향제, 보존제 등을 첨가하여 조제될 수 있다.
비경구 투여를 위한 제제는 멸균된 수용액, 비수성 용제, 현탁제, 유제, 동결건조 제제 및 과제를 포함한다. 비수성 용제 및 현탁제로는 프로필렌글리콜, 폴리에틸렌글리콜, 올리브 오일과 같은 식물성 오일, 에틸올레이트와 같은 주사 가능한 에스테르 등이 사용될 수 있다. 좌제의 기제로는 위텝솔, 마크로솔, 트윈 61, 카카오지, 라우린지, 글리세로젤라틴 등이 사용될 수 있다.
본 발명의 약학적 조성물은 상기 성분들 이외에 윤활제, 습윤제, 감미제, 향미제, 유화제, 현탁제, 보존제 등을 추가로 포함할 수 있다.
적합한 약제학적으로 허용되는 담체 및 제제는 Remington's Pharmaceutical Sciences (19th ed, 1995)에 상세히 기재되어 있다.
본 발명의 약학적 조성물은 경구 또는 비경구로 투여할 수 있고, 비경구 투여인 경우에는 정맥내 주입, 피하 주입, 근육 주입, 복강 주입, 경피 투여 등으로 투여할 수 있다.
본 발명의 약학적 조성물의 적합한 투여량은 제제화 방법, 투여 방식, 환자의 연령, 체중, 성, 병적 상태, 음식, 투여시간, 투여 경로, 배설 속도 및 반응 감응성, 환자의 골 손실 정도와 같은 요인들에 따라 다르며, 당 업자에 의하여 적절하게 선택될 수 있고, 구체적으로 0.001 mg/kg 내지 500 mg/kg이며, 필요에 따라 일일 1회 내지 수회로 나누어 투여할 수 있다.
본 발명의 약학적 조성물은 당해 발명이 속하는 기술 분야에서 통상의 지식을 가진 자가 용이하게 실시할 수 있는 방법에 따라, 약제학적으로 허용되는 담체 및/또는 부형제를 이용하여 제제화함으로써 단위 용량 형태로 제조되거나 또는 다용량 용기 내에 내입시켜 제조될 수 있다. 이때 제형은 오일 또는 수성 매질중의 용액, 현탁액 또는 유화액 형태이거나 엑스제, 분말제, 과립제, 정제 또는 갑셀제 형태일 수 있으며, 분산제 또는 안정화제를 추가적으로 포함할 수 있다.
본 발명의 "투여 대상"은 인간, 원숭이, 소, 말, 돼지, 양, 닭, 고양이, 개, 마우스, 토끼 등을 포함하지만, 특별히 이에 제한되는 것은 아니다.
본 발명은 서열번호 1 내지 서열번호 3의 펩타이드를 유효성분으로 함유하는 자가면역질환의 예방 또는 개선용 건강기능식품 조성물을 제공한다.
본 발명의 약학적 조성물 및 건강기능식품 조성물에서 언급된 사항은 서로 모순되지 않는 한 동일하게 적용된다.
이하, 본 발명을 하기 실시예 및 실험예에 의하여 상세히 설명한다.
단, 하기 실시예 및 실험예는 본 발명을 예시하기 위한 것일 뿐, 본 발명이 이들에 의하여 한정되는 것은 아니다.
<실시예 1> ShK domain 유사 펩타이드 도출
1-1. 독 관련 domain 도출
본 발명자는 노무라입깃해파리의 유전체 정보를 분석(Kim et al., 2019)하였으며, 분석한 gene set을 Tox-Prot 데이터베이스 (Jungo et al., 2012)과 비교하여, 52종의 독 관련 domain을 얻었다(표 3).
| Pfam ID | Pfam 설명 | Pfam ID | Pfam 설명 |
| PF12796 | Ankyrin repeats (3 copies) | PF00095 | WAP-type (Whey Acidic Protein) 'four-disulfide core' |
| PF00008 | EGF-like domain | PF08516 | ADAM cysteine-rich |
| PF13499 | EF-hand domain pair | PF00023 | Ankyrin repeat |
| PF01400 | Astacin (Peptidase family M12A) | PF00219 | Insulin-like growth factor binding protein |
| PF13637 | Ankyrin repeats (many copies) | PF00149 | Calcineurin-like phosphoesterase |
| PF00147 | Fibrinogen beta and gamma chains, C-terminal globular domain | PF02872 | 5'-nucleotidase, C-terminal domain |
| PF00089 | Trypsin | PF07732 | Multicopper oxidase |
| PF00754 | F5/8 type C domain | PF00326 | Prolyl oligopeptidase family |
| PF01391 | Collagen triple helix repeat (20 copies) | PF07678 | A-macroglobulin complement component |
| PF01421 | Reprolysin (M12B) family zinc metalloprotease | PF10569 | Alpha-macro-globulin thiol-ester bond-forming region |
| PF07648 | Kazal-type serine protease inhibitor domain | PF00207 | Alpha-2-macroglobulin family |
| PF00059 | Lectin C-type domain | PF07703 | Alpha-2-macroglobulin family N-terminal region |
| PF00188 | Cysteine-rich secretory protein family | PF00031 | Cystatin domain |
| PF00050 | Kazal-type serine protease inhibitor domain | PF04916 | Phospholipase B |
| PF01562 | Reprolysin family propeptide | PF01223 | DNA/RNA non-specific endonuclease |
| PF05826 | Phospholipase A2 | PF07677 | A-macroglobulin receptor |
| PF00135 | Carboxylesterase family | PF00068 | Phospholipase A2 |
| PF01593 | Flavin containing amine oxidoreductase | PF01823 | MAC/Perforin domain |
| PF13833 | EF-hand domain pair | PF01826 | Trypsin Inhibitor like cysteine rich domain |
| PF00200 | Disintegrin | PF01630 | Hyaluronidase |
| PF06607 | Prokineticin | PF00930 | Dipeptidyl peptidase IV (DPP IV) N-terminal region |
| PF01549 | ShK domain-like | PF00838 | Translationally controlled tumour protein |
| PF01663 | Type I phosphodiesterase / nucleotide pyrophosphatase | PF04389 | Peptidase family M28 |
| PF14670 | Coagulation Factor Xa inhibitory site | PF01835 | MG2 domain |
| PF00151 | Lipase | PF00341 | PDGF/VEGF domain |
| PF00014 | Kunitz/Bovine pancreatic trypsin inhibitor domain | PF10279 | Latarcin precursor |
1-2. ShK domain 유사 펩타이드 도출
상기 1-1에서 얻어진 독 관련 domain 52종을 자포동물에서 발견된 ShK 및 그 유사 펩타이드들의 아미노산 서열들이 갖는 하기 3가지 공통점과 비교하였다.
1) 펩타이드의 길이가 40 amino acid 이하이다.
2) 펩타이드의 내부에 시스테인이 6개 존재한다.
3) 펩타이드의 C-말단 쪽의 구조가 CXXXCXXC이다(C는 시스테인이고, X는 임의의 아미노산이다).
상기 3가지 공통점을 비교 결과, ShK domain과 아미노산 서열의 구조가 유사한 3개의 펩타이드(g5156.t1-3, g7640.t1-1 및 g5156.t1-2)를 얻었다(표 4).
| 서열번호 | 펩타이드 명 | 서열 | 길이 |
| 서열번호 1 | g5156.t1-3 | CKDHHTYGVY--CKDWKSSGECKKNPKGMRHFCRKTCGFC | 38 aa |
| 서열번호 2 | g7640.t1-1 | CMDRERESKAGLCKGWQKINSCFDHPVLMKTYCPKTCGFC | 40 aa |
| 서열번호 3 | g5156.t1-2 | CKNKEGTFCQ---RFKSDCFHDRLPSVQMKTICSETCGIC | 37 aa |
| 서열번호 4 | ShK | CIDTIP-------KSRCTAFQCKHSMKYRLSFCRKTCGTC | 33 aa |
상기 표 4의 펩타이드 서열에서 - 기호는 펩타이드서열 비교를 쉽게 하기 위해 임의로 추가한 공백 표시이다.
<실시예 2> 펩타이드의 제조
하기 solid phase peptide synthesis법으로 상기 실시예 1에서 도출한 3개의 펩타이드(g5156.t1-3, g7640.t1-1 및 g5156.t1-2)를 제조 하였다.
시험관에 DMF(15ml/g)과 레진을 넣고 30분동안 레진을 팽윤시켰다. DMF를 제거하고, 20% 피페리딘 DMF 용액(15ml/g)을 넣어 5분동안 탈보호 반응을 시켰다. 같은 방법으로 20% 피페리딘 DMF 용액을 제거 후 새로운 20% 피페리딘 DMF 용액(15ml/g)을 넣어 15분 동안 탈보호 반응을 시켰다. 탈보호 반응시킨 레진을 레진을 DMF(10ml/g) 2회, 메탄올(10ml/g) 2회, DMF(10ml/g) 2회 세척하였다. 그 다음 반응시키고 싶은 아미노산(3eq), HOBt(3eq)를 가능한 적은 DMF에 녹여 시험관에 넣고, 추가로 DIC(3eq)를 넣어 30분동안 커플링 반응을 시켰다. DMF(10ml/g) 1회, 메탄올(10ml/g) 2회, DMF(10ml/g) 2회 세척하였다. 원하는 서열이 되도록 상기 탈보호 반응부터 커플링 반응 후 세척까지를 반복하였다. 원하는 서열을 반응시킨 후, 시험관에 TFA 94.0%, 물 2.5%, EDT 2.5%, TIS 1%의 용해 용액(10ml/g)을 넣고 120분 동안 반응시켜 레진으로부터 용해된 용해물을 얻었다(참고: g는 레진의 단위 기준). 마지막으로, 용해물을 질소로 건조시키고, 에테르로 6번 세척 후, 실온에서 건조시켜 펩타이드를 얻었다.
<실험예 1> 전류 측정용 세포(hKv1.3 칼륨이온채널을 갖고 있는 HEK293세포) 의 준비
1-1. hKv1.3 칼륨이온채널의 클로닝 및 hKv1.3 벡터(vector)의 완성
hKv1.3 칼륨이온채널의 유전자를 증폭하기 위하여, 템플릿은 oriGENE human cDNA clones을 사용하였으며, 하기 표 5의 프라이머 세트를 사용하여 PCR을 수행하였다.
| 서열번호 | 서열 명 | 서열(5'→3') |
| 서열번호 5 | NheI-Kv1.3-F | 5'-TTTGCTAGCGCCACCATGGACGAGCGC-3' |
| 서열번호 6 | SaI1-Kv1.3-R | 5'-TTTGTCGACCTAAACATCGGTGAATATCTTTT-3' |
PCR은 1)95℃ 5분, 2)95℃ 30초, 58℃ 30초, 72℃ 1분 45초, 30회, 3)72℃ 3분 조건을 연속하여 시행하였다. oriGENE human cDNA clones 를 template로 하여 클로닝된 AAV-IRES2-EGFP 벡터의 NhaI site와 SalI site 사이에 상기 PCR을 수행하여 얻은 hKv1.3 칼륨이온채널의 유전자를 삽입하여, AAV-CMV-hK1.3-IRES2-EGFP 벡터를 완성하였다.
1-2. hKv1.3 칼륨이온채널의 유전자를 HEK 293 세포로의 형질주입(Transfection)
AAV-CMV-hKv1.3-IRES2-EGFP 벡터 2 μg을 35 mm 페트리디쉬에 배양 한 HEK 293 세포 (confluency 50%, 7X105 이상)에 Qiagen Effectene을 사용하여 형질주입하였다. 즉, DNA 2 μg에 제공된 버퍼를 첨가하여 100 μl로 적정하고, enhancer 8 μl를 넣고 2-5분 기다린 후, effectene 20 μl 을 첨가하고 볼텍스믹서로 1초간 섞었다. 시료를 원심분리 하여 침전(spin down)하고 10분동안 기다린 후 DMEM+10% Fetal Bovine Serum (FBS) 0.6 ml를 첨가하고, 잘 섞은 후, 물방울형태로 시계방향으로 HEK 293 세포에 뿌렸다. 그 다음 17시간동안 35mm 배양용기에서 보관하였다.
1-3. 형질 주입된 HEK 293 세포가 hKv1.3가 전압 의존성 칼륨이온채널인 것을 확인
1-3-1. 전류 측정을 위한 형질 전환된 HEK 293 세포의 준비
형질주입체(Transfectants, HEK293+ AAV-CMV-hKv1.3-IRES2-EGFP)를 35 mm 페트리디쉬에서 떼어 12 ml DMEM+10% FBS로 현탁(suspension)하여 24 well plate 한 well 당 0. 5 ml씩 24개의 0.01 mg ml PDL-coated coverslip (직경 12mm)에 세포수가 1X105 이 되도록 분주하였다. 세포가 커버슬립에 붙기까지 한 시간 기다린 후 전류 측정을 위한 패치 클램프(patch clamp)법을 실시하였다.
1-3-2. 전류 측정
패치 클램프 기기에 연결되어 있는 증폭기(amplifier, MultiClamp 700A), 디지타이저(digitizer, DIGIDATA 1322A), 원격조종기(manipulator), bath application, 현미경 및 컴퓨터 내에 HCImageLive 프로그램을 활용하여 세포와 형광발현, 세포와 파이펫을 찾고, Clampex software, MultiClamp 700A, digidata 1550을 활용하여 전체 세포 패치를 녹화하였다. 내부용액(Internal solution)[140 mM k-gluconate, 10 mM HEPES, 0.2 mM ATP, 0.06 mM GTP]을 준비하여 얼음 위 주사기에 보관하고, 외부용액(external solution)[130 mM NaCl, 10 mM HEPES, 3 mM KCl, 1.5 mM D-Glucose, 10 mM sucrose, 24 mM CaCl2, 1.5 mM MgCl2 6H2O, osmilarity 320mmol/kg, pH 7.2]을 저장소(reservoir)에 담고 기본버퍼로 사용하였다. Bath chamber에 100 nM 농도가 되도록 물질을 외부용액으로 희석하고 약물저장소(drug reservoir)에 저장하였다. 전압 클램프(Voltage clamp) 모드에서 전압 단계 (첫번째 단계 -130mV부터 50mV까지, delta 20mV 0.6s)을 주어 전류를 측정하였다.
Kv1.3의 억제제로 알려진 Psora 4 (100 nM)를 양성 대조군으로 사용하였다. 전류 측정 결과, hKv1.3가 형질 주입된 HEK 293 세포가 전압 의존성 칼륨이온채널인 것을 확인할 수 있었다(도3).
<실험예 2> ShK 유사 펩타이드의 hKv1.3 칼륨이온채널 활성 억제 확인
실험예 1에서 준비한 hKv1.3 칼륨이온채널을 갖고 있는 HEK293세포를 이용하여 g5156.t1-3, g7640.t1-1 및 g5156.t1-2 펩타이드의 hKv1.3 칼륨이온채널 활성 억제를 확인하였다.
그 결과, g5156.t1-3 펩타이드가 hKV1.3을 +50mV에서 중간 값 기준 hKV1.3의 활성을 약 54% (pre-g5156.t1-3: 3.7nA, post-g5156.t1-3: 1.7nA) 억제함을 확인하였다(도4).
또한, g7640.t1-1 펩타이드가 hKV1.3을 +50mV에서 중간 값 기준 hKV1.3의 활성을 약 40% (pre-g7640.t1-1: 3.7nA, post-g7640.t1-1: 2.2nA)를 억제함을 확인하였다(도5).
g5156.t1-2 펩타이드는 약 27% (pre-g5156.t1-2: 2.9nA, post- g5156.t1-2: 2.1nA) 억제함을 확인하였다(도6).
<실험예 3> 작은상자해파리 기원의 ShK 유사 펩타이드의 hKv1.3 칼륨이온채널 활성 억제 확인
상기 실시예 1-2와 같은 방법으로 도출한 작은상자해파리 기원의 ShK 유사 펩타이드(표 6, CBRV1_05766-1)의 hKv1.3 칼륨이온채널 활성 억제를 실험예 2와 같은 방법으로 확인하였다.
그 결과, CBRV1_05766-1 펩타이드가 hKV1.3을 +50mV에서 중간 값 기준 hKV1.3의 활성을 약 5.0% (pre-CBRV1_05766-1: 1.01nA, post- CBRV1_05766-1: 0.96nA) 억제하는 것으로 억제활성이 없는 것으로 확인하였다(도7).
| 서열번호 | 펩타이드 명 | 서열 | 길이 |
| 서열번호 7 | CBRV1_05766-1 | CDKKKELPFCNIVDAKTFCRDINQAKQCPLKCKLC | 35 aa |
<110> Korea Institute of Ocean Science and Technology
<120> Peptide with voltage-gated potassium ion channel inhibitory
activity
<130> 2022P-01-012
<160> 7
<170> KoPatentIn 3.0
<210> 1
<211> 38
<212> PRT
<213> Artificial Sequence
<220>
<223> g5156.t1-3
<400> 1
Cys Lys Asp His His Thr Tyr Gly Val Tyr Cys Lys Asp Trp Lys Ser
1 5 10 15
Ser Gly Glu Cys Lys Lys Asn Pro Lys Gly Met Arg His Phe Cys Arg
20 25 30
Lys Thr Cys Gly Phe Cys
35
<210> 2
<211> 40
<212> PRT
<213> Artificial Sequence
<220>
<223> g7640.t1-1
<400> 2
Cys Met Asp Arg Glu Arg Glu Ser Lys Ala Gly Leu Cys Lys Gly Trp
1 5 10 15
Gln Lys Ile Asn Ser Cys Phe Asp His Pro Val Leu Met Lys Thr Tyr
20 25 30
Cys Pro Lys Thr Cys Gly Phe Cys
35 40
<210> 3
<211> 37
<212> PRT
<213> Artificial Sequence
<220>
<223> g5156.t1-2
<400> 3
Cys Lys Asn Lys Glu Gly Thr Phe Cys Gln Arg Phe Lys Ser Asp Cys
1 5 10 15
Phe His Asp Arg Leu Pro Ser Val Gln Met Lys Thr Ile Cys Ser Glu
20 25 30
Thr Cys Gly Ile Cys
35
<210> 4
<211> 33
<212> PRT
<213> Artificial Sequence
<220>
<223> ShK
<400> 4
Cys Ile Asp Thr Ile Pro Lys Ser Arg Cys Thr Ala Phe Gln Cys Lys
1 5 10 15
His Ser Met Lys Tyr Arg Leu Ser Phe Cys Arg Lys Thr Cys Gly Thr
20 25 30
Cys
<210> 5
<211> 27
<212> DNA
<213> Artificial Sequence
<220>
<223> NheI-Kv1.3-F
<400> 5
tttgctagcg ccaccatgga cgagcgc 27
<210> 6
<211> 32
<212> DNA
<213> Artificial Sequence
<220>
<223> SaI1-Kv1.3-R
<400> 6
tttgtcgacc taaacatcgg tgaatatctt tt 32
<210> 7
<211> 35
<212> PRT
<213> Artificial Sequence
<220>
<223> CBRV1_05766-1
<400> 7
Cys Asp Lys Lys Lys Glu Leu Pro Phe Cys Asn Ile Val Asp Ala Lys
1 5 10 15
Thr Phe Cys Arg Asp Ile Asn Gln Ala Lys Gln Cys Pro Leu Lys Cys
20 25 30
Lys Leu Cys
35
Claims (7)
- 서열번호 1 내지 서열번호 3으로 구성된 군으로부터 선택되는 아미노산 서열을 포함하는 펩타이드.
- 제1항에 있어서,
상기 펩타이드는 3개의 첫번째 Cys와 여섯번째 Cys, 두번째 Cys와 네번째 Cys 및 세번째 Cys와 다섯번째 Cys이 각각 이황화결합(Disulfide bond)하는 것을 특징으로 하는 펩타이드. - 제1항에 있어서,
상기 펩타이드는 노무라입깃해파리에서 독액(venom)의 구성물인 것을 특징으로 하는 펩타이드. - 제1항에 있어서, 상기 펩타이드는 Kv1.3 칼륨이온채널 활성을 억제하는 것을 특징으로 하는, 펩타이드.
- 제1항의 펩타이드를 유효성분으로 함유하는 다발성 경화증, 류마티스 관절염, 제1형 당뇨병, 건선, 염증성 장질환, 접촉매개성 피부염, 건선성 관절염, 천식, 알레르기, 재협착증, 전신 경화증, 섬유증, 경피증, 사구체신염, 쇼그렌 증후군, 염증성 골흡수, 이식거부, 이식편대숙주병, 및 루푸스로 이루어지는 군으로부터 선택되는 hKv1.3 칼륨이온채널의 활성에 의해 유발되는 자가면역질환의 예방 또는 치료용 약학적 조성물.
- 삭제
- 제1항의 펩타이드를 유효성분으로 함유하는 다발성 경화증, 류마티스 관절염, 제1형 당뇨병, 건선, 염증성 장질환, 접촉매개성 피부염, 건선성 관절염, 천식, 알레르기, 재협착증, 전신 경화증, 섬유증, 경피증, 사구체신염, 쇼그렌 증후군, 염증성 골흡수, 이식거부, 이식편대숙주병, 및 루푸스로 이루어지는 군으로부터 선택되는 hKv1.3 칼륨이온채널의 활성에 의해 유발되는 자가면역질환의 예방 또는 개선용 건강기능식품 조성물.
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| KR1020220046057A KR102533290B1 (ko) | 2022-04-14 | 2022-04-14 | 전압개폐 칼륨이온채널 억제 활성능을 갖는 펩타이드 |
Applications Claiming Priority (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| KR1020220046057A KR102533290B1 (ko) | 2022-04-14 | 2022-04-14 | 전압개폐 칼륨이온채널 억제 활성능을 갖는 펩타이드 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| KR102533290B1 true KR102533290B1 (ko) | 2023-05-16 |
Family
ID=86545741
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| KR1020220046057A KR102533290B1 (ko) | 2022-04-14 | 2022-04-14 | 전압개폐 칼륨이온채널 억제 활성능을 갖는 펩타이드 |
Country Status (1)
| Country | Link |
|---|---|
| KR (1) | KR102533290B1 (ko) |
Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| KR101477296B1 (ko) * | 2004-10-07 | 2014-12-29 | 더 리젠츠 오브 더 유니버시티 오브 캘리포니아 | ＳＨＫ 독소의 유사체 및 그의 Ｋｖ1.3 칼륨 채널의 선택적저해에서의 용도 |
| JP2018008955A (ja) * | 2011-06-06 | 2018-01-18 | ケイ・ブイ・１．３・セラピューティクス・インコーポレイテッド | Ｓｈｋベースの薬学的組成物とその製造方法および使用方法 |
| JP6847828B2 (ja) * | 2014-08-15 | 2021-03-24 | モナッシュ ユニバーシティ | 新規なカリウムチャネルブロッカー及び自己免疫疾患の治療におけるそれらの使用 |
-
2022
- 2022-04-14 KR KR1020220046057A patent/KR102533290B1/ko active IP Right Grant
Patent Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| KR101477296B1 (ko) * | 2004-10-07 | 2014-12-29 | 더 리젠츠 오브 더 유니버시티 오브 캘리포니아 | ＳＨＫ 독소의 유사체 및 그의 Ｋｖ1.3 칼륨 채널의 선택적저해에서의 용도 |
| JP2018008955A (ja) * | 2011-06-06 | 2018-01-18 | ケイ・ブイ・１．３・セラピューティクス・インコーポレイテッド | Ｓｈｋベースの薬学的組成物とその製造方法および使用方法 |
| JP6847828B2 (ja) * | 2014-08-15 | 2021-03-24 | モナッシュ ユニバーシティ | 新規なカリウムチャネルブロッカー及び自己免疫疾患の治療におけるそれらの使用 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| DE60217507T2 (de) | Peptide für die behandlung von tumoren und anderen zuständen, die das entfernen oder zerstören von zellen erfordern | |
| JP6262721B2 (ja) | 敗血症の予防用または治療用の組成物 | |
| US8962817B2 (en) | Vectors encoding a paralytic peptide | |
| KR102623470B1 (ko) | Bph 증상의 악화 또는 진행을 개선하거나 예방하는 방법 | |
| KR20040063906A (ko) | 인간 3 릴랙신 | |
| US6727226B2 (en) | Mu-conopeptides | |
| US20030109670A1 (en) | Cone snail peptides | |
| KR101887577B1 (ko) | 항비만 및 항당뇨 효능을 갖는 펩타이드 및 이의 용도 | |
| CA2308768A1 (en) | 125 human secreted proteins | |
| JP2004501061A (ja) | 熱ショックタンパク質６０のフラグメントおよびアンタゴニスト | |
| CA2372926A1 (en) | 143 human secreted proteins | |
| JP2000083688A (ja) | ＩＬ―１ファミリ―の新規メンバ―、ＩＬ―１δ | |
| KR102533290B1 (ko) | 전압개폐 칼륨이온채널 억제 활성능을 갖는 펩타이드 | |
| DE69233155T2 (de) | Insulinartigen wachstumsfaktor bindendes protein | |
| DE69831084T2 (de) | Beta-defensine | |
| KR102553070B1 (ko) | 전압개폐 칼륨이온채널 억제 활성능을 갖는 작은상자해파리 기원 펩타이드 | |
| JP2004217651A (ja) | メタスチン誘導体およびその用途 | |
| US20050214903A1 (en) | O-superfamily conotoxin peptides | |
| US7390785B2 (en) | τ-conotoxin peptides | |
| AU5474200A (en) | Muo-conopeptides and their use as local anesthetics | |
| WO2002007675A2 (en) | Omega-conopeptides | |
| US20030119731A1 (en) | Omega-conopeptides | |
| AU2001271657A1 (en) | I-superfamily conotoxins | |
| WO2001089555A1 (en) | Compositions with anti-proliferative activities and methods for use thereof |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| E701 | Decision to grant or registration of patent right | ||
| GRNT | Written decision to grant |