ES8202958A1 - Un sistema de antenas para su uso en un sistema electronico de seguridad. - Google Patents

Un sistema de antenas para su uso en un sistema electronico de seguridad.

Info

Publication number
ES8202958A1
ES8202958A1 ES496218A ES496218A ES8202958A1 ES 8202958 A1 ES8202958 A1 ES 8202958A1 ES 496218 A ES496218 A ES 496218A ES 496218 A ES496218 A ES 496218A ES 8202958 A1 ES8202958 A1 ES 8202958A1
Authority
ES
Spain
Prior art keywords
antenna
twisted
electronic security
shield
enclosing
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Expired
Application number
ES496218A
Other languages
English (en)
Spanish (es)
Other versions
ES496218A0 (es
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Individual
Original Assignee
Individual
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Individual filed Critical Individual
Publication of ES496218A0 publication Critical patent/ES496218A0/es
Publication of ES8202958A1 publication Critical patent/ES8202958A1/es
Expired legal-status Critical Current

Links

Classifications

    • GPHYSICS
    • G08SIGNALLING
    • G08BSIGNALLING OR CALLING SYSTEMS; ORDER TELEGRAPHS; ALARM SYSTEMS
    • G08B13/00Burglar, theft or intruder alarms
    • G08B13/22Electrical actuation
    • G08B13/24Electrical actuation by interference with electromagnetic field distribution
    • G08B13/2402Electronic Article Surveillance [EAS], i.e. systems using tags for detecting removal of a tagged item from a secure area, e.g. tags for detecting shoplifting
    • G08B13/2465Aspects related to the EAS system, e.g. system components other than tags
    • G08B13/2468Antenna in system and the related signal processing
    • G08B13/2471Antenna signal processing by receiver or emitter
    • GPHYSICS
    • G08SIGNALLING
    • G08BSIGNALLING OR CALLING SYSTEMS; ORDER TELEGRAPHS; ALARM SYSTEMS
    • G08B13/00Burglar, theft or intruder alarms
    • G08B13/22Electrical actuation
    • G08B13/24Electrical actuation by interference with electromagnetic field distribution
    • G08B13/2402Electronic Article Surveillance [EAS], i.e. systems using tags for detecting removal of a tagged item from a secure area, e.g. tags for detecting shoplifting
    • G08B13/2465Aspects related to the EAS system, e.g. system components other than tags
    • G08B13/2468Antenna in system and the related signal processing
    • G08B13/2474Antenna or antenna activator geometry, arrangement or layout
    • HELECTRICITY
    • H01ELECTRIC ELEMENTS
    • H01QANTENNAS, i.e. RADIO AERIALS
    • H01Q7/00Loop antennas with a substantially uniform current distribution around the loop and having a directional radiation pattern in a plane perpendicular to the plane of the loop
    • H01Q7/04Screened antennas

Landscapes

  • Engineering & Computer Science (AREA)
  • Physics & Mathematics (AREA)
  • Signal Processing (AREA)
  • Automation & Control Theory (AREA)
  • Computer Security & Cryptography (AREA)
  • Electromagnetism (AREA)
  • General Physics & Mathematics (AREA)
  • Burglar Alarm Systems (AREA)
  • Variable-Direction Aerials And Aerial Arrays (AREA)
  • Details Of Aerials (AREA)
ES496218A 1979-11-15 1980-10-23 Un sistema de antenas para su uso en un sistema electronico de seguridad. Expired ES8202958A1 (es)

Applications Claiming Priority (1)

Application Number Priority Date Filing Date Title
US06/094,429 US4251808A (en) 1979-11-15 1979-11-15 Shielded balanced loop antennas for electronic security systems

Publications (2)

Publication Number Publication Date
ES496218A0 ES496218A0 (es) 1982-02-16
ES8202958A1 true ES8202958A1 (es) 1982-02-16

Family

ID=22245143

Family Applications (2)

Application Number Title Priority Date Filing Date
ES496218A Expired ES8202958A1 (es) 1979-11-15 1980-10-23 Un sistema de antenas para su uso en un sistema electronico de seguridad.
ES507188A Expired ES8302369A1 (es) 1979-11-15 1981-11-16 Un sistema de antenas para su uso en un sistema electronico de seguridad.

Family Applications After (1)

Application Number Title Priority Date Filing Date
ES507188A Expired ES8302369A1 (es) 1979-11-15 1981-11-16 Un sistema de antenas para su uso en un sistema electronico de seguridad.

Country Status (13)

Country Link
US (1) US4251808A (OSRAM)
JP (1) JPS5683000A (OSRAM)
AU (1) AU530083B2 (OSRAM)
CA (1) CA1148630A (OSRAM)
DE (1) DE3043026A1 (OSRAM)
DK (1) DK158686C (OSRAM)
ES (2) ES8202958A1 (OSRAM)
FR (1) FR2470976A1 (OSRAM)
GB (1) GB2063569B (OSRAM)
IT (1) IT1129351B (OSRAM)
MX (1) MX148678A (OSRAM)
SE (1) SE445498B (OSRAM)
ZA (1) ZA806639B (OSRAM)

Families Citing this family (63)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CA1138955A (en) * 1979-09-14 1983-01-04 Edward R. Fearon Anti-shoplifting system
US4373163A (en) * 1980-07-14 1983-02-08 I.D. Engineering, Inc. Loop antenna for security systems
US4384281A (en) * 1980-10-31 1983-05-17 Knogo Corporation Theft detection apparatus using saturable magnetic targets
US4342999A (en) * 1980-11-25 1982-08-03 Rca Corporation Loop antenna arrangements for inclusion in a television receiver
USRE32627E (en) * 1981-09-10 1988-03-22 Sensormatic Electronics Corporation Electrical surveillance apparatus with moveable antenna elements
US4394645A (en) * 1981-09-10 1983-07-19 Sensormatic Electronics Corporation Electrical surveillance apparatus with moveable antenna elements
EP0130973A1 (en) * 1983-01-03 1985-01-16 SHIN, Myong Anti-shoplifting system
US4509039A (en) * 1983-07-05 1985-04-02 Minnesota Mining And Manufacturing Company Shielded, closely spaced transmit-receiver antennas for electronic article surveillance system
US4531117A (en) * 1983-07-05 1985-07-23 Minnesota Mining And Manufacturing Company Variable frequency RF electronic surveillance system
US4609911A (en) * 1983-07-05 1986-09-02 Minnesota Mining And Manufacturing Company Variable frequency RF electronic surveillance system
US4642613A (en) * 1984-03-16 1987-02-10 Knogo Corporation Electronic theft detection apparatus with responder elements on protected articles
AU633247B2 (en) * 1985-01-10 1993-01-28 Checkpoint Systems, Inc. Antenna system for magnetic and resonant circuit detection
US4751516A (en) * 1985-01-10 1988-06-14 Lichtblau G J Antenna system for magnetic and resonant circuit detection
US4647910A (en) * 1985-09-17 1987-03-03 Allied Corporation Selector for AC magnetic inductive field receiver coils
US4728938A (en) * 1986-01-10 1988-03-01 Checkpoint Systems, Inc. Security tag deactivation system
US4769631A (en) * 1986-06-30 1988-09-06 Sensormatic Electronics Corporation Method, system and apparatus for magnetic surveillance of articles
JPS63236401A (ja) * 1987-03-25 1988-10-03 Kokusai Electric Co Ltd 誘導無線装置用ループアンテナ
US4779077A (en) * 1987-04-13 1988-10-18 Lichtblau G J Continuously armed high reliability pulse train processor
US4872018A (en) * 1987-08-31 1989-10-03 Monarch Marking Systems, Inc. Multiple loop antenna
US4972198A (en) * 1987-08-31 1990-11-20 Monarch Marking Systems, Inc. Multiple loop antenna
US5121103A (en) * 1988-07-29 1992-06-09 Knogo Corporation Load isolated article surveillance system and antenna assembly
US5103235A (en) * 1988-12-30 1992-04-07 Checkpoint Systems, Inc. Antenna structure for an electronic article surveillance system
US4999641A (en) * 1989-09-01 1991-03-12 Monarch Marking Systems, Inc. Magnetic antenna system having independently controllable electrical field shielding and magnetic field balance
GB9004431D0 (en) * 1990-02-28 1990-04-25 Scient Generics Ltd Detection system for security systems
US5051726A (en) * 1990-08-14 1991-09-24 Sensormatic Electronics Corporation Electronic article surveillance system with antenna array for enhanced field falloff
NL9100397A (nl) * 1991-03-06 1992-10-01 Nedap Nv Asymmetrische antenne voor winkeldiefstaldetectiesystemen.
US5142292A (en) * 1991-08-05 1992-08-25 Checkpoint Systems, Inc. Coplanar multiple loop antenna for electronic article surveillance systems
US5442334A (en) * 1992-07-20 1995-08-15 Stoplift Corporation Security system having deactivatable security tag
US5404147A (en) * 1992-10-28 1995-04-04 Sensormatic Electronics Corporation EAS system loop antenna having three loops of different area
US5373301A (en) * 1993-01-04 1994-12-13 Checkpoint Systems, Inc. Transmit and receive antenna having angled crossover elements
ATE169776T1 (de) * 1993-07-13 1998-08-15 Actron Entwicklungs Ag Antennenvorrichtung
US5694139A (en) * 1994-06-28 1997-12-02 Sony Corporation Short-distance communication antenna and methods of manufacturing and using the short-distance communication antenna
EP0703637A1 (de) 1994-09-23 1996-03-27 Actron Entwicklungs AG Antenne für ein elektronisches Sicherungssystem
DE69636999T2 (de) * 1995-05-30 2007-12-13 Sensormatic Electronics Corp., Boca Raton Antennenanordnung für warenüberwachungssystem mit verbesserter abfragefeldverteilung
US5602556A (en) * 1995-06-07 1997-02-11 Check Point Systems, Inc. Transmit and receive loop antenna
US5825335A (en) * 1995-10-23 1998-10-20 Kubota Corporation Sheet antenna apparatus
US5653192A (en) * 1996-03-06 1997-08-05 Alfa Laval Agri Inc. Livestock identification apparatus
WO1997038404A1 (en) * 1996-04-10 1997-10-16 Sentry Technology Corporation Electronic article surveillance system
US5914692A (en) * 1997-01-14 1999-06-22 Checkpoint Systems, Inc. Multiple loop antenna with crossover element having a pair of spaced, parallel conductors for electrically connecting the multiple loops
DE19732254A1 (de) * 1997-07-26 1999-02-11 Kaba Benzing Gmbh Vorrichtung zur Übermittlung magnetischer Signale mittels einer Leiterplatte
JP3389464B2 (ja) 1997-08-07 2003-03-24 三洋電機株式会社 盗難防止ゲート
US6611783B2 (en) 2000-01-07 2003-08-26 Nocwatch, Inc. Attitude indicator and activity monitoring device
EP1158601A1 (de) * 2000-05-15 2001-11-28 Häni Prolectron Ag Trägerelement für eine Antenne mit geringer Handempfindlichkeit
US6900727B2 (en) 2002-07-16 2005-05-31 Bert Taeho Lee Weapon detector system
US7030750B2 (en) 2002-07-16 2006-04-18 Bert Taeho Lee Detachable entrance and exit gate with a combined commodity burglarproofing and small arms detecting system
KR200298223Y1 (ko) * 2002-09-11 2002-12-16 태호 리 버트 총기류 탐지 겸용 상품도난 방지장치의 출입게이트 구조
US20040102870A1 (en) * 2002-11-26 2004-05-27 Andersen Scott Paul RFID enabled paper rolls and system and method for tracking inventory
WO2005083649A1 (en) * 2004-02-19 2005-09-09 Koninklijke Philips Electronics, N.V. Method and apparatus for communicating the existence of an emergency situation without uniquely identifying the source of the communication
US7591415B2 (en) * 2004-09-28 2009-09-22 3M Innovative Properties Company Passport reader for processing a passport having an RFID element
US20070252001A1 (en) * 2006-04-25 2007-11-01 Kail Kevin J Access control system with RFID and biometric facial recognition
NZ591383A (en) 2008-09-04 2013-08-30 Allflex Usa Inc Combination full-duplex and half-duplex electronic identification tag
NZ599877A (en) * 2009-10-09 2014-03-28 Allflex Usa Inc Hdx demodulator
WO2011041849A1 (en) * 2009-10-09 2011-04-14 Aleis Pty Ltd Radio frequency identification reader antenna having a dynamically adjustable q-factor
EP2497152B1 (en) * 2009-11-04 2020-01-01 Allflex Usa, Inc. Signal cancelling transmit/receive multi-loop antenna for a radio frequency identification reader
US20120139730A1 (en) * 2010-12-03 2012-06-07 Metrologic Instruments, Inc. Electronic article surveillance system
US9004164B2 (en) 2011-04-25 2015-04-14 Conocophillips Company In situ radio frequency catalytic upgrading
WO2013013680A1 (de) * 2011-07-22 2013-01-31 MAX-PLANCK-Gesellschaft zur Förderung der Wissenschaften e.V. Antenne und antennenanordnung für magnetresonanz-anwendungen
US20130241745A1 (en) 2011-10-11 2013-09-19 Senseonics, Incorporated Electrodynamic field strength triggering system
US9577349B2 (en) 2015-06-29 2017-02-21 Near Field Magnetics, Inc. Near-field magnetic communication antenna
DE102017105649A1 (de) * 2017-03-16 2018-09-20 Bundesdruckerei Gmbh RFID-Lesegerät und Verfahren zu seiner Herstellung
US11277029B2 (en) 2017-05-26 2022-03-15 Nucurrent, Inc. Multi coil array for wireless energy transfer with flexible device orientation
US11283303B2 (en) 2020-07-24 2022-03-22 Nucurrent, Inc. Area-apportioned wireless power antenna for maximized charging volume
US11695302B2 (en) 2021-02-01 2023-07-04 Nucurrent, Inc. Segmented shielding for wide area wireless power transmitter

Family Cites Families (11)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
GB419783A (en) * 1933-02-02 1934-11-19 Marconi Wireless Telegraph Co Improvements in and relating to wireless receiving apparatus
US2391026A (en) * 1943-11-15 1945-12-18 Standard Telephones Cables Ltd Shielded loop antenna
JPS4327094Y1 (OSRAM) * 1964-02-25 1968-11-09
US3863244A (en) * 1972-06-14 1975-01-28 Lichtblau G J Electronic security system having improved noise discrimination
US3810147A (en) * 1971-12-30 1974-05-07 G Lichtblau Electronic security system
US3967161A (en) * 1972-06-14 1976-06-29 Lichtblau G J A multi-frequency resonant tag circuit for use with an electronic security system having improved noise discrimination
US3973263A (en) * 1973-04-20 1976-08-03 The United States Of America As Represented By The Secretary Of The Navy Sensitivity improvement of spaced-loop antenna by capacitive gap loading
JPS5046062A (OSRAM) * 1973-08-28 1975-04-24
JPS5226879A (en) * 1975-08-26 1977-02-28 Nippon Telegr & Teleph Corp <Ntt> Method of measuring phase constants in waveguides
US4243980A (en) * 1978-02-17 1981-01-06 Lichtblau G J Antenna system for electronic security installations
US4260990A (en) * 1979-11-08 1981-04-07 Lichtblau G J Asymmetrical antennas for use in electronic security systems

Also Published As

Publication number Publication date
MX148678A (es) 1983-05-27
JPH0230553B2 (OSRAM) 1990-07-06
SE445498B (sv) 1986-06-23
ZA806639B (en) 1981-11-25
FR2470976B1 (OSRAM) 1984-11-23
IT8068658A0 (it) 1980-10-30
US4251808A (en) 1981-02-17
DE3043026C2 (OSRAM) 1990-02-22
DE3043026A1 (de) 1981-05-21
DK158686C (da) 1991-02-25
CA1148630A (en) 1983-06-21
SE8007986L (sv) 1981-05-16
ES496218A0 (es) 1982-02-16
IT1129351B (it) 1986-06-04
DK489380A (da) 1981-05-16
FR2470976A1 (fr) 1981-06-12
JPS5683000A (en) 1981-07-07
GB2063569B (en) 1983-06-22
DK158686B (da) 1990-07-02
ES507188A0 (es) 1982-12-16
ES8302369A1 (es) 1982-12-16
GB2063569A (en) 1981-06-03
AU530083B2 (en) 1983-06-30
AU6298980A (en) 1981-06-04

Similar Documents

Publication Publication Date Title
ES8202958A1 (es) Un sistema de antenas para su uso en un sistema electronico de seguridad.
ES477673A1 (es) Sistema de antenas para su uso en un sistema de seguridad electronico.
ES8703689A1 (es) Un sistema de antenas para su uso en un sistema electronico de seguridad.
EP0407532B1 (en) Antenna structure for an electronic article surveillance system
EP0645840B1 (en) Antenna configuration of an electromagnetic detection system and an electromagnetic detection system comprising such antenna configuration
US4872018A (en) Multiple loop antenna
GB1516006A (en) Article detection system with near field electromagnetic wave control
IL130767A (en) Multiple loop antenna
US4972198A (en) Multiple loop antenna
GB1453754A (en) Antenna apparatus for an electronic security system
KR970705197A (ko) 송수신용 루프 안테나(Transmit and receive loop antenna)
DE3373232D1 (en) Detection system
ES8401653A1 (es) Un dispositivo marcador utilizable para propositos de vigilancia o control y una instalacion que lo incluye
CA2023253A1 (en) Magnetic antenna system having independently controllable electrical field shielding and magnetic field balance
GB664330A (en) Improvements in antenna systems
GB596479A (en) Directive antenna system
GB710467A (en) Improvements in or relating to aerial systems
GB1156984A (en) Antenna
CHERNIAK Space-frequency filtering of signals in the presence of stochastic interference in multi-channel receiving systems
JPS5661804A (en) Microstrip antenna
JPS5242393A (en) Electronic type detector
GB1251316A (OSRAM)
GB556324A (en) Improvements in or relating to antenna systems
JPS5773447A (en) Input device of position information
KNAPP et al. WEDCOM 4: A FORTRAN code for the calculation of ELF, VLF, and LF propagation in a nuclear environment. Volume 2: Computer routines[Topical Report, 15 Oct. 1977- 1 Nov. 1978]

Legal Events

Date Code Title Description
FD1A Patent lapsed

Effective date: 19971205