AU530083B2 - Loop antennas for electronic security system - Google Patents

Loop antennas for electronic security system

Info

Publication number
AU530083B2
AU530083B2 AU62989/80A AU6298980A AU530083B2 AU 530083 B2 AU530083 B2 AU 530083B2 AU 62989/80 A AU62989/80 A AU 62989/80A AU 6298980 A AU6298980 A AU 6298980A AU 530083 B2 AU530083 B2 AU 530083B2
Authority
AU
Australia
Prior art keywords
security system
loop antennas
electronic security
electronic
antennas
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
AU62989/80A
Other languages
English (en)
Other versions
AU6298980A (en
Inventor
George Jay Lichtblau
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Individual
Original Assignee
Individual
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Individual filed Critical Individual
Publication of AU6298980A publication Critical patent/AU6298980A/en
Application granted granted Critical
Publication of AU530083B2 publication Critical patent/AU530083B2/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • GPHYSICS
    • G08SIGNALLING
    • G08BSIGNALLING OR CALLING SYSTEMS; ORDER TELEGRAPHS; ALARM SYSTEMS
    • G08B13/00Burglar, theft or intruder alarms
    • G08B13/22Electrical actuation
    • G08B13/24Electrical actuation by interference with electromagnetic field distribution
    • G08B13/2402Electronic Article Surveillance [EAS], i.e. systems using tags for detecting removal of a tagged item from a secure area, e.g. tags for detecting shoplifting
    • G08B13/2465Aspects related to the EAS system, e.g. system components other than tags
    • G08B13/2468Antenna in system and the related signal processing
    • G08B13/2471Antenna signal processing by receiver or emitter
    • GPHYSICS
    • G08SIGNALLING
    • G08BSIGNALLING OR CALLING SYSTEMS; ORDER TELEGRAPHS; ALARM SYSTEMS
    • G08B13/00Burglar, theft or intruder alarms
    • G08B13/22Electrical actuation
    • G08B13/24Electrical actuation by interference with electromagnetic field distribution
    • G08B13/2402Electronic Article Surveillance [EAS], i.e. systems using tags for detecting removal of a tagged item from a secure area, e.g. tags for detecting shoplifting
    • G08B13/2465Aspects related to the EAS system, e.g. system components other than tags
    • G08B13/2468Antenna in system and the related signal processing
    • G08B13/2474Antenna or antenna activator geometry, arrangement or layout
    • HELECTRICITY
    • H01ELECTRIC ELEMENTS
    • H01QANTENNAS, i.e. RADIO AERIALS
    • H01Q7/00Loop antennas with a substantially uniform current distribution around the loop and having a directional radiation pattern in a plane perpendicular to the plane of the loop
    • H01Q7/04Screened antennas

Landscapes

  • Engineering & Computer Science (AREA)
  • Physics & Mathematics (AREA)
  • Signal Processing (AREA)
  • Automation & Control Theory (AREA)
  • Computer Security & Cryptography (AREA)
  • Electromagnetism (AREA)
  • General Physics & Mathematics (AREA)
  • Burglar Alarm Systems (AREA)
  • Variable-Direction Aerials And Aerial Arrays (AREA)
  • Details Of Aerials (AREA)
AU62989/80A 1979-11-15 1980-10-06 Loop antennas for electronic security system Ceased AU530083B2 (en)

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US06/094,429 US4251808A (en) 1979-11-15 1979-11-15 Shielded balanced loop antennas for electronic security systems
US094429 1979-11-15

Publications (2)

Publication Number Publication Date
AU6298980A AU6298980A (en) 1981-06-04
AU530083B2 true AU530083B2 (en) 1983-06-30

Family

ID=22245143

Family Applications (1)

Application Number Title Priority Date Filing Date
AU62989/80A Ceased AU530083B2 (en) 1979-11-15 1980-10-06 Loop antennas for electronic security system

Country Status (13)

Country Link
US (1) US4251808A (OSRAM)
JP (1) JPS5683000A (OSRAM)
AU (1) AU530083B2 (OSRAM)
CA (1) CA1148630A (OSRAM)
DE (1) DE3043026A1 (OSRAM)
DK (1) DK158686C (OSRAM)
ES (2) ES496218A0 (OSRAM)
FR (1) FR2470976A1 (OSRAM)
GB (1) GB2063569B (OSRAM)
IT (1) IT1129351B (OSRAM)
MX (1) MX148678A (OSRAM)
SE (1) SE445498B (OSRAM)
ZA (1) ZA806639B (OSRAM)

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
AU608720B2 (en) * 1988-07-29 1991-04-11 Knogo Corporation Load isolated article surveillance system and antenna assembly
AU640464B2 (en) * 1990-02-28 1993-08-26 Esselte Meto International Produktions Gmbh Detection apparatus for security systems

Families Citing this family (61)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CA1138955A (en) * 1979-09-14 1983-01-04 Edward R. Fearon Anti-shoplifting system
US4373163A (en) * 1980-07-14 1983-02-08 I.D. Engineering, Inc. Loop antenna for security systems
US4384281A (en) * 1980-10-31 1983-05-17 Knogo Corporation Theft detection apparatus using saturable magnetic targets
US4342999A (en) * 1980-11-25 1982-08-03 Rca Corporation Loop antenna arrangements for inclusion in a television receiver
USRE32627E (en) * 1981-09-10 1988-03-22 Sensormatic Electronics Corporation Electrical surveillance apparatus with moveable antenna elements
US4394645A (en) * 1981-09-10 1983-07-19 Sensormatic Electronics Corporation Electrical surveillance apparatus with moveable antenna elements
AU1152083A (en) * 1983-01-03 1984-08-02 Shin, M. Anti-shoplifting system
US4509039A (en) * 1983-07-05 1985-04-02 Minnesota Mining And Manufacturing Company Shielded, closely spaced transmit-receiver antennas for electronic article surveillance system
US4531117A (en) * 1983-07-05 1985-07-23 Minnesota Mining And Manufacturing Company Variable frequency RF electronic surveillance system
US4609911A (en) * 1983-07-05 1986-09-02 Minnesota Mining And Manufacturing Company Variable frequency RF electronic surveillance system
US4642613A (en) * 1984-03-16 1987-02-10 Knogo Corporation Electronic theft detection apparatus with responder elements on protected articles
US4751516A (en) * 1985-01-10 1988-06-14 Lichtblau G J Antenna system for magnetic and resonant circuit detection
AU633247B2 (en) * 1985-01-10 1993-01-28 Checkpoint Systems, Inc. Antenna system for magnetic and resonant circuit detection
US4647910A (en) * 1985-09-17 1987-03-03 Allied Corporation Selector for AC magnetic inductive field receiver coils
US4728938A (en) * 1986-01-10 1988-03-01 Checkpoint Systems, Inc. Security tag deactivation system
US4769631A (en) * 1986-06-30 1988-09-06 Sensormatic Electronics Corporation Method, system and apparatus for magnetic surveillance of articles
JPS63236401A (ja) * 1987-03-25 1988-10-03 Kokusai Electric Co Ltd 誘導無線装置用ループアンテナ
US4779077A (en) * 1987-04-13 1988-10-18 Lichtblau G J Continuously armed high reliability pulse train processor
US4872018A (en) * 1987-08-31 1989-10-03 Monarch Marking Systems, Inc. Multiple loop antenna
US4972198A (en) * 1987-08-31 1990-11-20 Monarch Marking Systems, Inc. Multiple loop antenna
US5103235A (en) * 1988-12-30 1992-04-07 Checkpoint Systems, Inc. Antenna structure for an electronic article surveillance system
US4999641A (en) * 1989-09-01 1991-03-12 Monarch Marking Systems, Inc. Magnetic antenna system having independently controllable electrical field shielding and magnetic field balance
US5051726A (en) * 1990-08-14 1991-09-24 Sensormatic Electronics Corporation Electronic article surveillance system with antenna array for enhanced field falloff
NL9100397A (nl) * 1991-03-06 1992-10-01 Nedap Nv Asymmetrische antenne voor winkeldiefstaldetectiesystemen.
US5142292A (en) * 1991-08-05 1992-08-25 Checkpoint Systems, Inc. Coplanar multiple loop antenna for electronic article surveillance systems
US5442334A (en) * 1992-07-20 1995-08-15 Stoplift Corporation Security system having deactivatable security tag
US5404147A (en) * 1992-10-28 1995-04-04 Sensormatic Electronics Corporation EAS system loop antenna having three loops of different area
US5373301A (en) * 1993-01-04 1994-12-13 Checkpoint Systems, Inc. Transmit and receive antenna having angled crossover elements
ATE169776T1 (de) * 1993-07-13 1998-08-15 Actron Entwicklungs Ag Antennenvorrichtung
US5694139A (en) * 1994-06-28 1997-12-02 Sony Corporation Short-distance communication antenna and methods of manufacturing and using the short-distance communication antenna
EP0703637A1 (de) 1994-09-23 1996-03-27 Actron Entwicklungs AG Antenne für ein elektronisches Sicherungssystem
ES2284172T3 (es) * 1995-05-30 2007-11-01 Sensormatic Electronics Corporation Configuracion de antenas para un sistema electronico de vigilancia de articulos con distribucion del campo de interrogacion mejorada.
US5602556A (en) * 1995-06-07 1997-02-11 Check Point Systems, Inc. Transmit and receive loop antenna
US5825335A (en) * 1995-10-23 1998-10-20 Kubota Corporation Sheet antenna apparatus
US5653192A (en) * 1996-03-06 1997-08-05 Alfa Laval Agri Inc. Livestock identification apparatus
EP0892969A4 (en) * 1996-04-10 2000-12-06 Sentry Technology Corp ELECTRONIC GOODS MONITORING SYSTEM
US5914692A (en) * 1997-01-14 1999-06-22 Checkpoint Systems, Inc. Multiple loop antenna with crossover element having a pair of spaced, parallel conductors for electrically connecting the multiple loops
DE19732254A1 (de) * 1997-07-26 1999-02-11 Kaba Benzing Gmbh Vorrichtung zur Übermittlung magnetischer Signale mittels einer Leiterplatte
JP3389464B2 (ja) 1997-08-07 2003-03-24 三洋電機株式会社 盗難防止ゲート
US6611783B2 (en) 2000-01-07 2003-08-26 Nocwatch, Inc. Attitude indicator and activity monitoring device
EP1158601A1 (de) * 2000-05-15 2001-11-28 Häni Prolectron Ag Trägerelement für eine Antenne mit geringer Handempfindlichkeit
US7030750B2 (en) 2002-07-16 2006-04-18 Bert Taeho Lee Detachable entrance and exit gate with a combined commodity burglarproofing and small arms detecting system
US6900727B2 (en) 2002-07-16 2005-05-31 Bert Taeho Lee Weapon detector system
KR200298223Y1 (ko) * 2002-09-11 2002-12-16 태호 리 버트 총기류 탐지 겸용 상품도난 방지장치의 출입게이트 구조
US20040102870A1 (en) * 2002-11-26 2004-05-27 Andersen Scott Paul RFID enabled paper rolls and system and method for tracking inventory
WO2005083649A1 (en) * 2004-02-19 2005-09-09 Koninklijke Philips Electronics, N.V. Method and apparatus for communicating the existence of an emergency situation without uniquely identifying the source of the communication
US7591415B2 (en) * 2004-09-28 2009-09-22 3M Innovative Properties Company Passport reader for processing a passport having an RFID element
US20070252001A1 (en) * 2006-04-25 2007-11-01 Kail Kevin J Access control system with RFID and biometric facial recognition
EP2327230B1 (en) 2008-09-04 2013-03-27 Allflex Usa, Inc. Combination full-duplex and half-duplex electronic identification tag
NO2486552T3 (OSRAM) * 2009-10-09 2018-01-27
NZ599877A (en) * 2009-10-09 2014-03-28 Allflex Usa Inc Hdx demodulator
CA2783571C (en) * 2009-11-04 2018-01-09 Allflex Usa, Inc. Signal cancelling transmit/receive multi-loop antenna for a radio frequency identification reader
US20120139730A1 (en) * 2010-12-03 2012-06-07 Metrologic Instruments, Inc. Electronic article surveillance system
WO2012149025A1 (en) * 2011-04-25 2012-11-01 Conocophillips Company In situ radio frequency catalytic upgrading
US9671478B2 (en) * 2011-07-22 2017-06-06 Max-Planck-Gesellschaft Zur Foerderung Der Wissenschaften E.V. Antenna and antenna arrangement for magnetic resonance applications
CN103988238B (zh) 2011-10-11 2017-05-10 传感技术股份有限公司 电动力场强触发系统
US9577349B2 (en) 2015-06-29 2017-02-21 Near Field Magnetics, Inc. Near-field magnetic communication antenna
DE102017105649A1 (de) * 2017-03-16 2018-09-20 Bundesdruckerei Gmbh RFID-Lesegerät und Verfahren zu seiner Herstellung
US11283296B2 (en) 2017-05-26 2022-03-22 Nucurrent, Inc. Crossover inductor coil and assembly for wireless transmission
US11283303B2 (en) * 2020-07-24 2022-03-22 Nucurrent, Inc. Area-apportioned wireless power antenna for maximized charging volume
US11695302B2 (en) 2021-02-01 2023-07-04 Nucurrent, Inc. Segmented shielding for wide area wireless power transmitter

Family Cites Families (11)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
GB419783A (en) * 1933-02-02 1934-11-19 Marconi Wireless Telegraph Co Improvements in and relating to wireless receiving apparatus
US2391026A (en) * 1943-11-15 1945-12-18 Standard Telephones Cables Ltd Shielded loop antenna
JPS4327094Y1 (OSRAM) * 1964-02-25 1968-11-09
US3810147A (en) * 1971-12-30 1974-05-07 G Lichtblau Electronic security system
US3863244A (en) * 1972-06-14 1975-01-28 Lichtblau G J Electronic security system having improved noise discrimination
US3967161A (en) * 1972-06-14 1976-06-29 Lichtblau G J A multi-frequency resonant tag circuit for use with an electronic security system having improved noise discrimination
US3973263A (en) * 1973-04-20 1976-08-03 The United States Of America As Represented By The Secretary Of The Navy Sensitivity improvement of spaced-loop antenna by capacitive gap loading
JPS5046062A (OSRAM) * 1973-08-28 1975-04-24
JPS5226879A (en) * 1975-08-26 1977-02-28 Nippon Telegr & Teleph Corp <Ntt> Method of measuring phase constants in waveguides
US4243980A (en) * 1978-02-17 1981-01-06 Lichtblau G J Antenna system for electronic security installations
US4260990A (en) * 1979-11-08 1981-04-07 Lichtblau G J Asymmetrical antennas for use in electronic security systems

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
AU608720B2 (en) * 1988-07-29 1991-04-11 Knogo Corporation Load isolated article surveillance system and antenna assembly
AU640464B2 (en) * 1990-02-28 1993-08-26 Esselte Meto International Produktions Gmbh Detection apparatus for security systems

Also Published As

Publication number Publication date
DE3043026A1 (de) 1981-05-21
ZA806639B (en) 1981-11-25
GB2063569A (en) 1981-06-03
ES8202958A1 (es) 1982-02-16
ES507188A0 (es) 1982-12-16
DE3043026C2 (OSRAM) 1990-02-22
ES8302369A1 (es) 1982-12-16
DK158686C (da) 1991-02-25
DK158686B (da) 1990-07-02
SE8007986L (sv) 1981-05-16
FR2470976B1 (OSRAM) 1984-11-23
US4251808A (en) 1981-02-17
SE445498B (sv) 1986-06-23
IT8068658A0 (it) 1980-10-30
AU6298980A (en) 1981-06-04
GB2063569B (en) 1983-06-22
JPH0230553B2 (OSRAM) 1990-07-06
FR2470976A1 (fr) 1981-06-12
ES496218A0 (es) 1982-02-16
JPS5683000A (en) 1981-07-07
DK489380A (da) 1981-05-16
IT1129351B (it) 1986-06-04
CA1148630A (en) 1983-06-21
MX148678A (es) 1983-05-27

Similar Documents

Publication Publication Date Title
AU530083B2 (en) Loop antennas for electronic security system
GB2062969B (en) Antenna systems for electronic security systems
JPS54115099A (en) Antenna system for electronic security system
DE3066820D1 (en) Electronic tuning antenna system
GB2051442B (en) Security system
DE3070243D1 (en) System for electronic audio communication
GB2080040B (en) Passive stabilisation system for tracking antennas
AU514190B2 (en) Microwave surveillance system
AU2897184A (en) Shielded loop for electronic surveillance system
DE3070576D1 (en) Directivity-controllable antenna system
AU532289B2 (en) Segmented loop antenna system
GB2039683B (en) Security system
AU536696B2 (en) Antenna
AU496857B1 (en) Feed system for microwave antenna
AU7760881A (en) Receiver loop antenna
AU531930B2 (en) Antenna locking mount
DE3070377D1 (en) Combined antenna system
AU5714280A (en) Electromagnetic devices
JPS55165382A (en) Lock system
AU6060580A (en) Key loop
GB2051445B (en) Surveillance system
IL57521A0 (en) An electronic security system
AU525443B2 (en) Security system
AU536803B2 (en) Security system
AU526820B2 (en) Security system