EP4185281A1 - Composés pour le traitement de l'hémophilie - Google Patents

Composés pour le traitement de l'hémophilie

Info

Publication number
EP4185281A1
EP4185281A1 EP21742857.2A EP21742857A EP4185281A1 EP 4185281 A1 EP4185281 A1 EP 4185281A1 EP 21742857 A EP21742857 A EP 21742857A EP 4185281 A1 EP4185281 A1 EP 4185281A1
Authority
EP
European Patent Office
Prior art keywords
compound
use according
group
general formula
saturated
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Pending
Application number
EP21742857.2A
Other languages
German (de)
English (en)
Inventor
Aline Thomas
Marie-Claire DAGHER
Muriel JOURDAN
Romain NAVARRO
Benoît POLACK
Raphael Marlu
Landry SEYVE
Renaud ZELLI
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Centre National de la Recherche Scientifique CNRS
Institut Polytechnique de Grenoble
Centre Hospitalier Universitaire de Grenoble
Universite Grenoble Alpes
Original Assignee
Centre National de la Recherche Scientifique CNRS
Institut Polytechnique de Grenoble
Centre Hospitalier Universitaire de Grenoble
Universite Grenoble Alpes
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Centre National de la Recherche Scientifique CNRS, Institut Polytechnique de Grenoble, Centre Hospitalier Universitaire de Grenoble, Universite Grenoble Alpes filed Critical Centre National de la Recherche Scientifique CNRS
Publication of EP4185281A1 publication Critical patent/EP4185281A1/fr
Pending legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/185Acids; Anhydrides, halides or salts thereof, e.g. sulfur acids, imidic, hydrazonic or hydroximic acids
    • A61K31/19Carboxylic acids, e.g. valproic acid
    • A61K31/192Carboxylic acids, e.g. valproic acid having aromatic groups, e.g. sulindac, 2-aryl-propionic acids, ethacrynic acid 
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/01Hydrocarbons
    • A61K31/015Hydrocarbons carbocyclic
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/16Amides, e.g. hydroxamic acids
    • A61K31/165Amides, e.g. hydroxamic acids having aromatic rings, e.g. colchicine, atenolol, progabide
    • A61K31/166Amides, e.g. hydroxamic acids having aromatic rings, e.g. colchicine, atenolol, progabide having the carbon of a carboxamide group directly attached to the aromatic ring, e.g. procainamide, procarbazine, metoclopramide, labetalol
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/185Acids; Anhydrides, halides or salts thereof, e.g. sulfur acids, imidic, hydrazonic or hydroximic acids
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/395Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/40Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having five-membered rings with one nitrogen as the only ring hetero atom, e.g. sulpiride, succinimide, tolmetin, buflomedil
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/395Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/40Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having five-membered rings with one nitrogen as the only ring hetero atom, e.g. sulpiride, succinimide, tolmetin, buflomedil
    • A61K31/403Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having five-membered rings with one nitrogen as the only ring hetero atom, e.g. sulpiride, succinimide, tolmetin, buflomedil condensed with carbocyclic rings, e.g. carbazole
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/395Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/435Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with one nitrogen as the only ring hetero atom
    • A61K31/47Quinolines; Isoquinolines
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P7/00Drugs for disorders of the blood or the extracellular fluid
    • A61P7/04Antihaemorrhagics; Procoagulants; Haemostatic agents; Antifibrinolytic agents

Definitions

  • the present invention falls within the therapeutic field, more specifically in the field of the treatment of hemophilia.
  • the present invention relates to a compound of particular chemical structure, for its use for the treatment of haemophilia.
  • Hemophilia is a rare genetic disease resulting in an impossibility for the blood to clot, and whose symptoms are spontaneous and repetitive post-traumatic bleeding in the joints and muscles. This bleeding can result in severe bleeding, the consequences of which can be particularly serious.
  • hemophilia type A due to a deficiency of the coagulation factor FVIII, which is the most common type of hemophilia
  • hemophilia type B due to a deficiency of the factor coagulation FIX.
  • TFPI tissue Factor Pathway Inhibitor
  • the alpha isoform contains an N-terminus of 22 residues, followed by three Kunitz domains (K1, K2, K3) and then a long negatively charged C-terminus.
  • the beta isoform lacks a K3 domain and is terminated with a different C-terminus.
  • the three-dimensional structure of each Kunitz domain is experimentally known.
  • the K2 domain of TFPI binds to the active site of FXa and the K1 domain of TFPI binds to the active site of FVIIa, as described in particular in the publication by Girard et al., 1989, Nature 338(6215), 518-20.
  • hemophilia is systematically treated by replacement therapies, consisting of intravenous injections, in the subject affected by the disease, of the missing factors FVIII or FIX. These treatments, in addition to their binding mode of administration, have the disadvantage of generating antibodies.
  • New therapeutic strategies currently under development are based on the use of proteins which either increase coagulation, such as emicizumab, a bispecific monoclonal antibody, restoring coagulation equivalently to 10 to 20 IU/dL (10 to 20%) of factor VIII, but which can under certain conditions be responsible for thrombotic accidents, or block the main anticoagulants of the coagulation cascade, in particular TFPI.
  • emicizumab a bispecific monoclonal antibody
  • restoring coagulation equivalently to 10 to 20 IU/dL (10 to 20%) of factor VIII but which can under certain conditions be responsible for thrombotic accidents, or block the main anticoagulants of the coagulation cascade, in particular TFPI.
  • Concizumab an anti-TFPI monoclonal antibody, has in particular been proposed as an inhibitor of TFPI.
  • the present invention aims to provide a treatment for hemophilia not having in particular the disadvantages of antibody/protein-based treatments, this treatment making it possible to effectively restore coagulation in patients affected by the disease, preferably being administered by oral route.
  • the present invention relates to a compound of formula (III') below, or one of its pharmaceutically acceptable salts, for its use, as an active agent, for the treatment of hemophilia in a subject suffering from by illness:
  • Y 1 ' represents a covalent bond or an amide group
  • R 4 ' represents a hydrogen atom, a hydroxyl group, a halogen atom, an amine group or a linear or branched, saturated or unsaturated carbon radical, optionally interrupted and/or substituted by one or more heteroatoms and/or a or more groups comprising at least one heteroatom,
  • Y 2 ' represents a covalent bond or an amide group
  • a 2 ' represents an optionally substituted cyclic or heterocyclic group comprising two fused rings, at least one of said rings being aromatic.
  • the term treatment is understood to mean a curative treatment of the bleeding episodes linked to the disease, and in particular the reduction and/or inhibition of the development of at least one of the associated symptoms, in particular the improvement of clotting and decrease in the amount and/or frequency of bleeding.
  • the subject treated according to the invention is in particular a mammal, for example a non-human mammal. It is preferably a human being.
  • the compound used according to the invention advantageously makes it possible to restore coagulation, by restoring the generation of thrombin, in the plasma of a subject with haemophilia, type A as well as type B, including for subjects affected by severe forms of the disease.
  • the compound according to the invention subjected to an ex vivo test for the generation of fluorimetric thrombin, on the plasma of subjects suffering from severe hemophilia A, allows, at a dose of 50 ⁇ M, to restore the generation of thrombin equivalent to FVIII and even higher depending on the conditions.
  • the compound used according to the invention does not present any toxicity for mammals. It can advantageously be administered orally, much more simply than the proteins used by the prior art, which must in turn be administered by injection.
  • the compound according to the invention and its pharmaceutically acceptable salts, by their chemical nature and their low molecular weight, generally less than 5 kDa and even, for certain combinations of substituents, less than 1 kDa, or even less than 500 Da, are in particular much easier, and less expensive, to prepare than the protein/antibody compounds proposed by the prior art for the treatment of haemophilia.
  • the compound according to the invention can be prepared by any method of synthesis conventional in itself for those skilled in the art.
  • the term “pharmaceutically acceptable salt” means any salt of the compound that does not cause any adverse, allergic or other undesirable reaction when it is administered to the subject, in particular to a human subject.
  • any non-toxic conventional salt of the compound of general formula (III') can be used according to the invention, for example a metallic salt such as a sodium, potassium, magnesium, calcium, lithium salt, etc.
  • a salt formed from organic or inorganic acids may be used, for example salts derived from inorganic acids such as hydrochloric, hydrobromic, phosphoric, sulfuric acids, etc., and salts derived from organic acids such as acetic, trifluoroacetic, propionic, maleic, benzoic, stearic acids, etc.
  • the salt can be synthesized, starting from the compound of general formula (III'), according to any conventional chemical method in itself.
  • R 4 ' represents an -OR 8 group or an -O-CO-R 8 group , where R 8 represents a linear or branched, saturated or unsaturated hydrocarbon radical, in particular alkyl, comprising from 1 to 10 carbon atoms, optionally substituted by one or two R 14 , R 14' substituents, identical or different, each chosen from -F, -CO 2 H, -SO 3 H, - represents a hydrogen atom or a methyl group.
  • R 8 can in particular represent a group of general formula (XVIII): in which y is an integer between 1 and 10 and R 14 is as defined above.
  • R 4 ' is attached to the phenyl radical in the ortho or para position with respect to to the adamantyl unit
  • Y 2 ' is attached to the phenyl radical in the meta position with respect to the adamantyl unit.
  • a 2 ' is at least substituted by one substituent R 11 chosen from fluorine, carboxyl, sulphonyl, phosphonyl, tetrazole or keto-oxadiazole groups, and linear, branched and /or cyclic, saturated or unsaturated, aromatic or not, optionally interrupted and/or substituted by one or more heteroatoms, in particular fluorine, and/or one or more groups comprising at least one heteroatom, in particular carboxyl -CO 2 H, sulfonyl - SO 3 H and/or phosphonyl -P(O)(OH) 2 .
  • R 11 can in particular be chosen from tetrazole or keto-oxadiazole groups of respective formulas:
  • the compound used for the treatment of hemophilia corresponds to the general formula (IX): in which Y 1 ', Y 2 ' and R 4 ' are as defined above,
  • a 3 represents a 3 to 8-membered cyclic or heterocyclic hydrocarbon, saturated or unsaturated, aromatic or not, fused to the adjacent six-membered aromatic ring,
  • R 9 and R 10 which are identical or different, each represent a hydrogen atom, a hydroxyl group or an -OR 12 or -CO-OR 12 group
  • R 12 represents a linear or branched hydrocarbon radical, saturated or unsaturated, in particular alkyl, containing from 1 to 10 carbon atoms, optionally substituted by one or two substituents R 16 , R 16 ' , identical or different, each chosen from -F, -CO2H, -SO 3 H, -P (O)(OH) 2 , -P(O)(OCH 3 )2, -P(O)(OCH 2 CH 3 ) 2 , methyl, and R 11 represents a substituent chosen from fluorine, carboxyl, sulphonyl, phosphonyl, tetrazole or keto-oxadiazole groups, and linear, branched and/or cyclic, saturated
  • R 11 may in particular represent a -(CH 2 ) X -R 13 group where x is an integer between 0 and 4 and R 13 represents a fluorine atom or a carboxyl, sulphonyl, phosphonyl, tetrazole or keto-oxadiazole group , in particular a tetrazole or keto-oxadiazole group of respective formulas:
  • R 9 and R 10 which are identical or different, may also each represent a group of general formula (XVI II'): in which y' is an integer between 1 and 10 and R 18 is chosen from where R 19 represents a hydrogen atom or a methyl group.
  • the compound used according to the invention may in particular correspond to the general formula (X): in which Y 1 ', Y 2 ', R 4 ', A 3 , B 1 , B 2 , R 9 , R 10 , R 13 and x are as defined above.
  • Y 1 ', Y 2 ', R 4 ', R 13 and x are as defined above.
  • the present invention relates to a compound of formula (I) below, or one of its pharmaceutically acceptable salts, for its use, as an active agent, for said treatment of hemophilia in a subject suffering from by illness: in which
  • W 1 , W 2 , W 3 and W 4 which are identical or different, each represent an oxygen atom or a bivalent radical chosen from the groups -CH 2 -, carbonyl -CO-, amine, in particular secondary amine -NH-, and sulfonyl -SO 2 -, R 1 and R 2 , identical or different, each represent a hydrogen atom, a hydroxyl group or a hydrocarbon radical, preferably C1-C8 and in particular C1-C4, linear, branched and/or cyclic, saturated or unsaturated, aromatic or not, optionally substituted, possibly comprising one or more heteroatoms and/or one or more groups comprising at least one heteroatom and possibly comprising a single cycle or several cycles, fused cycles where appropriate ,
  • R 3 represents a hydrogen atom, a halogen atom, a group alkyl, preferably C1-C8 and preferably C1-C4, or a hydroxyl group
  • R represents a hydrogen atom, a hydroxyl group, an -NH 2 group or a linear, branched and/or cyclic hydrocarbon radical, saturated or unsaturated, aromatic or not, optionally substituted, possibly comprising one or more heteroatoms and/or one or more groups comprising at least one heteroatom and possibly comprising a single cycle or several cycles, where appropriate fused cycles.
  • the compound used according to the invention is adamantane, or tricyclo[3.3.1.1(3.7)]decane, of chemical formula: or one of its derivatives or analogues corresponding to the general formula (I).
  • any non-toxic conventional salt of the compound of general formula (I) can be used according to the invention, for example a metallic salt such as a sodium, potassium, magnesium, calcium, lithium salt, etc.
  • a salt formed from organic or inorganic acids may be used, for example salts derived from inorganic acids such as hydrochloric, hydrobromic, phosphoric, sulfuric acids, etc., and salts derived from organic acids such as as acetic, trifluoroacetic, propionic, maleic, benzoic, stearic, etc.
  • the salt can be synthesized, starting from the compound of general formula (I), according to any conventional chemical method in itself.
  • the compound used according to the invention meets one or more of the characteristics below, implemented alone or according to any technically relevant combination.
  • at least one, preferably at least two, preferably at least three and preferably all four, among W 1 , W 2 , W 3 and W 4 represent(s) a methylene bridge -CH 2 -.
  • R 1 and R 2 which are identical or different, also preferably each represent a hydrogen atom, a hydroxyl group, a C1-C8 alkyl group, preferably a C1-C4 alkyl group or an optionally substituted phenyl radical.
  • R 1 and R 2 can for example be identical, and each represent a hydrogen atom or a methyl group. They can otherwise be different, and for example represent for one, a hydrogen atom, and for the other, a hydroxyl group.
  • W 1 , W 2 , W 3 and W 4 each represent a methylene bridge, R 3 represents a hydrogen atom, R 1 represents a hydrogen atom and R 2 represents a hydroxyl group;
  • W1, W2, W3 and W4 each represent a methylene bridge
  • R 3 represents a hydrogen atom
  • R 1 and R 2 each represent a methyl group
  • W1, W3 and W4 each represent a methylene bridge
  • W 2 represents a carbonyl group
  • R 3 represents a hydrogen atom
  • R 1 and R 2 each represent a methyl group.
  • W 2 can otherwise represent a group of formula:
  • the compound of general formula (I) may be bromantane, in which W 1 , W 3 and W 4 each represent a methylene bridge -CH 2 -, and R 1 , R 2 , R 3 and R each represent a hydrogen atom.
  • R 2 is chosen from the groups of chemical formulas:
  • the compound used according to the invention can thus in particular be saxagliptin, of chemical formula: or vildagliptin, with the chemical formula:
  • R can represent a primary amine group.
  • the 4th compound used according to the invention can then in particular be amantadine or memantine, in which W 1 , W 2 , W 3 and W 4 each represent a methylene bridge -CH 2 -, R 3 represents a hydrogen atom, and R 1 and R 2 each represent a hydrogen atom for the first, and a methyl group for the second.
  • R may otherwise, for example, represent a group chosen from the following groups:
  • the compound used according to the invention can then in particular be adapromine, rimantadine or tromantadine, in which W 1 , W 2 , W 3 and W 4 each represent a methylene bridge -CH 2 -, and R 1 , R 2 and R 3 each represent a hydrogen atom.
  • R represents a group of formula -Y 1 -A 1 , in which: Y 1 represents a covalent bond, an amine group or a linear or branched, saturated or unsaturated, optionally interrupted and/or substituted by one or more heteroatoms and/or one or more groups comprising at least one heteroatom, said carbon radical preferably comprising 1 to 4 carbon atoms, in particular an -NH-CO-, -CO group -NH-, -NH-CS- or -CS-NH-, and A 1 represents a cyclic or heterocyclic, saturated or unsaturated, optionally substituted hydrocarbon, which may comprise a single ring, aromatic or not, or several fused rings, each of said rings which may or may not be aromatic.
  • the compound then corresponds to the general formula (II):
  • a 1 can in particular be of the monocyclic, bicyclic or tricyclic type.
  • a 1 represents a monocyclic unit, preferably aromatic, comprising from 4 to 6 atoms, one or more of these atoms possibly being a heteroatom, and substituted on at least one, preferably at least two (this being understood in addition bond to Y 1 ), ring atoms.
  • a 1 may in particular represent a phenyl radical, substituted on at least two of the ring atoms (this being understood in addition to the bond to Y 1 ), the substituents preferably being located in the para position with respect to the the other, one of the substituents also preferably being located in the ortho position with respect to the bond to Y 1 .
  • a 1 is substituted, in the ortho position with respect to the bond to Y 1 , by a group R 4 representing a hydrogen atom, a hydroxyl group, a halogen atom, an amine group or a linear, branched carbon radical and/or cyclic, saturated or unsaturated, aromatic or not, optionally interrupted and/or substituted by one or more heteroatoms and/or one or more groups comprising at least one heteroatom.
  • group R 4 representing a hydrogen atom, a hydroxyl group, a halogen atom, an amine group or a linear, branched carbon radical and/or cyclic, saturated or unsaturated, aromatic or not, optionally interrupted and/or substituted by one or more heteroatoms and/or one or more groups comprising at least one heteroatom.
  • a 1 is substituted by at least one group of general formula (II'): in which Y 2 represents a covalent bond, an amine group, or a linear or branched, saturated or unsaturated, optionally interrupted and/or substituted by one or more heteroatoms and/or one or more groups comprising at least one heteroatom, preferably C1-C4, in particular an -NH-CO-, -CO-NH-, -NH-CS- or -CS- group NH-, and A 2 represents an optionally substituted cyclic or heterocyclic group, which may comprise a single ring, which may or may not be aromatic, or several fused rings, each of said rings may or may not be aromatic.
  • group of general formula (II') in which Y 2 represents a covalent bond, an amine group, or a linear or branched, saturated or unsaturated, optionally interrupted and/or substituted by one or more heteroatoms and/or one or more groups comprising at least one heteroatom, preferably C1-C4, in
  • a 2 can in particular be of the monocyclic, bicyclic or tricyclic type.
  • a 2 represents a cyclic or heterocyclic group, optionally substituted, comprising two fused rings, at least one of said rings being aromatic, each of said rings preferably comprising between 4 and 6 atoms, one or more of these atoms possibly being a heteroatom.
  • each of the rings of A 2 is aromatic.
  • Each of the rings also preferably comprises 6 carbon atoms.
  • a 2 is preferably substituted on at least one, preferably at least two, of the atoms of at least one ring.
  • a 2 is preferentially substituted on at least one, preferably at least two, ring atoms not carrying the bond to Y 2 .
  • a 2 represents a naphthalene unit, optionally substituted, and preferentially substituted on at least the ring not bearing the bond to Y 2 .
  • a 2 is substituted by at least one group chosen from the group consisting of halogen atoms, in particular chlorine, bromine or iodine atoms, hydroxyl, amine or amine oxide groups , and linear, branched and/or cyclic, saturated or unsaturated, aromatic or non-aromatic carbon radicals, optionally interrupted and/or substituted by one or more heteroatoms and/or one or more groups comprising at least one heteroatom.
  • halogen atoms in particular chlorine, bromine or iodine atoms, hydroxyl, amine or amine oxide groups
  • linear, branched and/or cyclic, saturated or unsaturated, aromatic or non-aromatic carbon radicals optionally interrupted and/or substituted by one or more heteroatoms and/or one or more groups comprising at least one heteroatom.
  • halogen atoms in particular chlorine, bromine or iodine atoms, hydroxyl, amine or amine oxide groups
  • the compound corresponds to the general formula (III): in which W 1 , W 2 , W 3 , W 4 , R 1 , R 2 , R 3 , Y 1 , Y 2 and A 2 are as defined above, and R 4 represents a hydrogen atom, a hydroxyl group, a halogen atom, an amine group or a linear, branched and/or cyclic, saturated or unsaturated, aromatic or non-aromatic carbon radical, optionally interrupted and/or substituted by one or more heteroatoms and/or one or more groups containing at least one heteroatom.
  • R 4 can represent a hydrogen atom or an -OR 5 group, where R 5 represents a C1-C8 alkyl group, preferably C1-C4, and in particular a methyl group.
  • the compound used according to the invention may, for example, correspond to one of the general formulas (IIIa), (IIIb), (IIIc) or (IIId) below:
  • R 4 , Y 2 and A 2 are as defined above.
  • the compound corresponds to the general formula (IV): in which W 1 , W 2 , W 3 , W 4 , R 1 , R 2 , R 3 , Y 1 and Y 2 are as defined above,
  • R5 represents a hydrogen atom or a C1-C8, preferably C1-C4, alkyl group, for example a methyl group
  • R 6 represents a halogen atom, in particular a chlorine, bromine and iodine atom , a hydroxyl, amine or amineoxide group, or a linear, branched and/or cyclic, saturated or unsaturated, aromatic or non-aromatic carbon radical, optionally interrupted and/or substituted by one or more heteroatoms and/or one or more groups comprising at least a heteroatom.
  • R 6 can for example represent an amide, ketoxime, carbonyl, carboxyl, ester, alkyl, in particular C1-C8, in particular C1-C4, aryl, etc
  • R 6 represents a -CO-OR 7 group , where R 7 represents a hydrogen atom, a C1-C8, preferably C1-C4, alkyl group, a aryl group or a C6-C14 arylalkyl group.
  • the compound used according to the invention may in particular correspond to one of the general formulas (IVa), (IVb), (IVc) and (IVd) below:
  • a particularly preferred compound according to the invention is adapalene, name given to 6-[3-(1-adamantyl)-4-methoxyphenyl]naphthalene-2-carboxylic acid, of formula (V):
  • Adapalene is particularly effective in restoring coagulation in the plasma of patients with severe hemophilia A.
  • the compound according to the invention can be administered to the subject in need thereof, that is to say suffering from hemophilia, in a therapeutically effective quantity, by any route, in particular by the enteral route, in particular oral, buccal or rectal, parenterally, including subcutaneous, intramuscular, intravenous, intradermal, etc.
  • the administration of the compound to the treated subject is preferably carried out orally.
  • therapeutically effective amount is understood to mean the amount of the compound which makes it possible, when it is administered to the subject, to obtain the desired level of therapeutic response, in particular, for the particular case of hemophilia, the level of restoration of the desired clotting.
  • the therapeutically effective dose level of each specific compound for a particular subject varies depending on many factors such as, for example, the exact pathology and its severity, body weight, age and general health of the subject, duration of treatment, any drugs used in parallel, the sensitivity of the individual to be treated, etc. Accordingly, the optimal dosage is determined by the doctor based on the parameters that he considers relevant.
  • the administration dosage of the compound used according to the invention can for example be taken once or twice a day.
  • the compound is contained in a pharmaceutical composition, within which it constitutes an active principle, and is contained in a pharmaceutically acceptable vehicle.
  • This pharmaceutical composition may be in any form suitable for enteral or parenteral administration. It is preferably presented in a form suitable for administration to the subject by the oral route.
  • compositions are of course chosen to be pharmaceutically compatible, that is to say that they do not produce any adverse, allergic or other undesirable reaction when they are administered to the subject, in particular to a mammal and in particular to a human.
  • the pharmaceutical composition may contain any conventional excipient by itself.
  • an excipient may be a diluent, an adjuvant or any other conventional substance in itself for the constitution of medicaments, such as a preservative, filler, disintegrating, wetting, emulsifying, dispersing, antibacterial or antifungal agent, etc., or any of their mixtures
  • It may also contain one or more other active principles, acting or not acting in synergy with the compound used according to the invention,
  • the pharmaceutical composition can be formulated according to any pharmaceutical form suitable for oral administration in mammals, and in particular in humans. It may in particular be in the form of a powder, of tablets, of capsules, of granules, of a syrup, or of an oral solution or suspension, prepared in a conventional manner by itself.
  • each dose containing a therapeutically effective quantity of the compound according to the invention.
  • concentration of the compound in each dose of the pharmaceutical composition is thus preferably chosen to deliver to the subject, at each administration, an amount of compound which is effective to obtain the desired therapeutic response.
  • the pharmaceutical composition is for example packaged in the form of unit doses, which may in particular each comprise a quantity of between 1 and 10 g of the compound according to the invention.
  • the present invention is also expressed in terms of a method of treating hemophilia in a subject, and in particular a method of restoring coagulation in the plasma of a subject afflicted with hemophilia.
  • the subject can in particular be a mammal, and preferentially a human being.
  • This method comprises the administration, to said subject in need, of a therapeutically effective amount of the compound as defined above, or one of its pharmaceutically acceptable salts.
  • This method can meet one or more of the characteristics described above with reference to the use of the compound according to the invention for the treatment of haemophilia.
  • the present invention is also expressed in terms of the use of a compound according to the invention, or of one of its pharmaceutically acceptable salts, for the manufacture of a medicament for the treatment of haemophilia.
  • This use may correspond to one or more of the characteristics described above with reference to the use of the compound according to the invention for the treatment of haemophilia.
  • FIG. 1 shows a graph representing the results (amount of thrombin as a function of time) of an ex vivo thrombin generation test for the plasma of a subject suffering from severe hemophilia A, in the presence of plasma factor FVIII (100 % VIII, positive control), dilution buffer (0% VIII, negative control), and a compound according to the invention, adapalene, at respective concentrations of 0.5 mM, 5 mM and 50 mM.
  • FIG. 2 represents the chemical structure of comparative compounds C1 to C9 implemented in an example, not corresponding to the general formula (I).
  • FIG. 3 shows a histogram representing the amount of thrombin measured at the peak during an ex vivo thrombin generation test (TGT) in the plasma of an individual suffering from severe hemophilia A, in the presence of plasma factor FVIII (100 % VIII, positive control), dilution buffer (0 % VIII, control negative) and in the presence of adapalene at 50 mM (Ad) or of a comparative compound C1 to C9 not corresponding to the general formula (I).
  • TGT ex vivo thrombin generation test
  • Figure 4 shows a histogram representing the total amount of thrombin generated (endogenous thrombin potential) during an ex vivo thrombin generation test (TGT) in the plasma of an individual with severe hemophilia A, in the presence of plasma FVIII factor (100% VIII, positive control), dilution buffer (0% VIII, negative control) and in the presence of 50 mM adapalene (Ad) or a comparative compound C1 to C9 not responding to the general formula (I).
  • TGT ex vivo thrombin generation test
  • coagulation cascade a chain of enzymatic reactions, called the coagulation cascade. It results in the production of thrombin (factor IIa), the last enzymatic “link” in this coagulation cascade.
  • the thrombin generation test consists of measuring the kinetics of appearance of this key coagulation factor in the plasma over time. After activation of coagulation by calcium, the amount of thrombin changes over time. It is measured using a synthetic thrombin substrate coupled to a fluorescent molecule (ZGGR-AMC). The main parameters determined are the latency time before observing an increase in thrombin generation, the thrombin peak corresponding to the maximum amount of thrombin generated and I ⁇ TR (endogenous thrombin potential) corresponding to the total amount of thrombin generated. in the plasma during the test. In the case of a haemophilia A patient, the generation of thrombin is low or even almost zero for some patients.
  • thrombin generation test makes it possible to globally evaluate the coagulation rate of a given plasma and in the present case, it makes it possible to evaluate the capacity of a molecule to restore or not restore coagulation in a hemophiliac patient.
  • Hemophilia patient plasma was obtained from Cryopep (Montpellier, France).
  • Adapalene is commercially available, in particular from Prestwick. It was dissolved in an 8% solution of dimethylsulfoxide (DMSO) then diluted to a concentration of 1 mM and then tested at the following concentrations: 50 mM, 5 mM, 0.5 mM (final concentrations in plasma).
  • DMSO dimethylsulfoxide
  • the thrombin generation test was performed at 37°C using a fully automated STA-Genesia analyzer (Diagnostica Stago) with STG®- Bleedscreen reagent (Diagnostica Stago) according to the manufacturer's instructions and according to the method established by Pr. Hemker in 2003.
  • the STG®- Bleedscreen reagent is a mixture of tissue factor (TF) at low concentration with phospholipid vesicles (PL).
  • the test is triggered by the addition of a mixture of calcium + fluorescent substrate (ZGGR-AMC) (STG®-FluoStart mixture).
  • the plasma of a hemophiliac patient is spiked with the same buffer for diluting the compound, an 8% solution of dimethylsulfoxide (DMSO), as a negative control (0.4% of final DMSO ) in order to obtain the basal level of thrombin generation of the plasma used.
  • DMSO dimethylsulfoxide
  • the positive control is the same plasma spiked with plasma factor VIII (Factane, LFB, France) at a concentration of 1 IU/mL (or 100% factor VIII) in order to obtain the expected “normal” level of thrombin generation plasma used.
  • the negative control (plasma from a hemophilia A patient overloaded with the dilution buffer) shows weak thrombin generation with a peak at 25 nM of thrombin and an ETP at 360 nM.min.
  • the positive control (plasma from a hemophilia A patient spiked with 1 IU/mL of factor VIII) shows a “normal” generation of thrombin with a peak at 51 nM and an ETP at 599 nM.min.
  • concentration of adapalene For the different concentrations of adapalene, an increase in the generation of thrombin is observed depending on the concentration of adapalene: the higher the concentration, the greater the generation of thrombin.
  • adapalene already has an effect on increasing thrombin generation with a peak at 29.7 nM and an ETP at 455 nM.min.
  • the increase in thrombin generation is greater with a peak at 39 nM and an ETP at 504 nM.min.
  • adapalene restores thrombin generation to the same level as the positive control (100% FVIII) with a peak at 55 nM and an ETP at 588 nM.min.
  • adapalene (Ad) at 50 mM makes it possible to obtain an increase in the generation of thrombin compared to the negative control, with a peak of thrombin generated and an ETP at the same level as the positive control.
  • TFPI-K1 K2 truncated human TFPI
  • Adapalene was tested for its ability to release FXa inhibition by TFPI-K1 K2 using a colorimetric assay in a 96-well plate format. All steps were performed at room temperature. FXa inhibition by increasing TFPI-K1 K2 concentrations was first analyzed to determine the best detection conditions. Concentrations of TFPI-K1 K2 and of FXa (New England Biolabs) of 30 nM and 0.5 nM respectively, were chosen to ensure complete inhibition of FXa, without a significant excess of TFPI-K1 K2. Each protein was diluted using the same buffer: 20 mM Hepes, 135 mM NaCl, 1% BSA, 2 mM CaCl 2 , pH 7.3. The test was performed manually in 96-well plates (Nunc Maxisorp®). The experiment was performed in duplicate at a final adapalene concentration of 50 mM.
  • the plates were centrifuged to remove any bubbles and the optical density (OD) at 405 nm, corresponding to the hydrolysis of the PNAPEP-1025 substrate, was measured for 1 h at room temperature.
  • Pd2(dba)2 (1.7 mg, 0.0016 mmol, 1 mol%) was added to a flame-dried reactor followed by SPHOS (2.6 mg, 0.0064 mmol, 4 mol%), 1 -(5-bromo-2-methoxyphenyl)adamantane (5) (50 mg, 0.16 mmol, 1 eq.), methyl 1,2,3,4-tetrahydroisoquinoline-6-carboxylate hydrochloride (6) (43 mg , 0.19 mmol, 1.2 eq.) and NaOfBu (36.5 mg, 0.38 mmol, 2.4 eq.). Anhydrous toluene (600mI, 267mM) was added and the reactor was sealed.
  • ester (10) (30 mg, 0.07 mmol, 1eq.) in 4:1 THF:MeOH at room temperature was added 2M NaOH (105 ⁇ I, 0.21 mmol, 3 eq.) .
  • the solution obtained was mixed for 16 h at 60°C.
  • the reaction mixture was then poured into water and the aqueous phase was extracted with AcOEt.
  • the resulting aqueous phase was acidified using 1 M HCl and extracted 3 times with AcOEt.
  • the combined organic phases were dried over Na 2 SO 4 , filtered and concentrated in vacuo to obtain (HEMO-031) (17 mg, 59%) in the form of a white solid.
  • ester (12) 15 mg, 0.035 mmol, 1eq.
  • 2M NaOH 53 ⁇ l, 0.11 mmol, 3 eq.
  • the solution obtained was stirred for 2 hours at 60°C.
  • the reaction mixture was poured into water and the aqueous phase was extracted with AcOEt.
  • the resulting aqueous phase was acidified with 1 M HCl and extracted 3 times with AcOEt.
  • the combined organic phases were dried over Na2SO4, filtered and concentrated in vacuo to obtain (HEMO-032) (9mg, 62%) as a white solid.
  • a second thrombin generation test is carried out, for compounds H27, H31, H32, H35, H38, H39 and compound H24.
  • the thrombin generation test was carried out at 37°C using a CAT analyzer (Diagnostica Stago) with the PPP Reagent LOW reagent (Diagnostica Stago) in accordance with the manufacturer's instructions and according to the method established by Pr. Hemker in 2003.
  • PPP Reagent LOW is a mixture of tissue factor (TF) 1pM with phospholipid vesicles (PL, 4mM).
  • TF tissue factor
  • PL, 4mM phospholipid vesicles
  • ZGGR-AMC calcium + fluorescent substrate
  • the plasma of a hemophiliac patient is spiked with the same buffer for diluting the compound, an 8% solution of dimethylsulfoxide (DMSO), as a negative control (0.4% of final DMSO ) in order to obtain the basal level of thrombin generation of the plasma used.
  • DMSO dimethylsulfoxide
  • the positive control is the same plasma spiked with plasma factor VIII (Factane, LFB, France) at a concentration of 1 IU/mL (or 100% factor VIII) in order to obtain the expected “normal” level of thrombin generation plasma used.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Animal Behavior & Ethology (AREA)
  • General Health & Medical Sciences (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Epidemiology (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Diabetes (AREA)
  • Hematology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Organic Chemistry (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
  • Cephalosporin Compounds (AREA)
  • Acyclic And Carbocyclic Compounds In Medicinal Compositions (AREA)
  • Organic Low-Molecular-Weight Compounds And Preparation Thereof (AREA)

Abstract

L'invention concerne un composé de formule générale (III'), ou l'un de ses sels pharmaceutiquement acceptables, pour son utilisation pour le traitement de l'hémophilie chez un sujet, en particulier pour la restauration de la coagulation dans le plasma d'un sujet atteint d'hémophilie, ce composé étant avantageusement administrable par voie orale.

Description

COMPOSÉS POUR LE TRAITEMENT DE L’HÉMOPHILIE
La présente invention s’inscrit dans le domaine thérapeutique, plus spécifiquement dans le domaine du traitement de l’hémophilie.
Plus précisément, la présente invention concerne un composé de structure chimique particulière, pour son utilisation pour le traitement de l’hémophilie. L’hémophilie est une maladie génétique rare se traduisant par une impossibilité pour le sang de coaguler, et dont les symptômes sont des saignements spontanés et post-traumatiques répétitifs au niveau des articulations et des muscles. Ces saignements peuvent résulter en des hémorragies sévères, dont les conséquences peuvent s’avérer particulièrement graves.
Il existe deux types d’hémophilie : l’hémophilie de type A, due à une carence du facteur de coagulation FVIII, qui constitue le type d’hémophilie le plus répandu, et l’hémophilie de type B, due à une carence du facteur de coagulation FIX. Ces carences en facteur de coagulation FVIII ou FIX entraînent un blocage direct du complexe ténase intrinsèque, si bien que, pour produire le facteur FXa, qui génère la thrombine et qui est essentiel à la formation de caillots sanguins et donc à la coagulation, les patients hémophiles dépendent uniquement de la voie extrinsèque de la coagulation, et donc du complexe ténase extrinsèque. Ce complexe, composé du facteur tissulaire (TF) et du facteur de coagulation FVIIa, permet l’activation du facteur FX en FXa. FXa peut ensuite s'associer au facteur Va pour former de la prothrombinase, qui accélère la transformation de la prothrombine en thrombine nécessaire à la coagulation. Le complexe ténase extrinsèque est cependant également inhibé chez les sujets hémophiles, par la liaison d’une protéine, nommée inhibiteur de la voie du facteur tissulaire (Tissue Factor Pathway Inhibitor, TFPI), au facteur FXa et au complexe TF-FVIIa-FXa. Le TFPI est une protéine qui existe sous deux isoformes, alpha et beta. L’isoforme alpha contient une extrémité N-terminale de 22 résidus, suivie de trois domaines Kunitz (K1 , K2, K3) puis d’une longue extrémité C-terminale chargée négativement. L’isoforme beta ne possède pas de domaine K3 et est terminée par une extrémité C-terminale différente. La structure tridimensionnelle de chaque domaine Kunitz est expérimentalement connue. Dans le complexe TFPI- TF-FVIIa-FXa, l’hypothèse généralement reconnue est que le domaine K2 du TFPI se fixe au site actif du FXa et le domaine K1 du TFPI se fixe au site actif du FVIIa, comme décrit notamment dans la publication de Girard et al., 1989, Nature 338(6215), 518-20.
A l’heure actuelle, l’hémophilie est systématiquement traitée par des thérapies de remplacement, consistant en des injections par voie intraveineuse, au sujet atteint par la maladie, des facteurs manquants FVIII ou FIX. Ces traitements, outre leur mode d’administration contraignant, ont l’inconvénient de générer des anticorps.
De nouvelles stratégies thérapeutiques actuellement en voie de développement, telle que celle décrite dans la publication de Franchini et al., 2018, Blood transfusion, 16, 457-461 , reposent sur l’utilisation de protéines qui soit augmentent la coagulation, telle que l’emicizumab, un anticorps monoclonal bispécifique, restaurant la coagulation de façon équivalente à 10 à 20 UI/dL (10 à 20 %) de facteur VIII, mais pouvant dans certaines conditions être responsable d’accidents thrombotiques, soit bloquent les principaux anticoagulants de la cascade de la coagulation, en particulier le TFPI. Le concizumab, anticorps monoclonal anti-TFPI, a en particulier été proposé comme inhibiteur du TFPI.
La présente invention vise à proposer un traitement de l’hémophilie ne présentant notamment pas les inconvénients des traitements à base d’anticorps/protéines, ce traitement permettant de restaurer efficacement la coagulation chez les patients atteints par la maladie, en étant de préférence administrable par voie orale.
Des objectifs supplémentaires de l’invention sont que ce traitement soit peu coûteux et facile à produire et administrer, et qu’il provoque peu ou pas d’effets secondaires indésirables.
Les présents inventeurs ont maintenant découvert que ces objectifs peuvent être atteints par des molécules chimiques particulières, dérivées de l’adamantane, et définies par une formule générale particulière.
Ainsi, la présente invention concerne un composé de formule (III') ci-dessous, ou l’un de ses sels pharmaceutiquement acceptable, pour son utilisation, en tant qu’agent actif, pour le traitement de l’hémophilie chez un sujet atteint par la maladie :
dans laquelle
Y1' représente une liaison covalente ou un groupement amide,
R4’ représente un atome d’hydrogène, un groupement hydroxyle, un atome d’halogène, un groupement amine ou un radical carboné linéaire ou ramifié, saturé ou insaturé, éventuellement interrompu et/ou substitué par un ou plusieurs hétéroatomes et/ou un ou plusieurs groupements comportant au moins un hétéroatome,
Y2’ représente une liaison covalente ou un groupement amide, A2’ représente un groupement cyclique ou hétérocyclique, optionnellement substitué, comportant deux cycles fusionnés, au moins un desdits cycles étant aromatique.
Lorsque Y1' représente un groupement amide, l’atome d’azote de ce groupement peut aussi bien être lié au motif adamantyle qu’au radical phényle. De même, lorsque Y2’ représente un groupement amide, l’atome d’azote de ce groupement peut aussi bien être lié au radical phényle qu’au groupement A2’. On entend dans la présente description, par le terme traitement, un traitement curatif des épisodes hémorragiques liés à la maladie, et notamment la diminution et/ou l’inhibition du développement d’au moins un des symptômes associés, en particulier l’amélioration de la coagulation et la diminution de l’ampleur des saignements et/ou de leur fréquence.
Le sujet traité selon l’invention est notamment un mammifère, par exemple un mammifère non humain. Il s’agit préférentiellement d’un être humain.
Le composé utilisé selon l’invention permet avantageusement de restaurer la coagulation, par restauration de la génération de thrombine, dans le plasma d’un sujet atteint d’hémophilie, de type A comme de type B, y compris pour les sujets atteints par des formes sévères de la maladie.
En particulier, il a été découvert par les présents inventeurs que le composé selon l’invention, soumis à un test ex vivo de génération de thrombine fluorimétrique, sur du plasma de sujets atteints d’hémophilie A sévère, permet, à une dose de 50 μM, de restaurer la génération de thrombine de manière équivalente au FVIII et même supérieure selon les conditions.
On ne préjugera pas ici des mécanismes sous-tendant un tel effet avantageux du composé utilisé selon l’invention. On peut cependant penser que cet effet pourrait être dû, au moins en partie, à une inhibition, par le composé selon l’invention, en particulier le composé de formule générale (III') ou un de ses sels, de la liaison de l’inhibiteur de la voie du facteur tissulaire (TFPI) au facteur de la coagulation FXa.
Le composé utilisé selon l’invention ne présente pas de toxicité pour les mammifères. Il peut avantageusement être administré par voie orale, bien plus simplement que les protéines utilisées par l’art antérieur, qui doivent quant à elles être administrées par injection.
Le composé selon l’invention, et ses sels pharmaceutiquement acceptables, de par leur nature chimique et leur faible poids moléculaire, généralement inférieur à 5 kDa et même, pour certaines combinaisons de substituants, inférieur à 1 kDa, voire inférieur à 500 Da, sont en particulier bien plus faciles, et moins coûteux, à préparer, que les composés protéiques / anticorps proposés par l’art antérieur pour le traitement de l’hémophilie. A cet égard, le composé selon l’invention peut être préparé par toute méthode de synthèse classique en elle- même pour l’homme du métier.
On entend dans la présente description, par sel pharmaceutiquement acceptable, tout sel du composé ne provoquant aucun effet adverse, allergique ou autre réaction indésirable quand il est administré au sujet, notamment à un sujet humain.
Tout sel conventionnel non toxique du composé de formule générale (III') peut être utilisé selon l’invention, par exemple un sel métallique tel qu’un sel de sodium, de potassium, de magnésium, de calcium, de lithium, etc. Il peut autrement être utilisé un sel formé à partir d’acides organiques ou inorganiques, par exemple les sels dérivés d’acides inorganiques tels que les acides chlorhydrique, bromhydrique, phosphorique, sulfurique, etc., et les sels dérivés d’acides organiques tels que les acides acétique, trifluoroacétique, propionique, maléique, benzoïque, stéarique, etc. Le sel peut être synthétisé, à partir du composé de formule générale (III'), selon toute méthode chimique classique en elle-même.
Toutes les propriétés décrites dans la présente description pour le composé de formule générale (III') s’appliquent également à ses sels pharmaceutiquement acceptables. La formule générale (III') ci-dessus englobe en outre toutes les combinaisons possibles de formes isomères au niveau des carbones asymétriques, et tous les mélanges de telles formes isomères. A partir d’un mélange d’isomères, chaque isomère particulier peut être obtenu par des méthodes de purification classiques en elles-mêmes pour l’homme du métier. Préférentiellement, dans la formule générale (III'), R 4'représente un groupement -OR8 ou un groupement -O-CO-R8, où R8 représente un radical hydrocarboné linéaire ou ramifié, saturé ou insaturé, notamment alkyle, comportant de 1 à 10 atomes de carbone, optionnellement substitué par un ou deux substituants R14, R14’, identiques ou différents, choisis chacun parmi -F, -CO2H, -SO3H, - représente un atome d’hydrogène ou un groupement méthyle.
R8 peut notamment représenter un groupement de formule générale (XVIII) : dans laquelle y est un nombre entier compris entre 1 et 10 et R14 est tel que défini ci-avant.
Dans des modes de réalisation particuliers de l’invention, dans la formule générale (III'), R4’ est fixé au radical phényle en position ortho ou para par rapport au motif adamantyle, et Y2’ est fixé au radical phényle en position méta par rapport au motif adamantyle.
Préférentiellement, dans la formule générale (III'), A2’ est au moins substitué par un substituant R11 choisi parmi le fluor, les groupements carboxyle, sulfonyle, phosphonyle, tétrazole ou céto-oxadiazole, et les radicaux carbonés linéaires, ramifiés et/ou cycliques, saturés ou insaturés, aromatiques ou non, éventuellement interrompus et/ou substitués par un ou plusieurs hétéroatomes, notamment de fluor, et/ou un ou plusieurs groupements comportant au moins un hétéroatome, notamment carboxyle -CO2H, sulfonyle -SO3H et/ou phosphonyle -P(O)(OH)2. R11 peut en particulier être choisi parmi les groupements tétrazole ou céto- oxadiazole de formules respectives :
Dans des modes de réalisation particuliers de l’invention, le composé utilisé pour le traitement de l’hémophilie répond à la formule générale (IX) : dans laquelle Y1’, Y2’ et R4’ sont tels que définis ci-avant,
A3 représente un hydrocarbure cyclique ou hétérocyclique à 3 à 8 chaînons, saturé ou insaturé, aromatique ou non, fusionné au cycle aromatique à six chaînons adjacent,
B1 et B2, identiques ou différents, représentent chacun un groupement -CH- ou un atome d’azote, R9 et R10, identiques ou différents, représentent chacun un atome d’hydrogène, un groupement hydroxyle ou un groupement -OR12 ou -CO-O-R12 où R12 représente un radical hydrocarboné linéaire ou ramifié, saturé ou insaturé, notamment alkyle, comportant de 1 à 10 atomes de carbone, optionnellement substitué par un ou deux substituants R16, R16’, identiques ou différents, choisis chacun parmi -F, -CO2H, -SO3H, -P(O)(OH)2, -P(O)(OCH3)2, -P(O)(OCH2CH3)2, méthyle, et R11 représente un substituant choisi parmi le fluor, les groupements carboxyle, sulfonyle, phosphonyle, tétrazole ou céto-oxadiazole, et les radicaux carbonés linéaires, ramifiés et/ou cycliques, saturés ou insaturés, aromatiques ou non, éventuellement interrompus et/ou substitués par un ou plusieurs hétéroatomes, notamment de fluor, et/ou un ou plusieurs groupements comportant au moins un hétéroatome, notamment carboxyle, sulfonyle et/ou phosphonyle. R11 peut en particulier représenter un groupement -(CH2)X-R13 où x est un nombre entier compris entre 0 et 4 et R13 représente un atome de fluor ou un groupement carboxyle, sulfonyle, phosphonyle, tétrazole ou céto-oxadiazole, notamment un groupement tétrazole ou céto-oxadiazole de formules respectives :
Dans la formule générale (IX), R9 et R10, identiques ou différents, peuvent en outre représenter chacun un groupement de formule générale (XVI II’) : dans laquelle y’ est un nombre entier compris entre 1 et 10 et R18 est choisi parmi où R19 représente un atome d’hydrogène ou un groupement méthyle.
Le composé utilisé selon l’invention peut notamment répondre à la formule générale (X) : dans laquelle Y1’, Y2’, R4’, A3, B1, B2, R9, R10, R13 et x sont tels que définis ci- avant.
Il peut en particulier répondre à la formule générale (XI) : dans laquelle Y1’, Y2’, R4’, A3, B1, R9, R10, R13 et x sont tels que définis ci-avant. Il peut autrement répondre à la formule générale (XII) : dans laquelle Y1’, Y2’, R4’, A3, B1, B2, R9, R10, R13 et x sont tels que définis ci- avant. Dans des modes de réalisation particuliers de l’invention, le composé utilisé répond à la formule générale (XIII) : dans laquelle Y1’, Y2’, R4’, A3, B1, R9, R10, R13 et x sont tels que définis ci-avant. Il peut en particulier répondre à la formule générale (XIV) :
dans laquelle Y1’, Y2’, R4’, R9, B1, R10, R13 et x sont tels que définis ci-avant. Il peut notamment répondre à la formule générale (XV) : dans laquelle Y1’, Y2’, R4’, R9, B1, R10, R13 et x sont tels que définis ci-avant.
Une sous-famille particulièrement préférée de la formule générale (XV) dans le contexte de l’invention répond à la formule générale (XVI) :
dans laquelle Y1’, Y2’, R4’, R13 et x sont tels que définis ci-avant.
Plus généralement, la présente invention concerne un composé de formule (I) ci-dessous, ou l’un de ses sels pharmaceutiquement acceptable, pour son utilisation, en tant qu’agent actif, pour ledit traitement de l’hémophilie chez un sujet atteint par la maladie : dans laquelle
W1 , W2, W3 et W4, identiques ou différents, représentent chacun un atome d’oxygène ou un radical bivalent choisi parmi les groupements -CH2-, carbonyle -CO-, amine, notamment amine secondaire -NH-, et sulfonyle -SO2-, R1 et R2, identiques ou différents, représentent chacun un atome d’hydrogène, un groupement hydroxyle ou un radical hydrocarboné, de préférence en C1-C8 et en particulier en C1-C4, linéaire, ramifié et/ou cyclique, saturé ou insaturé, aromatique ou non, éventuellement substitué, pouvant comporter un ou plusieurs hétéroatomes et/ou un ou plusieurs groupements comportant au moins un hétéroatome et pouvant comporter un seul cycle ou plusieurs cycles, le cas échéant des cycles fusionnés,
R3 représente un atome d’hydrogène, un atome d’halogène, un groupement alkyle, de préférence en C1-C8 et préférentiellement en C1-C4, ou un groupement hydroxyle, et R représente un atome d’hydrogène, un groupement hydroxyle, un groupement -NH2 ou un radical hydrocarboné linéaire, ramifié et/ou cyclique, saturé ou insaturé, aromatique ou non, éventuellement substitué, pouvant comporter un ou plusieurs hétéroatomes et/ou un ou plusieurs groupements comportant au moins un hétéroatome et pouvant comporter un seul cycle ou plusieurs cycles, le cas échéant des cycles fusionnés.
Le compose utilisé selon l’invention est l’adamantane, ou tricyclo[3.3.1.1(3,7)]décane, de formule chimique : ou un de ses dérivés ou analogues répondant à la formule générale (I).
Tout sel conventionnel non toxique du composé de formule générale (I) peut être utilisé selon l’invention, par exemple un sel métallique tel qu’un sel de sodium, de potassium, de magnésium, de calcium, de lithium, etc. Il peut autrement être utilisé un sel formé à partir d’acides organiques ou inorganiques, par exemple les sels dérivés d’acides inorganiques tels que les acides chlorhydrique, bromhydrique, phosphorique, sulfurique, etc., et les sels dérivés d’acides organiques tels que les acides acétique, trifluoroacétique, propionique, maléique, benzoïque, stéarique, etc. Le sel peut être synthétisé, à partir du composé de formule générale (I), selon toute méthode chimique classique en elle-même.
Toutes les propriétés décrites dans la présente description pour le composé de formule générale (I) s’appliquent également à ses sels pharmaceutiquement acceptables.
La formule générale (I) ci-dessus englobe en outre toutes les combinaisons possibles de formes isomères au niveau des carbones asymétriques, et tous les mélanges de telles formes isomères. A partir d’un mélange d’isomères, chaque isomère particulier peut être obtenu par des méthodes de purification classiques en elles-mêmes pour l’homme du métier. Un isomère particulièrement préféré selon l’invention répond à la formule générale (I') :
Dans des modes de mise en oeuvre particuliers, le composé utilisé selon l’invention répond à l’une ou plusieurs des caractéristiques ci-après, mises en oeuvre seules ou selon toute combinaison techniquement pertinente. Préférentiellement, au moins un, de préférence au moins deux, préférentiellement au moins trois et préférentiellement les quatre, parmi W1, W2, W3 et W4, représente(nt) un pont méthylène -CH2-. R1 et R2, identiques ou différents, représentent en outre de préférence chacun un atome d’hydrogène, un groupement hydroxyle, un groupe alkyle en C1-C8, de préférence en C1-C4 ou un radical phényle optionnellement substitué. R1 et R2 peuvent par exemple être identiques, et représenter chacun un atome d’hydrogène ou un groupement méthyle. Ils peuvent autrement être différents, et par exemple représenter pour l’un, un atome d’hydrogène, et pour l’autre, un groupement hydroxyle.
Des composés particuliers selon l’invention répondent aux combinaisons de caractéristiques suivantes :
- W1 , W2, W3 et W4 représentent chacun un pont méthylène, R3 représente un atome d’hydrogène, R1 représente un atome d’hydrogène et R2 représente un groupement hydroxyle ;
- W1, W2, W3 et W4 représentent chacun un pont méthylène, R3 représente un atome d’hydrogène et R1 et R2 représentent chacun un groupement méthyle ;
- W1, W3 et W4 représentent chacun un pont méthylène, W2 représente un groupe carbonyle, R3 représente un atome d’hydrogène, et R1 et R2 représentent chacun un groupement méthyle.
W2 peut autrement représenter un groupement de formule :
A cet égard, le composé de formule générale (I) peut être le bromantane, dans lequel W1 , W3 et W4 représentent chacun un pont méthylène -CH2-, et R1, R2, R3 et R représentent chacun un atome d’hydrogène. Dans des modes de mise en œuvre particuliers de l’invention, R2 est choisi parmi les groupements de formules chimiques :
Le composé utilisé selon l’invention peut ainsi notamment être la saxagliptine, de formule chimique : ou la vildagliptine, de formule chimique :
Dans la formule générale (I), R peut représenter un groupement amine primaire. 4e composé utilisé selon l’invention peut alors notamment être l’amantadine ou la mémantine, dans lesquelles W1 , W2, W3 et W4 représentent chacun un pont méthylène -CH2-, R3 représente un atome d’hydrogène, et R1 et R2 représentent chacun un atome d’hydrogène pour la première, et un groupement méthyle pour la seconde.
R peut autrement par exemple représenter un groupement choisi parmi les groupements suivants :
Le composé utilisé selon l’invention peut alors notamment être l’adapromine, la rimantadine ou la tromantadine, dans lesquelles W1 , W2, W3 et W 4représentent chacun un pont méthylène -CH2-, et R1, R2 et R3 représentent chacun un atome d’hydrogène.
Dans des modes de mise en œuvre particulièrement préférés de l’invention, R représente un groupement de formule -Y1-A1, dans lequel : Y1 représente une liaison covalente, un groupement amine ou un radical carboné linéaire ou ramifié, saturé ou insaturé, éventuellement interrompu et/ou substitué par un ou plusieurs hétéroatomes et/ou un ou plusieurs groupements comportant au moins un hétéroatome, ledit radical carboné comportant de préférence 1 à 4 atomes de carbone, notamment un groupement -NH-CO-, -CO-NH-, -NH-CS- ou -CS-NH-, et A1 représente un hydrocarbure cyclique ou hétérocyclique, saturé ou insaturé, optionnellement substitué, pouvant comporter un seul cycle, aromatique ou non, ou plusieurs cycles fusionnés, chacun desdits cycles pouvant être aromatique ou non. Le composé répond alors à la formule générale (II) :
dans laquelle W1, W2, W3, W4, R1, R2, R3, Y1 et A1 sont tels que définis ci-avant. A1 peut notamment être de type monocyclique, bicyclique ou tricyclique. Préférentiellement, A1 représente un motif monocyclique, de préférence aromatique, comportant de 4 à 6 atomes, un ou plusieurs de ces atomes pouvant être un hétéroatome, et substitué sur au moins un, de préférence au moins deux (ceci s’entendant en plus de la liaison à Y1), des atomes du cycle. A1 peut en particulier représenter un radical phényle, substitué sur au moins deux des atomes du cycle (ceci s’entendant en plus de la liaison à Y1), les substituants étant de préférence situés en position para l’un par rapport à l’autre, l’un des substituants étant en outre de préférence situé en position ortho par rapport à la liaison à Y1.
Préférentiellement, A1 est substitué, en position ortho par rapport à la liaison àY1, par un groupement R4 représentant un atome d’hydrogène, un groupement hydroxyle, un atome d’halogène, un groupement amine ou un radical carboné linéaire, ramifié et/ou cyclique, saturé ou insaturé, aromatique ou non, éventuellement interrompu et/ou substitué par un ou plusieurs hétéroatomes et/ou un ou plusieurs groupements comportant au moins un hétéroatome.
Dans des modes de mise en oeuvre particulièrement préférés selon l’invention, en particulier lorsque A1 représente un groupement carbocyclique ou hétérocyclique aromatique, notamment à 6 atomes, A1 est substitué au moins par un groupement de formule générale (II') : dans laquelle Y2 représente une liaison covalente, un groupement amine, ou un radical carboné linéaire ou ramifié, saturé ou insaturé, éventuellement interrompu et/ou substitué par un ou plusieurs hétéroatomes et/ou un ou plusieurs groupements comportant au moins un hétéroatome, de préférence en C1-C4, notamment un groupement -NH-CO-, -CO-NH-, -NH-CS- ou -CS-NH-, et A2 représente un groupement cyclique ou hétérocyclique, optionnellement substitué, pouvant comporter un seul cycle, pouvant être aromatique ou non, ou plusieurs cycles fusionnés, chacun desdits cycles pouvant être aromatique ou non. A2 peut notamment être de type monocyclique, bicyclique ou tricyclique. Préférentiellement, A2 représente un groupement cyclique ou hétérocyclique, éventuellement substitué, comportant deux cycles fusionnés, au moins un desdits cycles étant aromatique, chacun desdits cycles comportant préférentiellement entre 4 et 6 atomes, un ou plusieurs de ces atomes pouvant être un hétéroatome.
Préférentiellement, dans une telle configuration, chacun des cycles de A2 est aromatique. Chacun des cycles comporte en outre de préférence 6 atomes de carbone. A2 est de préférence substitué sur au moins un, de préférence au moins deux, des atomes d’au moins un cycle. A2 est préférentiellement substitué sur au moins un, de préférence au moins deux, atomes du cycle ne portant pas la liaison à Y2. Préférentiellement, A2 représente un motif naphtalène, éventuellement substitué, et préférentiellement substitué sur au moins le cycle ne portant pas la liaison à Y2.
Dans des modes de mise en oeuvre particuliers de l’invention, A2 est au moins substitué par un groupement choisi dans le groupe constitué des atomes d’halogène, notamment des atomes de chlore, brome ou iode, des groupements hydroxyle, amine ou aminoxyde, et des radicaux carbonés linéaires, ramifiés et/ou cycliques, saturés ou insaturés, aromatiques ou non, éventuellement interrompus et/ou substitués par un ou plusieurs hétéroatomes et/ou un ou plusieurs groupements comportant au moins un hétéroatome. A titre d’exemples de tels radicaux, on peut citer les radicaux amide, kétoxime, carbonyle, carboxyle, ester, alkyle, en particulier en C1-C8, notamment en C1-C4, aryle, etc.
Dans des modes de mise en oeuvre particuliers de l’invention, le composé répond à la formule générale (III) : dans laquelle W1, W2, W3, W4, R1, R2, R3, Y1, Y2 et A2 sont tels que définis ci-avant, et R4 représente un atome d’hydrogène, un groupement hydroxyle, un atome d’halogène, un groupement amine ou un radical carboné linéaire, ramifié et/ou cyclique, saturé ou insaturé, aromatique ou non, éventuellement interrompu et/ou substitué par un ou plusieurs hétéroatomes et/ou un ou plusieurs groupements comportant au moins un hétéroatome. En particulier, dans la formule générale (III), R4 peut représenter un atome d’hydrogène ou un groupement -OR5, où R5 représente un groupement alkyle en C1-C8, de préférence en C1-C4, et en particulier un groupement méthyle.
Le composé utilisé selon l’invention peut par exemple répondre à l’une des formules générales (IlIa), (lllb), (lllc) ou (llld) ci-après :
dans lesquelles R4, Y2 et A2 sont tels que définis ci-avant.
Dans des modes de mise en oeuvre particulièrement préférés de l’invention, le composé répond à la formule générale (IV) : dans laquelle W1, W2, W3, W4, R1, R2, R3, Y1 et Y2 sont tels que définis ci-avant,
R5 représente un atome d’hydrogène ou un groupement alkyle en C1-C8, préférentiellement en C1-C4, par exemple un groupement méthyle, et R6 représente un atome d’halogène, notamment un atome de chlore, de brome et d’iode, un groupement hydroxyle, amine ou aminoxyde, ou un radical carboné linéaire, ramifié et/ou cyclique, saturé ou insaturé, aromatique ou non, éventuellement interrompu et/ou substitué par un ou plusieurs hétéroatomes et/ou un ou plusieurs groupements comportant au moins un hétéroatome. R6 peut par exemple représenter un radical amide, kétoxime, carbonyle, carboxyle, ester, alkyle, en particulier en C1-C8, notamment en C1-C4, aryle, etc.
Dans des modes de mise en œuvre particuliers de l’invention, R6 représente un groupement -CO-OR7, où R7 représente un atome d’hydrogène, un groupement alkyle en C1-C8, de préférence en C1-C4, un groupement aryle ou un groupement arylalkyle en C6-C14.
Le composé utilisé selon l’invention peut en particulier répondre à l’une des formules générales (IVa), (IVb), (IVc) et (IVd) ci-après :
dans lesquelles W1, W2, W3, W4 , R1, R2, R3, R5 et R6 sont tels que définis ci- avant
Un composé particulièrement préféré selon l’invention est l’adapalène, nom donné à l’acide 6-[3-(1-adamantyl)-4-méthoxyphényl]naphthalène-2- carboxylique, de formule (V) : L’adapalène s’avère particulièrement efficace pour restaurer la coagulation dans le plasma de patients atteints d’hémophilie A sévère.
D’autres composés particulièrement préférés selon l’invention, répondant notamment à la formule générale (III'), présentent les formules (XVII) et (XIX) :
D’autres composés utilisables conformément à l’invention, répondant en particulier à la formule générale (III'), présentent les formules (XX), (XXI), (XXII) et (XXIII) :
D’autres exemples de composés pouvant être utilisés selon l’invention présentent les formules (VI), (VII) et (VIII) ci-dessous :
Le composé selon l’invention peut être administré au sujet en ayant besoin, c’est- à-dire atteint d’hémophilie, dans une quantité thérapeutiquement efficace, par toute voie, en particulier par voie entérale, notamment orale, buccale ou rectale, par voie parentérale, notamment sous-cutanée, intramusculaire, intraveineuse, intradermique, etc. L’administration du composé au sujet traité est de préférence réalisée par voie orale.
On entend, par quantité thérapeutiquement efficace, la quantité du composé qui permet, lorsqu’il est administré au sujet, d’obtenir le niveau de réponse thérapeutique souhaité, notamment, pour le cas particulier de l’hémophilie, le niveau de restauration de la coagulation souhaité. Le niveau de dose thérapeutiquement efficace de chaque composé spécifique pour un sujet particulier varie en fonction de nombreux facteurs tels que, par exemple, la pathologie exacte et sa gravité, le poids corporel, l’âge et la santé générale du sujet, la durée du traitement, les médicaments éventuellement utilisés en parallèle, la sensibilité de l’individu à traiter, etc. En conséquence, la posologie optimale est déterminée par le médecin en fonction des paramètres qu’il juge pertinents. La posologie d’administration du composé utilisé selon l’invention peut par exemple être d’une prise une ou deux fois par jour.
Dans des modes de mise en oeuvre préférentiels de l’invention, le composé est contenu dans une composition pharmaceutique, au sein de laquelle il constitue un principe actif, et est contenu dans un véhicule pharmaceutiquement acceptable.
Cette composition pharmaceutique peut se présenter sous toute forme convenant à une administration par voie entérale ou par voie parentérale. Elle se présente de préférence sous une forme adaptée à une administration au sujet par voie orale.
L’ensemble des constituants de cette composition pharmaceutique sont bien entendu choisis pour être pharmaceutiquement compatibles, c’est-à-dire qu’ils ne produisent aucun effet adverse, allergique ou autre réaction indésirable lorsqu’ils sont administrés au sujet, notamment à un mammifère et en particulier à un humain.
La composition pharmaceutique peut contenir tout excipient classique en lui- même. Un tel excipient peut être un diluant, un adjuvant ou toute autre substance classique en elle-même pour la constitution des médicaments, telle qu’un agent préservatif, de remplissage, désintégrant, mouillant, émulsifiant, dispersant, antibactérien ou antifongique, etc., ou l’un quelconque de leurs mélanges Elle peut en outre contenir un ou plusieurs autres principes actifs, agissant ou non en synergie avec le composé utilisé selon l’invention,
La composition pharmaceutique peut être formulée selon toute forme galénique convenant à une administration par voie orale chez les mammifères, et en particulier chez les êtres humains. Elle peut notamment se présenter sous forme de poudre, de comprimés, de gélules, de granules, de sirop, ou de solution ou suspension orale, préparés de manière classique en elle-même.
Elle est préférentiellement conditionnée sous forme de doses unitaires, chaque dose contenant une quantité thérapeutiquement efficace du composé selon l’invention. La concentration du composé dans chaque dose de la composition pharmaceutique est ainsi de préférence choisie pour délivrer au sujet, à chaque administration, une quantité de composé qui est efficace pour obtenir la réponse thérapeutique désirée. La composition pharmaceutique est par exemple conditionnée sous forme de doses unitaires, pouvant notamment comprendre chacune une quantité comprise entre 1 et 10 g du composé selon l’invention.
La présente invention s’exprime également dans les termes d’un procédé de traitement de l’hémophilie chez un sujet, et en particulier d’un procédé pour restaurer la coagulation dans le plasma d’un sujet atteint d’hémophilie. Le sujet peut en particulier être un mammifère, et préférentiellement un être humain. Ce procédé comprend l’administration, audit sujet en ayant besoin, d’une quantité thérapeutiquement efficace du composé tel que défini ci-avant, ou un de ses sels pharmaceutiquement acceptables. Ce procédé peut répondre à l’une ou plusieurs des caractéristiques décrites ci-avant en référence à l’utilisation du composé selon l’invention pour le traitement de l’hémophilie.
La présente invention s’exprime également dans les termes de l’utilisation d’un composé selon l’invention, ou de l’un de ses sels pharmaceutiquement acceptable, pour la fabrication d’un médicament pour le traitement de l’hémophilie. Cette utilisation peut répondre à l’une ou plusieurs des caractéristiques décrites ci-avant en référence à l’utilisation du composé selon l’invention pour le traitement de l’hémophilie.
Les caractéristiques et avantages de l’invention apparaîtront plus clairement à la lumière des exemples de mise en œuvre ci-après, fournis à simple titre illustratif et nullement limitatifs de l’invention, avec l’appui des figures 1 à 4, dans lesquelles :
La figure 1 montre un graphe représentant les résultats (quantité de thrombine en fonction du temps) d’un test de génération de thrombine ex vivo pour le plasma d’un sujet atteint d’hémophilie A sévère, en présence de facteur FVIII plasmatique (100 % VIII, témoin positif), de tampon de dilution (0% VIII, témoin négatif), et d’un composé selon l’invention, l’adapalène, à des concentrations respectives de 0,5 mM, 5 mM et 50 mM.
La figure 2 représente la structure chimique de composés comparatifs C1 à C9 mis en œuvre dans un exemple, ne répondant pas à la formule générale (I).
La figure 3 montre un histogramme représentant la quantité de thrombine mesurée au pic lors d’un test de génération de thrombine (TGT) ex vivo dans le plasma d’un individu atteint d’hémophilie A sévère, en présence de facteur FVIII plasmatique (100 % VIII, témoin positif), de tampon de dilution (0 % VIII, témoin négatif) et en présence d’adapalène à 50 mM (Ad) ou d’un composé comparatif C1 à C9 ne répondant pas à la formule générale (I).
La figure 4 montre un histogramme représentant la quantité totale de thrombine générée (potentiel endogène de thrombine) lors d’un test de génération de thrombine (TGT) ex vivo dans le plasma d’un individu atteint d’hémophilie A sévère, en présence de facteur FVIII plasmatique (100 % VIII, témoin positif), de tampon de dilution (0 % VIII, témoin négatif) et en présence d’adapalène à 50 mM (Ad) ou d’un composé comparatif C1 à C9 ne répondant pas à la formule générale (I).
Exemple 1 - test de génération de thrombine ex vivo
Lors de l’activation de la coagulation, un enchaînement de réactions enzymatiques, appelé cascade de coagulation, se produit. Elle aboutit à la production de thrombine (facteur lia), dernier « maillon » enzymatique de cette cascade de coagulation.
Le test de génération de thrombine consiste à mesurer la cinétique d’apparition de ce facteur clé de la coagulation dans le plasma au cours du temps. Après activation de la coagulation par du calcium, la quantité de thrombine évolue au cours du temps. Elle est mesurée grâce à un substrat synthétique de la thrombine couplé à une molécule fluorescente (ZGGR-AMC). Les principaux paramètres déterminés sont le temps de latence avant d’observer une augmentation de la génération de thrombine, le pic de thrombine correspondant à la quantité maximale de thrombine générée et IΈTR (potentiel endogène de la thrombine) correspondant à la quantité totale de thrombine générée dans le plasma pendant le test. Dans le cas d’un patient hémophile A, la génération de thrombine est faible voire quasi nulle pour certains patients. L’ajout du facteur de coagulation manquant (facteur VIII) à son niveau physiologique (1 UI/mL ou 100%) permet de restaurer la coagulation chez les patients et permet de récupérer une génération de thrombine « normale ». Ainsi le test de génération de thrombine permet d’évaluer globalement le taux de coagulation d’un plasma donné et dans le cas présent, il permet d’évaluer la capacité d’une molécule à restaurer ou non la coagulation chez un patient hémophile.
Pour cet exemple, plusieurs tests de génération de thrombine ex vivo ont été réalisés sur un plasma d’un patient atteint d’hémophilie A sévère, donc dépourvu de facteur FVIII, afin d’évaluer l’effet sur la coagulation d’un composé de formule générale (I), plus particulièrement l’adapalène, de formule (V) ci-dessus, sur la cinétique et la quantité de thrombine générée.
Le plasma de patient hémophile a été obtenu auprès de la société Cryopep (Montpellier, France).
L’adapalène est disponible commercialement, notamment auprès de la société Prestwick. Il a été solubilisé dans une solution de diméthylsulfoxyde (DMSO) 8% puis dilué à une concentration de 1 mM et testé ensuite aux concentrations suivantes : 50 mM, 5 mM, 0,5 mM (concentrations finales dans le plasma).
Le test de génération de thrombine a été effectué à 37°C à l'aide d’un analyseur STA-Genesia entièrement automatisé (Diagnostica Stago) avec le réactif STG®- Bleedscreen (Diagnostica Stago) conformément aux instructions du fabricant et selon la méthode établie par le Pr. Hemker en 2003. Le réactif STG®- Bleedscreen est un mélange de facteur tissulaire (TF) à faible concentration avec des vésicules phospholipidiques (PL). Le test est déclenché par l’ajout d’un mélange calcium + substrat fluorescent (ZGGR-AMC) (mélange STG®- FluoStart).
D’un point de vue technique, 4 volumes d'échantillon de plasma surchargé sont ajoutés à 1 volume de « complexe initiateur » (STG®-Bleedscreen) et incubés 10 min à 37°C. Ensuite, la réaction est déclenchée par l’ajout de 1 volume de STG®-FluoStart (mélange de CaCI2 et substrat ZGGR-AMC) et le signal de fluorescence est mesuré au cours du temps. Chaque test est réalisé en dupliquât Pour chaque molécule testée, 475 μL du plasma provenant du patient hémophile ont été surchargés avec 25 μL d’une solution contenant différentes quantités de composé (molécule à tester, facteur VIII ou tampon de dilution) pour obtenir la concentration finale souhaitée (dilution systématique de la molécule à tester dans le plasma au 1/20). Par exemple, pour obtenir la concentration finale de 50 mM dans le plasma, 25 μL d’une solution à 1 mM ont été ajoutés à 475 μL de plasma. La préparation de 500 μL de plasma surchargé permet de réaliser les 2 tests de génération de thrombine (dupliquat), les 2 tests de calibration (dupliquât) et prend en compte le volume mort de l’automate. En parallèle des tests sur les différents composés chimiques, le plasma de patient hémophile est surchargé avec le même tampon de dilution du composé, une solution de diméthylsulfoxyde (DMSO) à 8%, en tant que contrôle négatif (0,4% de DMSO final) afin d’obtenir le niveau de base de génération de thrombine du plasma utilisé. Le contrôle positif est le même plasma surchargé avec du facteur VIII plasmatique (Factane, LFB, France) à une concentration de 1 UI/mL (ou 100% de facteur VIII) afin d’obtenir le niveau « normal » attendu de génération de thrombine du plasma utilisé.
Les résultats obtenus en génération de thrombine, pour chacune des concentrations d’adapalène testées, sont montrés sur la figure 1.
Le contrôle négatif (plasma de patient hémophile A surchargé avec le tampon de dilution) présente une génération de thrombine faible avec un pic à 25 nM de thrombine et un ETP à 360 nM.min. Le contrôle positif (plasma de patient hémophile A surchargé avec 1 UI/mL de facteur VIII) présente une génération de thrombine « normale » avec un pic à 51 nM et un ETP à 599 nM.min. Pour les différentes concentrations d’adapalène, on observe une augmentation de la génération de thrombine dépendante de la concentration en adapalène : plus celle-ci est élevée, plus la génération de thrombine est importante. A 0,5 mM, l’adapalène a déjà un effet sur l’augmentation de la génération de thrombine avec un pic à 29,7 nM et un ETP à 455 nM.min. A 5 mM, l’augmentation de la génération de thrombine est plus importante avec un pic à 39 nM et un ETP à 504 nM.min. A la concentration de 50 mM, l’adapalène restaure la génération de thrombine au même niveau que le contrôle positif (100% FVIII) avec un pic à 55 nM et un ETP à 588 nM.min.
A titre comparatif, plusieurs composés de structure proche, mais ne répondant pas à la formule générale (I) (composés C1 à C9), ont également été soumis au même test. Ces composés sont montrés sur la figure 2. Chacun de ces composés a été surchargé dans le plasma du patient hémophile dans les mêmes conditions que l’adapalène, à hauteur de 50 mM.
Les résultats obtenus, pour l’adapalène (Ad) à 50 mM et pour les composés comparatifs C1 à C9, sont montrés sur la figure 3 et la figure 4.
On observe que parmi les différents composés testés, seul l’adapalène (Ad) à 50 mM permet d’obtenir une augmentation de la génération de thrombine par rapport au contrôle négatif, avec un pic de thrombine générée et un ETP au même niveau que le témoin positif.
Exemple 2 - Effet sur l’inhibition de FXa par TFPI
La capacité de l’adapalène à lever l'inhibition de FXa par TFPI a été évaluée en utilisant un test d'activité de FXa à faible concentration de TFPI. Pour cet essai, il a été utilisé un TFPI humain tronqué (TFPI-K1 K2) qui est commun aux deux isoformes TFPI a et b, présentant la séquence d’acides aminés SEQ ID No 1 : DSEEDEEHTIITDTELPPLKLMHSGCAFKADDGPCKAIMKRFFFNIFTRQCEEF IYGGCEGNQNRFESLEECKKMCTRDNANRIIKTTLQQEKPDFCFLEEDPGICR GYITRYFYNNQTKQCERFKYGGCLGNMNNFETLEECKNICEDGPNGF. L’adapalène a été soumis à un test quantifiant sa capacité à libérer l'inhibition du FXa par le TFPI-K1 K2 en utilisant un test colorimétrique dans un format de plaque de 96 puits. Toutes les étapes ont été réalisées à température ambiante. L'inhibition du FXa par l'augmentation des concentrations de TFPI-K1 K2 a d'abord été analysée pour déterminer les meilleures conditions de détection. Des concentrations de TFPI-K1 K2 et de FXa (New England Biolabs) de 30 nM et 0,5 nM respectivement, ont été choisies pour assurer une inhibition complète du FXa, sans un excès important de TFPI-K1 K2. Chaque protéine a été diluée en utilisant le même tampon : Hepes 20 mM, NaCI 135 mM, BSA 1 %, CaCI22 mM, pH 7,3. Le test a été effectué manuellement dans des plaques à 96 puits (Nunc Maxisorp®). L’expérience a été effectuée en double à une concentration finale d’adapalène de 50 mM.
En bref, 14,5 μL d’adapalène à 350 pM, prédilués dans le tampon décrit ci- dessus, ont été ajoutés à 62,5 μL TFPI-K1 K2 à 50 nM et mélangés ensemble par aspiration/distribution. Après 10 min d'incubation à la température ambiante, 6,25 μL de FXa à 8 nM ont été ajoutés, le mélange a été mélangé à nouveau, et l'activité du FXa non inhibé a été quantifiée par l'ajout de 18 μL de PNAPEP- 1025 (Cryopep), un substrat de FXa, dilué à 2 mM dans H2O.
Pour le contrôle négatif, 14,5 pl de DMSO 0,25% ont été ajoutés à 62,5 pl de TFPI-K1 K2, et pour le contrôle positif, 14,5 pl de DMSO 0,25% ont été ajoutés à 62,5 pl de tampon. Ensuite, après 10 min d'incubation à la température ambiante, 6,25 μI de FXa à 8 nM et 18 mI de PNAPEP-1025 ont été ajoutés comme décrit précédemment.
Les plaques ont été centrifugées pour éliminer toute bulle et la densité optique (DO) à 405 nm, correspondant à l’hydrolyse du substrat PNAPEP-1025, a été mesurée pendant 1 h à température ambiante. La valeur de l’absorbance à tO, correspondant à une absorbance de 0,05, a été soustraite et la valeur de restauration de la génération de thrombine a été rapportée en pourcentage du contrôle positif.
Les résultats suivants ont été obtenus : contrôle négatif : DO = 0,048 ; contrôle positif : DO = 0,406 ; adapalène à 50 mM : DO = 0,105. Le pourcentage de restauration de la coagulation mesuré est d’environ 14 %. Ce résultat démontre que l’adapalène présente un effet de levée de l’inhibition de FXa par le TFPI. Exemple 3 - Synthèse de composés selon l’invention Composé H27 Le composé H27 (HEMO-027) de formule : est préparé selon le schéma réactionnel suivant :
Méthyl 2-(3-(adamantan-1 -yl)-4-méthoxyphényl)-1 ,2,3,4-tétrahydroisoquinoline- 6-carboxylate (7)
Pd2(dba)2 (1,7 mg, 0,0016 mmol, 1 mol%) a été ajouté dans un réacteur séché à la flamme suivi de SPHOS (2,6 mg, 0,0064 mmol, 4 mol%), 1-(5-bromo-2- méthoxyphényl)adamantane (5) (50 mg, 0,16 mmol, 1 eq. ), hydrochlorure de méthyl 1 ,2,3,4-tétrahydroisoquinoline-6-carboxylate (6) (43 mg, 0,19 mmol, 1,2 eq.) et NaOfBu (36,5 mg, 0,38 mmol, 2,4 eq.). Du toluène anhydre (600 mI, 267 mM) a été ajouté et le réacteur a été scellé. Le mélange résultant a été agité à 100 °C pendant 16h. Après avoir atteint la température ambiante, H2O et AcOEt ont été ajoutés. La phase aqueuse a été extraite 3 fois avec AcOEt, et les phases organiques combinées ont été évaporées sur MgS04, filtrées et concentrées in vacuo. Le résidu a été élué sur colonne de gel de silice avec 4:1 cyclohexane- AcOEt pour obtenir (7) (66 mg, 96%) sous forme d’un solide jaune. 1H RMN (CDCI3, 400 MHz): d 7.85 (s, 1 H, H-ar), 7.84 (d, 1 H, J = 7.9 Hz, H-ar), 7.20 (d, 1 H, J = 7.9 Hz, H-ar), 6.99 (s, 1 H, H-ar), 6.85-6.80 (m, 2H, 2 H-ar), 4.32 (s, 2H, NCH2), 3.91 (s, 3H, OCH3), 3.81 (s, 3H, OCH3), 3.45 (t, 2H, J = 5.8 Hz, NCH2CH2), 3.05 (t, 2H, J = 5.8 Hz, NCH2CH2), 2.11 (bs, 6H), 2.07 (bs, 3H), 1.78 (bs, 6H). 13C RMN (CDCI3, 100.6 MHz) d 167.3, 153.5, 145.0, 140.4, 139.6, 135.0, 130.2, 128.3, 127.1 , 126.8, 117.4, 114.7, 112.7, 55.6, 53.4, 52.1 , 48.8, 40.8, 37.4, 37.3, 29.5, 29.3.
Acide 2-(3-(adamantan-1 -yl)-4-méthoxyphényl)-1 ,2,3,4-tetrahydroisoquinoline- 6-carboxylique (HEMO-027)
A une solution de (7) (22 mg, 0,051 mmol) dans 2:1 THF:H20 (2 ml) à température ambiante, a été ajouté LiOH (3,5 mg, 0,13 mmol, 2,5 eq.). Après avoir agité pendant 16h, HCl 1 M a été ajouté pour atteindre un pH = 1. Le précipité formé a été filtré et lavé avec H2O puis par du MeOH froid. Le solide résultant a été séché in vacuo pour obtenir (HEMO-027) (8 mg, 38%) sous forme d’un solide jaune clair. 1H RMN (DMSO -d6, 400 MHz): δ 12.79 (bs, 1 H, OH), 7.75 (s, 1 H, H-ar), 7.73 (d, 1 H, J = 8.0 Hz, H-ar), 7.32 (d, 1 H, J = 8.0 Hz, H-ar), 6.88- 6.81 (m, 3H, 3 H-ar), 4.29 (s, 2H, NCH2), 3.73 (s, 3H, OCH3), 3.39 (t, 2H, J = 5.8 Hz, NCH2CH2), 2.97 (t, 2H, J = 5.8 Hz, NCH2CH2), 2.04 (bs, 9H), 1.73 (bs, 6H). 13C RMN (DMSO -d6, 125.7 MHz) δ 167.3, 152.3, 144.5, 140.0, 138.2, 134.7, 130.2, 129.6, 128.6, 126.9, 126.6, 115.6, 114.2, 113.0, 55.6, 51.9, 47.5, 36.6, 28.5, 28.4. HRMS (ESI/Q-TDE) m/z cale, pour C27H31NO3 [M+H]+ 418.2377, obtenu 418.2369.
Composé H31
Le composé H31 (HEMO-031 ) de formule : est préparé selon le schéma réactionnel suivant :
Méthyl 6-(3-(adamantan-1-yl)-4-méthoxyphényl)quinoline-2-carboxylate (10) Pd(OAc)2 (6,10 mg, 0,027 mmol, 5 mol%) et S-Phos (11 ,2 mg, 0,027 mmol, 5 mol%) ont été ajoutés à une solution dégazée de méthyl 6-bromoquinoline-2- carboxylate (8) (144,5 mg, 0,54 mmol, 1 eq.), ester boronique (9) (200 mg, 0,54 mmol, 1 eq.) et Na2CO3 (173 mg, 1 ,63 mmol, 3 eq.) dans 10:1 Dioxane:H2O. La suspension jaune obtenue a été agitée à 80 °C pendant 16h. H2O a ensuite été ajoutée et la phase aqueuse a été extraite 3 fois avec AcOEt. Les phases organiques combinées ont été séchées sur Na2SO4, filtrées et concentrées in vacuo. Le résidu a été élué sur colonne de gel de silice avec de 0 à 70% de AcOEt dans le Cyclohexane pour obtenir (10) (95 mg, 41%) sous forme d’un solide blanc. 1H RMN (CDCI3, 400 MHz): d 8.46 (d, 1 H, J = 8.9 Hz, H-ar), 8.34 (d, 1 H, J = 8.5 Hz, H-ar), 8.17 (d, 1 H, J = 8.5 Hz, H-ar), 8.03 (dd, 1 H, J = 2.1 Hz,
J = 8.9 Hz, H-ar), 7.95 (d, 1 H, J = 2.1 Hz, H-ar), 7.54 (d, 1 H, J = 2.4 Hz, H-ar), 8.03 (dd, 1 H, J = 2.4 Hz, J = 8.4 Hz, H-ar), 6.94 (d, 1 H, J = 8.5 Hz, H-ar), 4.05 (s, 3H, CH3), 3.85 (s, 3H, CH3), 2.11 (bs, 6H), 2.04 (bs, 3H), 1.74 (bs, 6H).
Acide 6-(3-(adamantan-1-yl)-4-m2thoxyph2nyl)quinoline-2-carboxylique (HEMO-031 )
A une solution d’ester (10) (30 mg, 0,07 mmol, 1eq.) dans 4:1 THF:MeOH à température ambiante, a été ajouté NaOH 2M (105 μI, 0,21 mmol, 3 eq.). La solution obtenue a été mélangée pendant 16h à 60 °C. Le mélange réactionnel a ensuite été versé dans l’eau et la phase aqueuse a été extraite avec AcOEt. La phase aqueuse résultante a été acidifiée en utilisant 1 M HCl et extraite 3 fois avec AcOEt. Les phases organiques combinées ont été séchées sur Na2SO4, filtrées et concentrées in vacuo pour obtenir (HEMO-031 ) (17 mg, 59%) sous forme d’un solide blanc. 1H RMN (DMSO -d6, 500 MHz): δ 8.57 (d, 1 H, J = 8.6 Hz, H-ar), 8.30 (d, 1 H, J = 1 .4 Hz, H-ar), 8.19 (d, 1 H, J = 8.9 Hz, H-ar), 8.15 (dd, 1 H, J = 1.9 Hz, J = 9.0 Hz, H-ar), 8.11 (d, 1 H, J = 8.5 Hz, H-ar), 7.69 (dd, 1 H, J = 2.2 Hz, J = 8.4 Hz, H-ar), 7.61 (d, 1 H, J = 2.2 Hz, H-ar), 7.14 (d, 1 H, J = 8.6 Hz, H-ar), 3.88 (s, 3H, CH3), 2.14 (bs, 6H), 2.08 (bs, 3H), 1.77 (bs, 6H). 13C RMN (DMSO -d6, 125.7 MHz) δ 166.5, 158.8, 145.8, 140.0, 138.1 , 137.4, 130.9, 130.1 , 129.5, 129.2, 125.9, 125.2, 124.0, 121.1 , 112.8, 55.4, 36.6, 36.5, 28.4. HRMS (ESI/Q-TDE) m/z cale pour C27H28NO3 [M+H]+ 414.2064, obtenu 414.2060. Composé H32
Le composé H32 (HEMO-032) de formule : est préparé selon le schéma réactionnel suivant :
Méthyl 7-(3-(adamantan-1-yl)-4-méthoxyphényl)quinoline-3-carboxylate (12) Pd(OAc)2 (16,9 mg, 0,075 mmol, 10 mol%) et S-Phos (15,4 mg, 0,037 mmol, 5 mol%) ont été ajoutés à une solution dégazée de méthyl 7-bromoquinoline-3- carboxylate (11) (200 mg, 0,75 mmol, 1 eq.), ester boronique (9) (415 mg, 1 ,13 mmol, 1 ,5 eq.) et Na2CO3 (239 mg, 02,25 mmol, 3 eq.) dans 10:1 Dioxane:H20. La suspension jaune obtenue a été agitée à 80 °C pendant 16h. H2O a ensuite été ajoutée et la phase aqueuse a été extraite 3 fois avec AcOEt. Les phases organiques combinées ont été séchées sur Na2S04, filtrées et concentrées in vacuo. Le résidu a été élué sur colonne de gel de silice avec de 0 à 70% de AcOEt dans le Cyclohexane pour obtenir (12) (40 mg, 13%) sous forme d’un solide blanc. 1H RMN (DMSO -d6, 400 MHz): d 9.33 (d, 1 H, J = 2.2 Hz, H-ar), 9.02 (d, 1 H, J = 2.2 Hz, H-ar), 8.28-8.26 (m, 2H, 2 H-ar), 8.05 (dd, 1 H, J = 1.8 Hz, J = 8.7 Hz, H-ar), 7.74 (dd, 1 H, J = 2.3 Hz, J = 8.5 Hz, H-ar), 7.63 (d, 1 H, J = 2.4 Hz, H-ar), 7.16 (d, 1H, J = 8.6 Hz, H-ar), 3.97 (s, 3H, CH3), 3.89 (s, 3H, CH3), 2.16 (bs, 6H), 2.08 (bs, 3H), 1.77 (bs, 6H).
Acide 7-(3-(adamantan-1-yl)-4-méthoxyphényl)quinoline-3-carboxylique
(HEMO-032)
A une solution d’ester (12) (15 mg, 0,035 mmol, 1eq.) dans 2:1 THF:MeOH à température ambiante, a été ajouté NaOH 2M (53 μl, 0,11 mmol, 3 eq.). La solution obtenue a été agitée pendant 2h à 60 °C. Le mélange réactionnel a été versée dans l’eau et la phase aqueuse a été extraite avec AcOEt. La phase aqueuse résultante a été acidifiée avec 1 M HCl et extraite 3 fois par AcOEt. Les phases organiques combinées ont été séchées sur Na2S04, filtrées et concentrées in vacuo pour obtenir (HEMO-032) (9 mg, 62%) sous forme d’un solide blanc. 1H RMN (DMSO -d6, 500 MHz): d 13.45 (s, 1H, OH), 9.31 (d, 1H, J = 2.1 Hz, H-ar), 8.96 (d, 1 H, J = 1.8 Hz, H-ar), 8.25 (s, 1 H, H-ar), 8.23 (d, 1 H, J = 8.6 Hz, H-ar), 8.02 (dd, 1 H, J = 1.7 Hz, J = 8.5 Hz, H-ar), 7.73 (dd, 1 H, J = 2.2 Hz, J = 8.5 Hz, H-ar), 7.61 (d, 1H, J = 2.3 Hz, H-ar), 7.14 (d, 1H, J = 8.6 Hz, H- ar), 3.88 (s, 3H, CH3), 2.14 (bs, 6H), 2.07 (bs, 3H), 1.76 (bs, 6H). 13C RMN (DMSO -d6, 125.7 MHz) d 166.4, 159.0, 150.3, 149.7, 143.9, 138.2, 138.1, 130.8, 130.1, 126.6, 126.1, 125.3, 124.8, 123.1, 112.8, 55.4, 36.6, 36.5, 28.4. HRMS (ESI/Q-TDE) m/z cale. C27H28NO3 [M+H]+ 414.2064, obtenu 414.2058.
Composé H35
Le composé H35 (HEMO-035) de formule : est préparé selon le schéma réactionnel suivant :
Méthyl 6-(3-(adamantan-1-yl)-4-((2-méthoxyéthoxy)méthoxy)phényl)-2- naphthoate (15)
L’acide boronique (14) (500 mg, 1 ,39 mmol, 1 eq.) a été ajouté à réacteur séché à la flamme suivi par du méthyl 6-bromo-2-naphtoate (13) (368 mg, 1 ,39 mmol,
1 eq.), Pd(PPh3)4 (80 mg, 0,070 mmol, 5 mol%), et K2CO3 (383 mg, 2,78 mmol,
2 eq.). Après addition de 10:1 MeOH:H2O (11 ,5 ml, 120 mM) puis le réacteur a ensuite été scellé. La solution obtenue a été agitée à 80 °C pendant 4h. Après avoir atteint la température ambiante, H2O et CH2CI2 ont été ajoutés. La phase aqueuse a été extraite 3 fois avec CH2CI2, et les phases organiques combinées ont été lavées avec une solution saturée de NaCI, séchées sur MgSO4, filtrées et concentrées in vacuo. Le résidu a été élué sur colonne de gel de silice contenant de 0 à 5% d’AcOEt dans le toluène pour obtenir (15) (610 mg, 88%) sous forme d’un solide blanc. 1H RMN (CDCI3, 400 MHz): δ 8.61 (s, 1 H, H-ar), 8.07 (dd, 1 H, J = 1.4 Hz, J = 8.6 Hz, H-ar), 8.01 (s, 1 H, H-ar), 7.99 (d, 1 H, J = 8.6 Hz, H-ar), 7.92 (d, 1 H, J = 8.6 Hz, H-ar), 7.79 (dd, 1 H, J = 1 .6 Hz, J = 8.5 Hz, H-ar), 7.92 (d, 1 H, J = 2.2 Hz, H-ar), 7.51 (dd, 1 H, J = 2.2 Hz, J = 8.5 Hz, H-ar), 7.29 (d, 1 H, J = 8.6 Hz, H-ar), 5.39 (s, 2H, OCH2O), 3.99 (s, 3H, OCH3), 3.90
(dd, 1 H, J = 3.9 Hz, J = 5.4 Hz, OCH2), 3.62 (dd, 1 H, J = 3.9 Hz, J = 5.4 Hz, OCH2), 3.42 (s, 3H, OCH3), 2.20 (s, 6H), 2.11 (s, 3H), 1.81 (s, 6H). 13C RMN (CDCI3, 100.6 MHz) δ 167.4, 156.7, 141.4, 139.1 , 136.0, 133.8, 131.4, 130.9, 129.8, 128.4, 127.1 , 126.6, 126.2, 126.0, 125.7, 125.0, 115.2, 93.5, 71.7, 68.0, 59.2, 52.3, 40.9, 37.4, 37.2, 29.2. HRMS (ESI/Q-TDE) m/z cale, pour C32H40NO5 518.2901 , obtenu 518.2890.
Méthyl 6-(3-(adamantan-1-yl)-4-hydroxyphényl)-2-naphthoate (16)
Une suspension de (15) (610 mg, 1 ,22 mmol, 1eq.) dans du HCl (2M dans l’Et20, 25 mL) a été agitée à température ambiante pendant 16h. Une solution saturée de NaHCO3 a été ajoutée et la phase aqueuse a été extraite 3 fois avec AcOEt. Les phases organiques combinées ont été lavées avec une solution saturée de NaCI, séchées sur MgSO4, filtrées et concentrées in vacuo. Le résidu a été élué sur colonne de gel de silice avec de 0 à 40% d’AcOEt dans l’hexane pour obtenir (16) (440 mg, 87%) sous forme d’un solide blanc. 1H RMN (DMSO -d6, 400 MHz): d 9.58 (s, 1 H, OH), 8.61 (s, 1 H, H-ar), 8.17 (s, 1 H, H-ar), 8.14 (d, 1 H, J = 8.6 Hz, H-ar), 8.06 (d, 1 H, J = 8.7 Hz, H-ar), 7.97 (dd, 1 H, J = 1.1 Hz, J = 8.6 Hz, H-ar), 7.86 (dd, 1 H, J = 0.9 Hz, J = 8.6 Hz, H-ar), 7.52-7.48 (m, 2H, 2 H-ar), 6.92 (d, 1 H, J = 8.2 Hz, H-ar), 3.91 (s, 3H, OCH3), 2.17 (s, 6H), 2.06 (s, 3H), 1 .75 (s, 6H). 13C RMN (DMSO -d6, 100.6 MHz) δ 166.4, 156.5, 140.9, 136.1 , 135.6, 130.7,
130.2, 129.9, 129.8, 128.5, 126.0, 125.4, 125.2, 125.0, 123.6, 117.0, 52.1 , 36.6, 36.4, 28.4.
Méthyl 6-(3-(adamantan-1 -yl)-4-(prop-2-yn-1 -yloxy)phényl)-2-naphthoate (17)
A une solution de naphtoate (16) (100 mg, 0,24 mmol, 1eq.) dans le THF anhydre (2,4 ml, 0, 1 M) sous atmosphère d’argon à 0°C dans un ballon séché à la flamme a été ajouté NaH (60%, 12 mg, 0,29 mmol, 1 ,2 eq.). Le mélange obtenu a été agité pendant 5 min à 0 °C puis du bromure de propargyl (33 μl, 0.29 mmol, 1 .2 eq.) a ensuite été ajouté. La solution, après avoir atteint la température ambiante, a été mélangée pendant 3h. H2O a été ajouté et la phase aqueuse a été extraite 3 fois avec CH2CI2 et les phases organiques combinées ont été lavées avec une solution saturée de NaCI, séchées sur MgSO4, filtrées et concentrées in vacuo. Le résidu a été élué sur colonne de gel de silice avec 5:95 AcOEt: Cyclohexane pour obtenir (17) (102 mg, 94%) sous forme d’un solide blanc. 1H RMN (CDCI3, 400 MHz): d 8.62 (s, 1 H, H-ar), 8.07 (dd, 1 H, J = 1 .6 Hz, J = 8.6 Hz, H-ar), 8.01 (s, 1 H, H-ar), 7.99 (d, 1 H, J = 8.6 Hz, H-ar), 7.92 (d, 1 H, J = 8.6 Hz, H-ar), 7.79 (dd, 1 H, J = 1.7 Hz, J = 8.5 Hz, H-ar), 7.62 (d, 1 H, J = 2.3 Hz, H-ar), 7.54 (dd, 1 H, J = 2.3 Hz, J = 8.4 Hz, H-ar), 2.55 (t, 1 H, J = 2.3 Hz, CHCCH2), 2.20 (s, 6H), 2.12 (s, 3H), 1.81 (s, 6H). 13C RMN (CDCI3, 100.6 MHz) d 167.4, 157.0, 141.4,
139.6, 136.1 , 133.7, 131.5, 131.0, 129.9, 128.4, 127.2, 126.6, 126.4, 125.8,
125.7, 125.0, 113.5, 78.9, 75.5, 55.9, 52.3, 40.9, 37.4, 37.2, 29.2.
Acide 6-(3-(adamantan-1 -yl)-4-(prop-2-yn-1 -yloxy)phényl)-2-naphthoique (HEMO-035)
A une solution de (17) (100 mg, 0,22 mmol) dans 2:1 THF:H20 (3 ml) à température ambiante, a été ajouté LiOH (13 mg, 0,55 mmol, 2,5 eq.). Après avoir mélangé pendant 16h, HCl 1 M a été ajouté pour atteindre un pH = 1. Le précipité formé a été filtré, lavé avec H2O et séché in vacuo pour obtenir (HEMO- 035) (36 mg, 38%) sous forme d’un solide blanc. 1H RMN (DMSO -d6, 500 MHz): d 13.03 (s, 1 H, OH), 8.62 (s, 1 H, H-ar), 8.23 (s, 1 H, H-ar), 8.16 (d, 1 H, J = 8.6 Hz, H-ar), 8.08 (s, 1 H, H-ar), 7.98 (d, 1 H, J = 8.6 Hz, H-ar), 7.90 (d, 1 H, J = 8.6 Hz, H-ar), 7.66 (dd, 1 H, J = 1 .3 Hz, J = 8.4 Hz, H-ar), 7.60 (s, 1 H, H-ar), 7.18 (d, 1 H, 8.5 Hz, H-ar), 4.91 (d, J = 1.6 Hz, H-ar), 3.60 (t, 1 H, J = 1.6 Hz, CHCCH2), 2.16 (s, 6H), 2.08 (s, 3H), 1.77 (s, 6H). 13C RMN (DMSO -d6, 125.7 MHz) δ 167.5,
156.5, 140.1 , 138.5, 135.5, 132.3, 131.0, 130.3, 129.8, 128.4, 127.7, 126.0,
125.6, 125.5, 125.3, 124.3, 114.0, 79.3, 78.1 , 67.0, 56.6, 40.1 , 36.6, 36.5, 28.4. HRMS (ESI/Q-TDE) m/z cale, pour C30H27O3 [M-H]- 435.1966, obtenu 435.1962. Composé H38 Le composé H38 (HEMO-038) de formule : est préparé selon le schéma réactionnel suivant : Ethyl 6-(3-(adamantan-1 -yl)-4-méthoxyphényl)-4-hydroxy-2-naphthoate (19)
De l’acide boronique (2) (150 mg, 0,53 mmol, 1 eq.) a été ajouté à un réacteur séché à la flamme suivi par le bromoester (18) (179 mg, 0,53 mmol, 1 eq.), Pd(PPh3)4 (31 mg, 0,027 mmol, 5 mol%), et K2CO3 (146 mg, 1 ,06 mmol, 2 eq.). 10:1 EtOH:H2O (4,4 ml, 120 mM) a été ajouté et le réacteur a été scellé. Le mélange obtenu a été agité à 80 °C pendant 5h. Après avoir atteint la température ambiante, H2O et CH2CI2 ont été ajoutés. La phase aqueuse a été extraite 3 fois avec CH2CI2, et les phases organiques combinées ont été lavées avec une solution saturée de NaCI, séchées sur MgSO4, filtrées et concentrées in vacuo. Le résidu a été trituré dans du CH2CI2 froid et le précipité résultant a été filtré et séché in vacuo pour obtenir (19) (142 mg, 59%) sous forme d’un solide blanc. 1H RMN (DMSO -d6, 500 MHz): d 10.55 (s, 1 H, OH), 8.31 (s, 1 H, H- ar), 8.08 (s, 1 H, H-ar), 8.06 (d, 2H, J = 8.4 Hz, H-ar), 7.85 (d, 1 H, J = 8.4 Hz, H- ar), 7.60 (d, 1 H, J = 8.1 Hz, H-ar), 7.53 (s, 1 H, H-ar), 7.41 (s, 1 H, H-ar), 7.10 (d, 1 H, J = 8.4 Hz, H-ar), 4.35 (q, 2H, J = 6.9 Hz, OCH2), 3.85 (s, 3H, OCH3), 2.12 (bs, 6H), 2.05 (bs, 3H), 1.74 (bs, 6H), 4.35 (t, 2H, J = 7.1 Hz, CH3). 13C RMN (DMSO -d6, 125.7 MHz) d 166.0, 158.5, 153.5, 139.3, 138.0, 132.2, 131.9, 129.8, 127.2, 127.1 , 126.2, 125.6, 124.9, 121.0, 118.3, 112.8, 106.9, 60.7, 55.3, 40.1 , 36.6, 36.5, 28.4, 14.3.
Acide 6-(3-(adamantan-1-yl)-4-méthoxyphényl)-4-hydroxy-2-naphthoique (HEMO-038)
A une suspension d’ester (19) (25 mg, 0,055 mmol) dans 2:1 THF:H2O (1 ,5 ml) a été ajouté du LiOH (3 mg, 0,11 mmol, 2,5 eq.). Après avoir mélangé pendant 4h à 60 °C, HCl 1M a été ajouté pour atteindre un pH = 1 . Le précipité obtenu a été filtré, lavé avec H2O et séché in vacuo pour obtenir (HEMO-038) (12,3 mg, 52%) sous forme d’un solide jaune clair. 1H RMN (DMSO -d6, 400 MHz): d 12.86 (bs, 1 H, OH), 10.47 (s, 1 H, OH), 8.29 (s, 1 H, H-ar), 8.06 (s, 1 H, H-ar), 8.05 (d, 2H, J = 7.8 Hz, H-ar), 7.84 (d, 1 H, J = 8.7 Hz, H-ar), 7.61 (d, 1 H, J = 8.0 Hz, H- ar), 7.54 (s, 1 H, H-ar), 7.38 (s, 1 H, H-ar), 7.13 (d, 1 H, J = 8.6 Hz, H-ar), 3.87 (s, 3H, OCH3), 2.13 (bs, 6H), 2.07 (bs, 3H), 1.76 (bs, 6H). 13C RMN (DMSO -d6, 100.6 MHz) d 167.6, 158.5, 153.4, 139.0, 138.1 , 132.2, 132.0, 129.7, 128.2, 127.0, 126.0, 125.6, 124.9, 121.1 , 118.3, 112.8, 107.4, 53.4, 40.1 , 36.6, 36.5, 28.4. HRMS (ESI/Q-TDE) m/z cale, pour 427.1915, obtenu 427.1911.
Composé H39
Le composé H39 (HEMO-039) de formule : est préparé selon le schéma réactionnel suivant :
(6-(3-(adamantan-1 -yl)-4-méthoxyphényl)naphthalèn-2-yl)méthanol (21 )
De l’acide boronique (2) (150 mg, 0,53 mmol, 1 eq.) a été ajouté dans un réacteur à microonde séché à la flamme suivi par du bromonaphtol (20) (126 mg, 0,53 mmol, 1 eq.), Pd(PPh3)4 (31 mg, 0,027 mmol, 5 mol%), et K2CO3 (146 mg, 1 ,06 mmol, 2 eq.). 10:1 MeOH:H2O (4,4 ml, 120 mM) a été ajouté et le réacteur a été scellé. Le mélange obtenu a été agité à 120 °C pendant 1 h au micro-onde. Après avoir atteint la température ambiante, H2O et CH2CI2 ont été ajoutés. La phase aqueuse a été extraite 3 fois avec CH2CI2, et les phases organiques combinées ont été lavées avec une solution saturée de NaCI, séchées sur MgSO4, filtrées et concentrées in vacuo. Le résidu a été élué sur colonne de gel de silice avec 100% CH2CI2 pour obtenir (21) (167 mg, 80%) sous forme d’un solide blanc. 1H RMN (CDCI3, 400 MHz): d 7.98 (s, 1 H, H-ar), 7.90-7.82 (m, 4H, 4 H-ar), 7.74 (d, 1 H, J = 8.5 Hz, H-ar), 7.60 (d, 1 H, J = 1.7 Hz, H-ar), 7.55-7.48 (m, 2H, 2 H-ar),
6.99 (d, 1 H, J = 8.4 Hz, H-ar), 4.87 (s, 2H, OCH2), 3.90 (s, 3H, OCH3), 2.20 (bs, 6H), 2.11 (bs, 3H), 1.81 (bs, 6H). 13C RMN (CDCI3, 100.6 MHz) δ 158.7, 139.2, 139.0, 138.1 , 133.4, 133.2, 132.3, 128.6, 128.4, 126.2, 126.0, 125.7, 125.6, 125.4, 125.0, 112.2, 65.7, 55.3, 40.8, 37.3, 29.3. HRMS (ESI/Q-TDE) m/z calc. pour C28H3OO2K[M+K]+ 437.1877, obtenu 437.1869.
(6-(3-(adamantan-1-yl)-4-méthoxyphényl)naphthalèn-2-yl)méthyl) éthanethioate
(22)
A une solution de PPh3 (68 mg, 0,26 mmol, 2 eq.) dans le THF (500 μl) à 0 °C sous atmosphère d’argon a été ajouté du di-tert-butyl azodicarboxylate (60 mg, 0,26 mmol, 2 eq.) et la solution obtenue a été agitée pendant 30 min à 0 °C. Une solution d’alcool (21) (50 mg, 0,13 mmol, 1 eq.) dans le THF (500 pl) a ensuite été ajoutée et le mélange obtenu a été agité pendant 1 h à 0 °C puis pendant 1h à température ambiante. Après dilution avec CH2CI2, la phase organique a été lavée avec HCl 1 M. La phase aqueuse a été extraite 3 fois avec CH2CI2 et les phases organiques combinées ont été séchées sur MgSO4, filtrées et concentrées in vacuo. Le résidu a été élué sur colonne de gel de silice avec 3:1 CH2Cl2:Cyclohexane pour obtenir (22) (43 mg, 72%) sous forme d’un solide blanc. 1H RMN (CDCI3, 400 MHz): d 7.95 (d, 1 H, J = 0.6 Hz, H-ar), 7.83 (d, 1 H, J = 8.4 Hz, H-ar), 7.76 (s, 1 H, H-ar), 7.72 (dd, 1 H, J = 1 .6 Hz, J = 8.5 Hz, H-ar), 7.58 (d, 1 H, J = 2.3 Hz, H-ar), 7.52 (dd, 1 H, J = 2.3 Hz, J = 8.4 Hz, H-ar), 7.39 (dd, 1 H, J = 1 .6 Hz, J = 8.4 Hz, H-ar), 6.99 (d, 1 H, J = 8.4 Hz, H-ar), 4.30 (s, 2H, SCH2), 3.90 (s, 3H, OCH3), 2.38 (s, 3H, SAc), 2.19 (bs, 6H), 2.10 (bs, 3H), 1.81 (bs, 6H). 13C RMN (CDCI3, 100.6 MHz) δ 195.3, 158.8, 139.2, 139.0, 134.7,
133.2, 133.1 , 132.3, 128.8, 128.2, 127.4, 127.3, 126.2, 126.0, 125.7, 124.9,
112.3, 55.3, 40.8, 37.3, 34.0, 30.5, 29.3.
Acide (6-(3-(adamantan-1 -yl)-4-méthoxyphényl)naphthalèn-2- yl)méthanesulfonique (HEMO-039)
Du thioacétate (22) (43 mg, 0,094 mmol, 1eq.) a été mis en suspension dans l’AcOH (1 ,07 ml, 87,5 mM). AcONa (77 mg, 0,94 mmol, 10 eq.) a été ajouté, suivi d’hydrogénopersulfate de potassium (74 mg, 0,24 mmol, 2,5 eq.) et le mélange obtenu a été fortement agité pendant 16h. AcOEt a été ajouté et le précipité obtenu a été filtré et lavé avec AcOEt puis les phases organiques ont été concentrées in vacuo. Le résidu a été élué sur colonne de gel de silice avec de 0 to 20% de MeOH dans le CH2CI2 pour obtenir (HEMO-039) (14,5 mg, 33%) sous forme d’un solide blanc. 1H RMN (DMSO -d6, 400 MHz): d 8.08 (s, 1 H, H- ar), 7.89 (d, 1 H, J = 8.7 Hz, H-ar), 7.86 (d, 1 H, J = 8.4 Hz, H-ar), 7.77 -7.74 (m, 2H, 2 H-ar), 7.62 (dd, 1 H, J = 2.2 Hz, J = 8.4 Hz, H-ar), 7.56 (d, 1 H, J = 2.3 Hz, H-ar), 7.52 (dd, 1 H, J = 1 .5 Hz, J = 8.4 Hz, H-ar), 7.10 (d, 1 H, J = 8.6 Hz, H-ar), 3.88 (s, 2H, SCH2), 3.86 (s, 3H, OCH3), 2.14 (bs, 6H), 2.07 (bs, 3H), 1.76 (bs, 6H). 13C RMN (DMSO-d6, 100.6 MHz) δ 158.2, 137.9, 137.1 , 133.1 , 132.3, 132.1 , 131.7, 129.4, 128.1 , 128.0, 126.9, 125.4, 124.8, 123.9, 112.7, 57.7, 55.3, 36.6, 28.4. HRMS (ESI/Q-TDE) m/z cale pour C28H29O4S [M-H]- 461.1792, obtenu 461.1784.
Exemple 4 - Synthèse du composé H24 Le composé H24 de formule : est préparé selon le schéma réactionnel suivant :
Méthyl 3'-(adamantan-1-yl)-4'-méthoxy-[1 ,1'-biphényl]-4-carboxylate (3) L’acide boronique (2) (242 mg, 0,85 mmol, 1 eq.) a été ajouté dans un réacteur séché à la flamme suivi du méthyl 4-bromobenzoate (1) (183 mg, 0,85 mmol, 1 eq.), Pd(PPh3)4 (54 mg, 0,047 mmol, 5 mol%), et de K2CO3 (257 mg, 1 ,86 mmol, 2 eq.). Après addition de 10:1 MeOH:H2O (7,75 ml, 120 mM) le réacteur a été scellé. La solution a ensuite été agitée à 80 °C pendant 16h. Après avoir atteint la température ambiante, H2O et CH2CI2 ont été ajoutés. La phase aqueuse a été extraite 3 fois avec du CH2CI2, et les phases organiques combinées ont été lavées avec une solution saturée de NaCI, évaporées sur MgSO4, filtrées et concentrées in vacuo. Le résidu a été élué sur colonne de gel de silice avec 1 :2 CH2Cl2:Cyclohexane pour donner (3) (260 mg, 85%) sous forme d’un solide blanc. 1H RMN (CDCI3, 400 MHz): d 8.07 (d, 2H, J = 8.4 Hz, 2 H-ar), 7.63 (d, 2H, J = 8.4 Hz, 2 H-ar), 7.50 (d, 1 H, J = 2.3 Hz, H-ar), 7.45 (dd, 1 H, J = 2.3 Hz, J = 8.4 Hz, 2 H-ar), 6.96 (d, 1 H, J = 8.4 Hz, H-ar), 3.93 (s, 3H, CH3), 3.89 (s, 3H, CH3), 2.15 (bs, 6H), 2.09 (bs, 3H), 1.79 (bs, 6H). 13C RMN (CDCI3, 100.6 MHz) d 167.3, 159.3, 146.2, 139.1 , 132.1 , 130.2, 128.1 , 126.7, 125.9, 125.7, 112.2, 55.3, 52.2, 40.7, 37.2, 29.2, 27.1. HRMS (ESI/Q-TDE) m/z cale, pour C25H29O3 [M+H]+ 377.2111 , trouvé 377.2111 .
Acétate de méthyle de 2-(3'-(adamantan-1-yl)-4'-méthoxy-[1 ,1'-biphényl]-4- ylcarboxamido) (4)
A une suspension d’ester (3) (112 mg, 0,31 mmol) dans 2:1 THF:H20 (4,3 ml) a été ajouté LiOH (19 mg, 0,78 mmol, 2,5 eq.). Après avoir mélangé pendant 18h, HCl 1 M a été ajouté pour atteindre un pH = 1. Le précipité formé a été filtré, lavé avec H2O et évaporé in vacuo avant d’être mis en suspension dans CH2CI2 anhydre (7,5 ml). EDC.HCI (140 mg, 0,73 mmol, 2.5 eq.), HOBt (120 mg, 0,87 mmol, 3 eq.) et DIPEA (200 μl, 1 ,15 mmol, 4 eq.) ont ensuite été ajoutés et le mélange obtenu a été agité pendant 5 min à température ambiante avant l’addition de la glycine méthyl ester (74 mg, 0,58 mmol, 2 eq.). Après agitation pendant 16h, HCl 1M a été ajouté et la phase aqueuse a été extraite 3 fois avec CH2CI2. Les phases organiques combinées ont été lavées avec H2O et une solution saturée de NaCI, évaporées sur MgSO4, filtrées et concentrées in vacuo. Le résidu a été élué sur colonne de gel de silice avec de 30 à 50% d’AcOEt dans le Cyclohexane pour obtenir (4) (97 mg, 74%) sous la forme d’un solide blanc. 1H RMN (CDCI3, 500 MHz): d 7.87 (d, 2H, J = 8.3 Hz, 2 H-ar), 7.64 (d, 2H, J = 8.3 Hz, 2 H-ar), 7.48 (d, 1 H, J = 2.2 Hz, H-ar), 7.44 (dd, 1 H, J = 2.3 Hz, J = 8.4 Hz, 2 H-ar), 6.96 (d, 1 H, J = 8.4 Hz, H-ar), 6.68 (bs, 1 H, NH), 4.28 (d, 2H, J = 4.9 Hz, NCH2) 3.89 (s, 3H, CH3), 3.82 (s, 3H, CH3), 2.15 (bs, 6H), 2.09 (bs, 3H), 1.79 (bs, 6H). 13C RMN (CDCI3, 125.7 MHz) d 170.8, 167.5, 159.2, 145.2, 139.1 , 132.0, 131.5, 127.7, 126.9, 125.8, 125.6, 112.2, 55.3, 52.6, 41.9, 40.7, 37.3, 37.2, 29.2. HRMS (ESI/Q-TDE) m/z cale, pour C27H32NO4 [M+H]+ 434.2326, obtenu 434.2322.
Acide 2-(3'-(adamantan-1-yl)-4'-méthoxy-[1 ,1'-biphenyl]-4-ylcarboxamido) acétique (HEMO-024, ou H24) A une suspension d’ester (4) (25 mg, 0,058 mmol) dans 2:1 THF:H2O (1 ,5 ml) a été ajouté LiOH (4 mg, 0,15 mmol, 2,5 eq.). Après agitation pendant 18h, HCl 1 M a été ajouté pour atteindre un pH = 1 . Le précipité formé a été filtré, lavé avec H2O et évaporé in vacuo pour obtenir (HEMO-024) (13 mg, 54%) sous forme d’un solide blanc. 1H RMN (DMSO -d6, 400 MHz): d 12.57 (bs, 1 H, OH), 8.84 (t, 1 H, J = 5.9 Hz, NH), 7.93 (d, 2H, J = 8.4 Hz, 2 H-ar), 7.72 (d, 2H, J = 8.4 Hz, 2 H-ar), 7.55 (dd, 1 H, J = 1 .9 Hz, J = 8.4 Hz, H-ar), 7.46 (d, 1 H, J = 1 .9 Hz, H-ar), 7.08 (d, 1 H, J = 8.6 Hz, H-ar), 3.94 (d, 2H, J = 5.8 Hz, NCH2), 3.85 (s, 3H, OCH3), 2.11 (bs, 6H), 2.06 (bs, 3H), 1.75 (bs, 6H). 13C RMN (DMSO -d6, 125.7 MHz) d 171.4, 166.3, 158.7, 143.4, 138.0, 131.7, 131.1 , 127.9, 126.0, 125.5, 124.8, 112.7, 55.4, 41.2, 36.6, 28.4. HRMS (ESI/Q-TDE) m/z cale, pour C26H28NO4 [M- H]- 418.2024, obtenu 418.2016.
Exemple 5 - Test de génération de thrombine ex vivo
Un second test de génération de thrombine est réalisé, pour les composés H27, H31 , H32, H35, H38, H39 et le composé H24.
Le test de génération de thrombine a été effectué à 37°C à l'aide d’un analyseur CAT (Diagnostica Stago) avec le réactif PPP Reagent LOW (Diagnostica Stago) conformément aux instructions du fabricant et selon la méthode établie par le Pr. Hemker en 2003. Le réactif PPP Reagent LOW est un mélange de facteur tissulaire (TF) à 1pM avec des vésicules phospholipidiques (PL, 4mM). Le test est déclenché par l’ajout d’un mélange calcium + substrat fluorescent (ZGGR- AMC) (mélange FluCa).
D’un point de vue technique, 80 μL d'échantillon de plasma surchargé sont ajoutés à 20 μL de « complexe initiateur » (PPP Reagent LOW) et incubés 10 min à 37°C. Ensuite, la réaction est déclenchée par l’ajout de 20 μL de FluCa (mélange de CaCl2 et substrat ZGGR-AMC) et le signal de fluorescence est mesuré au cours du temps. Chaque test est réalisé en triplicat.
Pour chaque molécule testée, 247 μL du plasma provenant du patient hémophile ont été surchargés avec 13 μL d’une solution contenant différentes quantités de composé (molécule à tester, facteur VIII ou tampon de dilution) pour obtenir la concentration finale souhaitée (dilution systématique de la molécule à tester dans le plasma au 1/20). Par exemple, pour obtenir la concentration finale de 50 mM dans le plasma, 13 μL d’une solution à 1mM ont été ajoutés à 247 μL de plasma. En parallèle des tests sur les différents composés chimiques, le plasma de patient hémophile est surchargé avec le même tampon de dilution du composé, une solution de diméthylsulfoxyde (DMSO) à 8%, en tant que contrôle négatif (0,4% de DMSO final) afin d’obtenir le niveau de base de génération de thrombine du plasma utilisé. Le contrôle positif est le même plasma surchargé avec du facteur VIII plasmatique (Factane, LFB, France) à une concentration de 1 UI/mL (ou 100% de facteur VIII) afin d’obtenir le niveau « normal » attendu de génération de thrombine du plasma utilisé. Pour cet exemple, les solutions d’adapalène et des composés à 1mM ont été préparées avec du tampon (18 mM HEPES, NaCI 135 mM, pH 7,35) au lieu de l’eau comme dans l’exemple 1. Cette modification a permis d’augmenter la quantité de thrombine générée par le plasma du patient hémophile A en présence de 50 μM d’adapalène. Les composés ont été testés à une concentration finale de 50 μM dans le plasma, et le signal a été mesuré au cours du temps. Les résultats obtenus, exprimés en quantité de thrombine mesurée au maximum du pic obtenu et normalisés sur le pic de thrombine obtenu avec l’adapalène, sont indiqués dans le tableau 1 ci-après : Tableau 1
L’ensemble des composés selon l’invention testés permettent d’obtenir une augmentation significative de la génération de thrombine par rapport au contrôle négatif, avec, pour tous à l’exception du composé H24, un pic de thrombine générée supérieur à celui du contrôle positif, et notamment largement supérieur pour les composés Ad, H38 et H39.

Claims

REVENDICATIONS
1. Composé de formule générale (III') : dans laquelle
Y1’ représente une liaison covalente ou un groupement amide, R4’ représente un atome d’hydrogène, un groupement hydroxyle, un atome d’halogène, un groupement amine ou un radical carboné linéaire ou ramifié, saturé ou insaturé, éventuellement interrompu et/ou substitué par un ou plusieurs hétéroatomes et/ou un ou plusieurs groupements comportant au moins un hétéroatome, Y2’ représente une liaison covalente ou un groupement amide, A2’ représente un groupement cyclique ou hétérocyclique, optionnellement substitué, comportant deux cycles fusionnés, au moins un desdits cycles étant aromatique, ou l’un de ses sels pharmaceutiquement acceptables, pour son utilisation en tant qu’agent actif pour le traitement de l’hémophilie chez un sujet.
2. Composé pour son utilisation selon la revendication 1, pour la restauration de la coagulation dans le plasma d’un sujet atteint d’hémophilie.
3. Composé pour son utilisation selon la revendication 2, pour la restauration de la génération de thrombine dans le plasma d’un sujet atteint d’hémophilie.
4. Composé pour son utilisation selon l’une quelconque des revendications 1 à 3, selon laquelle, dans la formule générale (III'), R4’ représente un groupement -ORs ou un groupement -O-CO-R8, où Rs représente un radical hydrocarboné linéaire ou ramifié, saturé ou insaturé, comportant de 1 à 10 atomes de carbone, optionnellement substitué par un ou deux substituants R14, R14’, identiques ou différents, choisis chacun parmi F, -CO2H, -SO3H, -P(O)(OH)2, -P(O)(OCH3)2, d’hydrogène ou un groupement méthyle.
5. Composé pour son utilisation selon la revendication 4, selon laquelle Rs représente un groupement de formule générale (XVIII) : dans laquelle y est un nombre entier compris entre 1 et 10 et R14 est tel que défini dans la revendication 4.
6. Composé pour son utilisation selon l’une quelconque des revendications 1 à 5, selon laquelle, dans la formule générale (III'), R4’ est fixé au radical phényle en position ortho ou para par rapport au motif adamantyle, et Y2’ est fixé au radical phényle en position méta par rapport au motif adamantyle.
7. Composé pour son utilisation selon l’une quelconque des revendications 1 à 6, selon laquelle, dans la formule générale (III'), A2’ est au moins substitué par un substituant R11 choisi parmi le fluor, les groupements carboxyle, sulfonyle, phosphonyle, tétrazole ou céto-oxadiazole, et les radicaux carbonés linéaires, ramifiés et/ou cycliques, saturés ou insaturés, aromatiques ou non, éventuellement interrompus et/ou substitués par un ou plusieurs hétéroatomes, et/ou un ou plusieurs groupements comportant au moins un hétéroatome.
8. Composé pour son utilisation selon la revendication 7, selon lequel R11 est choisi parmi les groupements de formules :
9. Composé pour son utilisation selon l’une quelconque des revendications 1 à 8, ledit composé répondant à la formule générale (IX) : dans laquelle Y1’, Y2’ et R4’ sont tels que définis dans l’une des revendications 1 à 8, A3 représente un hydrocarbure cyclique ou hétérocyclique à 3 à 8 chaînons, saturé ou insaturé, aromatique ou non,
B1 et B2, identiques ou différents, représentent chacun un groupement -CH- ou un atome d’azote, R9 et R10, identiques ou différents, représentent chacun un atome d’hydrogène, un groupement hydroxyle ou un groupement -OR12 ou -O-CO-R12 où R12 représente un radical hydrocarboné linéaire ou ramifié, saturé ou insaturé, comportant de 1 à 10 atomes de carbone, optionnellement substitué par un ou deux substituants R16, R16’, identiques ou différents, choisis chacun parmi où R17 représente un atome d’hydrogène ou un groupement méthyle, et R11 représente un substituant choisi parmi le fluor, les groupements carboxyle, sulfonyle, phosphonyle, tétrazole ou céto-oxadiazole, et les radicaux carbonés linéaires, ramifiés et/ou cycliques, saturés ou insaturés, aromatiques ou non, éventuellement interrompus et/ou substitués par un ou plusieurs hétéroatomes, et/ou un ou plusieurs groupements comportant au moins un hétéroatome.
10. Composé pour son utilisation selon la revendication 9, dans laquelle R11 représente un groupement -(CH2)x-R13 où x est un nombre entier compris entre 0 et 4 et R13 représente un atome de fluor ou un groupement carboxyle, sulfonyle, phosphonyle, tétrazole ou céto-oxadiazole.
11. Composé pour son utilisation selon la revendication 10, ledit composé répondant à la formule générale (X) : dans laquelle Y1’, Y2’, R4’, A3, B1, B2, R9, R10, R13 et x sont tels que définis dans la revendication 9.
12. Composé pour son utilisation selon l’une des revendications 10 ou 11, ledit composé répondant à la formule générale (XI) : dans laquelle Y1’, Y2’, R4’, A3, B1, R9, R10, R13 et x sont tels que définis dans la revendication 9.
13. Composé pour son utilisation selon l’une quelconque des revendication 10 à 11 , ledit composé répondant à la formule générale (XII) :
dans laquelle Y1’, Y2’, R4’, A3, B1, B2, R9, R10, R13 et x sont tels que définis dans la revendication 9.
14. Composé pour son utilisation selon l’une quelconque des revendications 10 à 13, ledit composé répondant à la formule générale (XIII) : dans laquelle Y1’, Y2’, R4’, A3, B1, R9, R10, R13 et x sont tels que définis dans la revendication 9.
15. Composé pour son utilisation selon l’une quelconque des revendications 10 à 14, ledit composé répondant à la formule générale (XIV) :
dans laquelle Y1’, Y2’, R4’, R9, B1 , R10, R13 et x sont tels que définis dans la revendication 9.
16. Composé pour son utilisation selon l’une quelconque des revendications 10 à 15, ledit composé répondant à la formule générale (XV) : dans laquelle Y1’, Y2’, R4’, R9, B1 , R10, R13 et x sont tels que définis dans la revendication 9.
17. Composé pour son utilisation selon l’une quelconque des revendications 10 à 16, ledit composé répondant à la formule (XVI) :
dans laquelle Y1’, Y2’, R4’, R13 et x sont tels que définis dans la revendication 9.
18. Composé pour son utilisation selon l’une quelconque des revendications 1 à 17, ledit composé répondant à la formule (V) :
19. Composé pour son utilisation selon l’une quelconque des revendications 1 à 17, ledit composé répondant à la formule (XVII) :
à 19, selon laquelle ledit sujet est un mammifère, en particulier un être humain.
21. Composé pour son utilisation selon l’une quelconque des revendications 1 à 20, selon laquelle ledit composé est contenu dans une composition pharmaceutique, dans un véhicule pharmaceutiquement acceptable.
22. Composé pour son utilisation selon la revendication 21, selon laquelle ladite composition présente une forme adaptée à une administration audit sujet par voie orale.
EP21742857.2A 2020-07-24 2021-07-23 Composés pour le traitement de l'hémophilie Pending EP4185281A1 (fr)

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
FR2007806A FR3112684B1 (fr) 2020-07-24 2020-07-24 Composés pour le traitement de l’hémophilie
PCT/EP2021/070656 WO2022018256A1 (fr) 2020-07-24 2021-07-23 Composés pour le traitement de l'hémophilie

Publications (1)

Publication Number Publication Date
EP4185281A1 true EP4185281A1 (fr) 2023-05-31

Family

ID=73138945

Family Applications (1)

Application Number Title Priority Date Filing Date
EP21742857.2A Pending EP4185281A1 (fr) 2020-07-24 2021-07-23 Composés pour le traitement de l'hémophilie

Country Status (7)

Country Link
US (1) US20230346727A1 (fr)
EP (1) EP4185281A1 (fr)
JP (1) JP2024511910A (fr)
CN (1) CN116710080A (fr)
CA (1) CA3186258A1 (fr)
FR (1) FR3112684B1 (fr)
WO (1) WO2022018256A1 (fr)

Family Cites Families (10)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
LU85849A1 (fr) * 1985-04-11 1986-11-05 Cird Derives benzonaphtaleniques,leur procede de preparation et leur application dans les domaines pharmaceutiques et cosmetiques
FR2722190B1 (fr) * 1994-07-05 1996-10-04 Sanofi Sa Derives de 1-benzyl-1,3-dihydro-2h-benzimidazol-2-one, leur preparation, les compositions pharmaceutique en contenant
US20030092758A1 (en) * 1995-10-09 2003-05-15 Laszlo Fesus Use of a RAR-gamma-specific agonist ligand for increasing the rate of apoptosis
US7589239B2 (en) * 2005-09-02 2009-09-15 Auspex Pharmaceuticals Therapeutic agents for the treatment of cancer, metabolic diseases and skin disorders
EP3721880B1 (fr) * 2010-09-01 2022-02-02 Thomas Jefferson University Composition et procédé pour la réparation et la régénération musculaires
WO2012174224A2 (fr) * 2011-06-17 2012-12-20 Calando Pharmaceuticals, Inc. Procédés d'administration de produits thérapeutiques à base d'acide nucléique
WO2016120432A1 (fr) * 2015-01-30 2016-08-04 Fundación Para La Investigación Médica Aplicada Composés et procédés pour traitement anticoagulant
WO2016173948A1 (fr) * 2015-04-30 2016-11-03 Bayer Pharma Aktiengesellschaft Indazolopyrimidinones comme inhibiteurs de la fibrinolyse
US11278025B2 (en) * 2017-05-17 2022-03-22 The General Hospital Corporation Antibiotic compounds
CN108670963A (zh) * 2018-06-08 2018-10-19 中国医学科学院皮肤病医院 阿达帕林在制备预防或治疗人细胞异常增殖性疾病药物中的应用

Also Published As

Publication number Publication date
WO2022018256A1 (fr) 2022-01-27
CA3186258A1 (fr) 2022-01-27
FR3112684A1 (fr) 2022-01-28
US20230346727A1 (en) 2023-11-02
CN116710080A (zh) 2023-09-05
JP2024511910A (ja) 2024-03-18
FR3112684B1 (fr) 2022-08-12

Similar Documents

Publication Publication Date Title
ES2519346T3 (es) Derivado de ácido azetidinacarboxílico y uso medicinal del mismo
CN102091330B (zh) 含有缬沙坦和nep抑制剂的药物组合物
JP2005504053A (ja) アミロイドーシス治療のためのアミジン誘導体
FR2466248A1 (fr) Derives d'agents anti-inflammatoires non steroides, procede de preparation et compositions pharmaceutiques les contenant
WO1999012534A1 (fr) Regulateurs des recepteurs actives par le proliferateur des peroxisomes
JP2000517341A (ja) マトリックスメタロプロテイナーゼ阻害剤およびそれらの治療的使用
EP2403859A2 (fr) Pince moléculaire pour le traitement d'amyloses
JP2019503356A (ja) エンドソーマルgタンパク質共役受容体のトリパータイト・モジュレーター
EP0087378B1 (fr) Ethers-oximes d'alcoylaminoalcools comme médicaments, produits nouveaux et procédés pour leur préparation
EP2300424B1 (fr) Utilisation de derives d'indole comme activateurs de nurr-1, pour le traitement de la maladie de parkinson
TWI314457B (fr)
FR2833261A1 (fr) Nouveaux composes inhibiteurs specifiques de la phospholipase a2 secretee non pancreatique humaine du groupe ii
EP2113502B1 (fr) Composés de type hydrazide et leur utilisation dans des compositions pharmaceutiques pour le traitement des maladies cardiovasculaires
EP4185281A1 (fr) Composés pour le traitement de l'hémophilie
JP2001518458A (ja) キレート化剤の親油性ジエステル
JP2006501160A (ja) アミロイド症を処置するためのアミジン誘導体
FR2849598A1 (fr) Utilisation d'inhibiteurs de la kynurenine-3-hydroxylase pour le traitement du diabete, par augmentation du nombre de cellules des ilots de langerhans
TW200400971A (en) Par-2-activating peptide derivative and pharmaceutical composition using the same
JP2772660B2 (ja) リシルオキシダーゼの抑制剤
WO2003070235A1 (fr) Compositions medicinales inhibant les tryptases
CN101115709B (zh) 氨基羧酸衍生物及其医药用途
EP0723974B1 (fr) Dérivés de mercaptoalcanoyldipeptides, leur procédé de préparation et les compositions pharmaceutiques qui les contiennent
JPWO2005067904A1 (ja) Abca1安定化剤
FR2763847A1 (fr) Utilisation de tetrahydropyridines 4-substituees pour fabriquer des medicaments agissant sur le tgf-beta-1
EP3285774A1 (fr) Utilisation de la (4-hydroxy-2-methyl-1,1-dioxido-2h-benzo[e][1,2]thiazin-3-yl)(naphthalen-2-yl) methanone dans la prevention et/ou le traitement de la steatohepatite non-alcoolique

Legal Events

Date Code Title Description
STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: UNKNOWN

STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: THE INTERNATIONAL PUBLICATION HAS BEEN MADE

PUAI Public reference made under article 153(3) epc to a published international application that has entered the european phase

Free format text: ORIGINAL CODE: 0009012

STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: REQUEST FOR EXAMINATION WAS MADE

17P Request for examination filed

Effective date: 20230206

AK Designated contracting states

Kind code of ref document: A1

Designated state(s): AL AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HR HU IE IS IT LI LT LU LV MC MK MT NL NO PL PT RO RS SE SI SK SM TR

DAV Request for validation of the european patent (deleted)
DAX Request for extension of the european patent (deleted)
STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: EXAMINATION IS IN PROGRESS

17Q First examination report despatched

Effective date: 20250912

STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: THE APPLICATION IS DEEMED TO BE WITHDRAWN