EP3386536A2 - Composition de conjugués d'agonistes-constructions d'anticorps et leurs procédés d'utilisation - Google Patents

Composition de conjugués d'agonistes-constructions d'anticorps et leurs procédés d'utilisation

Info

Publication number
EP3386536A2
EP3386536A2 EP16873755.9A EP16873755A EP3386536A2 EP 3386536 A2 EP3386536 A2 EP 3386536A2 EP 16873755 A EP16873755 A EP 16873755A EP 3386536 A2 EP3386536 A2 EP 3386536A2
Authority
EP
European Patent Office
Prior art keywords
compound
antibody
conjugate
salt
seq
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Withdrawn
Application number
EP16873755.9A
Other languages
German (de)
English (en)
Other versions
EP3386536A4 (fr
Inventor
Peter Armstrong Thompson
Badreddin EDRIS
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Opi Vi- Ip Holdco LLC
Original Assignee
Opi Vi- Ip Holdco LLC
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority claimed from US15/173,075 external-priority patent/US20170158772A1/en
Application filed by Opi Vi- Ip Holdco LLC filed Critical Opi Vi- Ip Holdco LLC
Publication of EP3386536A2 publication Critical patent/EP3386536A2/fr
Publication of EP3386536A4 publication Critical patent/EP3386536A4/fr
Withdrawn legal-status Critical Current

Links

Classifications

    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/32—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against translation products of oncogenes
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6801—Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
    • A61K47/6803—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6835—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
    • A61K47/6849—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a receptor, a cell surface antigen or a cell surface determinant
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6835—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
    • A61K47/6851—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a determinant of a tumour cell
    • A61K47/6855—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a determinant of a tumour cell the tumour determinant being from breast cancer cell
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2878—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the NGF-receptor/TNF-receptor superfamily, e.g. CD27, CD30, CD40, CD95
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen

Definitions

  • a conjugate comprises a) an immune-stimulatory compound; b) an antibody construct comprising an antigen binding domain and an Fc domain, wherein said antigen binding domain binds to a first antigen and wherein a K d for binding of said Fc domain to an Fc receptor in the presence of said immune-stimulatory compound is no greater than about 100 times a K d for binding of said Fc domain to said Fc receptor in the absence of the immune stimulatory compound; and c) a linker, wherein said linker attaches said antibody construct to said immune-stimulatory compound.
  • said antigen binding domain binds said first antigen in a presence of said immune-stimulatory compound.
  • a K d for binding of said antigen binding domain to said first antigen in a presence of said immune- stimulatory compound is less than about 100 nM and no greater than about 100 times a K d for binding of said antigen binding domain to said first antigen in the absence of said immune- stimulatory compound.
  • said K d for binding of said antigen binding domain to said first antigen in the presence of said immune-stimulatory compound is less than about 100nM and is no greater than about 10 times the K d of the binding of the antigen binding domain to said first antigen in the absence of the immune-stimulatory compound; and said K d for binding of said Fc domain to said Fc receptor in the presence of said immune-stimulatory compound is no greater than about 10 times said K d for the binding of said Fc domain to said Fc receptor in the absence of said immune stimulatory compound.
  • a molar ratio of immune- stimulatory compound to antibody construct is less than 9, less than 8, less than 7, less than 6, less than 5, less than 4, less than 3, or less than 2.
  • said conjugate further comprises a targeting binding domain, wherein said targeting domain is attached to said antibody construct.
  • said targeting binding domain binds a second antigen.
  • said targeting binding domain is attached to said antibody construct at a C-terminal end of said Fc domain.
  • said antigen binding domain is from an antibody or non-antibody scaffold.
  • said antigen binding domain is at least 80% homologous to an antigen binding domain from an antibody or non-antibody scaffold.
  • said non-antibody scaffold is a DARPin, affimer, avimer, knottin, monobody, or affinity clamp.
  • said antigen binding domain is at least 80% homologous to an antigen binding domain from a DARPin, affimer, avimer, knottin, monobody, or affinity clamp.
  • said antigen binding domain recognizes a single antigen. In some aspects, said antigen binding domain recognizes two or more antigens. In some aspects, said first antigen is a tumor antigen. In some aspects, said first antigen that is at least 80% homologous to CD5, CD19, CD20, CD25, CD37, CD30, CD33, CD45, CAMPATH-1, BCMA, CS-1, PD-L1, B7-H3, B7-DC, HLD-DR, carcinoembryonic antigen, TAG-72, EpCAM, MUC1, folate-binding protein, A33, G250, prostate-specific membrane antigen, ferritin, GD2, GD3, GM2, Le y , CA-125, CA19- 9, epidermal growth factor, p185HER2, IL-2 receptor, de2-7 EGFR, fibroblast activation protein, tenascin, metalloproteinases, endosialin, vascular endothelial growth factor,
  • said first antigen is expressed on an immune cell. In some aspects, said first antigen is expressed on an antigen-presenting cell. In some aspects, said first antigen is expressed on a dendritic cell, a macrophage, or a B-cell. In some aspects, wherein said first antigen is CD40. In some aspects, said antigen binding domain is a CD40 agonist.
  • said antibody construct is an antibody.
  • said antibody construct is a human antibody or a humanized antibody.
  • said antibody construct comprises a light chain sequence that is at least 80%, 90%, or 100% homologous to SEQ ID NO: 4, at least 80%, 90%, or 100% homologous to SEQ ID NO: 26, or at least 80%, 90%, or 100% homologous to SEQ ID NO: 34.
  • said antibody construct comprises a light chain variable domain sequence that is at least 80%, 90%, or 100% homologous to SEQ ID NO: 6.
  • said antibody construct comprises: a) a heavy chain sequence that is at least 80%, 90%, or 100% homologous to SEQ ID NO: 15; b) a heavy chain sequence that is at least 80%, 90%, or 100% homologous to SEQ ID NO: 16; c) a heavy chain sequence that is at least 80%, 90%, or 100% homologous to SEQ ID NO: 17; d) a heavy chain sequence that is at least 80%, 90%, or 100% homologous to SEQ ID NO: 18; e) a heavy chain sequence that is at least 80%, 90%, or 100% homologous to SEQ ID NO: 22; or f) heavy chain sequence that is at least 80%, 90%, or 100% homologous to SEQ ID NO: 30.
  • said antibody construct comprises a heavy chain variable domain that is at least 80%, 90%, or 100% homologous to SEQ ID NO: 20.
  • said antibody binding domain comprises at least 80%, 90%, or 100% homology to: a) HC CDR1 comprising an amino acid sequence of SEQ ID NO: 23, HC CDR2 comprising an amino acid sequence of SEQ ID NO: 24, a HC CDR3 comprising an amino acid sequence of SEQ ID NO: 25, LC CDR1 comprising an amino acid sequence of SEQ ID NO: 27, LC CDR1 comprising an amino acid sequence of SEQ ID NO: 28, and LC CDR3 comprising an amino acid sequence of SEQ ID NO: 29; or b) HC CDR1 comprising an amino acid sequence of SEQ ID NO: 31, HC CDR2 comprising an amino acid sequence of SEQ ID NO: 32, a HC CDR3 comprising an amino acid sequence of SEQ ID NO: 33, LC CDR1 comprising an amino acid sequence of SEQ ID NO: 35,
  • said Fc domain is from an antibody. In some aspects, said Fc domain is at least 80% homologous to an Fc domain from an antibody. In some aspects, said Fc domain binding to said Fc receptor in the presence of said immune-stimulatory compound results in Fc- receptor-mediated signaling. In some aspects, said Fc domain binding to said Fc receptor in the presence of said immune-stimulatory compound results increased antigen presentation on an immune cell. In some aspects, said Fc domain is a human Fc domain. In some aspects, said Fc domain is selected from a group consisting of a human IgG1 Fc domain, a human IgG2 Fc domain, a human IgG3 Fc domain, and a human IgG4 Fc domain.
  • said Fc domain is an Fc domain variant comprising at least one amino acid residue change as compared to a wild type sequence of said Fc domain. In some aspects, said Fc domain binds said Fc receptor with altered affinity as compared to a wild type Fc domain. In some aspects, wherein said Fc receptor is selected from a group consisting of CD16a, CD16b, CD32a, CD32b, and CD64. In some aspects, said Fc receptor is a CD16a F158 variant or a CD16a V158 variant. In some aspects, said Fc domain binds said Fc receptor with higher affinity than a wild type Fc domain.
  • said Fc receptor is selected from a group consisting of: CD16a, CD16b, CD32a, CD32b, or CD64. In some aspects, said Fc receptor is a CD16a F158 variant or a CD16a V158 variant.
  • said Fc domain has at least one amino acid residue change as compared to wildtype, wherein said at least one amino acid residue change is: a) F243L, R292P, Y300L, L235V, and P396L, wherein numbering of amino acid residues in said Fc domain is according to the EU index as in Kabat; b) S239D and I332E, wherein numbering of amino acid residues in said Fc domain is according to the EU index as in Kabat; or c) S298A, E333A, and K334A, wherein numbering of amino acid residues in said Fc domain is according to the EU index as in Kabat.
  • said immune-stimulatory compound is a damage-associated molecular pattern molecule or a pathogen associated molecular pattern molecule
  • said immune-stimulatory compound is a toll-like receptor agonist, STING agonist, or RIG-I agonist.
  • said immune-stimulatory compound is a TLR1 agonist, a TLR2 agonist, a TLR3 agonist, a TLR4 agonist, a TLR5 agonist, a TLR6 agonist, a TLR7 agonist, a TLR8 agonist, a TLR9 agonist, or a TLR10 agonist.
  • said immune-stimulatory compound is selected from a group consisting of: S-27609, CL307, UC-IV150, imiquimod, gardiquimod, resiquimod, motolimod, VTS-1463GS-9620, GSK2245035, TMX-101, TMX-201, TMX-202, isatoribine, AZD8848, MEDI9197, 3M-051, 3M-852, 3M-052, 3M-854A, S-34240, KU34B, and CL663.
  • said immune-stimulatory compound comprises one or more rings selected from carbocyclic and heterocyclic rings.
  • said linker is covalently attached to said antibody construct. In some aspects, said linker is covalently attached to said immune-stimulatory compound.
  • said linker is not attached to an amino acid residue of said Fc domain selected from a group consisting of: 221, 222, 224, 227, 228, 230, 231, 223, 233, 234, 235, 236, 237, 238, 239, 240, 241, 243, 244, 245, 246, 247, 249, 250, 258, 262, 263, 264, 265, 266, 267, 268, 269, 270, 271, 272, 273, 274, 275, 276, 278, 280, 281, 283, 285, 286, 288, 290, 291, 292, 293, 294, 295, 296, 297, 298, 299, 300, 302, 305, 313, 317, 318, 320, 322, 323, 324, 325, 326, 327, 328, 329, 330, 331, 332, 333, 334, 335336, 396, or 428, wherein numbering of amino acid residues in said Fc domain is according to the EU index as in Kabat.
  • said linker is attached to an amino acid residue of said antibody construct by a THIOMAB linker, or a Sortase A-catalyzed linker.
  • said linker is attached to said antibody construct via a sulfhydryl group, a primary amine, a hinge cysteine, a C L lysine, an engineered cysteine in a light chain, an engineered light chain glutamine, or an unnatural amino acid engineered into a light chain or heavy chain.
  • said linker does not interfere with said Fc domain binding to said Fc receptor when said linker is attached to said antibody construct at an amino acid residue.
  • said linker does not interfere with Fc- receptor-mediated signaling resulting from said Fc domain binding to said Fc receptor when said linker is attached to said Fc domain at an amino acid residue.
  • said linker is attached to said immune-stimulatory compound via an exocyclic nitrogen or carbon atom of said immune-stimulatory compound.
  • said immune-stimulatory compound is covalently attached to said linker by a bond to an exocyclic carbon or nitrogen atom on said immune-stimulatory compound.
  • said linker is a peptide.
  • said linker is a cleavable linker.
  • said linker selected from a group consisting of: a) a valine- citrulline linker; b) a valine-citrulline linker containing a pentafluorophenyl group; c) a valine- citrulline linker containing a succinimide group; d) a valine-citrulline linker containing a para aminobenzoic acid group; e) a valine-citrulline linker containing a para aminobenzoic acid group and a pentafluorophenyl group; and f) a valine-citrulline linker containing a para aminobenzoic acid group and a succinimide group.
  • said linker is a non-cleavable linker.
  • said linker selected from a group consisting of: a) a maleimidocaproyl linker; b) a combination of a
  • maleimidocaproyl group and one or more polyethylene glycol molecules c) a maleimide-PEG4 linker; d) a maleimidocaproyl linker containing a succinimide group; e) a maleimidocaproyl linker containing a pentafluorophenyl group; f) a combination of a maleimidocaproyl linker containing a succinimide group and one or more polyethylene glycol molecules; and g) a combination of a maleimidocaproyl linker containing a pentafluorophenyl group and one or more polyethylene glycol molecules.
  • said conjugate induces the secretion of cytokine by an antigen presenting cell.
  • said cytokine is IFN- ⁇ , IL-8, IL-12, IL-2, or a combination thereof.
  • said conjugate induces antigen presentation on an antigen presenting cell.
  • said conjugate is formulated to treat tumors.
  • conjugate is in a pharmaceutical formulation.
  • a pharmaceutical composition comprises said conjugate of any of the proceeding embodiments and a pharmaceutically acceptable carrier.
  • a method of producing the conjugate of any of the preceding embodiments comprises: a) selecting an antibody construct; b) selecting an immune-stimulatory compound; and c) attaching said antibody construct to said immune-stimulatory compound, wherein said immune-stimulatory compound is attached to said antibody construct via a linker and said antibody construct comprises an antigen binding domain and an Fc domain, wherein said antigen binding domain specifically binds an antigen in the presence of said immune- stimulatory compound and said Fc domain specifically binds an Fc receptor in the presence of said immune-stimulatory compound.
  • a method of producing the conjugate of any of the preceding embodiments comprises: a) selecting an antibody construct; b) selecting an immune-stimulatory compound; c) selecting a targeting binding domain; d) attaching said targeting binding domain to said antibody construct; and e) attaching said antibody construct to said immune-stimulatory compound, wherein said immune-stimulatory compound is attached to said antibody construct via a linker, wherein said antigen binding domain specifically binds a first antigen in the presence of said immune-stimulatory compound and said targeting binding specifically binds a second antigen in the presence of said immune-stimulatory compound.
  • a method for treating a subject in need thereof comprises administering a therapeutic dose of said conjugate of any one of the preceding embodiments or said pharmaceutical composition of any of the preceding embodiments.
  • said subject has cancer.
  • said composition is administered intravenously, cutaneously, subcutaneously, or injected at a site of affliction.
  • a kit comprises said conjugate of any of the preceding
  • a composition comprising a light chain sequence that is at least 80%, 90%, or 100% homologous to SEQ ID NO: 4 and heavy chain sequence that is at least 80%, 90%, or 100% [0024] A composition comprising:
  • a heavy chain sequence that is at least 80%, 90%, or 100% homologous to SEQ ID NO: 16, at least 80%, 90%, or 100% homologous to SEQ ID NO: 17, or at least 80%, 90%, or 100% homologous to SEQ ID NO: 18.
  • composition of claim 75 wherein said composition binds to an Fc receptor with greater affinity than an antibody comprising a heavy chain sequence of SEQ ID NO: 15 or SEQ ID NO: 22.
  • the present disclosure provides a compound represented by the structure of Formula (I):
  • X 1 is selected from–OR 2 and–SR 2 ;
  • X 2 is selected from–OR 3 and–SR 3 ;
  • B 1 and B 2 are independently selected from optionally substituted nitrogenous bases;
  • Y is selected from––OR 4 ,–NR 4 R 4 , and halogen;
  • the compound of Formula (I) is represented by Formula (IA):
  • B 1 and B 2 are independently selected from optionally substituted purines, such as optionally substituted adenine, optionally substituted guanine, optionally substituted xanthine, optionally substituted hypoxanthine, optionally substituted theobromine, optionally substituted caffeine, optionally substituted uric acid, and optionally substituted isoguanine.
  • B 1 and B 2 are independently selected from optionally substituted adenine and optionally substituted guanine.
  • B 1 is an optionally substituted guanine.
  • B 2 is an optionally substituted guanine.
  • X 1 is selected from–OH and–SH.
  • X 1 may be– OH.
  • X 2 is selected from–OH and–SH.
  • X 2 may be–OH.
  • Y is selected from–OH,–O-C 1-10 alkyl,–NH(C 1-10 alkyl), and– NH 2 .
  • Y may be–OH.
  • the compound of Formula (I) is represented by Formula (IC):
  • the compound of Formula (IC) is represented by Formula (ID): ,
  • the compound is a pharmaceutically acceptable salt.
  • the compound or salt may agonize a stimulator of interferon genes (STING).
  • the present disclosure provides an antibody drug conjugate, comprising a compound or salt previously described, an antibody, and a linker group, wherein the compound or salt is linked to the antibody through the linker group.
  • the linker group may be selected from a cleavable or non-cleavable linker.
  • the present disclosure provides a compound represented by the structure of Formula (II):
  • X 1 is selected from–OR 2 and–SR 2 ;
  • X 2 is selected from–OR 3 and–SR 3 ;
  • Y is selected from––OR 4 ,–SR 4 ,–NR 4 R 4 , and halogen;
  • Z is selected from––OR 5, –SR 5 , and–NR 5 R 5 ;
  • X 3 is a linker moiety, wherein at least one of R 1 , R 2 , R 3 , R 4 , R 5 , X 1 , X 2 , a B 1 substituent and a B 2 substituent is -X 3 .
  • the compound of Formula (II) is represented by a structure of Formula (IIA):
  • the compound of Formula (II) is represented by a structure of Formula (IIB):
  • B 1 and B 2 are independently selected from optionally substituted purines.
  • B 1 and B 2 may be each, independently selected from one another, adenine, guanine, and derivatives thereof.
  • B 1 and B 2 may be independently selected from optionally substituted adenine, optionally substituted guanine, optionally substituted xanthine, optionally substituted
  • B 1 and B 2 are independently selected from optionally substituted adenine and optionally substituted guanine.
  • B and wherein B 1 is optionally further substituted by one or more substituents.
  • B 2 may be represented by: , and wherein B 2 is optionally further substituted by one or more substituents.
  • X 1 is selected from -O- X 3 and-S-X 3 . In some embodiments, X 1 is selected from–OH and–SH.
  • X 2 is selected from -O- X 3 and-S-X 3 . In some embodiments, X 2 is selected from–OH and–SH.
  • Y is selected from -NR 4 X 3 , -S-X 3 , and -O- X 3 .
  • Y is selected from–OH, -SH,–O-C 1-10 alkyl,–NH(C 1-10 alkyl), and–NH 2.
  • Z is selected from -NR 4 X 3 , -S-X 3 , and -O- X 3 .
  • Z is selected from–OH, -SH,–O-C 1-10 alkyl,–NH(C 1-10 alkyl), and–NH 2.
  • RX comprises a reactive moiety, such a maleimide.
  • RX * is a reactive moiety that has reacted with a moiety on an antibody to form an antibody drug conjugate.
  • RX 3 is represented by the formula: , wherein RX is a reactive moiety, such as a maleimide.
  • RX * is a reactive moiety that has reacted with a moiety on an antibody to form an antibody drug conjugate.
  • the compound is represented by the formula: , or a pharmaceutically acce table salt thereof.
  • the com ound ma be re resented b the formula:
  • the com ound is re resented by the formula:
  • the compound may be represented by the formula:
  • the compound may be represented by the formula: , or a pharmaceutically acceptable salt thereof.
  • the compound is represented by the formula:
  • the compound may be represented by the formula:
  • the compound may be represented by the formula:
  • the com ound is re resented b the formula:
  • the compound may be represented by the formula: , or a pharmaceutically acceptable salt thereof.
  • the compound may be represented by the formula:
  • the compound is represented by the formula:
  • the compound may be represented by the formula:
  • the compound is represented by the formula:
  • the compound may be represented by the formula:
  • the compound may be represented by the formula:
  • the com ound is re resented b the formula:
  • the compound may be represented by the formula: , or a pharmaceutically actable salt thereof.
  • the compound may be represented by the formula:
  • the compound is represented by the formula:
  • the compound may be represented by the formula:
  • the compound may be represented by the formula: or a pharmaceutically acceptable salt thereof.
  • the compound is represented by the formula:
  • the compound may be represented by the formula:
  • the compound may be represented by the formula:
  • FIGURE 1A illustrates a DNA sequence (SEQ ID NO: 1) of a light chain of a human CD40 monoclonal antibody SBT-040. Furthermore, SEQ ID NO: 1 illustrates a DNA sequence containing a signal sequence (SEQ ID NO: 2) as shown in FIGURE 1B and a variable domain sequence (SEQ ID NO: 3) as shown in FIGURE 1C.
  • SEQ ID NO: 1 illustrates a DNA sequence containing a signal sequence (SEQ ID NO: 2) as shown in FIGURE 1B and a variable domain sequence (SEQ ID NO: 3) as shown in FIGURE 1C.
  • FIGURE 1B illustrates a DNA sequence of a signal sequence (SEQ ID NO: 2) of a light chain of a human CD40 monoclonal antibody SBT-040.
  • FIGURE 1C illustrates a DNA sequence of a variable domain (SEQ ID NO: 3) in a light chain of a human CD40 monoclonal antibody SBT-040.
  • FIGURE 2A illustrates an amino acid sequence (SEQ ID NO: 4) of a light chain of a human CD40 monoclonal antibody SBT-040. Furthermore, SEQ ID NO: 4 illustrates an amino acid sequence containing a signal sequence (SEQ ID NO: 5) as shown in FIGURE 2B and a variable domain sequence (SEQ ID NO: 6) as shown in FIGURE 2C.
  • SEQ ID NO: 4 illustrates an amino acid sequence containing a signal sequence (SEQ ID NO: 5) as shown in FIGURE 2B and a variable domain sequence (SEQ ID NO: 6) as shown in FIGURE 2C.
  • FIGURE 2B illustrates an amino acid sequence of a signal sequence (SEQ ID NO: 5) of a light chain of a human CD40 monoclonal antibody SBT-040.
  • FIGURE 2C illustrates an amino acid sequence of a variable domain (SEQ ID NO: 6) in a light chain of a human CD40 monoclonal antibody SBT-040.
  • FIGURE 3A illustrates a DNA sequence (SEQ ID NO: 7) of a wildtype IgG2 isotype heavy chain of a human CD40 monoclonal antibody SBT-040, wherein this heavy chain of the SBT-040 antibody can also be referred to as SBT-040-G2. Furthermore, SEQ ID NO: 7 illustrates a DNA sequence containing a signal sequence (SEQ ID NO: 12) as shown in FIGURE 3F and a variable domain sequence (SEQ ID NO: 13) as shown in FIGURE 3G.
  • SEQ ID NO: 7 illustrates a DNA sequence containing a signal sequence (SEQ ID NO: 12) as shown in FIGURE 3F and a variable domain sequence (SEQ ID NO: 13) as shown in FIGURE 3G.
  • FIGURE 3B illustrates a DNA sequence (SEQ ID NO: 8) of a wild type IgG1 isotype heavy chain of a human CD40 monoclonal antibody SBT-040, wherein this heavy chain of the SBT-040 antibody can also be referred to as SBT-040-G1WT.
  • SEQ ID NO: 8 illustrates a DNA sequence containing a signal sequence (SEQ ID NO: 12) as shown in FIGURE 3F and a variable domain sequence (SEQ ID NO: 13) as shown in FIGURE 3G.
  • FIGURE 3C illustrates a DNA sequence (SEQ ID NO: 9) of an IgG1 isotype heavy chain of a human CD40 monoclonal antibody SBT-040 containing DNA nucleotide
  • SBT-040-G1VLPLL modified DNA nucleotides corresponding to the L235V, F243L, R292P, Y300L, and P396L amino acid residue modifications are in bold.
  • SEQ ID NO: 9 illustrates a DNA sequence containing a signal sequence (SEQ ID NO: 12) as shown in FIGURE 3F and a variable domain sequence (SEQ ID NO: 13) as shown in FIGURE 3G.
  • FIGURE 3D illustrates a DNA sequence (SEQ ID NO: 10) of an IgG1 isotype heavy chain of a human CD40 monoclonal antibody SBT-040 containing DNA nucleotide
  • SEQ ID NO: 10 illustrates a DNA sequence containing a signal sequence (SEQ ID NO: 12) as shown in FIGURE 3F and a variable domain sequence (SEQ ID NO: 13) as shown in FIGURE 3G.
  • FIGURE 3E illustrates a DNA sequence (SEQ ID NO: 11) of an IgG1 isotype heavy chain of human CD40 monoclonal antibody SBT-040 containing DNA nucleotide modifications corresponding to S298A, E333A, and K334A amino acid residue modifications of a wild type IgG1 Fc domain, wherein this heavy chain of the SBT-040 antibody can also be referred to as SBT-040-G1AAA.
  • the modified DNA nucleotides corresponding to the S298A, E333A, and K334A amino acid residue modifications are in bold.
  • SEQ ID NO: 11 illustrates a DNA sequence containing a signal sequence (SEQ ID NO: 12) as shown in FIGURE 3F and a variable domain sequence (SEQ ID NO: 13) as shown in FIGURE 3G.
  • FIGURE 3F illustrates a DNA sequence of a signal sequence (SEQ ID NO: 12) of a heavy chain of a human CD40 monoclonal antibody SBT-040.
  • FIGURE 3G illustrates a DNA sequence of a variable domain (SEQ ID NO: 13) in a heavy chain of a human CD40 monoclonal antibody SBT-040.
  • FIGURE 4A illustrates an amino acid sequence (SEQ ID NO: 14) of a wildtype IgG2 isotype heavy chain of a human CD40 monoclonal antibody SBT-040, wherein this heavy chain of the SBT-040 antibody can also be referred to as SBT-040-G2.
  • SEQ ID NO: 14 illustrates an amino acid sequence containing a signal sequence (SEQ ID NO: 19) as shown in FIGURE 4F and a variable domain sequence (SEQ ID NO: 20) as shown in FIGURE 4G.
  • FIGURE 4B illustrates an amino acid sequence (SEQ ID NO: 15) of a wild type IgG1 isotype heavy chain of a human CD40 monoclonal antibody SBT-040, wherein this heavy chain of the SBT-040 antibody can also be referred to as SBT-040-G1WT.
  • SEQ ID NO: 15 illustrates an amino acid sequence containing a signal sequence (SEQ ID NO: 19) as shown in FIGURE 4F and a variable domain sequence (SEQ ID NO: 20) as shown in FIGURE 4G.
  • FIGURE 4C illustrates an amino acid sequence (SEQ ID NO: 16) of an IgG1 isotype heavy chain of a human CD40 monoclonal antibody SBT-040 containing L235V, F243L, R292P, Y300L, and P396L amino acid residue modifications of a wild type IgG1 Fc domain, wherein this heavy chain of the SBT-040 antibody can also be referred to as SBT-040-G1VLPLL.
  • the amino acid residues corresponding to the L235V, F243L, R292P, Y300L, and P396L amino acid residue modifications are in bold.
  • SEQ ID NO: 16 illustrates an amino acid sequence containing a signal sequence (SEQ ID NO: 19) as shown in FIGURE 4F and a variable domain sequence (SEQ ID NO: 15) as shown in FIGURE 4G.
  • FIGURE 4D illustrates an amino acid sequence (SEQ ID NO: 17) of an IgG1 isotype heavy chain of a human CD40 monoclonal antibody SBT-040 containing S239D and I332 amino acid residue modifications of a wild type IgG1 Fc domain, wherein this heavy chain of the SBT- 040 antibody can also be referred to as SBT-040-G1DE.
  • SBT-040-G1DE The amino acid residues corresponding to the S239D and I332E amino acid residue modifications are in bold.
  • SEQ ID NO: 17 illustrates an amino acid sequence containing a signal sequence (SEQ ID NO: 19) as shown in FIGURE 4F and a variable domain sequence (SEQ ID NO: 20) as shown in FIGURE 4G.
  • FIGURE 4E illustrates an amino acid sequence (SEQ ID NO: 18) of an IgG1 isotype heavy chain of a human CD40 monoclonal antibody SBT-040 containing S298A, E333A, and K334A amino acid residue modifications of a wild type IgG1 Fc domain, wherein this heavy chain of the SBT-040 antibody can also be referred to as SBT-040-G1AAA.
  • SBT-040-G1AAA The amino acid residues corresponding to the S298A, E333A, and K334A amino acid modifications are in bold.
  • SEQ ID NO: 11 illustrates an amino acid sequence containing a signal sequence (SEQ ID NO: 19) as shown in FIGURE 4F and a variable domain sequence (SEQ ID NO: 20) as shown in FIGURE 4G.
  • FIGURE 4F illustrates an amino acid sequence of a signal sequence (SEQ ID NO: 19) of a heavy chain of a human CD40 monoclonal antibody SBT-040.
  • FIGURE 4G illustrates an amino acid sequence of a variable domain (SEQ ID NO: 20) in a heavy chain of a human CD40 monoclonal antibody SBT-040.
  • FIGURES 5A, 5B, & 5C illustrate a CLUSTAL O(1.2.1) multiple DNA sequence alignment of the DNA sequences of SBT-040-G1VLPLL (SEQ ID NO: 9), SBT-040-G1AAA (SEQ ID NO: 11), SBT-040-G1WT (SEQ ID NO: 8), and SBT-040-G1DE (SEQ ID NO: 10).
  • the SBT-040-G1VLPLL sequence is a DNA sequence of an IgG1 isotype heavy chain of a human CD40 monoclonal antibody SBT-040 containing DNA nucleotide modifications corresponding to L235V, F243L, R292P, Y300L, and P396L amino acid residue modifications of a wild type IgG1 Fc domain.
  • the modified DNA nucleotides corresponding to the L235V, F243L, R292P, Y300L, and P396L amino acid residue modifications are in bold.
  • the SBT-040- G1AAA sequence is a DNA sequence of an IgG1 isotype heavy chain of a human CD40 monoclonal antibody SBT-040 containing DNA nucleotide modifications corresponding to S298A, E333A, and K334A amino acid residue modifications of a wild type IgG1 Fc domain.
  • the modified DNA nucleotides corresponding to the S298A, E333A, and K334A amino acid residue modifications are boxed.
  • the SBT-040-G1WT sequence is a DNA sequence of an IgG1 isotype heavy chain of a human CD40 monoclonal antibody SBT-040.
  • the SBT-040-G1AAA sequence is a DNA sequence of an IgG1 isotype heavy chain of a human CD40 monoclonal antibody SBT-040 containing DNA nucleotide modifications corresponding to S239D and I332E amino acid residue modifications of a wild type IgG1 Fc domain.
  • the modified DNA nucleotides corresponding to the S239D and I332E amino acid residue modifications are in bold italics.
  • FIGURE 5A shows the start of the sequence alignment.
  • FIGURE 5B shows the middle of the sequence alignment as a continuation of FIGURE 5A.
  • FIGURE 5C shows the end of the sequence alignment as continuation of FIGURE 5C.
  • FIGURE 6 illustrates a CLUSTAL O(1.2.1) multiple amino acid sequence alignment of the amino acid sequences of SBT-040-G1VLPLL (SEQ ID NO: 16), SBT-040-G1AAA (SEQ ID NO: 18), SBT-040-G1WT (SEQ ID NO: 15), and SBT-040-G1DE (SEQ ID NO: 17).
  • the SBT- 040-G1VLPLL sequence is an amino acid sequence of an IgG1 isotype heavy chain of a human CD40 monoclonal antibody SBT-040 containing L235V, F243L, R292P, Y300L, and P396L amino acid residue modifications of a wild type IgG1 Fc domain.
  • the L235V, F243L, R292P, Y300L, and P396L amino acid residue modifications are in bold.
  • the SBT-040-G1AAA sequence is an amino acid sequence of an IgG1 isotype heavy chain of a human CD40 monoclonal antibody SBT-040 containing S298A, E333A, and K334A amino acid residue modifications of a wild type IgG1 Fc domain.
  • the S298A, E333A, and K334A amino acid residue modifications are italics.
  • the SBT-040-G1WT sequence is an amino acid sequence of an IgG1 isotype heavy chain of a human CD40 monoclonal antibody SBT-040.
  • the SBT-040- G1AAA sequence is an amino acid sequence of an IgG1 isotype heavy chain of a human CD40 monoclonal antibody SBT-040 containing S239D and I332E amino acid residue modifications bold italics. Additionally, the hinge region of each amino acid sequence is differentiated from other regions of the amino acid sequence by brackets. The left bracket indicates the upper portion of the hinge region (UH). The four residues between the brackets are the middle portion of the hinge region. The right bracket indicates the lower portion of the hinge region (LH).
  • FIGURE 7 illustrates a schematic of an antibody.
  • An antibody contains two heavy chains as shown in gray and two light chains as shown in light gray. A portion of the heavy chains contain Fc domains (705 and 720). An antibody contains two antigen binding sites (710 and 715).
  • FIGURE 8 illustrates a schematic of an exemplary conjugate.
  • An antibody construct is an antibody, which contains two heavy chains as shown in gray and two light chains as shown in light gray.
  • the antibody comprises two antigen binding sites (810 and 815), and a portion of the heavy chains contain Fc domains (805 and 820).
  • the immune-stimulatory compounds (830 and 840) are conjugated to the antibody by linkers (860 and 870).
  • FIGURE 9 illustrates a schematic of an exemplary conjugate.
  • An antibody construct is an antibody, which contains two heavy chains as shown in gray and two light chains as shown in light gray.
  • the antibody comprises two antigen binding sites (910 and 915), and a portion of the heavy chains contain Fc domains (905 and 920).
  • the immune-stimulatory compounds (930 and 940) are conjugated to the antibody by linkers (960 and 970). Targeting binding domains are conjugated to the antibody (980 and 985).
  • FIGURE 10 illustrates a schematic of an exemplary conjugate.
  • An antibody construct contains the Fc region of an antibody with the heavy chains shown in gray, and two scaffolds as shown in light gray.
  • the antibody construct comprises two antigen binding sites (1010 and 1015) in the scaffolds, and a portion of the heavy chains contain Fc domains (1005 and 1020).
  • the immune-stimulatory compounds (1030 and 1040) are conjugated to the antibody construct by linkers (1060 and 1070).
  • FIGURE 11 illustrates a schematic of an exemplary conjugate.
  • An antibody construct contains the Fc region of an antibody with the heavy chains shown in gray, and two scaffolds as shown in light gray.
  • the antibody construct comprises two antigen binding sites (1110 and 1115) in the scaffolds, and a portion of the heavy chains contain Fc domains (1105 and 1120).
  • the immune-stimulatory compounds (1130 and 1140) are conjugated to the antibody construct by linkers (1160 and 1170).
  • Targeting binding domains are conjugated to the antibody construct (1180 and 1185).
  • FIGURE 12 illustrates a schematic of an exemplary conjugate.
  • An antibody construct contains the F(ab') 2 region of an antibody with heavy chains shown in gray and light chains shown in light gray, and two scaffolds as shown in dark gray.
  • the antibody construct comprises two antigen binding sites (1210 and 1215), and a portion of two scaffolds contain Fc domains (1220 and 1245).
  • the immune-stimulatory compounds (1230 and 1240) are conjugated to the antibody construct by linkers (1260 and 1270).
  • FIGURE 13 illustrates a schematic of an exemplary conjugate.
  • An antibody construct contains the F(ab') 2 region of an antibody with heavy chains shown in gray and light chains shown in light gray, and two scaffolds as shown in dark gray.
  • the antibody construct comprises two antigen binding sites (1310 and 1315), and a portion of two scaffolds contain Fc domains (1320 and 1345).
  • the immune-stimulatory compounds (1330 and 1340) are conjugated to the antibody construct by linkers (1360 and 1370).
  • Targeting binding domains are conjugated to the antibody construct (1380 and 1385).
  • FIGURE 14 illustrates a schematic of an exemplary conjugate.
  • An antibody construct contains two scaffolds as shown in light gray and two scaffolds as shown in dark gray.
  • the antibody construct comprises two antigen binding sites (1410 and 1415), and a portion of the two dark gray scaffolds contain Fc domains (1420 and 1445).
  • the immune-stimulatory compounds (1430 and 1440) are conjugated to the antibody construct by linkers (1460 and 1470).
  • FIGURE 15 illustrates a schematic of an exemplary conjugate.
  • An antibody construct contains two scaffolds as shown in light gray and two scaffolds as shown in dark gray.
  • the antibody construct comprises two antigen binding sites (1510 and 1515), and a portion of the two dark gray scaffolds contain Fc domains (1520 and 1545).
  • the immune-stimulatory compounds (1530 and 1540) are conjugated to the antibody construct by linkers (1560 and 1570). Targeting binding domains are conjugated to the antibody construct (1580 and 1585).
  • FIGURE 16 is the two-dimensional structure of the heavy chain of Dacetuzumab.
  • FIGURE 17 is the two-dimensional structure of the light chain of Dacetuzumab.
  • FIGURE 18 is the two-dimensional structure of the heavy chain of Bleselumab.
  • FIGURE 19 is the two-dimensional structure of the light chain of Bleselumab.
  • FIGURE 20 is the two-dimensional structure of the heavy chain of Lucatumumab.
  • FIGURE 21 is the two-dimensional structure of the light chain of Lucatumumab
  • FIGURE 22 is the two-dimensional structure of the heavy chain of ADC-1013.
  • FIGURE 23 is the two-dimensional structure of the light chain of ADC-1013.
  • FIGURE 24 is the two-dimensional structure of the heavy chain of humanized rabbit antibody APX005.
  • FIGURE 25 is the two-dimensional structure of the light chain of humanized rabbit antibody APX005.
  • FIGURE 26 is the two-dimensional structure of the heavy chain of Chi Lob 7/4.
  • FIGURE 27 is the two-dimensional structure of the light chain of Chi Lob 7/4.
  • FIGURE 28 shows HPLC analysis of SBT-040-G1WT conjugated to a Cys-targeted drug linker tool compound.
  • FIGURE 29 shows HPLC analysis of SBT-040-G1WT conjugated to ATAC2.
  • FIGURE 30 shows HPLC analysis of SBT-040-G2WT conjugated to ATAC2.
  • FIGURE 31A shows the concentration of IL-12p70 produced by dendritic cells (DCs) from donor 358 after incubation with SBT-040-WT-ATAC23 or SBT-040-WT-ATAC17 as compared with SBT-050-WT.
  • DCs dendritic cells
  • FIGURE 31B shows the concentration of IL-12p70 produced by DCs from donor 363 after incubation with SBT-040-WT-ATAC23 or SBT-040-WT-ATAC17 as compared with SBT- 050-WT.
  • FIGURE 31C shows the concentration of TNF ⁇ produced by DCs from donor 358 after incubation with SBT-040-WT-ATAC23 or SBT-040-WT-ATAC17 as compared with SBT-050- WT.
  • FIGURE 31D shows the concentration of TNF ⁇ produced by DCs from donor 363 after incubation with SBT-040-WT-ATAC23 or SBT-040-WT-ATAC17 as compared with SBT-050- WT.
  • FIGURE 32A shows the concentration of IL-12p70 produced by DCs after incubation with SBT-040-WT-ATAC4, SBT-040-WT-ATAC3, SBT-040-G2-ATAC4, SBT-040-G2- ATAC3, SBT-040-AAA-ATAC22, SBT-040-VLPLL-ATAC22, SBT-040-WT-ATAC1, SBT- 040-G2-ATAC1, SBT-040-WT-ATAC12, SBT-040-G2-ATAC12, SBT-040-WT-ATAC30, SBT-040-G1AAA-ATAC11, SBT-040-VLPLL-ATAC11, SBT-040-VLPLL-ATAC12, SBT- 040-AAA-ATAC12, SBT-040-VLPLL-ATAC23, and SBT-040-AAA-ATAC23 as compared with SBT-050-G2 or CD40 ligand.
  • FIGURE 32B shows the concentration of IL-6 produced by DCs from donor 2 after incubation with SBT-040-WT-ATAC4, SBT-040-WT-ATAC3, SBT-040-G2-ATAC4, SBT-040- G2-ATAC3, SBT-040-AAA-ATAC22, SBT-040-VLPLL-ATAC22, SBT-040-WT-ATAC1, SBT-040-G2-ATAC1, SBT-040-WT-ATAC12, SBT-040-G2-ATAC12, SBT-040-WT-ATAC30, SBT-040-AAA-ATAC11, SBT-040-VLPLL-ATAC11, SBT-040-VLPLL-ATAC12, SBT-040- AAA-ATAC12, SBT-040-VLPLL-ATAC23, and SBT-040-AAA-ATAC30 compared with SBT- 050-G2 or CD40 ligand. Results are shown for the immune stimulatory cytokines IL-12p70 and IL-6.
  • FIGURE 33A shows a dose dependent increase in CD86 expression on dendritic cells after treatment with SBT-040-WT-ATAC23, SBT-040-WT-ATAC17, SBT-040-VLPLL- ATAC22, SBT-040-AAA-ATAC23 as compared to treatment a control SBT-050-WT or staining with an isotype control.
  • FIGURE 33B shows a dose dependent increase in CD83 expression on dendritic cells after treatment with SBT-040-WT-ATAC23, SBT-040-WT-ATAC17, SBT-040- VLPLL- ATAC23, SBT-040-AAA-ATAC23 as compared to treatment a control SBT-050-WT or staining with an isotype control.
  • FIGURE 33C shows a dose dependent increase in MHC class II expression on dendritic cells after treatment with SBT-040-WT-ATAC23, SBT-040-WT-ATAC17, SBT-040-VLPLL- ATAC23, SBT-040-AAA-ATAC23 as compared to treatment a control SBT-050-WT or staining with an isotype control.
  • Cancer is one of the leading causes of death in the United States. Conventional methods of cancer treatment like chemotherapy, surgery or radiation therapy, can be limited in their efficacy since they are often nonspecific to the cancer. In many cases tumors, however, can specifically express genes whose products are required for inducing or maintaining the malignant state. These proteins may serve as antigen markers for the development and establishment of efficient anti-cancer treatments.
  • “homologous” or“homology” can refer to the similarity between a DNA, RNA, nucleotide, amino acid, or protein sequence to another DNA, RNA, nucleotide, amino acid, or protein sequence. Homology can be expressed in terms of a percentage of sequence identity of a first sequence to a second sequence. Percent (%) sequence identity with respect to a reference DNA sequence can be the percentage of DNA nucleotides in a candidate sequence that are identical with the DNA nucleotides in the reference DNA sequence after aligning the sequences.
  • Percent (%) sequence identity with respect to a reference amino acid sequence can be the percentage of amino acid residues in a candidate sequence that are identical with the amino acid residues in the reference amino acid sequence after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity, and not considering any conservative substitutions as part of the sequence identity.
  • antibody can refer to an immunoglobulin molecule that specifically binds to, or is immunologically reactive toward, a specific antigen.
  • Antibody can include, for example, polyclonal, monoclonal, genetically engineered, and antigen binding fragments thereof.
  • An antibody can be, for example, murine, chimeric, humanized,
  • the antigen binding fragment can include, for example, Fab ⁇ , F(ab ⁇ ) 2 , Fab, Fv, rIgG, and scFv.
  • “recognize” can refer to the association or binding between an antigen binding domain and an antigen.
  • a“tumor antigen” can be an antigenic substance associated with a tumor or cancer cell, and can trigger an immune response in a host.
  • an“antibody construct” can refer to a construct that contains an antigen binding domain and an Fc domain.
  • an“antigen binding domain” can refer to an antigen binding domain from an antibody or from a non-antibody that can bind to the antigen.
  • a“Fc domain” can be an Fc domain from an antibody or from a non- antibody that can bind to an Fc receptor.
  • a“target binding domain” can refer to a construct that contains an antigen binding domain from an antibody or from a non-antibody that can bind to the antigen.
  • salts or“pharmaceutically acceptable salt” refers to salts derived from a variety of organic and inorganic counter ions well known in the art.
  • Pharmaceutically acceptable acid addition salts can be formed with inorganic acids and organic acids.
  • Inorganic acids from which salts can be derived include, for example, hydrochloric acid, hydrobromic acid, sulfuric acid, nitric acid, phosphoric acid, and the like.
  • Organic acids from which salts can be derived include, for example, acetic acid, propionic acid, glycolic acid, pyruvic acid, oxalic acid, maleic acid, malonic acid, succinic acid, fumaric acid, tartaric acid, citric acid, benzoic acid, cinnamic acid, mandelic acid, methanesulfonic acid, ethanesulfonic acid, p-toluenesulfonic acid, salicylic acid, and the like.
  • Pharmaceutically acceptable base addition salts can be formed with inorganic and organic bases.
  • Inorganic bases from which salts can be derived include, for example, sodium, potassium, lithium, ammonium, calcium, magnesium, iron, zinc, copper, manganese, aluminum, and the like.
  • Organic bases from which salts can be derived include, for example, primary, secondary, and tertiary amines, substituted amines including naturally occurring substituted amines, cyclic amines, basic ion exchange resins, and the like, specifically such as
  • the pharmaceutically acceptable base addition salt is chosen from ammonium, potassium, sodium, calcium, and magnesium salts.
  • C x-y when used in conjunction with a chemical moiety, such as alkyl, alkenyl, or alkynyl is meant to include groups that contain from x to y carbons in the chain.
  • C x-y alkyl refers to substituted or unsubstituted saturated hydrocarbon groups, including straight-chain alkyl and branched-chain alkyl groups that contain from x to y carbons in the chain, including haloalkyl groups such as trifluoromethyl and 2,2,2-trifluoroethyl, etc.
  • C x-y alkenyl and“C x-y alkynyl” refer to substituted or unsubstituted unsaturated aliphatic groups analogous in length and possible substitution to the alkyls described above, but that contain at least one double or triple bond respectively.
  • Carbocycle refers to a saturated, unsaturated or aromatic ring in which each atom of the ring is carbon.
  • Carbocycle includes 3- to 10-membered monocyclic rings, 6- to 12-membered bicyclic rings, and 6- to 12-membered bridged rings.
  • Each ring of a bicyclic carbocycle may be selected from saturated, unsaturated, and aromatic rings.
  • an aromatic ring e.g., phenyl
  • Any combination of saturated, unsaturated and aromatic bicyclic rings, as valence permits, is included in the definition of carbocyclic.
  • Exemplary carbocycles include cyclopentyl, cyclohexyl, cyclohexenyl, adamantyl, phenyl, indanyl, and naphthyl.
  • heterocycle refers to a saturated, unsaturated or aromatic ring comprising one or more heteroatoms.
  • exemplary heteroatoms include N, O, Si, P, B, and S atoms.
  • Heterocycles include 3- to 10-membered monocyclic rings, 6- to 12-membered bicyclic rings, and 6- to 12-membered bridged rings.
  • Each ring of a bicyclic heterocycle may be selected from saturated, unsaturated, and aromatic rings wherein at least one of the rings includes a heteroatom.
  • an aromatic ring e.g., pyridyl
  • a saturated or unsaturated ring e.g., cyclohexane, cyclopentane, morpholine, piperidine or cyclohexene.
  • the term“heteroaryl” includes aromatic single ring structures, preferably 5- to 7- membered rings, more preferably 5- to 6-membered rings, whose ring structures include at least one heteroatom, preferably one to four heteroatoms, more preferably one or two heteroatoms.
  • heteroaryl also include polycyclic ring systems having two or more cyclic rings in which two or more carbons are common to two adjoining rings wherein at least one of the rings is heteroaromatic, e.g., the other cyclic rings can be aromatic or non-aromatic carbocyclic, or heterocyclic.
  • Heteroaryl groups include, for example, pyrrole, furan, thiophene, imidazole, oxazole, thiazole, pyrazole, pyridine, pyrazine, pyridazine, and pyrimidine, and the like.
  • substitution refers to moieties having substituents replacing a hydrogen on one or more carbons or substitutable heteroatoms, e.g., NH, of the structure. It will be understood that “substitution” or“substituted with” includes the implicit proviso that such substitution is in accordance with permitted valence of the substituted atom and the substituent, and that the substitution results in a stable compound, i.e., a compound which does not spontaneously undergo transformation such as by rearrangement, cyclization, elimination, etc.
  • substituted refers to moieties having substituents replacing two hydrogen atoms on the same carbon atom, such as substituting the two hydrogen atoms on a single carbon with an oxo, imino or thioxo group.
  • the term“substituted” is contemplated to include all permissible substituents of organic compounds.
  • the permissible substituents include acyclic and cyclic, branched and unbranched, carbocyclic and heterocyclic, aromatic and non-aromatic substituents of organic compounds.
  • the permissible substituents can be one or more and the same or different for appropriate organic compounds.
  • the heteroatoms such as nitrogen may have hydrogen substituents and/or any permissible substituents of organic compounds described herein which satisfy the valences of the heteroatoms.
  • Chemical entities having carbon-carbon double bonds or carbon-nitrogen double bonds may exist in Z- or E- form (or cis- or trans- form). Furthermore, some chemical entities may exist in various tautomeric forms. Unless otherwise specified, chemical entities described herein are intended to include all Z-, E- and tautomeric forms as well.
  • a "tautomer” refers to a molecule wherein a proton shift from one atom of a molecule to another atom of the same molecule is possible.
  • the compounds disclosed herein are used in different enriched isotopic forms, e.g., enriched in the content of 2 H, 3 H, 11 C, 13 C and/or 14 C.
  • the compound is deuterated in at least one position.
  • deuterated forms can be made by the procedure described in U.S. Patent Nos.5,846,514 and 6,334,997.
  • deuteration can improve the metabolic stability and or efficacy, thus increasing the duration of action of drugs.
  • structures depicted herein are intended to include compounds which differ only in the presence of one or more isotopically enriched atoms.
  • compounds having the present structures except for the replacement of a hydrogen by a deuterium or tritium, or the replacement of a carbon by 13 C- or 14 C-enriched carbon are within the scope of the present disclosure.
  • the compounds of the present disclosure optionally contain unnatural proportions of atomic isotopes at one or more atoms that constitute such compounds.
  • the compounds may be labeled with isotopes, such as for example, deuterium ( 2 H), tritium ( 3 H), iodine-125 ( 125 I) or carbon-14 ( 14 C).
  • isotopes such as for example, deuterium ( 2 H), tritium ( 3 H), iodine-125 ( 125 I) or carbon-14 ( 14 C).
  • Isotopic substitution with 2 H, 11 C, 13 C, 14 C, 15 C, 12 N, 13 N, 15 N, 16 N, 16 O, 17 O, 14 F, 15 F, 16 F, 17 F, 18 F, 33 S, 34 S, 35 S, 36 S, 35 Cl, 37 Cl, 79 Br, 81 Br, 125 I are all contemplated. All isotopic variations of the compounds of the present invention, whether radioactive or not, are encompassed within the scope of the present invention.
  • the compounds disclosed herein have some or all of the 1 H atoms replaced with 2 H atoms.
  • the methods of synthesis for deuterium-containing compounds are known in the art and include, by way of non-limiting example only, the following synthetic methods.
  • Deuterium substituted compounds are synthesized using various methods such as described in: Dean, Dennis C.; Editor. Recent Advances in the Synthesis and Applications of Radiolabeled Compounds for Drug Discovery and Development. [In: Curr., Pharm. Des., 2000; 6(10)] 2000, 110 pp; George W.; Varma, Rajender S. The Synthesis of Radiolabeled Compounds via
  • Deuterated starting materials are readily available and are subjected to the synthetic methods described herein to provide for the synthesis of deuterium-containing compounds. Large numbers of deuterium-containing reagents and building blocks are available commercially from chemical vendors, such as Aldrich Chemical Co.
  • Compounds of the present invention also include crystalline and amorphous forms of those compounds, pharmaceutically acceptable salts, and active metabolites of these compounds having the same type of activity, including, for example, polymorphs, pseudopolymorphs, solvates, hydrates, unsolvated polymorphs (including anhydrates), conformational polymorphs, and amorphous forms of the compounds, as well as mixtures thereof.
  • phrases“parenteral administration” and“administered parenterally” as used herein means modes of administration other than enteral and topical administration, usually by injection, and includes, without limitation, intravenous, intramuscular, intraarterial, intrathecal,
  • intracapsular intraorbital, intracardiac, intradermal, intraperitoneal, transtracheal, subcutaneous, subcuticular, intraarticular, subcapsular, subarachnoid, intraspinal and intrasternal injection and infusion.
  • phrases“pharmaceutically acceptable” is employed herein to refer to those compounds, materials, compositions, and/or dosage forms which are, within the scope of sound medical judgment, suitable for use in contact with the tissues of human beings and animals without excessive toxicity, irritation, allergic response, or other problem or complication, commensurate with a reasonable benefit/risk ratio.
  • phrases“pharmaceutically acceptable excipient” or“pharmaceutically acceptable carrier” as used herein means a pharmaceutically acceptable material, composition or vehicle, such as a liquid or solid filler, diluent, excipient, solvent or encapsulating material. Each carrier must be“acceptable” in the sense of being compatible with the other ingredients of the formulation and not injurious to the patient.
  • materials which can serve as pharmaceutically acceptable carriers include: (1) sugars, such as lactose, glucose and sucrose; (2) starches, such as corn starch and potato starch; (3) cellulose, and its derivatives, such as sodium carboxymethyl cellulose, ethyl cellulose and cellulose acetate; (4) powdered tragacanth; (5) malt; (6) gelatin; (7) talc; (8) excipients, such as cocoa butter and suppository waxes; (9) oils, such as peanut oil, cottonseed oil, safflower oil, sesame oil, olive oil, corn oil and soybean oil; (10) glycols, such as propylene glycol; (11) polyols, such as glycerin, sorbitol, mannitol and polyethylene glycol; (12) esters, such as ethyl oleate and ethyl laurate; (13) agar; (14) buffering agents, such as magnesium hydroxide and aluminum hydroxide;
  • ADC Antibody drug conjugate
  • An ADC can comprise any embodiment as described herein for an antibody construct immune-stimulatory compound conjugate. Therefore, ADC and antibody construct immune-stimulatory compound conjugate can be used interchangeably herein.
  • An antigen can elicit an immune response.
  • An antigen can be a protein, polysaccharide, lipid, or glycolipid, which can be recognized by an immune cell, such as a T cell or a B cell. Exposure of immune cells to one or more of these antigens can elicit a rapid cell division and differentiation response resulting in the formation of clones of the exposed T cells and B cells. B cells can differentiate into plasma cells which in turn can produce antibodies which selectively bind to the antigens.
  • tumor antigens there are four general groups of tumor antigens: (i) viral tumor antigens which can be identical for any viral tumor of this type, (ii) carcinogenic tumor antigens which can be specific for patients and for the tumors, (iii) isoantigens of the transplantation type or tumor-specific transplantation antigens which can be different in all individual types of tumor but can be the same in different tumors caused by the same virus; and (iv) embryonic antigens.
  • viral tumor antigens which can be identical for any viral tumor of this type
  • carcinogenic tumor antigens which can be specific for patients and for the tumors
  • isoantigens of the transplantation type or tumor-specific transplantation antigens which can be different in all individual types of tumor but can be the same in different tumors caused by the same virus
  • embryonic antigens embryonic antigens.
  • tumor antigens As a result of the discovery of tumor antigens, tumor antigens have become important in the development of new cancer treatments that can specifically target the cancer. This has led to the development of antibodies directed against these tumor antigens.
  • CD40 Cluster of Differentiation 40
  • TNF-R Tumor Necrosis Factor Receptor
  • CD40 can be a 50 kDa cell surface glycoprotein that can be constitutively expressed in normal cells, such as monocytes, macrophages, B lymphocytes, dendritic cells, endothelial cells, smooth muscle cells, fibroblasts and epithelium, and in tumor cells, including B-cell lymphomas and many types of solid tumors.
  • Expression of CD40 can be increased in antigen presenting cells in response to IL-1 ⁇ p, IFN- ⁇ , GM-CSF, and LPS induced signaling events.
  • Humoral and cellular immune responses can be regulated, in part, by CD40.
  • CD40 CD40 Ligand
  • antigen presentation can result in tolerance.
  • CD40 activation can ameliorate tolerance.
  • CD40 activation can positively impact immune responses by enhancing antigen presentation by antigen presenting cells (APC), increasing cytokine and chemokine secretion, stimulating expression of and signaling by co-stimulatory molecules, and activating the cytolytic activity of different types of immune cells. Accordingly, the interaction between CD40 and CD40L can be essential to maintain proper humoral and cellular immune responses.
  • APC antigen presenting cells
  • cytokine and chemokine secretion stimulating expression of and signaling by co-stimulatory molecules
  • activating the cytolytic activity of different types of immune cells Accordingly, the interaction between CD40 and CD40L can be essential to maintain proper humoral and cellular immune responses.
  • the intracellular effects of CD40 and CD40L interaction can include association of the CD40 cytoplasmic domain with TRAFs (TNF-R associated factors), which can lead to the activation of NF ⁇ B and Jun/AP1 pathways. While the response to activation of NF ⁇ B and Jun/AP1 pathways can be cell type-specific, often such activation can lead to increased production and secretion of cytokines, including IL-6, IL-8, IL-12, IL-15; increased production and secretion of chemokines, including MIP1 ⁇ and ⁇ and RANTES; and increased expression of cellular adhesion molecules, including ICAM. While the effects of cytokines, chemokines and cellular adhesion molecules can be widespread, such effects can include enhanced survival and activation of T cells.
  • TRAFs TRAFs
  • CD40 activation can also be involved in chemokine- and cytokine-mediated cellular migration and differentiation; activation of immune cells, including monocytes; activation of and increased cytolytic activity of immune cells, including cytolytic T lymphocytes and natural killer cells; induction of CD40-positive tumor cell apoptosis and enhanced immunogenicity of CD40-positive tumors.
  • CD40 can initiate and enhance immune responses by many different mechanisms, including, inducing antigen-presenting cell maturation and increased expression of costimulatory molecules, increasing production of and secretion of cytokines, and enhancing effector functions.
  • CD40 activation can be effective for inducing immune-mediated antitumor responses.
  • CD40 activation reverses host immune tolerance to tumor-specific antigens which leads to enhanced antitumor responses by T cells. Such antitumor activity can also occur in the absence of immune cells.
  • antitumor effects can occur in response to anti-CD40 antibody- mediated activation of CD40 and can be independent of antibody-dependent cellular cytotoxicity.
  • CD40L-stimulation can cause dendritic cell maturation and stimulation.
  • CD40L-stimulated dendritic cells can contribute to the antitumor response.
  • vaccination strategies including CD40 can result in regression of CD40-positive and CD40-negative tumors.
  • CD40 activating antibodies can be useful for treatment of tumors. This can occur through one or more mechanisms, including cell activation, antigen presentation, production of cytokines and chemokines, amongst others.
  • CD40 antibodies activate dendritic cells, leading to processing and presentation of tumor antigens as well as enhanced immunogenicity of CD40-positive tumor cells.
  • antitumor activity can include, recruitment and activation monocytes, enhanced cytolytic activity of cytotoxic lymphocytes and natural killer cells as well as induction of apoptosis or by stimulation of a humoral response so as to directly target tumor cells.
  • tumor cell debris including tumor-specific antigens, can be presented to other cells of the immune system by CD40-activated antigen presenting cells.
  • CD40 can be important in an immune response, there is a need for enhanced CD40 meditated signaling events to provide reliable and rapid treatment options to patients suffering from diseases which may be ameliorated by treatment with CD40-targeted therapeutic strategies.
  • the HER2/neu human epidermal growth factor receptor 2/receptor tyrosine-protein kinase erbB-2
  • HER2/neu human epidermal growth factor receptor 2/receptor tyrosine-protein kinase erbB-2
  • Overexpression of this protein has been shown to play an important role in the progression of cancer, for example, breast cancer.
  • the HER2/neu protein functions as a receptor tyrosine kinase and autophosphorylates upon dimerization with binding partners.
  • HER2/neu can activate several signaling pathways including, for example, mitogen-activated protein kinase, phosphoinositide 3-kinase,
  • HER2/neu phospholipase C ⁇ , protein kinase C, and signal transducer and activator of transcription (STAT).
  • STAT signal transducer and activator of transcription
  • Immune-stimulatory molecular motifs such as Pathogen-Associated Molecular Pattern molecules, (PAMPs) can be recognized by receptors of the innate immune system, such as Toll- like receptors (TLRs), Nod-like receptors, C-type lectins, and RIG-I-like receptors. These receptors can be transmembrane and intra-endosomal proteins which can prime activation of the immune system in response to infectious agents such as pathogens. Similar to other protein families, TLRs can have many isoforms, including TLR4, TLR7 and TLR8. Several agonists targeting activation of different TLRs can be used in various immunotherapies, including vaccine adjuvants and in cancer immunotherapies.
  • TLR agonists can range from simple molecules to complex macromolecules. Likewise, the sizes of TLR agonists can range from small to large. TLR agonists can be synthetic or biosynthetic agonists. TLR agonists can also be PAMPs.
  • IRF Interferon Regulatory Factor
  • STING stimulator of interferon genes
  • Imiquimod a synthetic TLR7 agonist
  • a cream and marketed under the brand name Aldara imiquimod serves as a topical treatment for a variety of indications with immune components, such as, actinic keratosis, genital warts, and basal cell carcinomas.
  • imiquimod is indicated as a candidate adjuvant for enhancing adaptive immune responses when applied topically at an immunization site.
  • DAMPs damage-associated molecular pattern molecules
  • DAMPs can initiate and maintain an immune response occurring as part of the non-infectious inflammatory response.
  • DAMPs can be specially localized proteins that, when detected by the immune system in a location other than where DAMPs should be located, activate the immune system.
  • DAMPs can be nuclear or cytosolic proteins and upon release from the nucleus or cytosol, DAMP proteins can become denatured through oxidation. Examples of DAMP proteins can include chromatin-associated protein high-mobility group box 1
  • DAMPs can also be nucleic acids, such as DNA, when released from tumor cells following apoptosis or necrosis.
  • additional DAMP nucleic acids can include RNA and purine metabolites, such as ATP, adenosine and uric acid, present outside of the nucleus or mitochondria.
  • DAMPs can focus on indications with an immune component, such as arthritis, cancer, ischemia-reperfusion injury, myocardial infarction and stroke.
  • the mechanism of action for DAMP therapeutic effects can include the prevention of DAMP release using therapeutic strategies, such as proapoptotic interventions, platinum and ethyl pyruvate, extracellular neutralization or blockade of DAMP release or signaling using therapeutic strategies such as anti-HMGB1, rasburiaspect and sRAGE, as well as direct or indirect blockade of DAMP receptors, and downstream signaling events, using therapeutic strategies such as RAGE small molecule antagonists; TLR4 antagonists and antibodies to DAMP-R.
  • therapeutic strategies such as proapoptotic interventions, platinum and ethyl pyruvate, extracellular neutralization or blockade of DAMP release or signaling using therapeutic strategies such as anti-HMGB1, rasburiaspect and sRAGE, as well as direct or indirect blockade of DAMP receptors, and downstream signaling events
  • the immune response elicited by TLR agonists can further be enhanced when co-administered with a CD40-agonist antibody.
  • a TLR agonist such as poly IC:LC
  • a CD40-agonist antibody can synergize to stimulate a greater CD8 + T cell response than either agonist alone.
  • a conjugate can be utilized as a safe and effective strategy to enhance immune responses.
  • a conjugate can comprise an antibody construct and an immune- stimulatory compound.
  • An antibody construct can comprise an antigen binding domain.
  • An antigen binding domain can be a domain that can specifically bind to an antigen.
  • An antigen binding domain can be an antigen-binding portion of an antibody or an antibody fragment.
  • An antigen binding domain can be one or more fragments of an antibody that can retain the ability to specifically bind to an antigen.
  • An antigen binding domain can be any antigen binding fragment.
  • An antigen binding domain can recognize a single antigen.
  • An antigen binding domain can recognize, for example, two, three, four, five, six, seven, eight, nine, ten, or more antigens.
  • An antibody construct can contain, for example, two, three, four, five, six, seven, eight, nine, ten, or more antigen binding domains.
  • An antibody construct can contain two antigen binding domains in which each antigen binding domain can recognize the same antigen.
  • An antibody construct can contain two antigen binding domains in which each antigen binding domain can recognize different antigens.
  • An antigen binding domain can be in a scaffold, in which a scaffold is a supporting framework for the antigen binding domain.
  • An antigen binding domain can be in a non-antibody scaffold.
  • An antigen binding domain can be in an antibody scaffold.
  • An antibody construct can comprise an antigen binding domain in a scaffold.
  • the antibody construct can comprise a Fc fusion protein product. In some embodiments, the antibody construct is a Fc fusion protein product.
  • the antigen binding domain of an antibody construct can be selected from any domain that binds the antigen including, but not limited to, from a monoclonal antibody, a polyclonal antibody, a recombinant antibody, or a functional fragment thereof, for example, a heavy chain variable domain (V H ) and a light chain variable domain (V L ), a DARPin, an affimer, an avimer, a knottin, a monobody, an affinity clamp, an ectodomain, a receptor ectodomain, a receptor, a cytokine, a ligand, an immunocytokine, a T cell receptor, or a recombinant T cell receptor.
  • V H heavy chain variable domain
  • V L light chain variable domain
  • the antigen binding domain of an antibody construct can be at least 80% homologous to an antigen binding domain selected from, but not limited to, a monoclonal antibody, a polyclonal antibody, a recombinant antibody, or a functional fragment thereof, for example, a heavy chain variable domain (V H ) and a light chain variable domain (V L ), a DARPin, an affimer, an avimer, a knottin, a monobody, an affinity clamp, an ectodomain, a receptor ectodomain, a receptor, a cytokine, a ligand, an immunocytokine, a T cell receptor, or a recombinant T cell receptor.
  • V H heavy chain variable domain
  • V L light chain variable domain
  • An antigen binding domain of an antibody construct for example an antigen binding domain from a monoclonal antibody, can comprise a light chain and a heavy chain.
  • the monoclonal antibody binds to CD40 and comprises the light chain of an anti-CD40 antibody and the heavy chain of an anti-CD40 antibody, which bind a CD40 antigen.
  • the monoclonal antibody binds to a tumor antigen and comprises the light chain of a tumor antigen antibody and the heavy chain of a tumor antigen antibody, which bind the tumor antigen.
  • An antibody construct can be an antibody.
  • An antibody can consist of two identical light protein chains and two identical heavy protein chains, all held together covalently by precisely located disulfide linkages. The N-terminal regions of the light and heavy chains together can form the antigen recognition site of an antibody. Structurally, various functions of an antibody can be confined to discrete protein domains (i.e., regions). The sites that can recognize and can bind antigen can consist of three complementarity determining regions (CDRs) that can lie within the variable heavy chain region and variable light chain region at the N-terminal end of the heavy chain and the light chain.
  • CDRs complementarity determining regions
  • the constant domains can provide the general framework of the antibody and may not be involved directly in binding the antibody to an antigen, but can be involved in various effector functions, such as participation of the antibody in antibody- dependent cellular cytotoxicity, and can bind Fc receptors.
  • the domains of natural light and heavy chains can have the same general structures, and each domain can comprise four framework regions, whose sequences can be somewhat conserved, connected by three hyper-variable regions or CDRs.
  • the four framework regions can largely adopt a ⁇ -sheet conformation and the CDRs can form loops connecting, and in some aspects forming part of, the ⁇ -sheet structure.
  • the CDRs in each chain can be held in close proximity by the framework regions and, with the CDRs from the other chain, can contribute to the formation of the antigen binding site.
  • An antibody of an antibody construct can include an antibody of any type, which can be assigned to different classes of immunoglobins, e.g., IgA, IgD, IgE, IgG, and IgM. Several different classes can be further divided into isotypes, e.g., IgG1, IgG2, IgG3, IgG4, IgA1, and IgA2. An antibody can further comprise a light chain and a heavy chain, often more than one chain.
  • the heavy-chain constant regions (Fc) that corresponds to the different classes of immunoglobulins can be ⁇ , ⁇ , ⁇ , ⁇ , and ⁇ , respectively.
  • the light chains can be one of either kappa or ⁇ and lambda or ⁇ , based on the amino acid sequences of the constant domains.
  • the Fc region can contain an Fc domain.
  • An Fc receptor can bind an Fc domain.
  • Antibody constructs can also include any fragment or recombinant forms thereof, including but not limited to, single chain variable fragments (scFvs),‘T-bodies’, anti-calins, centyrins, affibodies, domain antibodies, or peptibodies.
  • An antibody can comprise an antigen binding domain, which can refer to a portion of an antibody comprising the antigen recognition portion, i.e., an antigenic determining variable region of an antibody sufficient to confer recognition of the antigen and binding of the antigen recognition portion to a target, such as an antigen, i.e., the epitope.
  • antigen binding domains can include, but are not limited to, Fab, scFv, variable Fv fragment, and other antibody fragments, combinations of fragments or types of fragments known or knowable to one of ordinary skill in the art.
  • An antibody construct can comprise an antigen binding domain of an antibody.
  • An antigen binding domain of an antibody can comprise one or more light chain (LC) CDRs and one or more heavy chain (HC) CDRs.
  • an antibody binding domain of an antibody can comprise one or more of the following: a light chain complementary determining region 1 (LC CDR1), a light chain complementary determining region 2 (LC CDR2), or a light chain complementary determining region 3 (LC CDR3).
  • an antibody binding domain can comprise one or more of the following: a heavy chain complementary determining region 1 (HC CDR1), a heavy chain complementary determining region 2 (HC CDR2), or a heavy chain complementary determining region 3 (HC CDR3).
  • an antibody binding domain of an antibody can comprise one or more of the following: LC CDR1, LC CDR2, LC CDR3, HC CDR1, HC CDR2, and HC CDR3.
  • An antibody construct can comprise an antibody fragment.
  • An antibody fragment can include (i) a Fab fragment, a monovalent fragment consisting of the V L , V H, C L and C H1 domains; (ii) a F(ab') 2 fragment, a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region; and (iii) a Fv fragment consisting of the VL and VH domains of a single arm of an antibody.
  • the two domains of the Fv fragment, V L and V H can be coded for by separate genes, they can be linked by a synthetic linker to be made as a single protein chain in which the V L and V H regions pair to form monovalent molecules.
  • F(ab') 2 and Fab' moieties can be produced by treating immunoglobulin (e.g., monoclonal antibody) with a protease such as pepsin and papain, and can include an antibody fragment generated by digesting immunoglobulin near the disulfide bonds existing between the hinge regions in each of the two H chains.
  • the Fab fragment can also contain the constant domain of the light chain and the first constant domain (C H1 ) of the heavy chain.
  • Fab' fragments can differ from Fab fragments by the addition of a few residues at the carboxyl terminus of the heavy chain C H1 domain including one or more cysteine(s) from the antibody hinge region.
  • An Fv can be the minimum antibody fragment which contains a complete antigen- recognition and antigen-binding site. This region can consist of a dimer of one heavy chain and one light chain variable domain in tight, non-covalent association. In this configuration the three hypervariable regions of each variable domain can interact to define an antigen-binding site on the surface of the V H -V L dimer. A single variable domain (or half of an Fv comprising only three hypervariable regions specific for an antigen) can recognize and bind antigen, although the binding can be at a lower affinity than the affinity of the entire binding site.
  • an antibody used herein can be“humanized.”
  • Humanized forms of non-human (e.g., murine) antibodies can be chimeric immunoglobulins, immunoglobulin chains or fragments thereof (such as Fv, Fab, Fab', F(ab') 2 or other target-binding subdomains of antibodies), which can contain minimal sequences derived from non-human immunoglobulin.
  • the humanized antibody can comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the CDR regions correspond to those of a non-human immunoglobulin and all or substantially all of the FR regions are those of a human
  • the humanized antibody can also comprise at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin consensus sequence.
  • Fc immunoglobulin constant region
  • an antibody described herein can be a human antibody.
  • “human antibodies” can include antibodies having, for example, the amino acid sequence of a human immunoglobulin and can include antibodies isolated from human immunoglobulin libraries or from animals transgenic for one or more human immunoglobulins that do not express endogenous immunoglobulins. Human antibodies can be produced using transgenic mice which are incapable of expressing functional endogenous immunoglobulins, but which can express human immunoglobulin genes. Completely human antibodies that recognize a selected epitope can be generated using guided selection. In this approach, a selected non-human monoclonal antibody, e.g., a mouse antibody, can be used to guide the selection of a completely human antibody recognizing the same epitope.
  • An antibody described herein can be a bispecific antibody or a dual variable domain antibody (DVD).
  • Bispecific and DVD antibodies can be monoclonal, often human or humanized, antibodies that can have binding specificities for at least two different antigens.
  • An antibody described herein can be a derivatized antibody.
  • derivatized antibodies can be modified by glycosylation, acetylation, pegylation, phosphorylation, amidation, derivatization by known protecting/blocking groups, proteolytic cleavage, linkage to a cellular ligand or other protein.
  • an antibody described herein can have a sequence that has been modified to alter at least one constant region-mediated biological effector function relative to the corresponding wild type sequence.
  • the antibody can be modified to reduce at least one constant region-mediated biological effector function relative to an unmodified antibody, e.g., reduced binding to the Fc receptor (FcR).
  • FcR binding can be reduced by, for example, mutating the immunoglobulin constant region segment of the antibody at particular regions necessary for FcR interactions.
  • An antibody described herein can be modified to acquire or improve at least one constant region-mediated biological effector function relative to an unmodified antibody, e.g., to enhance Fc ⁇ R interactions.
  • an antibody with a constant region that binds Fc ⁇ RIIA, Fc ⁇ RIIB and/or Fc ⁇ RIIIA with greater affinity than the corresponding wild type constant region can be produced according to the methods described herein.
  • An antibody described herein can bind to tumor cells, such as an antibody against a cell surface receptor or a tumor antigen.
  • An antibody described herein can bind to CD40, such as an antibody that can be a CD40 agonist and bind to CD40.
  • X can indicate any amino acid.
  • X can be asparagine (N), glutamine (Q
  • An antibody construct can comprise an anti-CD40 antibody.
  • An antibody construct can comprise an antibody light chain.
  • a light chain can be a light chain of an anti-CD40 antibody which can bind a CD40 antigen.
  • a light chain of an anti-CD40 antibody can be expressed from a DNA sequence comprising
  • a light chain of an anti-CD40 antibody can be expressed from DNA sequence comprising greater than 70%, greater than 75%, greater than 80%, greater than 85%, greater than 90%, greater than 95%, or greater than 99% homology to SEQ ID NO: 1.
  • a variable region of a light chain of an anti-CD40 antibody can be expressed from a DNA sequence comprising
  • a variable region of a light chain of an anti-CD40 antibody can be expressed from a DNA sequence comprising greater than 70%, greater than 75%, greater than 80%, greater than 85%, greater than 90%, greater than 95% or greater than 99% homology to SEQ ID NO: 3.
  • anti-CD40 antibodies expressed from SEQ ID NO: 1, or expressed from a DNA sequence comprising greater than 70% homology to SEQ ID NO: 1 can have a dissociation constant (K d ) for CD40 that is less than 10nM.
  • Anti-CD40 antibodies expressed from SEQ ID NO: 1, or expressed from a DNA sequence comprising greater than 70% homology to SEQ ID NO: 1 can have a dissociation constant (K d ) for CD40 that is less than 1 nM, less than 100 pM, less than 10 pM, less than 1 pM, or less than 0.1 pM.
  • the anti-CD40 light chain can be expressed with any anti-CD40 heavy chain or fragment thereof.
  • the anti-CD40 light chain can also expressed with any anti-CD40 heavy chain or fragment thereof to form an anti-CD40 antibody or fragment thereof.
  • the anti-CD40 antibody or fragment thereof can be purified, and can be combined with a pharmaceutically acceptable carrier.
  • the anti-CD40 antibody can be an antibody construct.
  • a light chain of an anti-CD40 antibody can comprise an amino acid sequence
  • a light chain of an anti-CD40 antibody can comprise an amino sequence with greater than 70%, greater than 75%, greater than 80%, greater than 85%, greater than 90%, greater than 95% or greater than 99% homology to SEQ ID NO: 4.
  • a variable region of a light chain of an anti-CD40 antibody can comprise an amino acid sequence
  • a variable region of a light chain of an anti-CD40 antibody can comprise an amino acid sequence with greater than 70%, greater than 75%, greater than 80%, greater than 85%, greater than 90%, greater than 95% or greater than 99% homology to SEQ ID NO: 6.
  • anti-CD40 antibodies comprising SEQ ID NO: 4, or comprising an amino acid sequence with greater than 70% homology to SEQ ID NO: 4 can have a dissociation constant (K d ) for CD40 that is less than 10nM.
  • Anti-CD40 antibodies comprising SEQ ID NO: 4, or comprising an amino acid sequence with greater than 70% homology to SEQ ID NO: 4 can have a dissociation constant (Kd) for CD40 that is less than 1 nM, less than 100 pM, less than 10 pM, less than 1 pM, or less than 0.1 pM.
  • the anti-CD40 light chain can be purified, and can be combined with a pharmaceutically acceptable carrier.
  • the anti-CD40 light chain can be combined with any anti-CD40 heavy chain or fragment thereof.
  • the anti-CD40 light chain can also be combined with any anti-CD40 heavy chain or fragment thereof to form an anti-CD40 antibody or fragment thereof.
  • the anti-CD40 antibody or fragment thereof can be purified, and can be combined with a pharmaceutically acceptable carrier.
  • the anti-CD40 antibody can be an antibody construct. Additionally, one skilled in the art would recognize that these same concepts could apply to anti-CD40 antibodies created for use in the veterinary sciences and/or in laboratory animals.
  • An antibody construct can comprise an antibody light chain.
  • a light chain can be a light chain of an anti-CD40 antibody which can bind a CD40 antigen.
  • a light chain of an anti-CD40 antibody can be SBT-040 VL-Ck.
  • SBT-040 VL-Ck can comprise an amino acid sequence DIQMTQSPSSVSASVGDRVTITCRASQGIYSWLAWYQQKPGKAPNLLIYTASTLQSGVPS RFSGSGSGTDFTLTISSLQPEDFATYYCQANIFPLTFGGGTKVEIKRTVAAPSVFIFPPSD EQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTL SKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC (SEQ ID NO: 26).
  • SBT-040 VL-Ck can comprise an amino acid sequence with greater than 70%, greater than 75%, greater than 80%, greater than 85%, greater than 90%
  • a light chain of an anti-CD40 antibody can comprise a CDR.
  • a light chain of an anti- CD40 antibody can comprise a CDR with an amino acid sequence QGIYSW (SEQ ID NO: 27).
  • a light chain of an anti-CD40 antibody can comprise a CDR with an amino acid sequence TAS (SEQ ID NO: 28).
  • a light chain of an anti-CD40 antibody can comprise a CDR with an amino acid sequence QQANIFPLT (SEQ ID NO: 29).
  • a light chain CDR of an anti-CD40 antibody can comprise an amino acid sequence with greater than 70%, greater than 75%, greater than 80%, greater than 85%, greater than 90%, greater than 95% or greater than 99% homology to SEQ ID NO: 27.
  • a light chain CDR of an anti-CD40 antibody can comprise an amino acid sequence with greater than 70%, greater than 75%, greater than 80%, greater than 85%, greater than 90%, greater than 95% or greater than 99% homology to SEQ ID NO: 28.
  • a light chain CDR of an anti-CD40 antibody can comprise an amino acid sequence with greater than 70%, greater than 75%, greater than 80%, greater than 85%, greater than 90%, greater than 95% or greater than 99% homology to SEQ ID NO: 29.
  • An antibody construct can comprise an antibody heavy chain.
  • a heavy chain can be a heavy chain of an anti-CD40 antibody which can bind a CD40 antigen.
  • a heavy chain of an anti- CD40 antibody can be an IgG1 isotype.
  • a heavy chain of an anti-CD40 antibody can be
  • Dacetuzumab can comprise an amino acid sequence
  • Dacetuzumab can comprise an amino acid sequence with greater than 70%, greater than 75%, greater than 80%, greater than 85%, greater than 90%, greater than 95% or greater than 99% homology to SEQ ID NO: 38.
  • a heavy chain of an anti-CD40 antibody can comprise a CDR.
  • a heavy chain of an anti- CD40 antibody can comprise a CDR with an amino acid sequence GYSFTGYY (SEQ ID NO: 39).
  • a heavy chain of an anti-CD40 antibody can comprise a CDR with an amino acid sequence VIPNAGGT (SEQ ID NO: 40).
  • a heavy chain of an anti-CD40 antibody can comprise a CDR with an amino acid sequence AREGIYW (SEQ ID NO: 41).
  • a heavy chain CDR of an anti- CD40 antibody can comprise an amino acid sequence with greater than 70%, greater than 75%, greater than 80%, greater than 85%, greater than 90%, greater than 95% or greater than 99% homology to SEQ ID NO: 39.
  • a heavy chain CDR of an anti-CD40 antibody can comprise an amino acid sequence with greater than 70%, greater than 75%, greater than 80%, greater than 85%, greater than 90%, greater than 95% or greater than 99% homology to SEQ ID NO: 40.
  • a heavy chain CDR of an anti-CD40 antibody can comprise an amino acid sequence with greater than 70%, greater than 75%, greater than 80%, greater than 85%, greater than 90%, greater than 95% or greater than 99% homology to SEQ ID NO: 41.
  • the two-dimensional structure of the dacetuzumab heavy chain is shown in FIGURE 16.
  • An antibody construct can comprise an antibody light chain.
  • a light chain can be a light chain of an anti-CD40 antibody which can bind a CD40 antigen.
  • a light chain of an anti-CD40 antibody can be dacetuzumab.
  • Dacetuzumab can comprise an amino acid sequence
  • Dacetuzumab can comprise an amino acid sequence with greater than 70%, greater than 75%, greater than 80%, greater than 85%, greater than 90%, greater than 95% or greater than 99% homology to SEQ ID NO: 42.
  • a light chain of an anti-CD40 antibody can comprise a CDR.
  • a light chain of an anti- CD40 antibody can comprise a CDR with an amino acid sequence QSLVHSNGNTF (SEQ ID NO: 43).
  • a light chain of an anti-CD40 antibody can comprise a CDR with an amino acid sequence TVS (SEQ ID NO: 44).
  • a light chain of an anti-CD40 antibody can comprise a CDR with an amino acid sequence SQTTHVPWT (SEQ ID NO: 45).
  • a light chain CDR of an anti- CD40 antibody can comprise an amino acid sequence with greater than 70%, greater than 75%, greater than 80%, greater than 85%, greater than 90%, greater than 95% or greater than 99% homology to SEQ ID NO: 43.
  • a light chain CDR of an anti-CD40 antibody can comprise an amino acid sequence with greater than 70%, greater than 75%, greater than 80%, greater than 85%, greater than 90%, greater than 95% or greater than 99% homology to SEQ ID NO: 44.
  • a light chain CDR of an anti-CD40 antibody can comprise an amino acid sequence with greater than 70%, greater than 75%, greater than 80%, greater than 85%, greater than 90%, greater than 95% or greater than 99% homology to SEQ ID NO: 45.
  • the two-dimensional structure of the Dacetuzumab light chain is shown in FIGURE 17.
  • An antibody construct can comprise an antibody heavy chain.
  • a heavy chain can be a heavy chain of an anti-CD40 antibody which can bind a CD40 antigen.
  • a heavy chain of an anti- CD40 antibody can be an IgG4 isotype.
  • a heavy chain of an anti-CD40 antibody can be
  • Bleselumab can comprise an amino acid sequence
  • Bleselumab can comprise an amino acid sequence with greater than 70%, greater than 75%, greater than 80%, greater than 85%, greater than 90%, greater than 95% or greater than 99% homology to SEQ ID NO: 46.
  • a heavy chain of an anti-CD40 antibody can comprise a CDR.
  • a heavy chain of an anti-CD40 antibody can comprise a CDR with an amino acid sequence GGSISSPGYY (SEQ ID NO: 47).
  • a heavy chain of an anti-CD40 antibody can comprise a CDR with an amino acid sequence IYKSGST (SEQ ID NO: 48).
  • a heavy chain of an anti-CD40 antibody can comprise a CDR with an amino acid sequence TRPVVRYFGWFDP (SEQ ID NO: 49).
  • a heavy chain CDR of an anti- CD40 antibody can comprise an amino acid sequence with greater than 70%, greater than 75%, greater than 80%, greater than 85%, greater than 90%, greater than 95% or greater than 99% homology to SEQ ID NO: 47.
  • a heavy chain CDR of an anti-CD40 antibody can comprise an amino acid sequence with greater than 70%, greater than 75%, greater than 80%, greater than 85%, greater than 90%, greater than 95% or greater than 99% homology to SEQ ID NO: 48.
  • a heavy chain CDR of an anti-CD40 antibody can comprise an amino acid sequence with greater than 70%, greater than 75%, greater than 80%, greater than 85%, greater than 90%, greater than 95% or greater than 99% homology to SEQ ID NO: 49.
  • the two-dimensional structure of the bleselumab heavy chain is shown in FIGURE 18.
  • An antibody construct can comprise an antibody light chain.
  • a light chain can be a light chain of an anti-CD40 antibody which can bind a CD40 antigen.
  • a light chain of an anti-CD40 antibody can be Bleselumab. Bleselumab can comprise an amino acid sequence
  • Bleselumab can comprise an amino acid sequence with greater than 70%, greater than 75%, greater than 80%, greater than 85%, greater than 90%, greater than 95% or greater than 99% homology to SEQ ID NO: 50.
  • a light chain of an anti-CD40 antibody can comprise a CDR.
  • a light chain of an anti-CD40 antibody can comprise a CDR with an amino acid sequence QGISSA (SEQ ID NO: 51).
  • a light chain of an anti-CD40 antibody can comprise a CDR with an amino acid sequence DAS (SEQ ID NO: 52).
  • a light chain of an anti-CD40 antibody can comprise a CDR with an amino acid sequence QQFNSYPT (SEQ ID NO: 53).
  • a light chain CDR of an anti-CD40 antibody can comprise an amino acid sequence with greater than 70%, greater than 75%, greater than 80%, greater than 85%, greater than 90%, greater than 95% or greater than 99% homology to SEQ ID NO: 51.
  • a light chain CDR of an anti-CD40 antibody can comprise an amino acid sequence with greater than 70%, greater than 75%, greater than 80%, greater than 85%, greater than 90%, greater than 95% or greater than 99% homology to SEQ ID NO: 52.
  • a light chain CDR of an anti-CD40 antibody can comprise an amino acid sequence with greater than 70%, greater than 75%, greater than 80%, greater than 85%, greater than 90%, greater than 95% or greater than 99% homology to SEQ ID NO: 53.
  • the two-dimensional structure of the bleselumab light chain is shown in FIGURE 19.
  • An antibody construct can comprise an antibody heavy chain.
  • a heavy chain can be a heavy chain of an anti-CD40 antibody which can bind a CD40 antigen.
  • a heavy chain of an anti- CD40 antibody can be an IgG1 isotype.
  • Lucatumumab can comprise an amino acid sequence QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAVISYEESNR YHADSVKGRFTISRDNSKITLYLQMNSLRTEDTAVYYCARDGGIAAPGPDYWGQGTLV TVSSASTKGPSVFPLAPASKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAV LQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPE LLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPR EEQYNSTYRVV
  • Lucatumumab can comprise an amino acid sequence with greater than 70%, greater than 75%, greater than 80%, greater than 85%, greater than 90%, greater than 95% or greater than 99% homology to SEQ ID NO: 54.
  • a heavy chain of an anti-CD40 antibody can comprise a CDR.
  • a heavy chain of an anti- CD40 antibody can comprise a CDR with an amino acid sequence GFTFSSYG (SEQ ID NO: 55).
  • a heavy chain of an anti-CD40 antibody can comprise a CDR with an amino acid sequence ISYEESNR (SEQ ID NO: 56).
  • a heavy chain of an anti-CD40 antibody can comprise a CDR with an amino acid sequence ARDGGIAAPGPDY (SEQ ID NO: 57).
  • a heavy chain CDR of an anti-CD40 antibody can comprise an amino acid sequence with greater than 70%, greater than 75%, greater than 80%, greater than 85%, greater than 90%, greater than 95% or greater than 99% homology to SEQ ID NO: 55.
  • a heavy chain CDR of an anti-CD40 antibody can comprise an amino acid sequence with greater than 70%, greater than 75%, greater than 80%, greater than 85%, greater than 90%, greater than 95% or greater than 99% homology to SEQ ID NO: 56.
  • a heavy chain CDR of an anti-CD40 antibody can comprise an amino acid sequence with greater than 70%, greater than 75%, greater than 80%, greater than 85%, greater than 90%, greater than 95% or greater than 99% homology to SEQ ID NO: 57.
  • the two-dimensional structure of the lucatumumab heavy chain is shown in FIGURE 20.
  • An antibody construct can comprise an antibody light chain.
  • a light chain can be a light chain of an anti-CD40 antibody which can bind a CD40 antigen.
  • a light chain of an anti-CD40 antibody can be Lucatumumab. Lucatumumab can comprise an amino acid sequence
  • Lucatumumab can comprise an amino acid sequence with greater than 70%, greater than 75%, greater than 80%, greater than 85%, greater than 90%, greater than 95% or greater than 99% homology to SEQ ID NO: 59.
  • a light chain of an anti-CD40 antibody can comprise a CDR with an amino acid sequence LGS (SEQ ID NO: 60).
  • a light chain of an anti-CD40 antibody can comprise a CDR with an amino acid sequence MQARQTPFT (SEQ ID NO: 61).
  • a light chain CDR of an anti-CD40 antibody can comprise an amino acid sequence with greater than 70%, greater than 75%, greater than 80%, greater than 85%, greater than 90%, greater than 95% or greater than 99% homology to SEQ ID NO: 59.
  • a light chain CDR of an anti-CD40 antibody can comprise an amino acid sequence with greater than 70%, greater than 75%, greater than 80%, greater than 85%, greater than 90%, greater than 95% or greater than 99% homology to SEQ ID NO: 60.
  • a light chain CDR of an anti-CD40 antibody can comprise an amino acid sequence with greater than 70%, greater than 75%, greater than 80%, greater than 85%, greater than 90%, greater than 95% or greater than 99% homology to SEQ ID NO: 61.
  • the two-dimensional structure of the lucatumumab light chain is shown in FIGURE 21.
  • An antibody construct can comprise an antibody heavy chain.
  • a heavy chain can be a heavy chain of an anti-CD40 antibody which can bind a CD40 antigen.
  • a heavy chain of an anti- CD40 antibody can be an IgG1 isotype.
  • a heavy chain of an anti-CD40 antibody can be ADC- 1013.
  • ADC-1013 can comprise an amino acid sequence
  • ADC-1013 can comprise an amino acid sequence with greater than 70%, greater than 75%, greater than 80%, greater than 85%, greater than 90%, greater than 95% or greater than 99% homology to SEQ ID NO: 62.
  • a heavy chain of an anti-CD40 antibody can comprise a CDR.
  • a heavy chain of an anti- CD40 antibody can comprise a CDR with an amino acid sequence GFTFSTYG (SEQ ID NO: 63).
  • a heavy chain of an anti-CD40 antibody can comprise a CDR with an amino acid sequence ISGGSSYI (SEQ ID NO: 64).
  • a heavy chain of an anti-CD40 antibody can comprise a CDR with an amino acid sequence ARILRGGSGMDL (SEQ ID NO: 65).
  • a heavy chain CDR of an anti-CD40 antibody can comprise an amino acid sequence with greater than 70%, greater than 75%, greater than 80%, greater than 85%, greater than 90%, greater than 95% or greater than 99% homology to SEQ ID NO: 63.
  • a heavy chain CDR of an anti-CD40 antibody can comprise an amino acid sequence with greater than 70%, greater than 75%, greater than 80%, greater than 85%, greater than 90%, greater than 95% or greater than 99% homology to SEQ ID NO: 64.
  • a heavy chain CDR of an anti-CD40 antibody can comprise an amino acid sequence with greater than 70%, greater than 75%, greater than 80%, greater than 85%, greater than 90%, greater than 95% or greater than 99% homology to SEQ ID NO: 65.
  • the two-dimensional structure of the ADC-1013 heavy chain is shown in FIGURE 22.
  • An antibody construct can comprise an antibody light chain.
  • a light chain can be a light chain of an anti-CD40 antibody which can bind a CD40 antigen.
  • a light chain of an anti-CD40 antibody can be ADC-1013.
  • ADC-1013 can comprise an amino acid sequence
  • ADC-1013 can comprise an amino acid sequence with greater than 70%, greater than 75%, greater than 80%, greater than 85%, greater than 90%, greater than 95% or greater than 99% homology to SEQ ID NO: 66.
  • a light chain of an anti-CD40 antibody can comprise a CDR.
  • a light chain of an anti- CD40 antibody can comprise a CDR with an amino acid sequence SSNIGAGYN (SEQ ID NO: 67).
  • a light chain of an anti-CD40 antibody can comprise a CDR with an amino acid sequence GNI (SEQ ID NO: 68).
  • a light chain of an anti-CD40 antibody can comprise a CDR with an amino acid sequence AAWDKSISGLV (SEQ ID NO: 69).
  • a light chain CDR of an anti-CD40 antibody can comprise an amino acid sequence with greater than 70%, greater than 75%, greater than 80%, greater than 85%, greater than 90%, greater than 95% or greater than 99% homology to SEQ ID NO: 67.
  • a light chain CDR of an anti-CD40 antibody can comprise an amino acid sequence with greater than 70%, greater than 75%, greater than 80%, greater than 85%, greater than 90%, greater than 95% or greater than 99% homology to SEQ ID NO: 68.
  • a light chain CDR of an anti-CD40 antibody can comprise an amino acid sequence with greater than 70%, greater than 75%, greater than 80%, greater than 85%, greater than 90%, greater than 95% or greater than 99% homology to SEQ ID NO: 69.
  • the two-dimensional structure of the ADC-1013 light chain is shown in FIGURE 23.
  • An antibody construct can comprise an antibody heavy chain.
  • a heavy chain can be a heavy chain of an anti-CD40 antibody which can bind a CD40 antigen.
  • a heavy chain of an anti- CD40 antibody can be the humanized rabbit antibody APX005.
  • APX005 can comprise an amino acid sequence
  • APX005 can comprise an amino acid sequence with greater than 70%, greater than 75%, greater than 80%, greater than 85%, greater than 90%, greater than 95% or greater than 99% homology to SEQ ID NO: 70.
  • a heavy chain of an anti-CD40 antibody can comprise a CDR.
  • a heavy chain of an anti- CD40 antibody can comprise a CDR with an amino acid sequence GFSFSSTY (SEQ ID NO: 71).
  • a heavy chain of an anti-CD40 antibody can comprise a CDR with an amino acid sequence IYTGDGTN (SEQ ID NO: 72).
  • a heavy chain of an anti-CD40 antibody can comprise a CDR with an amino acid sequence ARPDITYGFAINFW (SEQ ID NO: 73).
  • a heavy chain CDR of an anti-CD40 antibody can comprise an amino acid sequence with greater than 70%, greater than 75%, greater than 80%, greater than 85%, greater than 90%, greater than 95% or greater than 99% homology to SEQ ID NO: 71.
  • a heavy chain CDR of an anti-CD40 antibody can comprise an amino acid sequence with greater than 70%, greater than 75%, greater than 80%, greater than 85%, greater than 90%, greater than 95% or greater than 99% homology to SEQ ID NO: 72.
  • a heavy chain CDR of an anti-CD40 antibody can comprise an amino acid sequence with greater than 70%, greater than 75%, greater than 80%, greater than 85%, greater than 90%, greater than 95% or greater than 99% homology to SEQ ID NO: 73.
  • the two-dimensional structure of the APX005 heavy chain is shown in FIGURE 24.
  • An antibody construct can comprise an antibody light chain.
  • a light chain can be a light chain of an anti-CD40 antibody which can bind a CD40 antigen.
  • a light chain of an anti-CD40 antibody can be the humanized rabbit antibody APX005.
  • APX005 can comprise an amino acid sequence
  • APX005 can comprise an amino acid sequence with greater than 70%, greater than 75%, greater than 80%, greater than 85%, greater than 90%, greater than 95% or greater than 99% homology to SEQ ID NO: 74.
  • a light chain of an anti-CD40 antibody can comprise a CDR.
  • a light chain of an anti-CD40 antibody can comprise a CDR with an amino acid sequence QSISSR (SEQ ID NO: 75).
  • a light chain of an anti-CD40 antibody can comprise a CDR with an amino acid sequence RAS (SEQ ID NO: 76).
  • a light chain of an anti-CD40 antibody can comprise a CDR with an amino acid sequence QCTGYGISWP (SEQ ID NO: 77).
  • a light chain CDR of an anti-CD40 antibody can comprise an amino acid sequence with greater than 70%, greater than 75%, greater than 80%, greater than 85%, greater than 90%, greater than 95% or greater than 99% homology to SEQ ID NO: 75.
  • a light chain CDR of an anti-CD40 antibody can comprise an amino acid sequence with greater than 70%, greater than 75%, greater than 80%, greater than 85%, greater than 90%, greater than 95% or greater than 99% homology to SEQ ID NO: 76.
  • a light chain CDR of an anti-CD40 antibody can comprise an amino acid sequence with greater than 70%, greater than 75%, greater than 80%, greater than 85%, greater than 90%, greater than 95% or greater than 99% homology to SEQ ID NO: 77.
  • the two-dimensional structure of the APX005 light chain is shown in FIGURE 25.
  • An antibody construct can comprise an antibody heavy chain.
  • a heavy chain can be a heavy chain of an anti-CD40 antibody which can bind a CD40 antigen.
  • a heavy chain of an anti- CD40 antibody can be Chi Lob 7/4.
  • Chi Lob 7/4 can comprise an amino acid sequence
  • Chi Lob 7/4 can comprise an amino acid sequence with greater than 70%, greater than 75%, greater than 80%, greater than 85%, greater than 90%, greater than 95% or greater than 99% homology to SEQ ID NO: 78.
  • a heavy chain of an anti-CD40 antibody can comprise a CDR.
  • a heavy chain of an anti- CD40 antibody can comprise a CDR with an amino acid sequence GYTFTEYI (SEQ ID NO: 79).
  • a heavy chain of an anti-CD40 antibody can comprise a CDR with an amino acid sequence IIPNNGGT (SEQ ID NO: 80).
  • a heavy chain of an anti-CD40 antibody can comprise a CDR with an amino acid sequence TRREVYGRNYYALDY (SEQ ID NO: 81).
  • a heavy chain CDR of an anti-CD40 antibody can comprise an amino acid sequence with greater than 70%, greater than 75%, greater than 80%, greater than 85%, greater than 90%, greater than 95% or greater than 99% homology to SEQ ID NO: 79.
  • a heavy chain CDR of an anti-CD40 antibody can comprise an amino acid sequence with greater than 70%, greater than 75%, greater than 80%, greater than 85%, greater than 90%, greater than 95% or greater than 99% homology to SEQ ID NO: 80.
  • a heavy chain CDR of an anti-CD40 antibody can comprise an amino acid sequence with greater than 70%, greater than 75%, greater than 80%, greater than 85%, greater than 90%, greater than 95% or greater than 99% homology to SEQ ID NO: 81.
  • the two-dimensional structure of the Chi Lob 7/4 heavy chain is shown in FIGURE 26.
  • An antibody construct can comprise an antibody light chain.
  • a light chain can be a light chain of an anti-CD40 antibody which can bind a CD40 antigen.
  • a light chain of an anti-CD40 antibody can be Chi Lob 7/4.
  • Chi Lob 7/4 can comprise an amino acid sequence
  • Chi Lob 7/4 can comprise an amino acid sequence with greater than 70%, greater than 75%, greater than 80%, greater than 85%, greater than 90%, greater than 95% or greater than 99% homology to SEQ ID NO: 82.
  • a light chain of an anti-CD40 antibody can comprise a CDR.
  • a light chain of an anti- CD40 antibody can comprise a CDR with an amino acid sequence QGINNY (SEQ ID NO: 83).
  • a light chain of an anti-CD40 antibody can comprise a CDR with an amino acid sequence YTS (SEQ ID NO: 84).
  • a light chain of an anti-CD40 antibody can comprise a CDR with an amino acid sequence QQYSNLPYT (SEQ ID NO: 85).
  • a light chain CDR of an anti-CD40 antibody can comprise an amino acid sequence with greater than 70%, greater than 75%, greater than 80%, greater than 85%, greater than 90%, greater than 95% or greater than 99% homology to SEQ ID NO: 83.
  • a light chain CDR of an anti-CD40 antibody can comprise an amino acid sequence with greater than 70%, greater than 75%, greater than 80%, greater than 85%, greater than 90%, greater than 95% or greater than 99% homology to SEQ ID NO: 84.
  • a light chain CDR of an anti-CD40 antibody can comprise an amino acid sequence with greater than 70%, greater than 75%, greater than 80%, greater than 85%, greater than 90%, greater than 95% or greater than 99% homology to SEQ ID NO: 85.
  • the two-dimensional structure of the Chi Lob 7/4 light chain is shown in FIGURE 27.
  • An antibody construct can comprise an antibody heavy chain.
  • a heavy chain can be a heavy chain of an anti-CD40 antibody which can bind a CD40 antigen.
  • a heavy chain of an anti- CD40 antibody can be an IgG1 isotype.
  • a heavy chain of an anti-CD40 antibody can be SBT- 040-G1WT. SBT-040-G1WT can be expressed from a DNA sequence comprising
  • SBT-040-G1WT can be expressed from a DNA sequence comprising greater than 70%, greater than 75%, greater than 80%, greater than 85%, greater than 90%, greater than 95% or greater than 99% homology to SEQ ID NO: 8.
  • a variable region of SBT-040-G1WT can be expressed from a DNA sequence comprising
  • a variable region of SBT-040-G1WT can be expressed from a DNA sequence comprising greater than 70%, greater than 75%, greater than 80%, greater than 85%, greater than 90%, greater than 95% or greater than 99% homology to SEQ ID NO: 13.
  • anti-CD40 antibodies comprising SBT-040-G1WT expressed from SEQ ID NO: 8, or expressed from a DNA sequence comprising greater than 70% homology to SEQ ID NO: 8 can have a dissociation constant (K d ) for CD40 that is less than 10 nM.
  • Anti-CD40 antibodies comprising SBT-040-G1WT expressed from DNA sequence comprising SEQ ID NO: 8, or comprising greater than 70% homology to SEQ ID NO: 8 can have a dissociation constant (K d ) for CD40 that is less than 1 nM, less than 100 pM, less than 10 pM, less than 1 pM, or less than 0.1 pM.
  • K d dissociation constant
  • SBT-040-G1WT can be expressed with any anti-CD40 light chain or fragment thereof.
  • SBT-040-G1WT can also be expressed with any anti-CD40 light chain or fragment thereof to form an anti-CD40 antibody or fragment thereof.
  • the anti-CD40 antibody or fragment thereof can be purified, and can be combined with a pharmaceutically acceptable carrier.
  • the anti-CD40 antibody can be an antibody construct.
  • SBT-040-G1WT can comprise an amino acid sequence
  • SBT-040-G1WT can comprise an amino acid sequence with greater than 70%, greater than 75%, greater than 80%, greater than 85%, greater than 90%, greater than 95% or greater than 99% homology to SEQ ID NO: 15.
  • SBT-040-G1WT can comprise an amino acid sequence
  • a variable region of SBT-040-G1WT can comprise an amino acid sequence with greater than 70%, greater than 75%, greater than 80%, greater than 85%, greater than 90%, greater than 95% or greater than 99% homology to SEQ ID NO: 20.
  • anti-CD40 antibodies comprising SBT-040-G1WT with SEQ ID NO: 15 or with an amino acid sequence with greater than 70% homology to SEQ ID NO: 15 can have a dissociation constant (Kd) for CD40 that is less than 10 nM.
  • Anti-CD40 antibodies comprising SBT-040- G1WT with SEQ ID NO: 15 or with an amino acid sequence with greater than 70% homology to SEQ ID NO: 15 can have a dissociation constant (K d ) for CD40 that is less than 1 nM, less than 100 pM, less than 10 pM, less than 1 pM, or less than 0.1 pM.
  • SBT-040-G1WT can be purified.
  • SBT-040-G1WT can be combined with any anti-CD40 light chain or fragment thereof to form an anti-CD40 antibody or fragment thereof.
  • the anti-CD40 antibody or fragment thereof can be purified, and can be combined with a pharmaceutically acceptable carrier.
  • the anti-CD40 antibody can be an antibody construct. Additionally, one skilled in the art would recognize that these same concepts could apply to antibody constructs comprising anti-CD40 antibodies created for use in the veterinary sciences and/or in laboratory animals.
  • An antibody construct can comprise an antibody heavy chain.
  • a heavy chain can be a heavy chain of an anti-CD40 antibody which can bind a CD40 antigen.
  • a heavy chain of an anti- CD40 antibody can be an IgG1 isotype.
  • a heavy chain of an anti-CD40 antibody can be SBT- 040 VH-hIgG1 wt.
  • SBT-040 VH-hIgG1 wt can comprise an amino acid sequence with greater than 70%, greater than 75%, greater than 80%, greater than 85%, greater than 90%, greater than 95% or greater than 99% homology to an amino acid sequence
  • a heavy chain of an anti-CD40 antibody can comprise a CDR.
  • a heavy chain of an anti-CD40 antibody can comprise a CDR with an amino acid sequence GYTFTYY (SEQ ID NO: 23).
  • a heavy chain of an anti-CD40 antibody can comprise a CDR with an amino acid sequence INPDSGGT (SEQ ID NO: 24).
  • a heavy chain of an anti-CD40 antibody can comprise a CDR with an amino acid sequence ARDQPLGYCTNGVCSYFDY (SEQ ID NO: 25).
  • a heavy chain CDR of an anti- CD40 antibody can comprise an amino acid sequence with greater than 70%, greater than 75%, greater than 80%, greater than 85%, greater than 90%, greater than 95% or greater than 99% homology to SEQ ID NO: 23.
  • a heavy chain CDR of an anti-CD40 antibody can comprise an amino acid sequence with greater than 70%, greater than 75%, greater than 80%, greater than 85%, greater than 90%, greater than 95% or greater than 99% homology to SEQ ID NO: 24.
  • a heavy chain CDR of an anti-CD40 antibody can comprise an amino acid sequence with greater than 70%, greater than 75%, greater than 80%, greater than 85%, greater than 90%, greater than 95% or greater than 99% homology to SEQ ID NO: 25.
  • a heavy chain of an anti-CD40 antibody can be an IgG2 isotype.
  • a heavy chain of an anti-CD40 antibody can be SBT-040-G2. SBT-040-G2 be expressed from a DNA sequence comprising
  • SBT-040-G2 can be expressed from a DNA sequence comprising greater than 70%, greater than 75%, greater than 80%, greater than 85%, greater than 90%, greater than 95% or greater than 99% homology to SEQ ID NO: 7.
  • a variable region of SBT-040-G2 can be expressed from a DNA sequence comprising SEQ ID NO: 13.
  • a variable region of SBT-040-G2 can be expressed from a DNA sequence comprising greater than 70%, greater than 75%, greater than 80%, greater than 85%, greater than 90%, greater than 95% or greater than 99% homology to SEQ ID NO: 13.
  • anti-CD40 antibodies comprising SBT-040-G2 expressed from SEQ ID NO: 7, or expressed from a DNA sequence comprising greater than 70% homology to SEQ ID NO: 7 can have a dissociation constant (K d ) for CD40 that is less than 10 nM.
  • Anti- CD40 antibodies comprising SBT-040-G2 expressed from DNA sequence comprising SEQ ID NO: 7, or comprising greater than 70% homology to SEQ ID NO: 7 can have a dissociation constant (Kd) for CD40 that is less than 1 nM, less than 100 pM, less than 10 pM, less than 1 pM, or less than 0.1 pM.
  • SBT-040-G2 can be expressed with any anti-CD40 light chain or fragment thereof.
  • SBT-040-G2 can also be expressed with any anti-CD40 light chain or fragment thereof to form an anti-CD40 antibody or fragment thereof.
  • the anti-CD40 antibody or fragment thereof can be purified, and can be combined with a pharmaceutically acceptable carrier.
  • the anti-CD40 antibody can be an antibody construct. Additionally, one skilled in the art would recognize that these same concepts could apply to antibody constructs comprising anti-CD40 antibodies created for use in the veterinary sciences and/or in laboratory animals.
  • SBT-040-G2 can comprise an amino acid sequence
  • SBT-040-G2 can comprise an amino acid sequence with greater than 70%, greater than 75%, greater than 80%, greater than 85%, greater than 90%, greater than 95% or greater than 99% homology to SEQ ID NO: 14.
  • SBT-040-G1WT can comprise an amino acid sequence SEQ ID NO: 20.
  • a variable region of SBT-040-G2 can comprise an amino acid sequence with greater than 70%, greater than 75%, greater than 80%, greater than 85%, greater than 90%, greater than 95% or greater than 99% homology to SEQ ID NO: 20.
  • anti-CD40 antibodies comprising SBT-040-G2 with SEQ ID NO: 14 or with an amino acid sequence with greater than 70% homology to SEQ ID NO: 14 can have a dissociation constant (K d ) for CD40 that is less than 10 nM.
  • Anti-CD40 antibodies comprising SBT-040-G2 with SEQ ID NO: 14 or with an amino acid sequence with greater than 70% homology to SEQ ID NO: 14 can have a dissociation constant (K d ) for CD40 that is less than 1 nM, less than 100 pM, less than 10 pM, less than 1 pM, or less than 0.1 pM.
  • SBT-040-G2 can be purified.
  • SBT-040-G2 can be combined with any anti-CD40 light chain or fragment thereof to form an anti-CD40 antibody or fragment thereof.
  • the anti-CD40 antibody or fragment thereof can be purified, and can be combined with a pharmaceutically acceptable carrier.
  • the anti-CD40 antibody can be an antibody construct. Additionally, one skilled in the art would recognize that these same concepts could apply to antibody constructs comprising anti-CD40 antibodies created for use in the veterinary sciences and/or in laboratory animals.
  • An antibody construct can comprise an antibody with modifications occurring at least at one amino acid residue. Modifications can be substitutions, additions, mutations, deletions, or the like. An antibody modification can be an insertion of an unnatural amino acid.
  • An antibody construct can comprise a light chain of an amino acid sequence having at least one, two, three, four, five, six, seven, eight, nine or ten modifications but not more than 40, 35, 30, 25, 20, 15 or 10 modifications of the amino acid sequence relative to the natural or original amino acid sequence.
  • An antibody construct can comprise a heavy chain of an amino acid sequence having at least one, two, three, four, five, six, seven, eight, nine or ten
  • a heavy chain can be the heavy chain of an anti-CD40 antibody which can bind to the CD40 antigen.
  • An antibody construct can be an IgG1 isotype.
  • An antibody construct can be an IgG2 isotype.
  • An antibody construct can be an IgG3 isotype.
  • An antibody construct can be an IgG4 isotype.
  • An antibody construct can be of a hybrid isotype comprising constant regions from two or more isotypes.
  • An antibody construct can be an anti-CD40 antibody, in which the anti-CD40 antibody can be a monoclonal human antibody comprising a wild-type sequence of an IgG1 isoform, in particular, at an Fc region of the antibody.
  • Additional anti-CD40 antibody sequences that can be used in the antibody construct can comprise any sequence as shown below in TABLE 1 or combination thereof:
  • Additional anti-CD40 antibody sequences that can be used in the antibody construct can comprise a sequence with greater than 70%, greater than 75%, greater than 80%, greater than 85%, greater than 90%, greater than 95% or greater than 99% homology to any sequence in TABLE 1.
  • Antibody constructs disclosed herein can be non-natural, designed, and/or engineered. Antibody constructs disclosed herein can be non-natural, designed, and/or engineered scaffolds comprising an antigen binding domain. Antibody constructs disclosed herein can be non-natural, designed, and/or engineered antibodies. Antibody constructs can be monoclonal antibodies. Antibody constructs can be human antibodies. Antibody constructs can be humanized antibodies. Antibody constructs can be monoclonal humanized antibodies. Antibody constructs can be recombinant antibodies.
  • an antigen binding domain of an antibody construct can be selected in order to recognize an antigen.
  • an antigen can be a cell surface marker on a target cell associated with a disease or condition.
  • An antigen can be expressed on an immune cell.
  • An antigen can be a peptide or fragment thereof.
  • An antigen can be expressed on an antigen-presenting cell.
  • An antigen can be expressed on a dendritic cell, a macrophage, or a B cell.
  • An antigen can be a peptide presented in a major histocompatibility complex by cell.
  • a cell surface marker recognized by the antigen binding domain can include macromolecules associated with viral and bacterial diseases or infections, autoimmune diseases and cancerous diseases.
  • An antigen can be CD40 and an antigen binding domain can recognize a CD40 antigen.
  • An antigen can be a tumor antigen or fragment thereof.
  • a tumor antigen can be any antigen listed on tumor antigen databases, such as TANTIGEN, or peptide databases for T cell-defined tumor antigens, such as the Cancer Immunity Peptide database.
  • a tumor antigen can also be any antigen listed in the review by Chen (Chen, Cancer Immun 2004 [updated 2004 Mar 10; cited 2004 Apr 1]). Note that the‘antibody’ can recognize the‘tumor antigen’ or a peptide derived thereof, bound to an MHC molecule.
  • An antigen can have at least 80% homology to or can be CD5, CD19, CD20, CD25, CD37, CD30, CD33, CD45, CAMPATH-1, BCMA, CS-1, PD-L1, B7-H3, B7-DC, BCMA, CS-1, PD-L1, B7-H3, B7-DC, HLD-DR, carcinoembryonic antigen, TAG-72, EpCAM, MUC1, folate-binding protein, A33, G250, prostate-specific membrane antigen, ferritin, GD2, GD3, GM2, Le y , CA-125, CA19-9, epidermal growth factor, p185HER2, IL-2 receptor, de2-7 EGFR, fibroblast activation protein, tenascin, metalloproteinases, endosialin, vascular endothelial growth factor, avB3, WT1, LMP2, HPV E6 E7, EGFRvIII, Her-2/neu, idiotype, MAGE
  • An antigen binding domain can be capable of recognizing a single antigen.
  • An antigen binding domain can be capable of recognizing two or more different antigens.
  • An antibody construct can comprise an antibody heavy chain.
  • a heavy chain can be a heavy chain of an anti-HER2 monoclonal antibody which can bind a HER2 antigen.
  • a heavy chain of an anti-HER2 antibody can be an IgG1 isotype.
  • a heavy chain of an anti-HER2 antibody can be SBT-050 VH-hIgG1 wt (pertuzumab).
  • SBT-050 VH-hIgG1 wt can comprise an amino acid sequence
  • VH- hIgG1 wt can comprise an amino acid sequence with greater than 70%, greater than 75%, greater than 80%, greater than 85%, greater than 90%, greater than 95% or greater than 99% homology to SEQ ID NO: 30.
  • a heavy chain of an anti-HER2 antibody can comprise a CDR.
  • a heavy chain of an anti-HER2 antibody can comprise a CDR with an amino acid sequence GFTFTDYT (SEQ ID NO: 31).
  • a heavy chain of an anti-HER2 antibody can comprise a CDR with an amino acid sequence VNPNSGGS (SEQ ID NO: 32).
  • a heavy chain of an anti-HER2 antibody can comprise a CDR with an amino acid sequence ARNLGPSFYFDY (SEQ ID NO: 33).
  • a heavy chain CDR of an anti-HER2 antibody can comprise an amino acid sequence with greater than 70%, greater than 75%, greater than 80%, greater than 85%, greater than 90%, greater than 95% or greater than 99% homology to SEQ ID NO: 31.
  • a heavy chain CDR of an anti-HER2 antibody can comprise an amino acid sequence with greater than 70%, greater than 75%, greater than 80%, greater than 85%, greater than 90%, greater than 95% or greater than 99% homology to SEQ ID NO: 32.
  • a heavy chain CDR of an anti-HER2 antibody can comprise an amino acid sequence with greater than 70%, greater than 75%, greater than 80%, greater than 85%, greater than 90%, greater than 95% or greater than 99% homology to SEQ ID NO: 33.
  • An antibody construct can comprise an antibody light chain.
  • a light chain can be a light chain of a HER2 monoclonal antibody which can bind a HER2 antigen.
  • a light chain of an anti- HER2 antibody can be SBT-050 VL-Ck (pertuzumab).
  • SBT-050 VL-Ck can comprise an amino acid sequence
  • SBT-050 VL-Ck can comprise an amino acid sequence with greater than 70%, greater than 75%, greater than 80%, greater than 85%, greater than 90%, greater than 95% or greater than 99% homology to SEQ ID NO: 34.
  • a light chain of an anti-HER2 antibody can comprise a CDR.
  • a light chain of an anti-HER2 antibody can comprise a CDR with an amino acid sequence QDVSIG (SEQ ID NO: 35).
  • a light chain of an anti-HER2 antibody can comprise a CDR with an amino acid sequence SAS (SEQ ID NO: 36).
  • a light chain of an anti-HER2 antibody can comprise a CDR with an amino acid sequence QQYYIYPYT (SEQ ID NO: 37).
  • a light chain CDR of an anti-HER2 antibody can comprise an amino acid sequence with greater than 70%, greater than 75%, greater than 80%, greater than 85%, greater than 90%, greater than 95% or greater than 99% homology to SEQ ID NO: 35.
  • a light chain CDR of an anti-HER2 antibody can comprise an amino acid sequence with greater than 70%, greater than 75%, greater than 80%, greater than 85%, greater than 90%, greater than 95% or greater than 99% homology to SEQ ID NO: 36.
  • a light chain CDR of an anti-HER2 antibody can comprise an amino acid sequence with greater than 70%, greater than 75%, greater than 80%, greater than 85%, greater than 90%, greater than 95% or greater than 99% homology to SEQ ID NO: 37.
  • An antibody construct can comprise an Fc region with an Fc domain.
  • An Fc domain is a structure that can bind to Fc receptors (FcRs).
  • An antibody construct can comprise an Fc domain. Fc domains can be bound by FcRs.
  • An Fc domain can be from an antibody.
  • An Fc domain can be at least 80% homologous to an Fc domain from an antibody.
  • An Fc region can be in a scaffold.
  • An Fc region with an Fc domain can be in an antibody scaffold.
  • An Fc region with an Fc domain can be in a non-antibody scaffold.
  • An antibody construct can comprise an Fc region with an Fc domain in an antibody scaffold.
  • An antibody construct can comprise an Fc region with an Fc domain in a non-antibody scaffold.
  • An Fc domain can be in a scaffold.
  • An Fc domain can be in an antibody scaffold.
  • An Fc domain can be in a non-antibody scaffold.
  • An antibody construct can comprise an Fc domain in an antibody scaffold.
  • An antibody construct can comprise an Fc domain in a non-antibody scaffold.
  • Fc domains of antibodies can be bound by FcRs.
  • Fc domains can be a portion of the Fc region of an antibody.
  • FcRs can bind to an Fc domain of an antibody.
  • FcRs can bind to an Fc domain of an antibody bound to an antigen.
  • FcRs can be organized into classes (e.g., gamma ( ⁇ ), alpha ( ⁇ ) and epsilon ( ⁇ )) based on the class of antibody that the FcR recognizes.
  • the Fc ⁇ R class can bind to IgA and includes several isoforms, Fc ⁇ RI (CD89) and Fc ⁇ R.
  • the Fc ⁇ R class can bind to IgG and includes several isoforms, Fc ⁇ RI (CD64), Fc ⁇ RIIA (CD32a), Fc ⁇ RIIB (CD32b), Fc ⁇ RIIIA (CD16a), and Fc ⁇ RIIIB (CD16b).
  • An Fc ⁇ RIIIA (CD16a) can be an Fc ⁇ RIIIA (CD16a) F158 variant.
  • An Fc ⁇ RIIIA can be an Fc ⁇ RIIIA (CD16a) V158 variant.
  • Each Fc ⁇ R isoform can differ in affinity to the Fc region of the IgG antibody.
  • Fc ⁇ RI can bind to IgG with greater affinity than Fc ⁇ RII or Fc ⁇ RIII.
  • the affinity of a particular Fc ⁇ R isoform to IgG can be controlled, in part, by a glycan (e.g., oligosaccharide) at position CH 2 84.4 of the IgG antibody.
  • a glycan e.g., oligosaccharide
  • fucose containing CH 2 84.4 glycans can reduce IgG affinity for Fc ⁇ RIIIA.
  • G0 glucans can have increased affinity for Fc ⁇ RIIIA due to the lack of galactose and terminal GlcNAc moiety.
  • Binding of an Fc domain to an FcR can enhance an immune response.
  • FcR-mediated signaling that can result from an Fc region binding to an FcR can lead to the maturation of immune cells.
  • FcR-mediated signaling that can result from an Fc domain binding to an FcR can lead to the maturation of dendritic cells.
  • FcR-mediated signaling that can result from an Fc domain binding to an FcR can lead to more efficient immune cell antigen uptake and processing.
  • FcR-mediated signaling that can result from an Fc region binding to an FcR can lead to more efficient dendritic cell antigen uptake and processing.
  • FcR-mediated signaling that can result from an Fc region binding to an FcR can increase antigen presentation.
  • FcR-mediated signaling that can result from an Fc region binding to an FcR can increase antigen presentation by immune cells.
  • FcR-mediated signaling that can result from an Fc region binding to an FcR can increase antigen presentation by antigen presenting cells.
  • FcR-mediated signaling that can result from an Fc domain binding to an FcR can increase antigen presentation by dendritic cells.
  • FcR-mediated signaling that can result from an Fc domain binding to an FcR can promote the expansion and activation of T cells.
  • FcR-mediated signaling that can result from an Fc domain binding to an FcR can promote the expansion and activation of CD8 + T cells.
  • FcR-mediated signaling that can result from an Fc domain binding to an FcR can influence immune cell regulation of T cell responses.
  • FcR-mediated signaling that can result from an Fc domain binding to an FcR can influence immune cell regulation of T cell responses.
  • FcR-mediated signaling that can result from an Fc domain binding to an FcR can influence dendritic cell regulation of T cell responses.
  • FcR-mediated signaling that can result from an Fc domain binding to an FcR can influence functional polarization of T cells (e.g., polarization can be toward a T H 1 cell response).
  • DC can express both CD32a and CD32b, which can have opposing effects on IgG-mediated maturation and function of DCs: binding of IgG to CD32a can mature and activate DCs in contrast with CD32b, which can mediate inhibition due to
  • ITIM immunoreceptor tyrosine-based inhibition motif
  • a modification in the amino acid sequence of the antibody construct can alter the recognition and binding of an FcR for the Fc domain.
  • a modification of the amino acid sequence of the Fc domain in an antibody construct can increase the binding affinity and/or avidity of the Fc domain for FcRs. This increase in binding affinity and/or avidity can specific for a type of FcR.
  • a modification can be a substitution of an amino acid at a residue (e.g., wildtype) for a different amino acid at that residue.
  • a wildtype Fc domain can comprise
  • a modification can permit binding of an FcR to a site on the Fc region of an antibody construct that the FcR may not otherwise bind to.
  • a modification can increase binding affinity of an FcR to the Fc domain of an antibody construct that the FcR may have reduced binding affinity for.
  • a modification can decrease binding affinity of an FcR to a site on the Fc domain of an antibody construct that the FcR may have increased binding affinity for.
  • a modification can increase the subsequent FcR-mediated signaling after Fc binding to an FcR.
  • An antibody construct can comprise an Fc region with at least one amino acid change as compared to the sequence of the wild-type Fc region.
  • a wild-type Fc region can comprise SEQ ID NO: 162.
  • An antibody construct can comprise an Fc domain with at least one amino acid change as compared to the sequence of the wild-type Fc domain.
  • a wild-type Fc domain can comprise SEQ ID NO: 162.
  • an antibody construct can comprise an Fc domain with at least one amino acid change as compared to the sequence of the wild-type Fc domain comprising SEQ ID NO: 162.
  • An amino acid change in an Fc region of an antibody construct can allow the antibody construct to bind to at least one Fc receptor with greater affinity compared to a wild-type Fc region.
  • An amino acid change in an Fc domain of an antibody construct can allow the antibody to bind to at least one Fc receptor with greater affinity compared to a wild-type Fc domain.
  • An Fc region can comprise an amino acid sequence having at least one, two, three, four, five, six, seven, eight, nine or ten modifications but not more than 40, 35, 30, 25, 20, 15 or 10 modifications of the amino acid sequence relative to the natural or original amino acid sequence.
  • An Fc domain can comprise an amino acid sequence having at least one, two, three, four, five, six, seven, eight, nine or ten modifications but not more than 40, 35, 30, 25, 20, 15 or 10 modifications of the amino acid sequence relative to the natural or original amino acid sequence.
  • An Fc region can be an Fc region of an anti-CD40 antibody.
  • An Fc domain can be an Fc domain of an anti-CD40 antibody.
  • An Fc region can contain an Fc domain.
  • An Fc region can be an Fc domain.
  • An antibody construct can be an antibody comprising a sequence of the IgG1 isoform that has been modified from the wild type IgG1 sequence.
  • a wild type IgG1 sequence can comprise SEQ ID NO: 162.
  • a modification can comprise a substitution at more than one amino acid residue such as at 5 different amino acid residues including L235V/F243L/R292P/Y300L/P396L (G1VLPLL).
  • the numbering of amino acids residues described herein can be according to the EU index as in Kabat.
  • the 5 amino acid residues can be located in a portion of an antibody sequence which can encode an Fc region of the antibody and in particular, can be located in portions of the Fc region that can bind to Fc receptors (i.e., the Fc domain).
  • a modification can comprise a substitution at more than one amino acid residue such as at 2 different amino acid residues including S239D/I332E (G1DE).
  • the 2 amino acid residues can be located in a portion of an antibody sequence which encodes an Fc region of the antibody and in particular, are located in portions of the Fc region that can bind to Fc receptors (i.e., the Fc domain).
  • a modification can comprise a substitution at more than one amino acid residue such as at 3 different amino acid residues including S298A/E333A/K334A (G1AAA).
  • the 3 amino acid residues can be located in a portion of an antibody sequence which can encode an Fc region of the antibody and in particular, can be located in portions of the Fc region that can bind Fc receptors (i.e., the Fc domain).
  • An antibody construct can be a monoclonal anti-CD40 human antibody comprising a sequence of the IgG1 isoform that has been modified from the wildtype IgG1 sequence.
  • a wildtype IgG1 sequence can comprise SEQ ID NO: 15.
  • a modification can comprise a substitution at more than one amino acid residue such as at 5 different amino acid residues including L235V/F243L/R292P/Y300L/P396L (SBT-040-G1VLPLL).
  • the numbering of amino acids residues described herein can be according to the EU index as in Kabat.
  • the 5 amino acid residues can be located in a portion of an antibody sequence which can encode an Fc region of the antibody and in particular, can be located in portions of the Fc region that can bind to Fc receptors (i.e., the Fc domain).
  • a modification can comprise a substitution at more than one amino acid residue such as at 2 different amino acid residues including S239D/I332E (SBT-040- G1DE).
  • the 2 amino acid residues can be located in a portion of an antibody sequence which encodes an Fc region of the antibody and in particular, are located in portions of the Fc region that can bind to Fc receptors (i.e., the Fc domain).
  • a modification can comprise a substitution at more than one amino acid residue such as at 3 different amino acid residues including
  • S298A/E333A/K334A (SBT-040-G1AAA).
  • the 3 amino acid residues can be located in a portion of an antibody sequence which can encode an Fc region of the antibody and in particular, can be located in portions of the Fc region that can bind Fc receptors (i.e., the Fc domain).
  • FIGURE 4C illustrates SBT-040-G1VLPLL, which is an antibody with an amino acid sequence (SEQ ID NO: 16) of a heavy chain of human anti-CD40 monoclonal antibody with modifications to a wild-type IgG1 Fc domain (L235V/F243L/R292P/Y300L/P396L). Binding of some Fc receptors to the Fc region of SBT-040-G1VLPLL can be enhanced compared to wild- type by as result of the L235V/F243L/R292P/Y300L/P396L amino acid modifications.
  • binding of other Fc receptors to the Fc region of SBT-040-G1VLPLL can be reduced compared to wild-type by the L235V/F243L/R292P/Y300L/P396L amino acid modifications.
  • the binding affinities of SBT-040-G1VLPLL to Fc ⁇ RIIIA and to Fc ⁇ RIIA can be enhanced compared to wild-type whereas the binding affinity of SBT-040-G1VLPLLto Fc ⁇ RIIB can be reduced compared to wild-type.
  • FIGURE 4D illustrates an SBT-040-G1DE antibody, which is an antibody with an amino acid sequence (SEQ ID NO: 17) of a heavy chain of human anti- CD40 monoclonal antibody with modifications to a wild-type IgG1 Fc domain (S239D/I332E). Binding of Fc receptors to the Fc region of SBT-040-DE can be enhanced compared to wild-type as a result of the S239D/I332E amino acid modification. However, binding of some Fc receptors to the Fc region of SBT-040-G1DE can be reduced compared to wild-type by S239D/I332E amino acid modification.
  • FIGURE 4E illustrates an SBT-040-G1AAA antibody, which is an antibody with an amino acid sequence (SEQ ID NO: 18) of a heavy chain of a human anti-CD40 monoclonal antibody with modifications to a wild-type IgG1 Fc domain
  • binding of some Fc receptors to the Fc region of SBT-040-G1AAA can be reduced compared to wild-type by S298A/E333A/K334A amino acid modification. Binding affinities of SBT-040-G1AAA to Fc ⁇ RIIIA can be enhanced compared to wild-type whereas the binding affinity of SBT-040-G1AAA to Fc ⁇ RIIB can be reduced compared to wildtype.
  • the heavy chain of a human IgG2 antibody can be mutated at cysteines as positions 127, 232, or 233.
  • the light chain of a human IgG2 antibody can be mutated at a cysteine at position 214.
  • the mutations in the heavy and light chains of the human IgG2 antibody can be from a cysteine residue to a serine residue.
  • An antibody construct can be a heavy chain of an anti-CD40 antibody.
  • a heavy chain of an anti-CD40 antibody can be SBT-040-G1VLPLL.
  • SBT-040-G1VLPLL be expressed from a DNA sequence comprising
  • SBT-040-G1VLPLL can be expressed from a DNA sequence comprising greater than 70%, greater than 75%, greater than 80%, greater than 85%, greater than 90%, greater than 95% or greater than 99% homology to SEQ ID NO: 9.
  • a variable region of SBT-040-G1VLPLL can be expressed from a DNA sequence comprising SEQ ID NO: 13.
  • a variable region of SBT-040-G1VLPLL can be expressed from a DNA sequence comprising greater than 70%, greater than 75%, greater than 80%, greater than 85%, greater than 90%, greater than 95% or greater than 99% homology to SEQ ID NO: 13.
  • anti-CD40 antibodies comprising SBT-040-G1VLPLL expressed from SEQ ID NO: 9, or expressed from a DNA sequence comprising greater than 70% homology to SEQ ID NO: 9 can have a dissociation constant (K d ) for CD40 that is less than 10 nM.
  • Anti-CD40 antibodies comprising SBT-040-G1VLPLL expressed from DNA sequence comprising SEQ ID NO: 9, or comprising greater than 70% homology to SEQ ID NO: 9 can have a dissociation constant (K d ) for CD40 that is less than 1 nM, less than 100 pM, less than 10 pM, less than 1 pM, or less than 0.1 pM.
  • SBT-040-G1VLPLL can be expressed with any anti-CD40 light chain or fragment thereof.
  • SBT-040-G1VLPLL can also be expressed with any anti-CD40 light chain or fragment thereof to form an anti-CD40 antibody or fragment thereof.
  • the anti-CD40 antibody or fragment thereof can be purified, and can be combined with a pharmaceutically acceptable carrier.
  • the anti-CD40 antibody can be an antibody construct. Additionally, one skilled in the art would recognize that these same concepts could apply to antibody constructs comprising anti- CD40 antibodies created for use in the veterinary sciences and/or in laboratory animals.
  • SBT-040-G1VLPLL can comprise an amino acid sequence
  • SBT-040-G1VLPLL can comprise an amino acid sequence with greater than 70%, greater than 75%, greater than 80%, greater than 85%, greater than 90%, greater than 95% or greater than 99% homology to SEQ ID NO: 16.
  • SBT-040-G1VLPLL can comprise an amino acid sequence SEQ ID NO: 20.
  • a variable region of SBT-040-G1VLPLL can comprise an amino acid sequence with greater than 70%, greater than 75%, greater than 80%, greater than 85%, greater than 90%, greater than 95% or greater than 99% homology to SEQ ID NO: 20.
  • anti-CD40 antibodies comprising SBT-040-G1VLPLL with SEQ ID NO: 16 or with an amino acid sequence with greater than 70% homology to SEQ ID NO: 16 can have a dissociation constant (K d ) for CD40 that is less than 10 nM.
  • Anti-CD40 antibodies comprising SBT-040- G1VLPLL with SEQ ID NO: 16 or with an amino acid sequence with greater than 70% homology to SEQ ID NO: 16 can have a dissociation constant (K d ) for CD40 that is less than 1 nM, less than 100 pM, less than 10 pM, less than 1 pM, or less than 0.1 pM.
  • SBT-040-G1VLPLL can be purified.
  • SBT-040-G1VLPLL can be combined with any anti-CD40 light chain or fragment thereof to form an anti-CD40 antibody or fragment thereof.
  • the anti-CD40 antibody or fragment thereof can be purified, and can be combined with a pharmaceutically acceptable carrier.
  • the anti-CD40 antibody can be an antibody construct. Additionally, one skilled in the art would recognize that these same concepts could apply to antibody constructs comprising anti- CD40 antibodies created for use in the veterinary sciences and/or in laboratory animals.
  • a heavy chain of an anti-CD40 antibody can be SBT-040-G1DE.
  • SBT-040-G1DE be expressed from a DNA sequence comprising
  • SBT-040-G1DE can be expressed from a DNA sequence comprising greater than 70%, greater than 75%, greater than 80%, greater than 85%, greater than 90%, greater than 95% or greater than 99% homology to SEQ ID NO: 10.
  • a variable region of SBT-040-G1DE can be expressed from a DNA sequence comprising SEQ ID NO: 13.
  • a variable region of SBT-040-G1DE can be expressed from a DNA sequence comprising greater than 70%, greater than 75%, greater than 80%, greater than 85%, greater than 90%, greater than 95% or greater than 99% homology to SEQ ID NO: 13.
  • anti-CD40 antibodies comprising SBT-040-G1DE expressed from SEQ ID NO: 10, or expressed from a DNA sequence comprising greater than 70% homology to SEQ ID NO: 10 can have a dissociation constant (K d ) for CD40 that is less than 10 nM.
  • Anti-CD40 antibodies comprising SBT-040-G1DE expressed from DNA sequence comprising SEQ ID NO: 10, or comprising greater than 70% homology to SEQ ID NO: 10 can have a dissociation constant (K d ) for CD40 that is less than 1 nM, less than 100 pM, less than 10 pM, less than 1 pM, or less than 0.1 pM.
  • SBT-040-G1DE can be expressed with any anti-CD40 light chain or fragment thereof.
  • SBT-040-G1DE can also be expressed with any anti-CD40 light chain or fragment thereof to form an anti-CD40 antibody or fragment thereof.
  • the anti-CD40 antibody or fragment thereof can be purified, and can be combined with a pharmaceutically acceptable carrier.
  • the anti-CD40 antibody can be an antibody construct.
  • SBT-040-G1DE can comprise an amino acid sequence
  • SBT-040-G1DE can comprise an amino acid sequence with greater than 70%, greater than 75%, greater than 80%, greater than 85%, greater than 90%, greater than 95% or greater than 99% homology to SEQ ID NO: 17.
  • SBT-040-G1DE can comprise an amino acid sequence SEQ ID NO: 20.
  • a variable region of SBT-040-G1DE can comprise an amino acid sequence with greater than 70%, greater than 75%, greater than 80%, greater than 85%, greater than 90%, greater than 95% or greater than 99% homology to SEQ ID NO: 20.
  • anti-CD40 antibodies comprising SBT- 040-G1DE with SEQ ID NO: 17 or with an amino acid sequence with greater than 70% homology to SEQ ID NO: 17 can have a dissociation constant (K d ) for CD40 that is less than 10 nM.
  • Anti-CD40 antibodies comprising SBT-040-G1DE with SEQ ID NO: 17 or with an amino acid sequence with greater than 70% homology to SEQ ID NO: 17 can have a dissociation constant (K d ) for CD40 that is less than 1 nM, less than 100 pM, less than 10 pM, less than 1 pM, or less than 0.1 pM.
  • SBT-040-G1DE can be purified.
  • SBT-040-G1DE can be combined with any anti-CD40 light chain or fragment thereof to form an anti-CD40 antibody or fragment thereof.
  • the anti-CD40 antibody or fragment thereof can be purified, and can be combined with a pharmaceutically acceptable carrier.
  • the anti-CD40 antibody can be an antibody construct.
  • a heavy chain of an anti-CD40 antibody can be SBT-040-G1AAA.
  • SBT-040-G1AAA be expressed from a DNA sequence comprising
  • SBT-040-G1AAA can be expressed from a DNA sequence comprising greater than 70%, greater than 75%, greater than 80%, greater than 85%, greater than 90%, greater than 95% or greater than 99% homology to SEQ ID NO: 11.
  • a variable region of SBT-040-G1AAA can be expressed from a DNA sequence comprising SEQ ID NO: 13.
  • a variable region of SBT-040-G1AAA can be expressed from a DNA sequence comprising greater than 70%, greater than 75%, greater than 80%, greater than 85%, greater than 90%, greater than 95% or greater than 99% homology to SEQ ID NO: 13.
  • anti- CD40 antibodies comprising SBT-040-G1AAA expressed from SEQ ID NO: 11, or expressed from a DNA sequence comprising greater than 70% homology to SEQ ID NO: 11 can have a dissociation constant (K d ) for CD40 that is less than 10 nM.
  • Anti-CD40 antibodies comprising SBT-040-G1AAA expressed from DNA sequence comprising SEQ ID NO: 11, or comprising greater than 70% homology to SEQ ID NO: 11 can have a dissociation constant (K d ) for CD40 that is less than 1 nM, less than 100 pM, less than 10 pM, less than 1 pM, or less than 0.1 pM.
  • SBT-040-G1AAA can be expressed with any anti-CD40 light chain or fragment thereof.
  • SBT- 040-G1AAA can also be expressed with any anti-CD40 light chain or fragment thereof to form an anti-CD40 antibody or fragment thereof.
  • the anti-CD40 antibody or fragment thereof can be purified, and can be combined with a pharmaceutically acceptable carrier.
  • the anti-CD40 antibody can be an antibody construct. Additionally, one skilled in the art would recognize that these same concepts could apply to antibody constructs comprising anti-CD40 antibodies created for use in the veterinary sciences and/or in laboratory animals.
  • SBT-040-G1AAA can comprise an amino acid sequence
  • SBT-040-G1AAA can comprise an amino acid sequence with greater than 70%, greater than 75%, greater than 80%, greater than 85%, greater than 90%, greater than 95% or greater than 99% homology to SEQ ID NO: 18.
  • SBT-040-G1AAA can comprise an amino acid sequence SEQ ID NO: 20.
  • a variable region of SBT-040-G1AAA can comprise an amino acid sequence with greater than 70%, greater than 75%, greater than 80%, greater than 85%, greater than 90%, greater than 95% or greater than 99% homology to SEQ ID NO: 20.
  • anti- CD40 antibodies comprising SBT-040-G1AAA with SEQ ID NO: 18 or with an amino acid sequence with greater than 70% homology to SEQ ID NO: 18 can have a dissociation constant (K d ) for CD40 that is less than 10 nM.
  • Anti-CD40 antibodies comprising SBT-040-G1AAA with SEQ ID NO: 18 or with an amino acid sequence with greater than 70% homology to SEQ ID NO: 18 can have a dissociation constant (Kd) for CD40 that is less than 1 nM, less than 100 pM, less than 10 pM, less than 1 pM, or less than 0.1 pM.
  • SBT-040-G1AAA can be purified.
  • SBT-040-G1AAA can be combined with any anti-CD40 light chain or fragment thereof to form an anti-CD40 antibody or fragment thereof.
  • the anti-CD40 antibody or fragment thereof can be purified, and can be combined with a pharmaceutically acceptable carrier.
  • the anti-CD40 antibody can be an antibody construct. Additionally, one skilled in the art would recognize that these same concepts could apply to anti-CD40 antibodies created for use in the veterinary sciences and/or in laboratory animals.
  • an antibody construct of the present disclosure can comprise an anti-CD40 antibody with wild-type or modified amino acid sequences encoding the Fc region or Fc domain
  • the modifications of the Fc region or the Fc domain from the wild-type sequence may not significantly alter binding and/or affinity of the anti-CD40 antibody for CD40.
  • binding and/or affinity of SBT-040-G1WT, SBT-040-G1VLPLL, SBT-040-G1DE, and SBT- 040-G1AAA may not be significantly altered by modification of an Fc region or Fc domain amino acid sequence compared to a wild-type sequence.
  • Modifications of an Fc region or Fc domain from a wild-type sequence may not alter binding and/or affinity of antibodies that bind to CD40 in an antibody construct. Additionally, the binding and/or affinity of the antibodies described herein that bind to CD40 and are antibody constructs, for example SBT-040-G1WT, SBT-040-G1VLPLL, SBT-040-G1DE, and SBT-040-G1AAA, may be comparable to the binding and/or affinity of wild-type antibodies that can bind to CD40.
  • Sequences that can be used to produce antibodies for antibody constructs can include leader sequences.
  • Leader sequences can be signal sequences.
  • Leader sequences useful with the compositions and methods described herein can include, but are not limited to, a DNA sequence comprising
  • leader sequence can comprise a DNA sequence with greater than 70%, greater than 75%, greater than 80%, greater than 85%, greater than 90%, greater than 95% or greater than 99% homology to SEQ ID NO: 2 or SEQ ID NO: 12.
  • Leader sequence can comprise an amino acid sequence with greater than 70%, greater than 75%, greater than 80%, greater than 85%, greater than 90%, greater than 95% or greater than 99% homology to SEQ ID NO: 5 or SEQ ID NO: 19. Any of the sequences described herein can be used with or without a leader sequence. Additionally, one skilled in the art would recognize that these same concepts can apply to antibody constructs comprising anti- CD40 antibodies created for use in the veterinary sciences and/or in laboratory animals.
  • An antibody construct can further comprise a targeting binding domain.
  • a targeting domain can comprise a domain that binds to a target.
  • a target can be an antigen.
  • a targeting domain can comprise an antigen binding domain.
  • a targeting domain can be a domain that can specifically bind to an antigen.
  • a targeting domain can be an antigen-binding portion of an antibody or an antibody fragment.
  • a targeting domain can be one or more fragments of an antibody that can retain the ability to specifically bind to an antigen.
  • a targeting domain can be any antigen binding fragment.
  • a targeting domain can be in a scaffold, in which a scaffold is a supporting framework for the antigen binding domain.
  • a targeting domain can comprise an antigen binding domain in a scaffold.
  • a targeting domain can comprise an antigen binding domain which can refer to a portion of an antibody comprising the antigen recognition portion, i.e., an antigenic determining variable region of an antibody sufficient to confer recognition and binding of the antigen recognition portion to a target, such as an antigen, i.e., the epitope.
  • a targeting domain can include, but are not limited to, Fab, single chain variable fragment (scFv), variable Fv fragment and other fragments, combinations of fragments or types of fragments known or knowable to one of ordinary skill in the art.
  • a targeting domain can comprise an antigen binding domain which can refer to a portion of an antibody comprising the antigen recognition portion, i.e., an antigenic determining variable region of an antibody sufficient to confer recognition and binding of the antigen recognition portion to a target, such as an antigen, i.e., the epitope.
  • a targeting domain can include, but are not limited to, Fab, single chain variable fragment (scFv), variable Fv fragment and other fragments, combinations of fragments or types of fragments known or knowable to one of ordinary skill in the art.
  • a targeting domain can comprise an antigen binding domain of an antibody.
  • An antigen binding domain of an antibody can comprise one or more light chain (LC) CDRs and one or more heavy chain (HC) CDRs.
  • an antibody binding domain of an antibody can comprise one or more of the following: a light chain complementary determining region 1 (LC CDR1), a light chain complementary determining region 2 (LC CDR2), or a light chain complementary determining region 3 (LC CDR3).
  • an antibody binding domain can comprise one or more of the following: a heavy chain complementary determining region 1 (HC CDR1), a heavy chain complementary determining region 2 (HC CDR2), or a heavy chain complementary determining region 3 (HC CDR3).
  • An antibody construct can comprise an antibody fragment.
  • An antibody fragment can include (i) a Fab fragment, a monovalent fragment consisting of the V L , V H, C L and C H1 domains; (ii) a F(ab') 2 fragment, a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region; and (iii) a Fv fragment consisting of the V L and V H domains of a single arm of an antibody.
  • the two domains of the Fv fragment, V L and V H can be coded for by separate genes, they can be linked by a synthetic linker to be made as a single protein chain in which the V L and V H regions pair to form monovalent molecules.
  • F(ab') 2 and Fab' moieties can be produced by treating immunoglobulin (monoclonal antibody) with a protease such as pepsin and papain, and can include an antibody fragment generated by digesting immunoglobulin near the disulfide bonds existing between the hinge regions in each of the two H chains.
  • immunoglobulin monoclonal antibody
  • protease such as pepsin and papain
  • An Fv can be the minimum antibody fragment which contains a complete antigen- recognition and antigen-binding site. This region can consist of a dimer of one heavy chain and one light chain variable domain in tight, non-covalent association. In this configuration the three hypervariable regions of each variable domain can interact to define an antigen-binding site on the surface of the V H -V L dimer. A single variable domain (or half of an Fv comprising only three hypervariable regions specific for an antigen) can recognize and bind antigen, although at a lower affinity than the entire binding site.
  • a targeting domain can be at least 80% homologous to an antigen binding domain selected from, but not limited to, a monoclonal antibody, a polyclonal antibody, a recombinant antibody, or a functional fragment thereof, for example, a heavy chain variable domain (V H ) and a light chain variable domain (V L ), a DARPin, an affimer, an avimer, a knottin, a monobody, an affinity clamp, an ectodomain, a receptor ectodomain, a receptor, a cytokine, a ligand, an immunocytokine, a T cell receptor, or a recombinant T cell receptor.
  • V H heavy chain variable domain
  • V L light chain variable domain
  • a targeting domain can comprise an antigen binding domain comprising a light chain and a heavy chain from a monoclonal antibody.
  • a targeting domain binds to CD40 and comprises the light chain of an anti-CD40 antibody and the heavy chain of an anti-CD40 antibody, which bind a CD40 antigen.
  • the targeting domain binds to a tumor antigen comprises the light chain of a tumor antigen antibody and the heavy chain of a tumor antigen antibody, which bind the tumor antigen.
  • a targeting domain can bet attached to an antibody construct.
  • an antibody construct can be fused with a targeting binding domain to create an antibody construct targeting binding domain fusion.
  • the antibody construct- targeting binding domain fusion can be the result of the nucleic acid sequence of the targeting binding domain being expressed in frame with the nucleic acid sequence of the antibody construct.
  • the antibody construct-targeting binding domain fusion can be the result of an in-frame genetic nucleotide sequence or a contiguous peptide sequence encoding the antibody construct with the targeting binding domain.
  • a targeting binding domain can be linked to an antibody construct.
  • a targeting binding domain can be linked to an antibody construct by a chemical conjugation. The targeting binding domain can direct the antibody construct to, for example, a particular cell or cell type.
  • a targeting binding domain of an antibody construct can be selected in order to recognize an antigen.
  • an antigen can be expressed on an immune cell.
  • An antigen can be a peptide or fragment thereof.
  • An antigen can be expressed on an antigen-presenting cell.
  • An antigen can be expressed on a dendritic cell, a macrophage, or a B cell.
  • An antigen can be CD40 and a targeting binding domain can recognize a CD40 antigen.
  • a targeting binding domain can be a CD40 agonist.
  • a targeting domain can recognize CD40 on, for example, an antigen- presenting cell.
  • an antigen can be a tumor antigen.
  • the tumor antigen can be any tumor antigen described herein.
  • Pattern recognition receptors can recognize pathogen-associated molecular patterns (PAMPs) and damage-associated molecular patterns (DAMPs).
  • a PRR can be membrane bound.
  • a PRR can be cytosolic.
  • a PRR can be a toll-like receptor (TLR).
  • a PRR can be RIG-I-like receptor.
  • a PRR can be a receptor kinase.
  • a PRR can be a C-type lectin receptor.
  • a PRR can be a NOD-like receptor.
  • a PRR can be TLR1, TLR2, TLR3, TLR4, TLR5, TLR6, TLR7, TLR8, TLR9, TLR10, TLR11, TLR12 or TLR13.
  • a PRR agonist can be pathogen-associated molecular pattern (PAMP) molecule.
  • a PAMP molecule can be a toll-like receptor agonist.
  • a PRR agonist can be a toll-like receptor agonist.
  • a toll-like receptor agonist can be any molecule that acts as an agonist to at least one toll-like receptor.
  • a toll-like receptor agonist can be bacterial lipoprotein.
  • a toll-like receptor agonist can be bacterial peptidoglycans.
  • a toll-like receptor agonist can be double stranded RNA.
  • a toll-like receptor agonist can be lipopolysaccharides.
  • a toll-like receptor agonist can be bacterial flagella.
  • a toll-like receptor agonist can be single stranded RNA.
  • a toll-like receptor can be CpG DNA.
  • a toll-like receptor agonist can be imiquimod.
  • a toll-like receptor agonist can be CL307.
  • a toll-like receptor agonist can be S-27609.
  • a toll-like receptor agonist can be resiquimod.
  • a toll-like receptor agonist can be UC-IV150.
  • a toll-like receptor agonist can be gardiquimod.
  • a toll-like receptor agonist can be motolimod.
  • a toll-like receptor agonist can be VTX-1463.
  • a toll-like receptor agonist can be GS-9620.
  • a toll-like receptor agonist can be GSK2245035.
  • a toll-like receptor agonist can be TMX-101.
  • a toll-like receptor agonist can be TMX-201.
  • a toll-like receptor agonist can be TMX-202.
  • a toll-like receptor agonist can be isatoribine.
  • a toll-like receptor agonist can be AZD8848.
  • a toll-like receptor agonist can be MEDI9197.
  • a toll-like receptor agonist can be 3M-051.
  • a toll-like receptor agonist can be 3M- 852.
  • a toll-like receptor agonist can be 3M-052.
  • a toll-like receptor agonist can be 3M-854A.
  • a toll-like receptor agonist can be S-34240.
  • a toll-like receptor agonist can be CL663.
  • a RIG-I agonist can be KIN1148.
  • a RIG-I agonist can be SB-9200.
  • a RIG-I agonist can be KIN700, KIN600, KIN500, KIN100, KIN101, KIN400, or KIN2000.
  • a toll-like receptor agonist can be KU34B.
  • a PRR agonist can be a damage-associated molecular pattern (DAMP) molecule.
  • DAMP molecule can be an intracellular protein.
  • a DAMP molecule can be a heat-shock protein.
  • a DAMP molecule can be an HMGB1 protein.
  • a DAMP molecule can be a protein derived from the extracellular matrix that is generated after tissue injury.
  • a DAMP molecule can be a hyaluronan fragment.
  • a DAMP molecule can be DNA.
  • a DAMP molecule can be RNA.
  • a DAMP molecule can be an S100 molecule.
  • a DAMP molecule can be nucleotides.
  • a DAMP molecule can be an ATP.
  • a DAMP molecule can be nucleosides.
  • a DAMP molecule can be an adenosine.
  • a DAMP molecule can be uric acid.
  • stimulator of interferon genes can act as a cytosolic DNA sensor wherein cytosolic DNA and unique bacterial nucleic acids called cyclic dinucleotides are recognized by STING, and therefore STING agonists.
  • Interferon Regulatory Factor (IRF) agonist can be KIN-100.
  • Non-limiting examples of STING agonists include:
  • each X is independently O or S
  • R3 and R4 are each independently H or an optionally substituted straight chain alkyl of from 1 to 18 carbons and from 0 to 3 heteroatoms, an optionally substituted alkenyl of from 1-9 carbons, an optionally substituted alkynyl of from 1-9 carbons, or an optionally substituted aryl, wherein substitution(s), when present, may be independently selected from the group consisting of C 1-6 alkyl straight or branched chain, benzyl, halogen, trihalomethyl, C 1-6 alkoxy,—NO 2 ,—NH 2 ,— OH, ⁇ O,—COOR′ where R′ is H or lower alkyl,—CH 2 OH, and—CONH 2 , wherein R3 and R4 are not both H,
  • An immune-stimulatory compound can be a PRR agonist.
  • An immune-stimulatory compound can be a PAMP.
  • An immune-stimulatory compound can be a DAMP.
  • An immune- stimulatory compound can be a TLR agonist.
  • An immune-stimulatory compound can be a STING agonist.
  • An immune-stimulatory compound can be a cyclic dinucleotide.
  • An immune-stimulatory compound can be a drug.
  • the specificity of the antigen-binding domain to an antigen of an antibody construct in an antibody construct immune-stimulatory compound conjugate as disclosed herein can be influenced by the presence of an immune-stimulatory compound.
  • the antigen-binding domain of the antibody construct in an antibody construct immune-stimulatory compound conjugate can bind to an antigen with at least about 10%, about 20%, about 30%, about 40%, about 50%, about 60%, about 70%, about 80%, about 85%, about 90%, about 95%, or about 100% of a specificity of the antigen-binding domain to the antigen in the absence of the immune-stimulatory compound.
  • the specificity of the Fc domain to an Fc receptor of an antibody construct in an antibody construct immune-stimulatory compound conjugate as disclosed herein can be influenced by the presence of an immune-stimulatory compound.
  • the Fc domain of the antibody construct in an antibody construct immune-stimulatory compound conjugate can bind to an Fc receptor with at least about 10%, about 20%, about 30%, about 40%, about 50%, about 60%, about 70%, about 80%, about 85%, about 90%, about 95%, or about 100% of a specificity of the Fc domain to the Fc receptor in the absence of the immune-stimulatory compound.
  • the affinity of the antigen-binding domain to an antigen of an antibody construct in an antibody construct immune-stimulatory compound conjugate as disclosed herein can be influenced by the presence of an immune-stimulatory compound.
  • the antigen-binding domain of the antibody construct in an antibody construct immune-stimulatory compound conjugate can bind to an antigen with at least about 1%, about 5%, about 10%, about 20%, about 30%, about 40%, about 50%, about 60%, about 70%, about 80%, about 85%, about 90%, about 95%, or about 100% of an affinity of the antigen-binding domain to the antigen in the absence of the immune-stimulatory compound.
  • the affinity of the Fc domain to an Fc receptor of an antibody construct in an antibody construct immune-stimulatory compound conjugate as disclosed herein can be influenced by the presence of an immune-stimulatory compound.
  • the Fc domain of the antibody construct in an antibody construct immune-stimulatory compound conjugate can bind to an Fc receptor with at least about 1%, about 5%, about 10%, about 20%, about 30%, about 40%, about 50%, about 60%, about 70%, about 80%, about 85%, about 90%, about 95%, or about 100% of an affinity of the Fc domain to the Fc receptor in the absence of the immune-stimulatory compound.
  • the K d for binding of an antigen-binding domain of an antibody construct immune- stimulatory compound conjugate to an antigen in the presence of an immune-stimulatory compound can be about 2 times, about 3 times, about 4 times, about 5 times, about 6 times, about 7 times, about 8 times, about 9 times, about 10 times, about 15 times, about 20 times, about 25 times, about 30 times, about 35 times, about 40 times, about 45 times, about 50 times, about 60 times, about 70 times, about 80 times, about 90 times, about 100 times, about 110 times, or about 120 times greater than the K d for binding of the antigen binding domain to the antigen of an antibody construct in the absence of the immune-stimulatory compound.
  • the K d for binding of an antigen-binding domain of an antibody construct immune-stimulatory compound conjugate to an antigen in the presence of the immune-stimulatory compound can be less than 10 nM.
  • the K d for binding of an antigen-binding domain of an antibody construct immune-stimulatory compound conjugate to an antigen in the presence of the immune-stimulatory compound can be less than 100 nM, less than 50 nM, less than 20 nM, less than 5 nM, less than 1 nM, or less than 0.1 nM.
  • the K d for binding of an Fc domain of an antibody construct immune-stimulatory compound conjugate to a Fc receptor in the presence of the immune-stimulatory compound can be about 2 times, about 3 times, about 4 times, about 5 times, about 6 times, about 7 times, about 8 times, about 9 times, about 10 times, about 15 times, about 20 times, about 25 times, about 30 times, about 35 times, about 40 times, about 45 times, about 50 times, about 60 times, about 70 times, about 80 times, about 90 times, about 100 times, about 110 times, or about 120 times greater than the K d for binding of the Fc domain to the Fc receptor in the absence of the immune- stimulatory compound.
  • the K d for binding of an Fc domain of an antibody construct immune- stimulatory compound conjugate to an Fc receptor in the presence of the immune-stimulatory compound can be less than 10 nM.
  • the K d for binding of an Fc domain of an antibody construct immune-stimulatory compound conjugate to an Fc receptor in the presence of the immune- stimulatory compound can be less than 10 ⁇ M, less than 1 ⁇ M, less than 100 nM, less than 50 nM, less than 20 nM, less than 5 nM, less than 1 nM, or less than 0.1 nM.
  • Affinity can be the strength of the sum total of noncovalent interactions between a single binding site of a molecule, for example, an antibody, and the binding partner of the molecule, for example, an antigen.
  • the affinity can also measure the strength of an interaction between an Fc portion of an antibody and the Fc receptor.
  • “binding affinity” can refer to intrinsic binding affinity which reflects a 1:1 interaction between members of a binding pair (e.g., antibody and antigen or Fc domain and Fc receptor).
  • the affinity of a molecule X for its partner Y can generally be represented by the dissociation constant (K d ).
  • Affinity can be measured by common methods known in the art, including those described herein. Specific illustrative and exemplary embodiments for measuring binding affinity are described in the following.
  • an antibody provided herein can have a dissociation constant (K d ) of about 1 ⁇ M, about 100 nM, about 10 nM, about 5 nM, about 2 nM, about 1 nM, about 0.5 nM, about 0.1 nM, about 0.05 nM, about 0.01 nM, or about 0.001 nM or less (e.g., 10 -8 M or less, e.g., from 10 -8 M to 10 -13 M, e.g., from 10 -9 M to 10 -13 M).
  • K d dissociation constant
  • An affinity matured antibody can be an antibody with one or more alterations in one or more complementarity determining regions (CDRs), compared to a parent antibody, which may not possess such alterations, such alterations resulting in an improvement in the affinity of the antibody for antigen.
  • CDRs complementarity determining regions
  • These antibodies can bind to their antigen with a Kd of about 5 ⁇ 10 -9 M, about 2 ⁇ 10 -9 M, about 1 ⁇ 10 -9 M, about 5 ⁇ 10 -1 M, about 2 ⁇ 10 -9 M, about 1 ⁇ 10 -10 M, about 5 ⁇ 10 -11 M, about 1 ⁇ 10 -11 M, about 5 ⁇ 10 -12 M, about 1 ⁇ 10 -12 M, or less.
  • the antibody construct can have an increased affinity of at least 1.5-fold, 2-fold, 2.5-fold, 3-fold, 4-fold, 5-fold, 10-fold, 20-fold, or greater as compared to an antibody construct without alterations in one or more complementarity determining regions.
  • K d can be measured by any suitable assay.
  • K d can be measured by a radiolabeled antigen binding assay (RIA).
  • RIA radiolabeled antigen binding assay
  • K d can be measured using surface plasmon resonance assays (e.g., using a BIACORE®-2000 or a BIACORE®-3000).
  • Agonism can be described as the binding of a chemical to a receptor to induce a biological response.
  • a chemical can be, for example, a small molecule, a compound, or a protein.
  • An agonist causes a response
  • an antagonist can block the action of an agonist
  • an inverse agonist can cause a response that is opposite to that of the agonist.
  • a receptor can be activated by either endogenous or exogenous agonists.
  • the molar ratio of an antibody construct immune-stimulatory compound conjugate can refer to the average number of immune-stimulatory compounds conjugated to the antibody construct in a preparation of an antibody construct immune-stimulatory compound conjugate.
  • the molar ratio can be determined, for example, by Liquid Chromatography/Mass Spectrometry (LC/MS), in which the number of immune-stimulatory compounds conjugated to the antibody construct can be directly determined.
  • LC/MS Liquid Chromatography/Mass Spectrometry
  • the molar ratio can be determined based on hydrophobic interaction chromatography (HIC) peak area, by liquid chromatography coupled to electrospray ionization mass spectrometry (LC-ESI-MS), by UV/Vis spectroscopy, by reversed-phase-HPLC (RP-HPLC), or by matrix-assisted laser
  • MALDI-TOF-MS desorption/ionization time of flight mass spectrometry
  • the molar ratio of immune-stimulatory compound to antibody can be less than 8. In other embodiments, the molar ratio of immune-stimulatory compound to antibody can be 8, 7, 6, 5, 4, 3, 2, or 1.
  • the present disclosure provides a compound represented by the structure of Formula (I):
  • X 1 is selected from–OR 2 and–SR 2 ;
  • X 2 is selected from–OR 3 and–SR 3 ;
  • B 1 and B 2 are independently selected from optionally substituted nitrogenous bases;
  • Y is selected from––OR 4 ,–NR 4 R 4 , and halogen;
  • the compound of Formula (I) is represented by Formula (IA):
  • the compound of Formula (I) is represented by Formula (IB): (IB) ,
  • B 1 and B 2 are independently selected from optionally substituted
  • B is independently selected from optionally substituted pyrimidines.
  • optionally substituted purines may include optionally substituted adenine, optionally substituted guanine, optionally substituted xanthine, optionally substituted hypoxaanthine, optionally substituted theobromine, optionally substituted caffeine, optionally substituted uric acid, and optionally substituted isoguanine.
  • B 1 and B 2 are independently selected from:
  • B 1 and B 2 are independently selected from optionally substituted adenine and optionally substituted guanine. In certain embodiments, B 1 and B 2 are
  • B 1 and B 2 are independently selected from:
  • B 1 is an optionally substituted guanine. In certain embodiments,
  • B 1 is , wherein the point of connectivity of B 1 to the remainder of the compound is represented by .
  • B 2 is an optionally substituted guanine. In certain, embodiments,
  • B 2 wherein the point of connectivity on B 2 is represented by .
  • B 2 is an optionally substituted
  • B wherein the point of connectivity on B 2 is represented by .
  • B 1 is an optionally substituted guanine and B 2 is an optionally substituted guanine. In some embodiments, B 1 is an optionally substituted adenine and B 2 is an optionally substituted guanine.
  • X 1 is selected from–OH and–SH.
  • X 1 may be– OH.
  • X 2 is selected from–OH and–SH.
  • X 2 may be–OH.
  • X 1 is–OH and X 2 is–OH.
  • X 1 is–SH and X 2 is– SH.
  • Y is selected from–OH,–O-C 1-10 alkyl,–NH(C 1-10 alkyl), and– NH 2 .
  • Y may be–OH.
  • the compound of Formula (I) is represented by Formula (IC):
  • the compound of Formula (IC) is represented by Formula (ID):
  • the compound is a pharmaceutically acceptable salt.
  • the compound or salt is a modulator of a stimulator of interferon genes (STING).
  • the compound or salt may agonize a stimulator of interferon genes (STING).
  • the compound or salt may cause STING to coordinate multiple immune responses to infection, including the induction of interferons and STAT6-dependent response and selective autophagy response.
  • the compound or salt may cause STING to mediate type I interferon production.
  • the present disclosure provides an antibody drug conjugate, comprising a compound or salt previously described, an antibody, and a linker group, wherein the compound or salt is linked, e.g., covalently bound, to the antibody through the linker group.
  • the linker group may be selected from a cleavable or non-cleavable linker. In some embodiments, the linker group is cleavable. In alternative embodiments, the linker group is non-cleavable. Linkers are further described in the present application in the subsequent section, any one of which may be used to connect an antibody to a compound described herein.
  • the present disclosure provides a compound represented by the structure of Formula (II):
  • X 1 is selected from–OR 2 and–SR 2 ;
  • X 2 is selected from–OR 3 and–SR 3 ;
  • Y is selected from––OR 4 ,–SR 4 ,–NR 4 R 4 , and halogen;
  • Z is selected from––OR 5, –SR 5 , and–NR 5 R 5 ;
  • X 3 is a linker moiety, wherein at least one of R 1 , R 2 , R 3 , R 4 , R 5 , X 1 , X 2 , a B 1 substituent and a B 2 substituent is -X 3 .
  • the compound of Formula (II) is represented by a structure of Formula (IIA):
  • the compound of Formula (II) is represented by a structure of Formula (IIB):
  • B 1 and B 2 are independently selected from optionally substituted purines.
  • B 1 and B 2 may be each, independently selected from one another, adenine, guanine, and derivatives thereof.
  • B 1 and B 2 may be independently selected from optionally substituted adenine, optionally substituted guanine, optionally substituted xanthine, optionally substituted hypoxanthine, optionally substituted theobromine, optionally substituted caffeine, optionally substituted uric acid, and optionally substituted isoguanine.
  • B 1 and B 2 are independently selected from optionally substituted adenine and optionally substituted guanine.
  • B 1 is optionally further substituted by one or more substituents.
  • B 2 may be represented by: , and wherein B 2 is optionally further substituted by one or more substituents.
  • B 1 is represented by and B 2 is represented by
  • X 1 is selected from -O- X 3 and-S-X 3 . In some embodiments, X 1 is selected from–OH and–SH. In some embodiments, X 1 is -SH.
  • X 2 is selected from -O- X 3 and-S-X 3 . In some embodiments, X 2 is selected from–OH and–SH. In some embodiments, X 2 is -S-X 3 .
  • X 1 is–SH and X 2 is -S-X 3 .
  • Y is selected from -NR 4 X 3 , -S-X 3 , and -O- X 3 .
  • Y is selected from–OH, -SH,–O-C 1-10 alkyl,–NH(C 1-10 alkyl), and–NH 2 .
  • Y is selected from–OH.
  • Z is selected from -NR 4 X 3 , -S-X 3 , and -O- X 3 .
  • Z is selected from–OH, -SH,–O-C 1-10 alkyl,–NH(C 1-10 alkyl), and–NH 2.
  • RX comprises a reactive moiety, such a maleimide. 2 In m m im n –X 3 i r r n h f rm l
  • RX * is a reactive moiety that has reacted with a moiety on an antibody to form an antibody-drug conjugate.
  • RX 3 is represented by the formula: , wherein RX is a reactive moiety, such as a maleimide.
  • RX * is a reactive moiety that has reacted with a moiety on an antibody to form an antibody drug conjugate.
  • the compound is represented by the formula: , or a harmaceuticall acce table salt thereof.
  • the com ound may be represented by the formula:
  • the com ound is re resented by the formula:
  • the compound may be represented by the formula:
  • the compound may be represented by the formula: , or a pharmaceutically acceptable salt thereof.
  • the compound is represented by the formula:
  • the compound may be represented by the formula:
  • the compound is represented by the formula:
  • the compound may be represented by the formula: , or a pharmaceutically acceptable salt thereof.
  • the compound may be represented by the formula:
  • the compound is represented by the formula:
  • the compound may be represented by the formula:
  • the compound is represented by the formula:
  • the compound may be represented by the formula:
  • the compound may be represented by the formula:
  • the com ound is re resented b the formula:
  • the compound may be represented by the formula: , or a pharmaceutically actable salt thereof.
  • the compound may be represented by the formula:
  • the com ound is re resented b the formula:
  • the compound may be represented by the formula:
  • the compound may be represented by the formula: , or a pharmaceutically acceptable salt thereof.
  • the com ound is re resented b the formula:
  • the compound may be represented by the formula:
  • the compound may be represented by the formula:
  • compositions and methods described herein can comprise a linker, e.g., a peptide linker.
  • Linkers of the compositions and methods described herein may not affect the binding of active portions of a conjugate (e.g., active portions include antigen binding domains, Fc domains, targeting binding domains, antibodies, agonists or the like) to a target, which can be a cognate binding partner such as an antigen.
  • a linker sequence can form a linkage between different parts of a composition.
  • a composition can be a conjugate.
  • a conjugate can comprise multiple linkers. These linkers can be the same linkers or different linkers.
  • Attachment via a linker can involve incorporation of a linker between parts of a composition or conjugate.
  • a linker can be short, flexible, rigid, cleavable, non-cleavable, hydrophilic, or hydrophobic.
  • a linker can contain segments that have different characteristics, such as segments of flexibility or segments of rigidity.
  • the linker can be chemically stable to extracellular environments, for example, chemically stable in the blood stream, or may include linkages that are not stable.
  • the linker can include linkages that are designed to cleave and/or immolate or otherwise breakdown specifically or non- specifically inside cells.
  • a cleavable linker can be sensitive to enzymes.
  • a cleavable linker can be cleaved by enzymes such as proteases.
  • a cleavable linker can be a valine-citrulline linker or a valine-alanine linker.
  • a valine- citrulline or valine-alanine linker can contain a pentafluorophenyl group.
  • a valine-citrulline or valine-alanine linker can contain a succimide group.
  • a valine-citrulline or valine-alanine linker can contain a para aminobenzoic acid (PABA) group.
  • a valine-citrulline or valine-alanine linker can contain a PABA group and a pentafluorophenyl group.
  • a valine-citrulline or valine-alanine linker can contain a PABA group and a succinimide group.
  • a non-cleavable linker can be protease insensitive.
  • a non-cleavable linker can be maleimidocaproyl linker.
  • maleimidocaproyl linker can comprise N-maleimidomethylcyclohexane-1-carboxylate.
  • a maleimidocaproyl linker can contain a succinimide group.
  • a maleimidocaproyl linker can contain pentafluorophenyl group.
  • a linker can be a combination of a maleimidocaproyl group and one or more polyethylene glycol molecules.
  • a linker can be a maleimide-PEG4 linker.
  • a linker can be a combination of a maleimidocaproyl linker containing a succinimide group and one or more polyethylene glycol molecules.
  • a linker can be a combination of a
  • maleimidocaproyl linker containing a pentafluorophenyl group and one or more polyethylene glycol molecules.
  • a linker can contain maleimides linked to polyethylene glycol molecules in which the polyethylene glycol can allow for more linker flexibility or can be used lengthen the linker.
  • a linker can be a (maleimidocaproyl)-(valine-citrulline)-(para-aminobenzyloxycarbonly)- (NH 2 ) linker.
  • a linker can be a THIOMAB linker.
  • a THIOMAB linker can be a
  • a linker can also be an alkylene, alkenylene, alkynylene, polyether, polyester, polyamide, polyamino acids, polypeptides, cleavable peptides, or aminobenzylcarbamates.
  • a linker can contain a maleimide at one end and an N-hydroxysuccinimidyl ester at the other end.
  • a linker can contain a lysine with an N-terminal amine acetylated, and a valine-citrulline cleavage site.
  • a linker can be a link created by a microbial transglutaminase, wherein the link can be created between an amine-containing moiety and a moiety engineered to contain glutamine as a result of the enzyme catalyzing a bond formation between the acyl group of a glutamine side chain and the primary amine of a lysine chain.
  • a linker can contain a reactive primary amine.
  • a linker can be a Sortase A linker.
  • a Sortase A linker can be created by a Sortase A enzyme fusing an LXPTG recognition motif (SEQ ID NO: 21) to an N-terminal GGG motif to regenerate a native amide bond.
  • the linker created can therefore link a moiety attached to the LXPTG recognition motif (SEQ ID NO: 21) with a moiety attached to the N-terminal GGG motif.
  • a linker can be a link created between an unnatural amino acid on one moiety reacting with oxime bond that was formed by modifying a ketone group with an alkoxyamine on another moiety.
  • a moiety can be an antibody construct.
  • a moiety can be an antibody.
  • a moiety can be an immune-stimulatory compound.
  • a moiety can be a targeting binding domain.
  • a linker can be a portion of a linker can be unsubstituted or substituted, for example, with a substituent.
  • a substituent can include, for example, hydroxyl groups, amino groups, nitro groups, cyano groups, azido groups, carboxyl groups,
  • carboxaldehyde groups imine groups, alkyl groups, alkenyl groups, alkynyl groups, alkoxy groups, acyl groups, acyloxy groups, amide groups, and ester groups.
  • the immune-stimulatory compound is linked to the antibody construct by way of linkers.
  • the linker linking an immune-stimulatory compound to the antibody of an antibody construct immune- stimulatory compound conjugate can be short, long, hydrophobic, hydrophilic, flexible or rigid, or may be composed of segments that each independently have one or more of the above- mentioned properties such that the linker may include segments having different properties.
  • the linkers can be polyvalent such that they covalently link more than one immune-stimulatory compound to a single site on the antibody construct, or monovalent such that covalently they link a single immune-stimulatory compound to a single site on the antibody construct.
  • the linkers link the immune-stimulatory compound to the antibody by forming a covalent linkage to the immune-stimulatory compound at one location and a covalent linkage to the antibody construct at another.
  • the covalent linkages are formed by reaction between functional groups on the linker and functional groups on the inhibitors and antibody construct.
  • linker is intended to include (i) unconjugated forms of the linker that include a functional group capable of covalently linking the linker to an immune-stimulatory compound and a functional group capable of covalently linking the linker to an antibody construct; (ii) partially conjugated forms of the linker that include a functional group capable of covalently linking the linker to an antibody construct and that is covalently linked to an immune-stimulatory compound, or vice versa; and (iii) fully conjugated forms of the linker that is covalently linked to both an immune-stimulatory compound and an antibody construct.
  • moieties comprising the functional groups on the linker and covalent linkages formed between the linker and antibody construct are specifically illustrated as Rx and LK, respectively.
  • One embodiment pertains to an antibody construct immune-stimulatory compound conjugate formed by contacting an antibody construct that binds a cell surface receptor or tumor associated antigen expressed on a tumor cell with a synthon described herein under conditions in which the synthon covalently links to the antibody construct.
  • One embodiment pertains to a method of making an antibody construct immune-stimulatory compound conjugate formed by contacting a synthon described herein under conditions in which the synthon covalently links to the antibody construct.
  • One embodiment pertains to a method of stimulating immune activity in a cell that expresses CD40, comprising contacting the cell with an antibody construct immune-stimulatory compound conjugate described herein that is capable of binding the cell, under conditions in which the antibody construct immune-stimulatory compound conjugate binds the cell.
  • Exemplary polyvalent linkers that may be used to link many immune-stimulatory compounds to an antibody construct are described.
  • Fleximer® linker technology has the potential to enable high-DAR antibody construct immune-stimulatory compound conjugate with good physicochemical properties.
  • the Fleximer® linker technology is based on incorporating drug molecules into a solubilizing poly-acetal backbone via a sequence of ester bonds. The methodology renders highly-loaded antibody construct immune- stimulatory compound conjugates (DAR up to 20) whilst maintaining good physicochemical properties. This methodology could be utilized with immune-stimulatory compound as shown in the Scheme below.
  • an aliphatic alcohol can be present or introduced into the immune-stimulatory compound.
  • the alcohol moiety is then conjugated to an alanine moiety, which is then synthetically incorporated into the
  • Cleavable linkers can be cleavable in vitro and in vivo.
  • Cleavable linkers can include chemically or enzymatically unstable or degradable linkages.
  • Cleavable linkers can rely on processes inside the cell to liberate an immune-stimulatory compound, such as reduction in the cytoplasm, exposure to acidic conditions in the lysosome, or cleavage by specific proteases or other enzymes within the cell.
  • Cleavable linkers can incorporate one or more chemical bonds that are either chemically or enzymatically cleavable while the remainder of the linker can be non- cleavable.
  • a linker can contain a chemically labile group such as hydrazone and/or disulfide groups.
  • Linkers comprising chemically labile groups can exploit differential properties between the plasma and some cytoplasmic compartments.
  • the intracellular conditions that can facilitate immune-stimulatory compound release for hydrazone containing linkers can be the acidic environment of endosomes and lysosomes, while the disulfide containing linkers can be reduced in the cytosol, which can contain high thiol concentrations, e.g., glutathione.
  • the plasma stability of a linker containing a chemically labile group can be increased by introducing steric hindrance using substituents near the chemically labile group.
  • Acid-labile groups such as hydrazone
  • This pH dependent release mechanism can be associated with nonspecific release of the drug.
  • the linker can be varied by chemical modification, e.g., substitution, allowing tuning to achieve more efficient release in the lysosome with a minimized loss in circulation.
  • Hydrazone-containing linkers can contain additional cleavage sites, such as additional acid-labile cleavage sites and/or enzymatically labile cleavage sites.
  • Antibody construct immune- stimulatory compound conjugates including exemplary hydrazone-containing linkers can include, for example, the following structures:
  • linker (Ig) the linker can comprise two cleavable groups– a disulfide and a hydrazone moiety.
  • linkers such as (Ih) and (Ii) can be effective with a single hydrazone cleavage site.
  • Other acid-labile groups that can be included in linkers include cis-aconityl-containing linkers. cis-Aconityl chemistry can use a carboxylic acid juxtaposed to an amide bond to accelerate amide hydrolysis under acidic conditions.
  • Cleavable linkers can also include a disulfide group.
  • Disulfides can be
  • thermodynamically stable at physiological pH can be designed to release the immune- stimulatory compound upon internalization inside cells, wherein the cytosol can provide a significantly more reducing environment compared to the extracellular environment.
  • Scission of disulfide bonds can require the presence of a cytoplasmic thiol cofactor, such as (reduced) glutathione (GSH), such that disulfide-containing linkers can be reasonably stable in circulation, selectively releasing the immune-stimulatory compound in the cytosol.
  • GSH reduced glutathione
  • the intracellular enzyme protein disulfide isomerase, or similar enzymes capable of cleaving disulfide bonds can also contribute to the preferential cleavage of disulfide bonds inside cells.
  • GSH can be present in cells in the concentration range of 0.5-10 mM compared with a significantly lower concentration of GSH or cysteine, the most abundant low-molecular weight thiol, in circulation at approximately 5 ⁇ M.
  • Tumor cells where irregular blood flow can lead to a hypoxic state, can result in enhanced activity of reductive enzymes and therefore even higher glutathione concentrations.
  • the in vivo stability of a disulfide-containing linker can be enhanced by chemical modification of the linker, e.g., use of steric hindrance adjacent to the disulfide bond.
  • Antibody construct immune-stimulatory compound conjugates including exemplary disulfide-containing linkers can include the following structures:
  • n represents the number of immune-stimulatory compound -linkers linked to the antibody construct and R is independently selected at each occurrence from hydrogen or alkyl, for example.
  • R is independently selected at each occurrence from hydrogen or alkyl, for example.
  • Increasing steric hindrance adjacent to the disulfide bond can increase the stability of the linker.
  • Structures such as (Ij) and (Il) can show increased in vivo stability when one or more R groups is selected from a lower alkyl such as methyl.
  • linker that can be used is a linker that is specifically cleaved by an enzyme.
  • the linker can be cleaved by a lysosomal enzyme.
  • Such linkers can be peptide-based or can include peptidic regions that can act as substrates for enzymes. Peptide based linkers can be more stable in plasma and extracellular milieu than chemically labile linkers.
  • Peptide bonds can have good serum stability, as lysosomal proteolytic enzymes can have very low activity in blood due to endogenous inhibitors and the unfavorably high pH value of blood compared to lysosomes. Release of an immune-stimulatory compound from an antibody construct can occur due to the action of lysosomal proteases, e.g., cathepsin and plasmin. These proteases can be present at elevated levels in certain tumor tissues.
  • the linker can be cleavable by a lysosomal enzyme.
  • the lysosomal enzyme can be, for example, cathepsin B, ⁇ - glucuronidase, or ⁇ -galactosidase.
  • the cleavable peptide can be selected from tetrapeptides such as Gly-Phe-Leu-Gly, Ala- Leu-Ala-Leu or dipeptides such as Val-Cit, Val-Ala, and Phe-Lys. Dipeptides can have lower hydrophobicity compared to longer peptides.
  • a variety of dipeptide-based cleavable linkers can be used in the antibody constructs immune-stimulatory compound conjugates described herein.
  • Enzymatically cleavable linkers can include a self-immolative spacer to spatially separate the immune-stimulatory compound from the site of enzymatic cleavage.
  • the direct attachment of an immune-stimulatory compound to a peptide linker can result in proteolytic release of an amino acid adduct of the immune-stimulatory compound, thereby impairing its activity.
  • the use of a self-immolative spacer can allow for the elimination of the fully active, chemically unmodified immune-stimulatory compound upon amide bond hydrolysis.
  • One self-immolative spacer can be a bifunctional para-aminobenzyl alcohol group, which can link to the peptide through the amino group, forming an amide bond, while amine containing immune-stimulatory compounds can be attached through carbamate functionalities to the benzylic hydroxyl group of the linker (to give a p-amidobenzylcarbamate, PABC).
  • the resulting pro- immune-stimulatory compound can be activated upon protease- mediated cleavage, leading to a 1,6-elimination reaction releasing the unmodified immune-stimulatory compound, carbon dioxide, and remnants of the linker group.
  • the following scheme depicts the fragmentation of p- amidobenzyl carbamate and release of the immune-stimulatory compound:
  • X-D represents the unmodified immune-stimulatory compound.
  • the enzymatically cleavable linker can be a ß-glucuronic acid-based linker. Facile release of the immune-stimulatory compound can be realized through cleavage of the ß-glucuronide glycosidic bond by the lysosomal enzyme ß-glucuronidase. This enzyme can be abundantly present within lysosomes and can be overexpressed in some tumor types, while the enzyme activity outside cells can be low. ß- Glucuronic acid-based linkers can be used to circumvent the tendency of an antibody construct immune-stimulatory compound conjugate to undergo aggregation due to the hydrophilic nature of ß-glucuronides.
  • ß- glucuronic acid-based linkers can link an antibody construct to a hydrophobic immune- stimulatory compound.
  • the following scheme depicts the release of an immune-stimulatory compound (D) from an antibody construct (Ab) immune-stimulatory compound conjugate containing a ß-glucuronic acid-based linker:
  • cleavable ⁇ -glucuronic acid-based linkers useful for linking drugs such as auristatins, camptothecin and doxorubicin analogues, CBI minor-groove binders, and psymberin to antibodies have been described. All of these ⁇ -glucuronic acid-based linkers may be used in the ADCs described herein.
  • the enzymatically cleavable linker is a ⁇ - galactoside-based linker. ⁇ -Galactoside is present abundantly within lysosomes, while the enzyme activity outside cells is low.
  • immune-stimulatory compounds containing a phenol group can be covalently bonded to a linker through the phenolic oxygen.
  • a linker relies on a methodology in which a diamino-ethane "Space Link” is used in conjunction with traditional "PABO” -based self-immolative groups to deliver phenols.
  • Cleavable linkers can include non-cleavable portions or segments, and/or cleavable segments or portions can be included in an otherwise non-cleavable linker to render it cleavable.
  • polyethylene glycol (PEG) and related polymers can include cleavable groups in the polymer backbone.
  • a polyethylene glycol or polymer linker can include one or more cleavable groups such as a disulfide, a hydrazone or a dipeptide.
  • linkers can include ester linkages formed by the reaction of PEG carboxylic acids or activated PEG carboxylic acids with alcohol groups on an immune-stimulatory compound, wherein such ester groups can hydrolyze under physiological conditions to release the immune-stimulatory compound.
  • Hydrolytically degradable linkages can include, but are not limited to, carbonate linkages; imine linkages resulting from reaction of an amine and an aldehyde; phosphate ester linkages formed by reacting an alcohol with a phosphate group; acetal linkages that are the reaction product of an aldehyde and an alcohol; orthoester linkages that are the reaction product of a formate and an alcohol; and oligonucleotide linkages formed by a phosphoramidite group, including but not limited to, at the end of a polymer, and a 5' hydroxyl group of an oligonucleotide.
  • a linker can contain an enzymatically cleavable peptide moiety, for example, a linker comprising structural formula (IVa), (IVb), (IVc), or (IVd):
  • peptide represents a peptide (illustrated N ⁇ C, wherein peptide includes the amino and carboxy“termini”) a cleavable by a lysosomal enzyme
  • T represents a polymer comprising one or more ethylene glycol units or an alkylene chain, or combinations thereof
  • R a is selected from hydrogen, alkyl, sulfonate and methyl sulfonate
  • R y is hydrogen or C 1-4 alkyl-(O) r -(C 1-4 alkylene) s -G 1 or C 1-4 alkyl-(N)-[(C 1-4 alkylene)-G 1 ] 2
  • R z is C 1-4 alkyl-(O) r - (C 1-4 alkylene) s -G 2
  • G 1 is SO 3 H, CO 2 H, PEG 4-32, or sugar moiety
  • G 2 is SO 3 H, CO 2 H, or PEG 4-32 moiety
  • r is
  • the peptide can be selected from a tripeptide or a dipeptide.
  • the dipeptide can be selected from: Val-Cit; Cit-Val; Ala-Ala; Ala-Cit; Cit-Ala; Asn-Cit; Cit-Asn; Cit-Cit; Val-Glu; Glu-Val; Ser-Cit; Cit-Ser; Lys-Cit; Cit-Lys; Asp-Cit; Cit-Asp; Ala-Val; Val-Ala; Phe-Lys; Lys-Phe; Val-Lys; Lys-Val; Ala-Lys; Lys-Ala; Phe-Cit; Cit-Phe; Leu- Cit; Cit-Leu; Ile-Cit; Cit-Ile; Phe-Arg; Arg-Phe; Cit-Trp; and Trp-Cit, or salts thereof.
  • linkers according to structural formula (IVa) that can be included in the antibody construct immune-stimulatory compound conjugates described herein can include the linkers illustrated below (as illustrated, the linkers include a group suitable for
  • linkers according to structural formula (IVb), (IVc), or (IVd) that can be included in the antibody construct immune-stimulatory compound conjugates described herein can include the linkers illustrated below (as illustrated, the linkers can include a group suitable for covalently linking the linker to an antibody construct):
  • the linker can contain an enzymatically cleavable sugar moiety, for example, a linker comprising structural formula (Va), (Vb), (Vc), (Vd), or (Ve):
  • linkers according to structural formula (Va) that can be included in the antibody construct immune-stimulatory compound conjugates described herein can include the linkers illustrated below (as illustrated, the linkers include a group suitable for covalently linking the linker to an antibody construct):
  • linkers according to structural formula (Vb) that may be included in the antibody construct immune-stimulatory compound conjugates described herein include the linkers illustrated below (as illustrated, the linkers include a group suitable for covalently linking the linker to an antibody construct):
  • linkers according to structural formula (Vc) that may be included in the antibody construct immune-stimulatory compound conjugates described herein include the linkers illustrated below (as illustrated, the linkers include a group suitable for covalently linking the linker to an antibody construct):
  • linkers according to structural formula (Vd) that may be included in the antibody construct immune-stimulatory compound conjugates described herein include the linkers illustrated below (as illustrated, the linkers include a group suitable for covalently linking the linker to an antibody construct):
  • linkers according to structural formula (Ve) that may be included in the antibody construct immune-stimulatory compound conjugates described herein include the linkers illustrated below (as illustrated, the linkers include a group suitable for covalently linking the linker to an antibody construct):
  • cleavable linkers can provide certain advantages, the linkers comprising the conjugate described herein need not be cleavable.
  • the immune- stimulatory compound release may not depend on the differential properties between the plasma and some cytoplasmic compartments.
  • the release of the immune-stimulatory compound can occur after internalization of the antibody construct immune-stimulatory compound conjugate via antigen-mediated endocytosis and delivery to lysosomal compartment, where the antibody construct can be degraded to the level of amino acids through intracellular proteolytic degradation. This process can release a immune-stimulatory compound derivative, which is formed by the immune-stimulatory compound, the linker, and the amino acid residue to which the linker was covalently attached.
  • the immune-stimulatory compound derivative from antibody construct immune-stimulatory compound conjugates with non-cleavable linkers can be more hydrophilic and less membrane permeable, which can lead to less bystander effects and less nonspecific toxicities compared to antibody construct immune-stimulatory compound conjugates with a cleavable linker.
  • Antibody construct immune-stimulatory compound conjugates with non- cleavable linkers can have greater stability in circulation than antibody construct immune- stimulatory compound conjugates with cleavable linkers.
  • Non-cleavable linkers can be alkylene chains, or can be polymeric, such as, for example, based upon polyalkylene glycol polymers, amide polymers, or can include segments of alkylene chains, polyalkylene glycols and/or amide polymers.
  • the linker can contain a polyethylene glycol segment having from 1 to 6 ethylene glycol units.
  • the linker can be non-cleavable in vivo, for example, a linker according to the
  • R a is selected from hydrogen, alkyl, sulfonate and methyl sulfonate
  • R x is a moiety including a functional group capable of covalently linking the linker to an antibody construct; and represents the point of attachment of the linker to the immune-stimulatory compound.
  • linkers according to structural formula (VIa)-(VId) that may be included in the conjugates described herein include the linkers illustrated below (as illustrated, the linkers include a group suitable for covalently linking the linker to an antibody construct, and represents the point of attachment to an immune-stimulatory compound):
  • Attachment groups that are used to attach the linkers to an antibody can be electrophilic in nature and include, for example, maleimide groups, activated disulfides, active esters such as NHS esters and HOBt esters, haloformates, acid halides, alkyl, and benzyl halides such as haloacetamides.
  • maleimide groups activated disulfides
  • active esters such as NHS esters and HOBt esters
  • haloformates acid halides
  • alkyl alkyl
  • benzyl halides such as haloacetamides
  • a method for bridging a pair of sulfhydryl groups derived from reduction of a native hinge disulfide bond has been disclosed and is depicted in the schematic below.
  • An advantage of this methodology is the ability to synthesize homogenous DAR4 antibody construct immune- stimulatory compound conjugates by full reduction of IgGs (to give 4 pairs of sulfhydryls) followed by reaction with 4 equivalents of the alkylating agent.
  • Antibody construct immune- stimulatory compound conjugates containing "bridged disulfides” are also claimed to have increased stability.
  • the attachment moiety can contain the following structural formulas (VIIa), (VIIb), or (VIIc):
  • R q is H or–O-(CH 2 CH 2 O) 11 -CH 3 ; x is 0 or 1; y is 0 or 1; G 2 is–
  • R w is–O-CH2CH2SO3H or–NH(CO)- CH 2 CH 2 O-(CH 2 CH 2 O) 12 -CH 3 ; and * represents the point of attachment to the remainder of the linker.
  • linkers according to structural formula (VIIa) and (VIIb) that can be included in the antibody construct immune-stimulatory compound conjugates described herein can include the linkers illustrated below (as illustrated, the linkers can include a group suitable for covalently linking the linker to an antibody construct):
  • linkers according to structural formula (VIIc) that can be included in the antibody construct immune-stimulatory compound conjugates described herein can include the linkers illustrated below (as illustrated, the linkers can include a group suitable for covalently linking the linker to an antibody construct):
  • a composition as described herein can be a conjugate.
  • a conjugate can comprise an antibody construct, an immune-stimulatory compound, and a linker.
  • a conjugate can comprise an antibody construct, a pattern recognition receptor (PRR) agonist, and a linker.
  • a conjugate can comprise an antibody construct, a pattern-associated molecular pattern (PAMP) molecule, and a linker.
  • a conjugate can comprise an antibody construct, a damage-associated molecular pattern (DAMP) molecule, and a linker.
  • a conjugate can comprise an antibody construct, a STING agonist, and a linker.
  • a conjugate can comprise an antibody construct, a toll-like receptor agonist molecule, and a linker.
  • a conjugate can comprise an antibody construct, imiquimod, and a linker.
  • a conjugate can comprise an antibody construct, S-27609, and a linker.
  • a conjugate can comprise an antibody construct, CL307, and a linker.
  • a conjugate can comprise an antibody construct, resiquimod, and a linker.
  • a conjugate can comprise an antibody construct,
  • a conjugate can comprise an antibody construct, UC-IV150, and a linker.
  • a conjugate can comprise an antibody construct, KU34B, and a linker.
  • a conjugate can comprise an antibody construct, motolimod, and a linker.
  • a conjugate can comprise an antibody construct, VTX-1463, and a linker.
  • a conjugate can comprise an antibody construct, GS-9620, and a linker.
  • a conjugate can comprise an antibody construct, GSK2245035, and a linker.
  • a conjugate can comprise an antibody construct, TMX-101, and a linker.
  • a conjugate can comprise an antibody construct, TMX-201, and a linker.
  • a conjugate can comprise an antibody construct, TMX-202, and a linker.
  • a conjugate can comprise an antibody construct, isatoribine, and a linker.
  • a conjugate can comprise an antibody construct, AZD8848, and a linker.
  • a conjugate can comprise an antibody construct, MEDI9197, and a linker.
  • a conjugate can comprise an antibody construct, 3M-051, and a linker.
  • a conjugate can comprise an antibody construct, 3M-852, and a linker.
  • a conjugate can comprise an antibody construct, 3M-052, and a linker.
  • a conjugate can comprise an antibody construct, 3M-854A, and a linker.
  • a conjugate can comprise an antibody construct, S-34240, and a linker.
  • a conjugate can comprise an antibody construct, CL663, and a linker.
  • a conjugate can comprise an antibody construct, KIN1148, and a linker.
  • a conjugate can comprise an antibody construct, SB-9200, and a linker.
  • a conjugate can comprise an antibody construct, KIN-100, and a linker.
  • a conjugate can comprise an antibody construct, ADU-S100, and a linker.
  • a conjugate can comprise an antibody construct, KU34B, and a linker.
  • An antibody construct of any of the conjugates described herein can have a modified Fc domain of the antibody construct.
  • the modified Fc domain can comprise a substitution at more than one amino acid residue such as at 5 different amino acid residues including
  • S239D/I332E or as at 3 different amino acid residues including S298A/E333A/K334A.
  • the numbering of amino acids residues described herein can be according to the EU index as in Kabat.
  • a conjugate can comprise an antibody construct, a targeting binding domain, an immune- stimulatory compound, and a linker.
  • a conjugate can comprise an antibody construct, a targeting binding domain, a pattern recognition receptor (PRR) agonist, and a linker.
  • a conjugate can comprise an antibody construct, a targeting binding domain, a pattern-associated molecular pattern (PAMP) molecule, and a linker.
  • a conjugate can comprise an antibody construct, a targeting binding domain, a damage-associated molecular pattern (DAMP) molecule, and a linker.
  • a conjugate can comprise an antibody construct, a targeting binding domain, a STING agonist, and a linker.
  • a conjugate can comprise an antibody construct, a targeting binding domain, a toll-like receptor agonist molecule, and a linker.
  • a conjugate can comprise an antibody construct, a targeting binding domain, imiquimod, and a linker.
  • a conjugate can comprise an antibody construct, a targeting binding domain, S-27609, and a linker.
  • a conjugate can comprise an antibody construct, a targeting binding domain, CL307, and a linker.
  • a conjugate can comprise an antibody construct, a targeting binding domain, resiquimod, and a linker.
  • a conjugate can comprise an antibody construct, a targeting binding domain, gardiquimod, and a linker.
  • a conjugate can comprise an antibody construct, a targeting binding domain, UC-IV150, and a linker.
  • a conjugate can comprise an antibody construct, a targeting binding domain, motolimod, and a linker.
  • a conjugate can comprise an antibody construct, a targeting binding domain, VTX-1463, and a linker.
  • a conjugate can comprise an antibody construct, a targeting binding domain, GS-9620, and a linker.
  • a conjugate can comprise an antibody construct, a targeting binding domain, GSK2245035, and a linker.
  • a conjugate can comprise an antibody construct, a targeting binding domain, TMX-101, and a linker.
  • a conjugate can comprise an antibody construct, a targeting binding domain, TMX-201, and a linker.
  • a conjugate can comprise an antibody construct, a targeting binding domain, TMX-202, and a linker.
  • a conjugate can comprise an antibody construct, a targeting binding domain, isatoribine, and a linker.
  • a conjugate can comprise an antibody construct, a targeting binding domain, AZD8848, and a linker.
  • a conjugate can comprise an antibody construct, a targeting binding domain, MEDI9197, and a linker.
  • a conjugate can comprise an antibody construct, a targeting binding domain, 3M- 051, and a linker.
  • a conjugate can comprise an antibody construct, a targeting binding domain, 3M-852, and a linker.
  • a conjugate can comprise an antibody construct, a targeting binding domain, 3M-052, and a linker.
  • a conjugate can comprise an antibody construct, a targeting binding domain, 3M-854A, and a linker.
  • a conjugate can comprise an antibody construct, a targeting binding domain, S-34240, and a linker.
  • a conjugate can comprise an antibody construct, a targeting binding domain, CL663, and a linker.
  • a conjugate can comprise an antibody construct, a targeting binding domain, KIN1148, and a linker.
  • a conjugate can comprise an antibody construct, a targeting binding domain, SB-9200, and a linker.
  • a conjugate can comprise an antibody construct, a targeting binding domain, KIN-100, and a linker.
  • a conjugate can comprise an antibody construct, a targeting binding domain, ADU-S100, and a linker.
  • a conjugate can comprise an antibody construct, a targeting binding domain, KU34B, and a linker.
  • An antibody construct of any of the conjugates described herein can have a modified Fc domain of the antibody construct.
  • the modified Fc domain can comprise a substitution at more than one amino acid residue such as at 5 different amino acid residues including
  • the linker can be a linker as described herein.
  • a linker can be cleavable, non-cleavable, hydrophilic, or hydrophobic.
  • a cleavable linker can be sensitive to enzymes.
  • a cleavable linker can be cleaved by enzymes such as proteases.
  • a cleavable linker can be a valine-citrulline or a valine-alanine linker.
  • a valine-citrulline or valine-alanine linker can contain a pentafluorophenyl group.
  • a valine-citrulline or valine-alanine linker can contain a succimide group.
  • a valine- citrulline or valine-alanine linker can contain a PABA group.
  • a valine-citrulline or valine-alanine linker can contain a PABA group and a pentafluorophenyl group.
  • a valine-citrulline or valine- alanine linker can contain a PABA group and a succinimide group.
  • a non-cleavable linker can be protease insensitive.
  • a non-cleavable linker can be maleimidocaproyl linker.
  • maleimidocaproyl linker can comprise N-maleimidomethylcyclohexane-1-carboxylate.
  • a maleimidocaproyl linker can contain a succinimide group.
  • a maleimidocaproyl linker can contain pentafluorophenyl group.
  • a linker can be a combination of a maleimidocaproyl group and one or more polyethylene glycol molecules.
  • a linker can be a maleimide-PEG4 linker.
  • a linker can be a combination of a maleimidocaproyl linker containing a succinimide group and one or more polyethylene glycol molecules.
  • a linker can be a combination of a
  • maleimidocaproyl linker containing a pentafluorophenyl group and one or more polyethylene glycol molecules.
  • a linker can contain maleimides linked to polyethylene glycol molecules in which the polyethylene glycol can allow for more linker flexibility or can be used lengthen the linker.
  • a linker can be a (maleimidocaproyl)-(valine-citrulline)-(para-aminobenzyloxycarbonly)- (NH2) linker.
  • a linker can be a THIOMAB linker.
  • a THIOMAB linker can be a
  • a linker can also be an alkylene, alkenylene, alkynylene, polyether, polyester, polyamide, polyamino acids, polypeptides, cleavable peptides, or aminobenzylcarbamates.
  • a linker can contain a maleimide at one end and an N-hydroxysuccinimidyl ester at the other end.
  • a linker can contain a lysine with an N-terminal amine acetylated, and a valine-citrulline cleavage site.
  • a linker can be a link created by a microbial transglutaminase, wherein the link is created between an amine- containing moiety and a moiety engineered to contain glutamine as a result of the enzyme catalyzing a bond formation between the acyl group of a glutamine side chain and the primary amine of a lysine chain.
  • a linker can contain a reactive primary amine.
  • a linker can be a Sortase A linker.
  • a Sortase A linker can be created by a Sortase A enzyme fusing an LXPTG (SEQ ID NO: 21) recognition motif to an N-terminal GGG motif to regenerate a native amide bond.
  • the linker created can therefore link a moiety attached to the LXPTG (SEQ ID NO: 21) recognition motif with a moiety attached to the N-terminal GGG motif.
  • a linker can be a link created between an unnatural amino acid on one moiety reacting with oxime bond that was formed by modifying a ketone group with an alkoxyamine on another moiety.
  • a moiety can be an antibody construct.
  • a moiety can be a targeting binding domain.
  • a moiety can be an antibody.
  • a moiety can be an immune-stimulatory compound.
  • the antibody construct can be as described herein.
  • the antibody construct can be an anti- tumor antigen antibody construct.
  • the antibody construct can be an anti-tumor antigen antibody.
  • An antigen recognized by the antibody construct can be CD5, CD19, CD20, CD25, CD37, CD30, CD33, CD45, CAMPATH-1, BCMA, CS-1, PD-L1, B7-H3, B7-DC,HLD-DR, carcinoembryonic antigen, TAG-72, EpCAM, MUC1, folate-binding protein, A33, G250, prostate-specific membrane antigen, ferritin, GD2, GD3, GM2, Le y , CA-125, CA19-9, epidermal growth factor, p185HER2, IL-2 receptor, de2-7 EGFR, fibroblast activation protein, tenascin,
  • metalloproteinases endosialin, vascular endothelial growth factor, avB3, WT1, LMP2, HPV E6 E7, EGFRvIII, Her-2/neu, idiotype, MAGE A3, p53 nonmutant, NY-ESO-1, PMSA, GD2, CEA, MelanA/MART1, Ras mutant, gp100, p53 mutant, PR1, bcr-abl, tyronsinase, survivin, PSA, hTERT, Sarcoma translocation breakpoints, EphA2, PAP, ML-IAP, AFP, ERG, NA17, PAX3, ALK, androgen receptor, cyclin B1, polysialic acid, MYCN, RhoC, TRP-2, fucosyl GM1, mesothelin, PSCA, MAGE A1, sLe(animal), CYP1B1, PLAV1, GM3, BORIS, Tn, GloboH, ETV6-AML
  • the antibody construct can recognize an antigen that can be expressed on a cell.
  • the antibody construct can recognize an antigen that can be expressed by a cell.
  • the antibody construct can recognize an antigen that can be expressed in the context of a Major Histocompatibility Complex.
  • the antibody construct can recognize an antigen that can stimulate activity of a cell.
  • the antibody construct can recognize an antigen that can stimulate an immune response.
  • the antibody construct can recognize an antigen that can reduce an immune response.
  • the antibody construct can recognize an antigen can reduce activity of a cell.
  • the antibody construct can recognize an antigen that can be expressed on an immune cell.
  • the antibody construct can recognize an antigen that can be expressed by an immune cell.
  • the antibody construct can recognize an antigen that can be in the context of a Major Histocompatibility Complex.
  • the antibody construct can recognize an antigen that can stimulate activity of a cell.
  • the antibody construct can recognize an antigen that can stimulate an immune response.
  • the antibody construct can recognize an antigen that can reduce an immune response.
  • the antibody construct can recognize an antigen on a cell wherein the antigen can be involved in stimulating activity of a cell.
  • the antibody construct can recognize an antigen on an immune cell that can be involved in the costimulation of an immune cell.
  • the antibody construct can recognize an antigen on an immune cell that can be involved in the costimulation of an immune cell during an immune response.
  • the antibody construct can recognize a receptor.
  • the antibody construct can recognize a receptor on a cell.
  • the antibody construct can recognize a receptor ligand.
  • the antibody construct can recognize a receptor on a cell wherein the receptor can be involved in stimulating activity of a cell.
  • the antibody construct can recognize a receptor on an immune cell.
  • the antibody construct can recognize a receptor on an immune cell that can be involved in stimulating activity of an immune cell.
  • the antibody construct can recognize a receptor on an immune cell that can be involved in the costimulation of an immune cell.
  • the antibody construct can recognize a receptor on an immune cell that can be involved in the costimulation of an immune cell during an immune response.
  • the antibody construct can recognize an antigen that can be expressed on an immune cell and that can stimulate activity of an immune cell.
  • the antibody construct can recognize an antigen that can be expressed on an immune that can reduce activity of an immune cell.
  • the antibody construct can be an anti-CD40 antibody.
  • the antibody construct can comprise a light chain of an SBT-040 antibody.
  • the antibody construct can comprise an SBT-040-G1WT heavy chain.
  • the antibody construct can comprise an SBT-040-G1VLPLL heavy chain.
  • the antibody construct can comprise an SBT-040-G1DE heavy chain.
  • the antibody construct can comprise an SBT-040- G1AAA heavy chain.
  • the antibody construct can comprise an SBT-040-CDR sequence.
  • the antibody construct can be capable of recognizing a single antigen.
  • the antibody construct can be capable of recognizing two or more antigens.
  • the K d for binding of an antigen-binding domain of an antibody construct immune-stimulatory compound conjugate to an antigen in the presence of an immune-stimulatory compound can be about 2 times, about 3 times, about 4 times, about 5 times, about 6 times, about 7 times, about 8 times, about 9 times, about 10 times, about 15 times, about 20 times, about 25 times, about 30 times, about 35 times, about 40 times, about 45 times, about 50 times, about 60 times, about 70 times, about 80 times, about 90 times, about 100 times, about 110 times, or about 120 times greater than the K d for binding of the antigen binding domain to the antigen of an antibody construct in the absence of the immune-stimulatory compound.
  • the K d for binding of an antigen-binding domain of an antibody construct immune- stimulatory compound conjugate to an antigen in the presence of the immune-stimulatory compound can be less than 10 nM.
  • the K d for binding of an antigen-binding domain of an antibody construct immune-stimulatory compound conjugate to an antigen in the presence of the immune-stimulatory compound can be less than 100 nM, less than 50 nM, less than 20 nM, less than 5 nM, less than 1 nM, or less than 0.1 nM.
  • An antibody construct can further comprise a targeting binding domain.
  • a targeting binding domain of an antibody construct can recognize an antigen.
  • an antigen can be expressed on an immune cell.
  • an antigen can be expressed by a tumor or cancer cell.
  • An antigen can be a peptide or fragment thereof.
  • An antigen can be expressed on an antigen-presenting cell.
  • An antigen can be expressed on a dendritic cell, a macrophage, or a B cell.
  • An antigen can be CD40 and a targeting binding domain can recognize a CD40 antigen.
  • An antigen can be a tumor antigen and a targeting binding domain can recognize a tumor antigen.
  • a targeting binding domain of an antibody construct can be a CD40 agonist.
  • a targeting binding domain of an antibody construct can bind to a tumor antigen.
  • the antibody construct can have an Fc domain that can bind to an FcR when linked to an immune-stimulatory compound.
  • the antibody construct can have an Fc domain that can bind to an FcR to initiate FcR-mediated signaling when linked to an immune stimulatory compound.
  • the antibody construct can bind to its antigen when linked to an immune-stimulatory compound.
  • the antibody construct can bind to its antigen when linked to an immune-stimulatory compound and the Fc domain of the antibody construct can bind to an FcR when linked to an immune- stimulatory compound.
  • the antibody construct can bind to its antigen when linked to an immune- stimulatory compound and the Fc domain of the antibody can bind to an FcR to initiate FcR- mediated signaling when linked to an immune stimulatory compound.
  • the Fc domain linked to an immune-stimulatory compound can be a modified Fc domain.
  • the modified Fc domain can comprise a substitution at more than one amino acid residue such as at 5 different amino acid residues including L235V/F243L/R292P/Y300L/P396L, as at 2 different amino acid residues including S239D/I332E, or as at 3 different amino acid residues including
  • the K d for binding of an Fc domain to a Fc receptor when the Fc domain is linked to an immune-stimulatory compound can be about 2 times, about 3 times, about 4 times, about 5 times, about 6 times, about 7 times, about 8 times, about 9 times, about 10 times, about 15 times, about 20 times, about 25 times, about 30 times, about 35 times, about 40 times, about 45 times, about 50 times, about 60 times, about 70 times, about 80 times, about 90 times, about 100 times, about 110 times, or about 120 times greater than the K d for binding of the Fc domain to the Fc receptor in the absence of the immune-stimulatory compound.
  • the K d for binding of an Fc domain to an Fc receptor when linked to an immune-stimulatory compound can be less than 10 nM.
  • the K d for binding of an Fc domain to an Fc receptor when linked to an immune- stimulatory compound can be less than 100 nM, less than 50 nM, less than 20 nM, less than 5 nM, less than 1 nM, or less than 0.1 nM.
  • the PRR agonist can be a toll-like receptor agonist.
  • the toll-like receptor agonist can be a TLR1 agonist, a TLR2 agonist, a TLR3 agonist, a TLR4 agonist, a TLR5 agonist, a TLR6 agonist, a TLR7 agonist, a TLR8 agonist, a TLR9 agonist, a TLR10 agonist, a TLR11 agonist, a TLR12 agonist or a TLR13 agonist.
  • the toll-like receptor agonist can activate two or more TLRs.
  • the PAMP molecule can be a RIG-I agonist.
  • a conjugate can be formed by a linker that can connect an antibody construct to a PRR.
  • a conjugate can be formed by a linker that can connect an antibody construct to a PAMP molecule.
  • a conjugate can be formed by a linker that can connect an antibody construct and a DAMP molecule.
  • a conjugate can be formed by a linker that can connect an antibody construct to a PRR, and a linker that can connect an antibody construct and a targeting binding domain.
  • a conjugate can be formed by a linker that can connect an antibody construct to a PAMP molecule, and a linker that can connect an antibody construct and a targeting binding domain.
  • a conjugate can be formed by a linker that can connect an antibody construct and a DAMP molecule, and a linker that can connect an antibody construct and a targeting binding domain.
  • a linker can be connected to an antibody construct by a direct linkage between the antibody construct and the linker.
  • a linker can be connected to an anti-CD40 antibody construct by a direct linkage between the anti-CD40 antibody construct and the linker.
  • a linker can be connected to an anti-CD40 antibody by a direct linkage between the anti-CD40 antibody and the linker.
  • a linker can be connected to an anti-tumor antigen antibody construct by a direct linkage between the anti-tumor antigen antibody construct and the linker.
  • a linker can be connected to an anti-tumor antigen antibody by a direct linkage between the anti-tumor antigen antibody and the linker.
  • a direct linkage can be a covalent bond.
  • a linker can be attached to a terminus of an amino acid sequence of an antibody construct, or could be attached to a side chain modification to the antibody construct, such as the side chain of a lysine, serine, threonine, cysteine, tyrosine, aspartic acid, a non-natural amino acid residue, or glutamic acid residue.
  • An attachment can be via any of a number of bonds, for example but not limited to, an amide bond, an ester bond, an ether bond, a carbon-nitrogen bond, a carbon-carbon single double or triple bond, a disulfide bond, or a thioether bond.
  • a linker can have at least one functional group, which can be linked to the antibody.
  • Non-limiting examples of the functional groups can include those which form an amide bond, an ester bond, an ether bond, a carbonate bond, a carbamate bond, or a thioether bond, such functional groups can be, for example, amino groups; carboxyl groups; aldehyde groups; azide groups; alkyne and alkene groups; ketones; carbonates; carbonyl functionalities bonded to leaving groups such as cyano and succinimidyl and hydroxyl groups.
  • a linker can be connected to an antibody construct at a hinge cysteine.
  • a linker can be connected to an antibody construct at a light chain constant domain lysine.
  • a linker can be connected to an antibody construct at an engineered cysteine in the light chain.
  • a linker can be connected to an antibody construct at an engineered light chain glutamine.
  • a linker can be connected to an antibody construct at an unnatural amino acid engineered into the light chain.
  • a linker can be connected to antibody construct at an unnatural amino acid engineered into the heavy chain.
  • Amino acids can be engineered into an amino acid sequence of a composition as described herein, for example, a linker of a conjugate.
  • Engineered amino acids can be added to a sequence of existing amino acids.
  • Engineered amino acids can be substituted for one or more existing amino acids of a sequence of amino acids.
  • a linker can be conjugated to antibody construct via a sulfhydryl group.
  • a linker can be conjugated to an antibody construct via a primary amine.
  • a linker can be a link created between an unnatural amino acid on an antibody construct reacting with oxime bond that was formed by modifying a ketone group with an alkoxyamine on an immune-stimulatory compound.
  • an Fc domain of the antibody construct can bind to Fc receptors.
  • the antigen binding domain of the antibody construct can bind its antigen.
  • a targeting binding domain of said antibody construct can bind its antigen.
  • An antibody with engineered reactive cysteine residues can be used to link a targeting binding domain to the antibody.
  • a linker can connect an antibody construct to a targeting binding domain via Sortase A linker.
  • a Sortase A linker can be created by a Sortase A enzyme fusing an LXPTG (SEQ ID NO: 21) recognition motif to an N-terminal GGG motif to regenerate a native amide bond. The linker created can therefore link an antibody construct attached to the LXPTG (SEQ ID NO: 21) recognition motif with a targeting binding domain attached to the N-terminal GGG motif.
  • a targeting binding domain can be connected to a linker by a direct linkage.
  • a direct linkage can be a covalent bond.
  • a linker can be attached to a terminus of an amino acid sequence of a targeting binding domain, or could be attached to a side chain modification to the targeting binding domain, such as the side chain of a lysine, serine, threonine, cysteine, tyrosine, aspartic acid, a non-natural amino acid residue, or glutamic acid residue.
  • An attachment can be via any of a number of bonds, for example but not limited to, an amide bond, an ester bond, an ether bond, a carbon-nitrogen bond, a carbon-carbon single double or triple bond, a disulfide bond, or a thioether bond.
  • a linker can have at least one functional group, which can be linked to the targeting binding domain.
  • Non-limiting examples of the functional groups can include those which form an amide bond, an ester bond, an ether bond, a carbonate bond, a carbamate bond, or a thioether bond, such functional groups can be, for example, amino groups; carboxyl groups; aldehyde groups; azide groups; alkyne and alkene groups; ketones; carbonates; carbonyl functionalities bonded to leaving groups such as cyano and succinimidyl and hydroxyl groups.
  • Amino acids can be engineered into an amino acid sequence of the targeting binding domain.
  • Engineered amino acids can be added to a sequence of existing amino acids.
  • Engineered amino acids can be substituted for one or more existing amino acids of a sequence of amino acids.
  • a linker can be conjugated to a targeting binding domain via a sulfhydryl group.
  • a linker can be conjugated to a targeting binding domain via a primary amine.
  • a targeting binding domain can be conjugated to the C-terminal of an Fc domain of an antibody construct.
  • An antibody with engineered reactive cysteine residues can be used to link an immune-stimulatory compound to the antibody.
  • a linker can connect an antibody construct to an immune-stimulatory compound via THIOMAB linker.
  • a linker can connect an antibody construct to an immune-stimulatory compound via Sortase A linker.
  • a Sortase A linker can be created by a Sortase A enzyme fusing an LXPTG (SEQ ID NO: 21) recognition motifto an N- terminal GGG motif to regenerate a native amide bond.
  • the linker created can therefore link an antibody construct attached the LXPTG (SEQ ID NO: 21) recognition motif with an immune- stimulatory compound attached to the N-terminal GGG motif.
  • a linker can be a link created between an unnatural amino acid on an antibody construct reacting with oxime bond that was formed by modifying a ketone group with an alkoxyamine on an immune-stimulatory compound.
  • the immune-stimulatory compound can comprise one or more rings selected from carbocyclic and heterocyclic rings.
  • the immune-stimulatory compound can be covalently bound to a linker by a bond to an exocyclic carbon or nitrogen atom on said immune-stimulatory compound.
  • a linker can be conjugated to an immune-stimulatory compound via an exocyclic nitrogen or carbon atom of an immune-stimulatory compound.
  • a linker can be connected to a STING a onist for exam le:
  • a linker agonist complex can dissociate under physiological conditions to yield an active agonist.
  • a linker can be connected to a PRR agonist by a direct linkage between the PRR agonist and the linker.
  • a linker can be connected to a PAMP molecule by a direct linkage between the PAMP molecule and the linker.
  • a linker can be connected to a toll-like receptor agonist by a direct linkage between the toll-like receptor agonist and the linker.
  • Examples of toll-like receptor agonists connected to a linker in a manner able to release an active toll-like receptor agonist under physiologic condition can include:
  • RIG-I agonists connected to a linker in a manner able to release an active toll-like receptor agonist under physiologic conditions can include:
  • a linker can be connected to a DAMP molecule by a direct linkage between the DAMP molecule and the linker.
  • a direct linkage can be a covalent bond.
  • a linker can be attached to a terminus of an amino acid sequence of an antibody, or could be attached to a side chain modification to the antibody, such as the side chain of a lysine, serine, threonine, cysteine, tyrosine, aspartic acid, a non-natural amino acid residue, or glutamic acid residue.
  • An attachment can be via any of a number of bonds, for example but not limited to, an amide bond, an ester bond, an ether bond, a carbon-nitrogen bond, a carbon-carbon single double or triple bond, a disulfide bond, or a thioether bond.
  • a linker can have at least one functional group, which can be linked to the antibody construct.
  • Non-limiting examples of the functional groups can include those which form an amide bond, an ester bond, an ether bond, a carbonate bond, a carbamate bond, or a thioether bond, such functional groups can be, for example, amino groups; carboxyl groups; aldehyde groups; azide groups; alkyne and alkene groups; ketones; carbonates; carbonyl functionalities bonded to leaving groups such as cyano and succinimidyl and hydroxyl groups.
  • An ATAC can be formed by conjugating a noncleavable maleimide-PEG4 linker containing a succinimide group with an immune-stimulatory compound.
  • an ATAC can be N-((4-amino-1-(2-hydroxy-2-methylpropyl)-1H-imidazo[4,5-c]quinolin-2-yl)methyl)-1- (3-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)propanamido)-N-ethyl-3,6,9,12-tetraoxapentadecan- 15-amide (ATAC11); N-(5-(2-amino-3-pentylquinolin-5-yl)pentyl)-1-(3-(2,5-dioxo-2,5-dihydro- 1H-pyrrol-1-yl)propanamido)-3,6,9,12-tetraoxapentadecan-15
  • An ATAC can be formed by conjugating a cleavable valine-alanine or valine-citrulline linker containing a PABA group and a succinimide group with an immune-stimulatory compound.
  • an ATAC can be 4-((S)-2-((S)-2-(6-(2,5-dioxo-2,5-dihydro-1H-pyrrol- 1-yl)hexanamido)-3-methylbutanamido)propanamido)benzyl ((4-amino-1-(2-hydroxy-2-methyl- propyl)-1H-imidazo[4,5-c]quinolin-2-yl)methyl)(ethyl)carbamate (ATAC22); 4-((S)-2-((S)-2-(6- (2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)hexanamido)-3-methyl-butanamido)propanamid
  • An ATAC can be formed by conjugating a noncleavable maleimide-PEG4 linker containing an activated ester such as a pentafluorophenyl group or an N-hydroxysuccinimide group with an immune-stimulatory compound.
  • an ATAC can be pentafluorophenyl 25-(2-amino-3-pentylquinolin-5-yl)-19-oxo-4,7,10,13,16-pentaoxa-20-azapentacosanoate (ATAC1); perfluorophenyl 3-((4-amino-1-(2-hydroxy-2-methylpropyl)-1H-imidazo[4,5- c]quinolin-2-yl)methyl)-4-oxo-7,10,13,16,19-pentaoxa-3-azadocosan-22-oate (ATAC2);
  • pentafluorophenyl 25-(2-amino-3-pentylquinolin-5-yl)-19-oxo-4,7,10,13,16-pentaoxa-20- azapentacosanoate (ATAC3); or 2,5-Dioxopyrrolidin-1-yl 3-((4-amino-1-(2-hydroxy-2- methylpropyl)-1H-imidazo-[4,5-c]quinolin-2-yl)methyl)-4-oxo-7,10,13,16,19-pentaoxa-3- azadocosan-22-oate (ATAC4).
  • An ATAC can be formed by conjugating a cleavable valine-alanine or valine-citrulline linker containing a PABA group and an activated ester such as a pentafluorophenyl group or an N-hydroxysuccinimde group to an immune-stimulatory compo pound.
  • an ATAC can be 2,5-dioxopyrrolidin-1-yl 6-(((S)-1-(((S)-1-((4-((((5-(2-amino-3-pentylquinolin-5- yl)pentyl)carbamoyl)oxy)methyl)phenyl)amino)-1-oxopropan-2-yl)amino)-3-methyl-1-oxobutan- 2-yl)amino)-6-oxohexanoate (ATAC5); 2,5-dioxopyrrolidin-1-yl 7-(((S)-1-(((S)-1-((4-((((((4- amino-1-(2-hydroxy-2-methylpropyl)-1H-imidazo[4,5-c]quinolin-2- yl)methyl)(ethyl)carbamoyl)oxy)methyl)phenyl)amino)-1-oxopropan-2-
  • An antibody construct can comprise an anti-CD40 antibody.
  • An anti-CD40 antibody can comprise two SBT-040-G1WT heavy chains and two light chain from a SBT-040 antibody, which can be referred to as SBT-040-WT or as SBT-040-G1.
  • An anti-CD40 antibody can comprise two SBT-040-G1VLPLL heavy chains and two light chains from a SBT-040 antibody, which can be referred to as SBT-040-VLPLL.
  • An anti-CD40 antibody can comprise two SBT- 040-G1DE heavy chains and two light chains from a SBT-040 antibody, which can be referred to as SBT-040-DE.
  • An anti-CD40 antibody can comprise two SBT-040-G1AAA heavy chains and two light chains from a SBT-040 antibody, which can be referred to as SBT-040-AAA.
  • An anti- CD40 antibody can comprise two IgG2 heavy chains and two light chain from a SBT-040 antibody, which can be referred to as SBT-040-G2.
  • a conjugate can comprise SBT-040-WT-ATAC1.
  • a conjugate can comprise SBT-040- WT-ATAC2.
  • a conjugate can comprise SBT-040-WT-ATAC3.
  • a conjugate can comprise SBT- 040-WT-ATAC4.
  • a conjugate can comprise SBT-040-WT-ATAC5.
  • a conjugate can comprise SBT-040-WT-ATAC6.
  • a conjugate can comprise SBT-040-WT-ATAC7.
  • a conjugate can comprise SBT-040-WT-ATAC8.
  • a conjugate can comprise SBT-040-WT-ATAC9.
  • a conjugate can comprise SBT-040-WT-ATAC10.
  • a conjugate can comprise SBT-040-WT-ATAC11.
  • a conjugate can comprise SBT-040-WT-ATAC12.
  • a conjugate can comprise SBT-040-WT- ATAC13.
  • a conjugate can comprise SBT-040-WT-ATAC14.
  • a conjugate can comprise SBT- 040-WT-ATAC15.
  • a conjugate can comprise SBT-040-WT-ATAC16.
  • a conjugate can comprise SBT-040-WT-ATAC17.
  • a conjugate can comprise SBT-040-WT-ATAC18.
  • a conjugate can comprise SBT-040-WT-ATAC19.
  • a conjugate can comprise SBT-040-WT- ATAC20.
  • a conjugate can comprise SBT-040-WT-ATAC21.
  • a conjugate can comprise SBT- 040-WT-ATAC22.
  • a conjugate can comprise SBT-040-WT-ATAC23.
  • a conjugate can comprise SBT-040-WT-ATAC24.
  • a conjugate can comprise SBT-040-WT-ATAC25.
  • a conjugate can comprise SBT-040-WT-ATAC26.
  • a conjugate can comprise SBT-040-WT- ATAC27.
  • a conjugate can comprise SBT-040-WT-ATAC28.
  • a conjugate can comprise SBT- 040-WT-ATAC29.
  • a conjugate can comprise SBT-040-WT-ATAC30.
  • a conjugate can comprise SBT-040-WT-ATAC31.
  • a conjugate can comprise SBT-040-WT-ATAC32.
  • a conjugate can comprise SBT-040-WT-ATAC33.
  • a conjugate can comprise SBT-040-WT- ATAC34.
  • a conjugate can comprise SBT-040-WT-ATAC43.
  • a conjugate can comprise SBT- 040-VLPLL-ATAC1.
  • a conjugate can comprise SBT-040-VLPLL-ATAC2.
  • a conjugate can comprise SBT-040-VLPLL-ATAC3.
  • a conjugate can comprise SBT-040-VLPLL-ATAC4.
  • a conjugate can comprise SBT-040-VLPLL-ATAC5.
  • a conjugate can comprise SBT-040-VLPLL-ATAC6.
  • a conjugate can comprise SBT-040-VLPLL-ATAC7.
  • a conjugate can comprise SBT- 040-VLPLL-ATAC8.
  • a conjugate can comprise SBT-040-VLPLL-ATAC9.
  • a conjugate can comprise SBT-040-VLPLL-ATAC10.
  • a conjugate can comprise SBT-040-VLPLL-ATAC11.
  • a conjugate can comprise SBT-040-VLPLL-ATAC12.
  • a conjugate can comprise SBT-040- VLPLL-ATAC13.
  • a conjugate can comprise SBT-040-VLPLL-ATAC14.
  • a conjugate can comprise SBT-040-VLPLL-ATAC15.
  • a conjugate can comprise SBT-040-VLPLL-ATAC16.
  • a conjugate can comprise SBT-040-VLPLL-ATAC17.
  • a conjugate can comprise SBT-040- VLPLL-ATAC18.
  • a conjugate can comprise SBT-040-VLPLL-ATAC19.
  • a conjugate can comprise SBT-040-VLPLL-ATAC20.
  • a conjugate can comprise SBT-040-VLPLL-ATAC21.
  • a conjugate can comprise SBT-040-VLPLL-ATAC22.
  • a conjugate can comprise SBT-040- VLPLL-ATAC23.
  • a conjugate can comprise SBT-040-VLPLL-ATAC24.
  • a conjugate can comprise SBT-040-VLPLL-ATAC25.
  • a conjugate can comprise SBT-040-VLPLL-ATAC26.
  • a conjugate can comprise SBT-040-VLPLL-ATAC27.
  • a conjugate can comprise SBT-040- VLPLL-ATAC28.
  • a conjugate can comprise SBT-040-VLPLL-ATAC29.
  • a conjugate can comprise SBT-040-VLPLL-ATAC30.
  • a conjugate can comprise SBT-040-VLPLL-ATAC31.
  • a conjugate can comprise SBT-040-VLPLL-ATAC32.
  • a conjugate can comprise SBT-040- VLPLL-ATAC33.
  • a conjugate can comprise SBT-040-VLPLL-ATAC34.
  • a conjugate can comprise SBT-040-VLPLL-ATAC43.
  • a conjugate can comprise SBT-040-DE-ATAC1.
  • a conjugate can comprise SBT-040-DE-ATAC2.
  • a conjugate can comprise SBT-040-DE-ATAC3.
  • a conjugate can comprise SBT-040-DE-ATAC4.
  • a conjugate can comprise SBT-040-DE- ATAC5.
  • a conjugate can comprise SBT-040-DE-ATAC6.
  • a conjugate can comprise SBT-040- DE-ATAC7.
  • a conjugate can comprise SBT-040-DE-ATAC8.
  • a conjugate can comprise SBT- 040-DE-ATAC9.
  • a conjugate can comprise SBT-040-DE-ATAC10.
  • a conjugate can comprise SBT-040-DE-ATAC11.
  • a conjugate can comprise SBT-040-DE-ATAC12.
  • a conjugate can comprise SBT-040-DE-ATAC13.
  • a conjugate can comprise SBT-040-DE-ATAC14.
  • a conjugate can comprise SBT-040-DE-ATAC15.
  • a conjugate can comprise SBT-040-DE- ATAC16.
  • a conjugate can comprise SBT-040-DE-ATAC17.
  • a conjugate can comprise SBT- 040-DE-ATAC18.
  • a conjugate can comprise SBT-040-DE-ATAC19.
  • a conjugate can comprise SBT-040-DE-ATAC20.
  • a conjugate can comprise SBT-040-DE-ATAC21.
  • a conjugate can comprise SBT-040-DE-ATAC22.
  • a conjugate can comprise SBT-040-DE-ATAC23.
  • a conjugate can comprise SBT-040-DE-ATAC24.
  • a conjugate can comprise SBT-040-DE- ATAC25.
  • a conjugate can comprise SBT-040-DE-ATAC26.
  • a conjugate can comprise SBT- 040-DE-ATAC27.
  • a conjugate can comprise SBT-040-DE-ATAC28.
  • a conjugate can comprise SBT-040-DE-ATAC29.
  • a conjugate can comprise SBT-040-DE-ATAC30.
  • a conjugate can comprise SBT-040-DE-ATAC31.
  • a conjugate can comprise SBT-040-DE-ATAC32.
  • a conjugate can comprise SBT-040-DE-ATAC33.
  • a conjugate can comprise SBT-040-DE- ATAC34.
  • a conjugate can comprise SBT-040-DE-ATAC43.
  • a conjugate can comprise SBT- 040-AAA-ATAC1.
  • a conjugate can comprise SBT-040-AAA-ATAC2.
  • a conjugate can comprise SBT-040-AAA-ATAC3.
  • a conjugate can comprise SBT-040-AAA-ATAC4.
  • a conjugate can comprise SBT-040-AAA-ATAC5.
  • a conjugate can comprise SBT-040-AAA-ATAC7.
  • a conjugate can comprise SBT- 040-AAA-ATAC8.
  • a conjugate can comprise SBT-040-AAA-ATAC9.
  • a conjugate can comprise SBT-040-AAA-ATAC10.
  • a conjugate can comprise SBT-040-AAA-ATAC11.
  • a conjugate can comprise SBT-040-AAA-ATAC12.
  • a conjugate can comprise SBT-040-AAA- ATAC13.
  • a conjugate can comprise SBT-040-AAA-ATAC14.
  • a conjugate can comprise SBT- 040-AAA-ATAC15.
  • a conjugate can comprise SBT-040-AAA-ATAC16.
  • a conjugate can comprise SBT-040- AAA -ATAC17.
  • a conjugate can comprise SBT-040-AAA-ATAC18.
  • a conjugate can comprise SBT-040-AAA-ATAC19.
  • a conjugate can comprise SBT-040-AAA- ATAC20.
  • a conjugate can comprise SBT-040-AAA-ATAC21.
  • a conjugate can comprise SBT- 040-AAA-ATAC22.
  • a conjugate can comprise SBT-040-AAA-ATAC23.
  • a conjugate can comprise SBT-040-AAA-ATAC24.
  • a conjugate can comprise SBT-040-AAA-ATAC25.
  • a conjugate can comprise SBT-040-AAA-ATAC26.
  • a conjugate can comprise SBT-040-AAA- ATAC27.
  • a conjugate can comprise SBT-040-AAA-ATAC28.
  • a conjugate can comprise SBT- 040-AAA-ATAC29.
  • a conjugate can comprise SBT-040-AAA-ATAC30.
  • a conjugate can comprise SBT-040-AAA-ATAC31.
  • a conjugate can comprise SBT-040-AAA-ATAC32.
  • a conjugate can comprise SBT-040-AAA-ATAC33.
  • a conjugate can comprise SBT-040-AAA- ATAC34.
  • a conjugate can comprise SBT-040-AAA-ATAC33.
  • a conjugate can comprise SBT- 040-AAA-ATAC43.
  • the K d for binding of the CD40 binding domain of any of these conjugates to CD40 can be about 2 times, about 3 times, about 4 times, about 5 times, about 6 times, about 7 times, about 8 times, about 9 times, about 10 times, about 15 times, about 20 times, about 25 times, about 30 times, about 35 times, about 40 times, about 45 times, about 50 times, about 60 times, about 70 times, about 80 times, about 90 times, about 100 times, about 110 times, or about 120 times greater than the K d for binding of the CD40 binding domain to CD40 in the absence of the immune-stimulatory compound or ATAC.
  • the Kd for binding of the CD40 binding domain of any of these conjugates to CD40 can be less than 10 nM.
  • the K d for binding of the CD40 binding domain of any of the conjugates to CD40 can be less than 100 nM, less than 50 nM, less than 20 nM, less than 5 nM, less than 1 nM, or less than 0.1 nM.
  • the K d for binding of the Fc domain of any of the conjugates to an Fc receptor can be about 2 times, about 3 times, about 4 times, about 5 times, about 6 times, about 7 times, about 8 times, about 9 times, about 10 times, about 15 times, about 20 times, about 25 times, about 30 times, about 35 times, about 40 times, about 45 times, about 50 times, about 60 times, about 70 times, about 80 times, about 90 times, about 100 times, about 110 times, or about 120 times greater than the K d for binding of the Fc domain to the Fc receptor in the absence of the immune-stimulatory compound or ATAC.
  • the K d for binding of the Fc domain of any of the conjugates to an Fc receptor of an can be less than 10 nM.
  • the K d for binding of the Fc domain of any of the conjugates to an Fc receptor can be less than 100 nM, less than 50 nM, less than 20 nM, less than 5 nM, less than 1 nM, or less than 0.1 nM.
  • an antibody in a conjugate, can be linked to an immune-stimulatory compound in such a way that the antibody can still bind to an antigen and the Fc domain of the antibody can still bind to an FcR.
  • an antibody construct is linked to an immune-stimulatory compound in such a way that the linking does not interfere with ability of the antigen binding domain of the antibody construct to bind to antigen, the ability of the Fc domain of the antibody construct to bind to an FcR, or FcR-mediated signaling resulting from the Fc domain of the antibody construct from binding to an FcR.
  • an immune-stimulatory compound in a conjugate, can be linked to an antibody construct in such a way the linking does not interfere with the ability of the immune-stimulatory compound to bind to its receptor.
  • a conjugate can produce stronger immune stimulation and a greater therapeutic window than components of the conjugate alone.
  • the combination of CD40 agonism, TLR agonism, and an accessible Fc domain of the anti-CD40 antibody to allow FcR-mediated signaling can produce stronger immune stimulation and a greater therapeutic window than the CD40 agonism, TLR agonism, or the FcR-mediated signaling alone.
  • ATAC compound can be synthesized by various methods.
  • ATAC compounds such as ATAC1– ATAC4, can be synthesized as shown in Scheme B1.
  • a PEGylated carboxylic acid (i) that has been activated for amide bond formation can be reacted with an appropriately substituted amine containing immune-stimulatory compound to afford an intermediate amide.
  • Formation of an activated ester (ii) can be achieved by reaction the intermediate amide-containing carboxylic using a reagent such as N-hydroxysuccinimide or pentafluorophenol in the presence of a coupling agent such as diisopropylcarbodiimide (DIC) to provide compounds (ii).
  • ATAC compound can be synthesized by various methods.
  • ATAC compounds such as ATAC5– ATAC10, can be synthesized as shown in Scheme B2.
  • An activated carbonate such as (i) can be reacted with an appropriately substituted amine containing immune-stimulatory compound to afford carbamates (ii) which can be deprotected using standard methods based on the nature of the R 3 ester group.
  • the resulting carboxylic acid (iii) can then by coupled with an activating agent such as N-hydroxysuccinimide or
  • ATAC compound can be synthesized by various methods.
  • ATAC compounds such as ATAC11– ATAC21, can be synthesized as shown in Scheme B3.
  • An activated carboxylic ester such as (i-a) can be reacted with an appropriately substituted amine containing immune-stimulatory compound to afford amides (ii).
  • carboxylic acids of type (i-b) can be coupled to an appropriately substituted amine containing immune-stimulatory compound in the presence of an amide bond forming agent such as dicyclohexycarbodiimde (DCC) to provide the desired ATAC compounds.
  • DCC dicyclohexycarbodiimde
  • ATAC compound can be synthesized by various methods.
  • ATAC compounds such as ATAC22– ATAC31, can be synthesized as shown in Scheme B4.
  • An activated carbonate such as (i) can be reacted with an appropriately substituted amine containing immune-stimulatory compound to afford carbamates (ii) as the target ATAC compounds.
  • ATAC compound can be synthesized by various methods.
  • ATAC compounds such as ATAC32– ATAC34, can be synthesized as shown in Scheme B5.
  • An activated carboxylic acid such as (i-a, i-b, i-c) can be reacted with an appropriately substituted amine containing immune-stimulatory compound to afford amides (ii-a, ii-b, ii-c) as the target ATAC compounds.
  • compositions and methods described herein can be considered useful as
  • compositions for administration to a subject in need thereof.
  • Pharmaceutical compositions can comprise at least the compositions described herein and one or more pharmaceutically acceptable carriers, diluents, excipients, stabilizers, dispersing agents, suspending agents, and/or thickening agents.
  • the composition can comprise the conjugate having an antibody construct and an agonist.
  • the composition can comprise the conjugate having an antibody construct, a targeting binding domain, and an agonist.
  • the composition can comprise any conjugate described herein.
  • the antibody construct is an anti-CD40 antibody.
  • a conjugate can comprise an anti-CD40 antibody and a PAMP molecule.
  • a conjugate can comprise an anti-CD40 antibody and a DAMP molecule.
  • a pharmaceutical composition can further comprise buffers, antibiotics, steroids, carbohydrates, drugs (e.g., chemotherapy drugs), radiation, polypeptides, chelators, adjuvants and/or preservatives.
  • compositions can be formulated using one or more physiologically- acceptable carriers comprising excipients and auxiliaries. Formulation can be modified depending upon the route of administration chosen.
  • Pharmaceutical compositions comprising a composition as described herein can be manufactured, for example, by lyophilizing the conjugate, mixing, dissolving, emulsifying, encapsulating or entrapping the conjugate.
  • the pharmaceutical compositions can also include the compositions described herein in a free-base form or pharmaceutically-acceptable salt form.
  • Methods for formulation of the conjugates described herein can include formulating any of the conjugates described herein with one or more inert, pharmaceutically-acceptable excipients or carriers to form a solid, semi-solid, or liquid composition.
  • Solid compositions can include, for example, powders, tablets, dispersible granules and capsules, and in some aspects, the solid compositions further contain nontoxic, auxiliary substances, for example wetting or emulsifying agents, pH buffering agents, and other pharmaceutically-acceptable additives.
  • the compositions described herein can be lyophilized or in powder form for re-constitution with a suitable vehicle, e.g., sterile pyrogen-free water, before use
  • compositions of the conjugates described herein can comprise at least an active ingredient.
  • the active ingredients can be entrapped in microcapsules prepared, for example, by coacervation techniques or by interfacial polymerization (e.g.,
  • colloidal drug-delivery systems e.g., liposomes, albumin microspheres, microemulsions, nano-particles and nanocapsules
  • compositions as described herein often further can comprise more than one active compound as necessary for the particular indication being treated.
  • the active compounds can have complementary activities that do not adversely affect each other.
  • the composition can comprise a chemotherapeutic agent, cytotoxic agent, cytokine, growth-inhibitory agent, anti-hormonal agent, anti-angiogenic agent, and/or cardioprotectant.
  • Such molecules can be present in combination in amounts that are effective for the purpose intended.
  • compositions and formulations can be sterilized. Sterilization can be accomplished by filtration through sterile filtration.
  • compositions described herein can be formulated for administration as an injection.
  • formulations for injection can include a sterile suspension, solution or emulsion in oily or aqueous vehicles.
  • Suitable oily vehicles can include, but are not limited to, lipophilic solvents or vehicles such as fatty oils or synthetic fatty acid esters, or liposomes.
  • Aqueous injection suspensions can contain substances which increase the viscosity of the suspension.
  • the suspension can also contain suitable stabilizers.
  • Injections can be formulated for bolus injection or continuous infusion.
  • the compositions described herein can be lyophilized or in powder form for reconstitution with a suitable vehicle, e.g., sterile pyrogen-free water, before use.
  • the conjugates can be formulated in a unit dosage injectable form (e.g., use letter solution, suspension, emulsion) in association with a pharmaceutically acceptable parenteral vehicle.
  • a pharmaceutically acceptable parenteral vehicle can be inherently nontoxic, and non-therapeutic.
  • a vehicles can be water, saline, Ringer’s solution, dextrose solution, and 5% human serum albumin.
  • Nonaqueous vehicles such as fixed oils and ethyl oleate can also be used.
  • Liposomes can be used as carriers.
  • the vehicle can contain minor amounts of additives such as substances that enhance isotonicity and chemical stability (e.g., buffers and preservatives).
  • sustained-release preparations can be also be prepared.
  • sustained-release preparations can include semipermeable matrices of solid hydrophobic polymers that can contain the antibody, and these matrices can be in the form of shaped articles (e.g., films or
  • sustained-release matrices can include polyesters, hydrogels (e.g., poly(2-hydroxyethyl-methacrylate), or poly(vinylalcohol)), polylactides, copolymers of L- glutamic acid and ⁇ ethyl-L-glutamate, non-degradable ethylene-vinyl acetate, degradable lactic acid-glycolic acid copolymers such as the LUPRON DEPO TM (i.e., injectable microspheres composed of lactic acid-glycolic acid copolymer and leuprolide acetate), and poly-D-(– )-3- hydroxybutyric acid.
  • polyesters e.g., poly(2-hydroxyethyl-methacrylate), or poly(vinylalcohol)
  • polylactides e.g., poly(2-hydroxyethyl-methacrylate), or poly(vinylalcohol)
  • polylactides e.g., poly
  • compositions described herein can be prepared for storage by mixing a conjugate with a pharmaceutically acceptable carrier, excipient, and/or a stabilizer.
  • This formulation can be a lyophilized formulation or an aqueous solution.
  • Acceptable carriers, excipients, and/or stabilizers can be nontoxic to recipients at the dosages and concentrations used.
  • Acceptable carriers, excipients, and/or stabilizers can include buffers such as phosphate, citrate, and other organic acids; antioxidants including ascorbic acid and methionine; preservatives, polypeptides; proteins, such as serum albumin or gelatin; hydrophilic polymers; amino acids; monosaccharides, disaccharides, and other carbohydrates including glucose, mannose, or dextrins; chelating agents such as EDTA; sugars such as sucrose, mannitol, trehalose or sorbitol; salt-forming counter-ions such as sodium; metal complexes; and/or non- ionic surfactants or polyethylene glycol.
  • buffers such as phosphate, citrate, and other organic acids
  • antioxidants including ascorbic acid and methionine
  • preservatives polypeptides
  • proteins such as serum albumin or gelatin
  • hydrophilic polymers amino acids
  • compositions and methods of the present disclosure can be useful for a plurality of different subjects including, but are not limited to, a mammal, human, non-human mammal, a domesticated animal (e.g., laboratory animals, household pets, or livestock), non-domesticated animal (e.g., wildlife), dog, cat, rodent, mouse, hamster, cow, bird, chicken, fish, pig, horse, goat, sheep, rabbit, and any combination thereof.
  • a mammal human
  • non-human mammal e.g., a domesticated animal (e.g., laboratory animals, household pets, or livestock), non-domesticated animal (e.g., wildlife), dog, cat, rodent, mouse, hamster, cow, bird, chicken, fish, pig, horse, goat, sheep, rabbit, and any combination thereof.
  • a domesticated animal e.g., laboratory animals, household pets, or livestock
  • non-domesticated animal e.g., wildlife
  • compositions and methods described herein can be useful as a therapeutic, for example a treatment that can be administered to a subject in need thereof.
  • a therapeutic effect of the present disclosure can be obtained in a subject by reduction, suppression, remission, or eradication of a disease state, including, but not limited to, a symptom thereof.
  • a therapeutic effect in a subject having a disease or condition, or pre-disposed to have or is beginning to have the disease or condition can be obtained by a reduction, a suppression, a prevention, a remission, or an eradication of the condition or disease, or pre-condition or pre-disease state.
  • therapeutically-effective amounts of the compositions described herein can be administered to a subject in need thereof, often for treating and/or preventing a condition or progression thereof.
  • a pharmaceutical composition can affect the physiology of the subject, such as the immune system, inflammatory response, or other physiologic affect.
  • a therapeutically-effective amount can vary widely depending on the severity of the disease, the age and relative health of the subject, the potency of the compounds used, and other factors.
  • Treat and/or treating can refer to any indicia of success in the treatment or amelioration of the disease or condition. Treating can include, for example, reducing, delaying or alleviating the severity of one or more symptoms of the disease or condition, or it can include reducing the frequency with which symptoms of a disease, defect, disorder, or adverse condition, and the like, are experienced by a patient. Treat can be used herein to refer to a method that results in some level of treatment or amelioration of the disease or condition, and can contemplate a range of results directed to that end, including but not restricted to prevention of the condition entirely.
  • Prevent, preventing and the like can refer to the prevention of the disease or condition, e.g., tumor formation, in the patient.
  • the disease or condition e.g., tumor formation
  • the disease has been prevented, at least over a period of time, in that individual.
  • a therapeutically effective amount can be the amount of a composition or an active component thereof sufficient to provide a beneficial effect or to otherwise reduce a detrimental non-beneficial event to the individual to whom the composition is administered.
  • therapeutically effective dose can be a dose that produces one or more desired or desirable (e.g., beneficial) effects for which it is administered, such administration occurring one or more times over a given period of time.
  • An exact dose can depend on the purpose of the treatment, and can be ascertainable by one skilled in the art using known techniques.
  • conjugates described herein that can be used in therapy can be formulated and dosages established in a fashion consistent with good medical practice taking into account the disorder to be treated, the condition of the individual patient, the site of delivery of the composition, the method of administration and other factors known to practitioners.
  • the conjugates described herein can be prepared according to the description of preparation described herein.
  • compositions can be considered useful with the compositions and methods described herein can be administered to a subject in need thereof using a technique known to one of ordinary skill in the art which can be suitable as a therapy for the disease or condition affecting the subject.
  • a technique known to one of ordinary skill in the art which can be suitable as a therapy for the disease or condition affecting the subject.
  • One of ordinary skill in the art would understand that the amount, duration and frequency of administration of a pharmaceutical composition described herein to a subject in need thereof depends on several factors including, for example but not limited to, the health of the subject, the specific disease or condition of the patient, the grade or level of a specific disease or condition of the patient, the additional therapeutics the subject is being or has been administered, and the like.
  • compositions described herein can be for administration to a subject in need thereof.
  • administration of the compositions described herein can include routes of administration, non-limiting examples of administration routes include intravenous, intraarterial, subcutaneous, subdural, intramuscular, intracranial, intrasternal, intratumoral, or
  • a pharmaceutical composition can be administered to a subject by additional routes of administration, for example, by inhalation, oral, dermal, intranasal, or intrathecal administration.
  • compositions of the present disclosure can be administered to a subject in need thereof in a first administration, and in one or more additional administrations.
  • the one or more additional administrations can be administered to the subject in need thereof minutes, hours, days, weeks or months following the first administration. Any one of the additional administrations can be administered to the subject in need thereof less than 21 days, or less than 14 days, less than 10 days, less than 7 days, less than 4 days or less than 1 day after the first administration.
  • the one or more administrations can occur more than once per day, more than once per week or more than once per month.
  • compositions and methods provided herein can be useful for the treatment of a plurality of diseases, conditions, preventing a disease or a condition in a subject or other therapeutic applications for subjects in need thereof.
  • the compositions and methods provided herein can be useful for treatment of hyperplastic conditions, including but not limited to, neoplasms, cancers, tumors and the like.
  • a condition such as a cancer, can be associated with expression of a molecule on the cancer cells.
  • the molecule expressed by the cancer cells can comprise an extracellular portion capable of recognition by the antibody portion of the conjugate.
  • a molecule expressed by the cancer cells can be a tumor antigen.
  • An antibody portion of the conjugate can recognize a tumor antigen.
  • a tumor antigen can include CD5, CD19, CD20, CD25, CD37, CD30, CD33, CD45, CAMPATH-1, BCMA, CS-1, PD-L1, B7-H3, B7-DC, HLD- DR, carcinoembryonic antigen, TAG-72, EpCAM, MUC1, folate-binding protein, A33, G250, prostate-specific membrane antigen, ferritin, GD2, GD3, GM2, Le y , CA-125, CA19-9, epidermal growth factor, p185HER2, IL-2 receptor, de2-7 EGFR, fibroblast activation protein, tenascin, metalloproteinases, endosialin, vascular endothelial growth factor, avB3, WT1, LMP2, HPV E6 E7, EGFRvIII, Her-2/neu, idiotype, MAGE A3, p53 nonmutant, NY-ESO-1, PMSA, GD2, CEA, MelanA/MART
  • an antigen binding domain portion of the conjugate can be configured to recognize a molecule expressed by a cancer cell, such as for example, a disease antigen, tumor antigen or a cancer antigen. Often such antigens are known to those of ordinary skill in the art, or newly found to be associated with such a condition, to be commonly associated with, and/or, specific to, such conditions.
  • a disease antigen, tumor antigen or a cancer antigen is, but is not limited to, CD5, CD19, CD20, CD25, CD37, CD30, CD33, CD45, CAMPATH-1, BCMA, CS-1, PD-L1, B7-H3, B7-DC, HLD-DR, carcinoembryonic antigen, TAG-72, EpCAM, MUC1, folate-binding protein, A33, G250, prostate-specific membrane antigen, ferritin, GD2, GD3, GM2, Le y , CA-125, CA19-9, epidermal growth factor, p185HER2, IL-2 receptor, de2-7 EGFR, fibroblast activation protein, tenascin, metalloproteinases,
  • HMWMAA HMWMAA
  • AKAP-4 SSX2, XAGE 1, B7H3, Legumain, Tie 3, Page4, VEGFR2, MAD-CT-1, PDGFR-B, MAD-CT-2, ROR2, TRAIL1, MUC16, MAGE A4, MAGE C2, GAGE, EGFR, CMET, HER3, MUC1, MUC15, MSLN, CA6, NAPI2B, TROP2, CLDN18.2, RON, LY6E, FRA, DLL3, PTK7, LIV1, ROR1, MAGE-A3, or Fos-related antigen 1.
  • tumor antigens can be derived from the following specific conditions and/or families of conditions, including but not limited to, cancers such as brain cancers, skin cancers, lymphomas, sarcomas, lung cancer, liver cancer, leukemias, uterine cancer, breast cancer, ovarian cancer, cervical cancer, bladder cancer, kidney cancer, hemangiosarcomas, bone cancers, blood cancers, testicular cancer, prostate cancer, stomach cancer, intestinal cancers, pancreatic cancer, and other types of cancers as well as pre-cancerous conditions such as hyperplasia or the like.
  • cancers such as brain cancers, skin cancers, lymphomas, sarcomas, lung cancer, liver cancer, leukemias, uterine cancer, breast cancer, ovarian cancer, cervical cancer, bladder cancer, kidney cancer, hemangiosarcomas, bone cancers, blood cancers, testicular cancer, prostate cancer, stomach cancer, intestinal cancers, pancreatic cancer, and other types of cancers as well as pre-cance
  • Non-limiting examples of cancers can include Acute lymphoblastic leukemia (ALL); Acute myeloid leukemia; Adrenocortical carcinoma; Astrocytoma, childhood cerebellar or cerebral; Basal-cell carcinoma; Bladder cancer; Bone tumor, osteosarcoma/malignant fibrous histiocytoma; Brain cancer; Brain tumors, such as, cerebellar astrocytoma, malignant glioma, ependymoma, medulloblastoma, visual pathway and hypothalamic glioma; Brainstem glioma; Breast cancer; Bronchial adenomas/carcinoids; Burkitt's lymphoma; Cerebellar astrocytoma; Cervical cancer; Cholangiocarcinoma; Chondrosarcoma; Chronic lymphocytic leukemia;
  • Head and neck cancer Heart cancer; Hepatocellular (liver) cancer; Hodgkin lymphoma;
  • hypopharyngeal cancer Islet cell carcinoma (endocrine pancreas); Kaposi sarcoma; Kidney cancer (renal cell cancer); Laryngeal cancer; Leukaemia, such as, acute lymphoblastic, acute myeloid, chronic lymphocytic, chronic myelogenous and, hairy cell; Lip and oral cavity cancer; Liposarcoma; Lung cancer, such as, non-small cell and small cell; Lymphoma, such as, AIDS- related, Burkitt; Lymphoma, cutaneous T-Cell, Hodgkin and Non-Hodgkin, Macroglobulinemia, Malignant fibrous histiocytoma of bone/osteosarcoma; Melanoma; Merkel cell cancer;
  • Mesothelioma Multiple myeloma/plasma cell neoplasm; Mycosis fungoides; Myelodysplastic syndromes; Myelodysplastic/myeloproliferative diseases; Myeloproliferative disorders, chronic; Nasal cavity and paranasal sinus cancer; Nasopharyngeal carcinoma; Neuroblastoma;
  • Oligodendroglioma Oropharyngeal cancer; Osteosarcoma/malignant fibrous histiocytoma of bone; Ovarian cancer; Pancreatic cancer; Parathyroid cancer; Pharyngeal cancer;
  • Pheochromocytoma Pituitary adenoma; Plasma cell neoplasia; Pleuropulmonary blastoma; Prostate cancer; Rectal cancer; Renal cell carcinoma (kidney cancer); Renal pelvis and ureter, transitional cell cancer; Rhabdomyosarcoma; Salivary gland cancer; Sarcoma, Ewing family of tumors; Sarcoma, Kaposi; Sarcoma, soft tissue; Sarcoma, uterine; Sézary syndrome; Skin cancer (non-melanoma); Skin carcinoma; Small intestine cancer; Soft tissue sarcoma; Squamous cell carcinoma; Squamous neck cancer with occult primary, metastatic; Stomach cancer; Testicular cancer; Throat cancer; Thymoma and thymic carcinoma; Thymoma,; Thyroid cancer; Thyroid cancer, childhood; Uterine cancer; Vaginal cancer; Waldenström macroglobulinemia; Wilms tumor and any combination thereof.
  • An anti-CD40 antibody is comprised of two SBT-040-G1WT heavy chains and two light chain from a SBT-040 antibody, which is referred to as a SBT-040-WT antibody.
  • An anti-CD40 antibody is comprised of two SBT-040-G1VLPLL heavy chains and two light chains from a SBT-040 antibody, which is referred to as a SBT-040-VLPLL antibody.
  • An anti-CD40 antibody is comprised two SBT-040-G1DE heavy chains and two light chains from a SBT-040 antibody, which is referred to as a SBT-040-DE antibody.
  • An anti-CD40 antibody is comprised of two SBT-040-G1AAA heavy chains and two light chains from a SBT-040 antibody, which is referred to as a SBT-040-AAA antibody.
  • SBT-040-WT antibody, SBT-040-VLPLL antibody, SBT-040-DE antibody, and SBT- 040-AAA antibody are produced by standard methods for producing antibodies. These antibodies are purified, and each antibody’s affinity for soluble glycosylated ectodomains from all human Fc ⁇ receptors (Fc ⁇ Rs) is measured. These affinities are measured by experiments using surface plasmon resonance. In these experiments, biotinylated soluble glycosylated Fc ⁇ R ectodomains from all human Fc ⁇ Rs are immobilized on a streptavidin-coated surface.
  • each antibody to bind to soluble glycosylated Fc ⁇ R ectodomains from all human Fc ⁇ Rs is then measured by surface plasmon resonance using a Biacore instrument.
  • the data from this experiment shows that the Fc domain of a SBT-040-WT antibody, the Fc domain of a SBT-040- VLPLL antibody, the Fc domain of a SBT-040-DE antibody, and the Fc domain of a SBT-040- AAA antibody are each bound to soluble glycosylated Fc ⁇ R ectodomains from all human Fc ⁇ Rs.
  • the surface plasmon resonance experiments show that the Fc domain of the SBT-040- G1WT antibody and variants of the Fc domain of a SBT-040-G1WT antibody (i.e., the Fc domain of a SBT-040-G1VLPLL antibody, the Fc domain of a SBT-040-DE antibody and the Fc domain of a SBT-040-AAA antibody) are each bound to all human Fc ⁇ Rs.
  • the affinity of each antibody for each human Fc ⁇ Rs is also shown by these experiments.
  • a linker is linked with an immune-stimulatory compound.
  • a linker linked to an immune- stimulatory compound is formed to make a linker-immune stimulatory compound conjugate (ATAC).
  • an ATAC is conjugated to an antibody, in which the ATAC is any one of ATAC1– ATAC34 or ATAC 43 (each of which is described in the below EXAMPLES).
  • a linker is linked with an antibody, in which the linker is a pegylated linker, a valine- alanine linker, a valine-citrulline linker, or an N-Maleimidomethylcyclohexane-1-carboxylate (MCC) linker.
  • MCC N-Maleimidomethylcyclohexane-1-carboxylate
  • an immune-stimulatory compound is conjugated to the linker linked with the antibody, in which the immune-stimulatory compound is a TLR ligand, a Nod-like receptor ligand, a RIG-Like receptor ligand, a CLR ligand, a CDS ligand, or an inflammasome inducer.
  • a linker is linked with an antibody, in which the linker is a pegylated linker, a valine- alanine linker, a valine-citrulline linker, or an N-Maleimidomethylcyclohexane-1-carboxylate (MCC) linker.
  • MCC N-Maleimidomethylcyclohexane-1-carboxylate
  • the resulting solution was stirred for 1 h at 25 o C and the resulting solution was diluted with 500 mL of dichloromethane and washed with 4 x 400 mL of saturated sodium bicarbonate solution and 1x400 mL of saturated sodium chloride solution, respectively.
  • the organic phase was dried over anhydrous sodium sulfate, filtered and concentrated under vacuum.
  • the crude product was purified by flash chromatography (C18 silica gel; mobile phase, acetonitrile in water gradient: 40% up to 100% within 8 min and 100% maintained 10 min) to afford 25 g of Int 2.13-4 as a white solid.
  • Step E Preparation of Int 2.13-5
  • the solution was cooled to 0 o C and treated with 184.8 g (655.5 mmol, 2.0 equiv) triflic anhydride dropwise.
  • the resulting solution was stirred for 2 h at 0 o C then quenched by the addition of 4000 mL of water/ice.
  • the resulting solution was extracted with 3 x 4000 mL of dichloromethane and the organic layers were combined. The organic extracts were washed with 2 x 4000 mL of water/ice and 1 x 4000 mL of saturated sodium chloride solution, respectively.
  • Triflic anhydride (30.8 g, 109.24 mmol, 1.30 equiv) was then added dropwise with stirring at 0 o C. The resulting solution was stirred at this temperature for 1 h. The reaction was then quenched by the addition of 500 mL of ice/water then extracted with 3 x 500 mL of dichloromethane and the organic layers were combined. The organic layer was washed with 2 x 100 mL of saturated sodium chloride solution. The solution was dried over anhydrous sodium sulfate, filtered and concentrated under vacuum. The crude product (Int 2.13-8) (55 g) was thus isolated and used directly in the next step.
  • This example shows the synthesis of Pentafluorophenyl 25-(2-amino-3-pentylquinolin-5- yl)-19-oxo-4,7,10,13,16-pentaoxa-20-azapentacosanoate (ATAC1) and Perfluorophenyl 3-((4- amino-1-(2-hydroxy-2-methylpropyl)-1H-imidazo[4,5-c]quinolin-2-yl)methyl)-4-oxo- 7,10,13,16,19-pentaoxa-3-azadocosan-22-oate (ATAC2).
  • Step A Preparation of Int ATAC1-1
  • This example shows the synthesis of pentafluorophenyl 25-(2-amino-3-pentylquinolin-5- yl)-19-oxo-4,7,10,13,16-pentaoxa-20-azapentacosanoate (ATAC3) and 2,5-Dioxopyrrolidin-1-yl 3-((4-amino-1-(2-hydroxy-2-methylpropyl)-1H-imidazo-[4,5-c]quinolin-2-yl)methyl)-4-oxo- 7,10,13,16,19-pentaoxa-3-azadocosan-22-oate (ATAC4).
  • This example shows the synthesis of 2,5-dioxopyrrolidin-1-yl 6-(((S)-1-(((S)-1-((4-((((5- (2-amino-3-pentylquinolin-5-yl)pentyl)carbamoyl)oxy)methyl)phenyl)amino)-1-oxopropan-2- yl)amino)-3-methyl-1-oxobutan-2-yl)amino)-6-oxohexanoate (ATAC5), 2,5-dioxopyrrolidin-1-yl 7-(((S)-1-(((S)-1-((4-(((((4-amino-1-(2-hydroxy-2-methylpropyl)-1H-imidazo[4,5-c]quinolin-2- yl)methyl)(ethyl)carbamoyl)oxy)methyl)phenyl)amino)-1-ox
  • Step A Preparation of Int ATAC5-1
  • ATAC6 compound and ATAC7 compound in TABLE 3 can be prepared using a method similar to that described above for ATAC5.
  • This example shows the synthesis of N-((4-amino-1-(2-hydroxy-2-methylpropyl)-1H- imidazo[4,5-c]quinolin-2-yl)methyl)-1-(3-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)propanamido)- N-ethyl-3,6,9,12-tetraoxapentadecan-15-amide (ATAC11).

Abstract

L'invention concerne diverses compositions de constructions d'anticorps. L'invention concerne aussi des compositions de conjugués de composés immunostimulateurs-constructions d'anticorps. L'invention concerne également des procédés de préparation et d'utilisation des conjugués de composés immunostimulateurs-constructions d'anticorps. Les procédés incluent des procédés de traitement d'affections comme le cancer. L'invention concerne par ailleurs un genre de composés agonistes du stimulateur STING et un procédé de synthèse.
EP16873755.9A 2015-12-07 2016-12-07 Composition de conjugués d'agonistes-constructions d'anticorps et leurs procédés d'utilisation Withdrawn EP3386536A4 (fr)

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
US201562264260P 2015-12-07 2015-12-07
US15/173,075 US20170158772A1 (en) 2015-12-07 2016-06-03 Compositions of antibody construct - agonist conjugates and methods of use thereof
US201662371141P 2016-08-04 2016-08-04
PCT/US2016/065353 WO2017100305A2 (fr) 2015-12-07 2016-12-07 Composition de conjugués d'agonistes-constructions d'anticorps et leurs procédés d'utilisation

Publications (2)

Publication Number Publication Date
EP3386536A2 true EP3386536A2 (fr) 2018-10-17
EP3386536A4 EP3386536A4 (fr) 2019-07-31

Family

ID=59013332

Family Applications (1)

Application Number Title Priority Date Filing Date
EP16873755.9A Withdrawn EP3386536A4 (fr) 2015-12-07 2016-12-07 Composition de conjugués d'agonistes-constructions d'anticorps et leurs procédés d'utilisation

Country Status (4)

Country Link
EP (1) EP3386536A4 (fr)
CA (1) CA3007311A1 (fr)
DE (1) DE212016000029U1 (fr)
WO (1) WO2017100305A2 (fr)

Cited By (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11299512B2 (en) 2016-03-18 2022-04-12 Immunesensor Therapeutics, Inc. Cyclic di-nucleotide compounds and methods of use

Families Citing this family (48)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11453697B1 (en) 2015-08-13 2022-09-27 Merck Sharp & Dohme Llc Cyclic di-nucleotide compounds as sting agonists
GEP20207182B (en) 2015-08-13 2020-11-25 Merck Sharp & Dohme Cyclic di-nucleotide compounds as sting agonists
WO2018009916A1 (fr) 2016-07-07 2018-01-11 The Board Of Trustees Of The Leland Stanford Junior University Conjugués d'adjuvant d'anticorps
RS62410B1 (sr) 2016-10-04 2021-10-29 Merck Sharp & Dohme Benzo[b]tiofenska jedinjenja kao agonisti sting
JOP20170192A1 (ar) * 2016-12-01 2019-01-30 Takeda Pharmaceuticals Co داي نوكليوتيد حلقي
CA3049842A1 (fr) * 2017-02-02 2018-08-09 Silverback Therapeutics, Inc. Compositions de produit de recombinaison-peptide et leurs methodes d'utilisation
AR113224A1 (es) * 2017-04-28 2020-02-19 Novartis Ag Conjugados de anticuerpo que comprenden un agonista de sting
US11466047B2 (en) 2017-05-12 2022-10-11 Merck Sharp & Dohme Llc Cyclic di-nucleotide compounds as sting agonists
MA49772A (fr) 2017-08-04 2021-04-21 Merck Sharp & Dohme Agonistes benzo[b]thiophène de sting pour le traitement du cancer
AU2018311965A1 (en) 2017-08-04 2020-02-13 Merck Sharp & Dohme Llc Combinations of PD-1 antagonists and benzo[b]thiophene sting antagonists for cancer treatment
CN107365361B (zh) * 2017-08-21 2020-05-19 中国药科大学 与pd-l1结合的重复域锚定蛋白及其用途
US10953032B2 (en) * 2017-08-31 2021-03-23 Bristol-Myers Squibb Company Cyclic dinucleotides as anticancer agents
EP3676278B1 (fr) * 2017-08-31 2023-04-12 Bristol-Myers Squibb Company Dinucléotides cycliques utilisés en tant qu'agents anticancéreux
US11707531B2 (en) * 2017-09-11 2023-07-25 F-star Therapeutics, Inc. Compounds, compositions, and methods for the treatment of disease
US11584774B2 (en) 2017-09-11 2023-02-21 F-star Therapeutics, Inc. Compounds, compositions, and methods for the treatment of disease
US11542293B2 (en) 2017-11-10 2023-01-03 Takeda Pharmaceutical Company Limited Sting modulator compounds, and methods of making and using
EP3727401A4 (fr) 2017-12-20 2022-04-06 Merck Sharp & Dohme Corp. Composés dinucléotidiques cycliques utilisés comme agonistes sting
EP3505188A1 (fr) 2017-12-29 2019-07-03 Invivogen Conjugués de dinucléotide pro-cycliques pour l'induction de la cytokine
CA3095646A1 (fr) 2018-04-03 2019-10-10 Merck Sharp & Dohme Corp. Benzothiophenes et composes associes utilises en tant qu'agonistes de sting
WO2019195063A1 (fr) 2018-04-03 2019-10-10 Merck Sharp & Dohme Corp. Composés aza-benzothiophènes utilisés en tant qu'agonistes de sting
WO2019227007A1 (fr) 2018-05-25 2019-11-28 Incyte Corporation Composés hétérocycliques tricycliques en tant qu'activateurs de sting
US10875872B2 (en) 2018-07-31 2020-12-29 Incyte Corporation Heteroaryl amide compounds as sting activators
US11008344B2 (en) 2018-07-31 2021-05-18 Incyte Corporation Tricyclic heteroaryl compounds as STING activators
AU2019337051B2 (en) 2018-09-06 2023-11-23 Daiichi Sankyo Company, Limited Novel cyclic dinucleotide derivative and antibody-drug conjugate thereof
US11596692B1 (en) 2018-11-21 2023-03-07 Incyte Corporation PD-L1/STING conjugates and methods of use
WO2020190725A1 (fr) 2019-03-15 2020-09-24 Bolt Biotherapeutics, Inc. Immunoconjugués ciblant le her2
EP3962493A2 (fr) 2019-05-03 2022-03-09 Flagship Pioneering Innovations V, Inc. Métodes de modulation de l'activité immunitaire
US11787833B2 (en) 2019-05-09 2023-10-17 Aligos Therapeutics, Inc. Modified cyclic dinucleoside compounds as sting modulators
CN114206355A (zh) * 2019-06-03 2022-03-18 芝加哥大学 用靶向癌症的佐剂治疗癌症的方法和组合物
WO2020245321A1 (fr) 2019-06-04 2020-12-10 Institut Curie Méthodes de production de monomères et d'oligomères de la sous-unité b de la toxine de shiga (stxb), et leurs utilisations
EP3999118A1 (fr) 2019-07-19 2022-05-25 Immunesensor Therapeutics, Inc. Conjugués anticorps-agonistes de sting et leur utilisation en immunothérapie
JP2022543086A (ja) 2019-08-02 2022-10-07 メルサナ セラピューティクス インコーポレイテッド がんの処置用のＳＴＩＮＧ（インターフェロン遺伝子刺激因子）アゴニストとしてのビス－［Ｎ－（（５－カルバモイル）－１Ｈ－ベンゾ［ｄ］イミダゾール－２－イル）－ピラゾール－５－カルボキサミド］誘導体および関連化合物
WO2021046112A1 (fr) * 2019-09-03 2021-03-11 Bolt Biotherapeutics, Inc. Composés aminoquinoline, immunoconjugués et leurs utilisations
WO2021110987A1 (fr) 2019-12-06 2021-06-10 Life & Soft Procédés et appareils permettant de diagnostiquer un cancer à partir d'acides nucléiques acellulaires
CN111233850B (zh) * 2020-01-21 2022-09-23 南开大学 含苯并噻唑氨基和杂芳基的萘酚衍生物与制备方法和用途
WO2021168274A1 (fr) 2020-02-21 2021-08-26 Silverback Therapeutics, Inc. Conjugués d'anticorps de nectine-4 et leurs utilisations
IL296124A (en) 2020-03-06 2022-11-01 Daiichi Sankyo Co Ltd Conjugation of an antibody with a drug including a novel cyclic dinucleotide derivative
JP2023541497A (ja) 2020-03-13 2023-10-03 ヘファイストス－ファーマ 脱酸素化リポ多糖（ｌｐｓ）、天然非毒性ｌｐｓおよびそれらの使用
WO2021232019A1 (fr) 2020-05-15 2021-11-18 Immunesensor Therapeutics, Inc. Polythérapies à agoniste de sting assorties d'inhibiteurs de points de contrôle immunitaires
AU2021300362A1 (en) 2020-07-01 2023-02-23 ARS Pharmaceuticals, Inc. Anti-ASGR1 antibody conjugates and uses thereof
EP3943505A1 (fr) 2020-07-22 2022-01-26 Encefa Peptides cd31 de liaison à cd38 et leurs utilisations
JPWO2022050300A1 (fr) 2020-09-02 2022-03-10
MX2023005381A (es) 2020-11-09 2023-05-23 Takeda Pharmaceuticals Co Conjugados de anticuerpo y farmaco.
US20240033366A1 (en) 2020-12-02 2024-02-01 Institut Curie FUNCTIONALIZED SHIGA TOXIN B-SUBUNIT (STxB) PROTEINS AND CONJUGATES THEREOF
KR20230152073A (ko) 2021-02-26 2023-11-02 브레누스 파마 비자가 다중 스트레스성 암 세포 및 암의 백신접종 및 치료를 위한 이의 용도
CA3226976A1 (fr) 2021-07-23 2023-01-26 Immunesensor Therapeutics, Inc. Polytherapies a base d'agonistes de sting comprenant des cytokines
WO2023041717A1 (fr) 2021-09-16 2023-03-23 Aboleris Pharma Domaines de liaison anti-cd45rc humaine et leurs utilisations
TW202342105A (zh) * 2021-12-17 2023-11-01 大陸商北京加科思新藥研發有限公司 包含可用作sting激動劑的化合物的化合物-連接基構建體及其用途

Family Cites Families (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
IE920561A1 (en) * 1991-02-21 1992-08-26 Gilead Sciences Aptamer specific for thrombin and methods of use
DE69535592T2 (de) 1994-03-25 2008-06-12 Isotechnika, Inc., Edmonton Verbesserung der effektivität von arzneimitteln duren deuterierung
US6334997B1 (en) 1994-03-25 2002-01-01 Isotechnika, Inc. Method of using deuterated calcium channel blockers
AR039067A1 (es) * 2001-11-09 2005-02-09 Pfizer Prod Inc Anticuerpos para cd40
US8946387B2 (en) * 2002-08-14 2015-02-03 Macrogenics, Inc. FcγRIIB specific antibodies and methods of use thereof
PE20142406A1 (es) * 2012-05-04 2015-01-23 Pfizer Antigenos asociados a prostata y regimenes de inmunoterapia basados en vacuna
CA2936377A1 (fr) * 2014-01-10 2015-07-16 Shanghai Birdie Biotech, Inc. Composes et compositions pour le traitement de tumeurs exprimant egfr

Cited By (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11299512B2 (en) 2016-03-18 2022-04-12 Immunesensor Therapeutics, Inc. Cyclic di-nucleotide compounds and methods of use

Also Published As

Publication number Publication date
WO2017100305A3 (fr) 2017-07-20
EP3386536A4 (fr) 2019-07-31
CA3007311A1 (fr) 2017-06-15
WO2017100305A2 (fr) 2017-06-15
WO2017100305A8 (fr) 2017-09-08
DE212016000029U1 (de) 2017-07-30

Similar Documents

Publication Publication Date Title
US20210139604A1 (en) Compositions of antibody construct-agonist conjugates and methods of use thereof
EP3386536A2 (fr) Composition de conjugués d'agonistes-constructions d'anticorps et leurs procédés d'utilisation
US20190336615A1 (en) Tumor targeting conjugates and methods of use thereof
AU2018236272B2 (en) Benzazepine compounds, conjugates, and uses thereof
US20200199242A1 (en) Construct-peptide compositions and methods of use thereof
US20210115109A1 (en) Conjugates and methods of use thereof for selective delivery of immune-modulatory agents
WO2018227023A1 (fr) Conjugués de construction d'anticorps
US20210154317A1 (en) Compositions and methods for the treatment of viral infections
WO2018227018A1 (fr) Conjugués d'anticorps constitués de composés immunomodulateurs et leurs utilisations
CN113164618A (zh) 用免疫刺激性缀合物治疗疾病的方法和组合物
WO2020056194A1 (fr) Composés de benzazépine, conjugués et utilisations associées
US20220323596A1 (en) Antibody conjugates of toll-like receptor agonists
AU2020358726A1 (en) Combination therapy with immune stimulatory conjugates
GB2552041A (en) Compositions of antibody construct-agonist conjugates and methods thereof
RU2780334C2 (ru) Бензазепиновые соединения, конъюгаты и их применение

Legal Events

Date Code Title Description
PUAI Public reference made under article 153(3) epc to a published international application that has entered the european phase

Free format text: ORIGINAL CODE: 0009012

17P Request for examination filed

Effective date: 20180706

AK Designated contracting states

Kind code of ref document: A2

Designated state(s): AL AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HR HU IE IS IT LI LT LU LV MC MK MT NL NO PL PT RO RS SE SI SK SM TR

AX Request for extension of the european patent

Extension state: BA ME

DAV Request for validation of the european patent (deleted)
DAX Request for extension of the european patent (deleted)
A4 Supplementary search report drawn up and despatched

Effective date: 20190701

RIC1 Information provided on ipc code assigned before grant

Ipc: C07K 16/32 20060101ALI20190624BHEP

Ipc: A61K 39/395 20060101ALI20190624BHEP

Ipc: A61K 39/39 20060101ALI20190624BHEP

Ipc: C07K 16/28 20060101ALI20190624BHEP

Ipc: A61K 47/68 20170101ALI20190624BHEP

Ipc: A61K 39/00 20060101AFI20190624BHEP

REG Reference to a national code

Ref country code: HK

Ref legal event code: DE

Ref document number: 1261040

Country of ref document: HK

17Q First examination report despatched

Effective date: 20200213

STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: THE APPLICATION IS DEEMED TO BE WITHDRAWN

18D Application deemed to be withdrawn

Effective date: 20200624