EP3160671A1 - Verfahren zur herstellung eines partikelhaltigen aerosols - Google Patents

Verfahren zur herstellung eines partikelhaltigen aerosols

Info

Publication number
EP3160671A1
EP3160671A1 EP15733419.4A EP15733419A EP3160671A1 EP 3160671 A1 EP3160671 A1 EP 3160671A1 EP 15733419 A EP15733419 A EP 15733419A EP 3160671 A1 EP3160671 A1 EP 3160671A1
Authority
EP
European Patent Office
Prior art keywords
cylinder
particles
particle
binder
mixtures
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Withdrawn
Application number
EP15733419.4A
Other languages
English (en)
French (fr)
Inventor
Harald Wagner
Uwe Ott
Kerstin Schindler
Christian Wolfrum
Markus Rupprecht
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Eckart GmbH
Original Assignee
Eckart GmbH
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Eckart GmbH filed Critical Eckart GmbH
Publication of EP3160671A1 publication Critical patent/EP3160671A1/de
Withdrawn legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C23COATING METALLIC MATERIAL; COATING MATERIAL WITH METALLIC MATERIAL; CHEMICAL SURFACE TREATMENT; DIFFUSION TREATMENT OF METALLIC MATERIAL; COATING BY VACUUM EVAPORATION, BY SPUTTERING, BY ION IMPLANTATION OR BY CHEMICAL VAPOUR DEPOSITION, IN GENERAL; INHIBITING CORROSION OF METALLIC MATERIAL OR INCRUSTATION IN GENERAL
    • C23CCOATING METALLIC MATERIAL; COATING MATERIAL WITH METALLIC MATERIAL; SURFACE TREATMENT OF METALLIC MATERIAL BY DIFFUSION INTO THE SURFACE, BY CHEMICAL CONVERSION OR SUBSTITUTION; COATING BY VACUUM EVAPORATION, BY SPUTTERING, BY ION IMPLANTATION OR BY CHEMICAL VAPOUR DEPOSITION, IN GENERAL
    • C23C4/00Coating by spraying the coating material in the molten state, e.g. by flame, plasma or electric discharge
    • C23C4/12Coating by spraying the coating material in the molten state, e.g. by flame, plasma or electric discharge characterised by the method of spraying
    • C23C4/134Plasma spraying
    • BPERFORMING OPERATIONS; TRANSPORTING
    • B22CASTING; POWDER METALLURGY
    • B22FWORKING METALLIC POWDER; MANUFACTURE OF ARTICLES FROM METALLIC POWDER; MAKING METALLIC POWDER; APPARATUS OR DEVICES SPECIALLY ADAPTED FOR METALLIC POWDER
    • B22F1/00Metallic powder; Treatment of metallic powder, e.g. to facilitate working or to improve properties
    • B22F1/10Metallic powder containing lubricating or binding agents; Metallic powder containing organic material
    • BPERFORMING OPERATIONS; TRANSPORTING
    • B22CASTING; POWDER METALLURGY
    • B22FWORKING METALLIC POWDER; MANUFACTURE OF ARTICLES FROM METALLIC POWDER; MAKING METALLIC POWDER; APPARATUS OR DEVICES SPECIALLY ADAPTED FOR METALLIC POWDER
    • B22F1/00Metallic powder; Treatment of metallic powder, e.g. to facilitate working or to improve properties
    • B22F1/10Metallic powder containing lubricating or binding agents; Metallic powder containing organic material
    • B22F1/105Metallic powder containing lubricating or binding agents; Metallic powder containing organic material containing inorganic lubricating or binding agents, e.g. metal salts
    • BPERFORMING OPERATIONS; TRANSPORTING
    • B22CASTING; POWDER METALLURGY
    • B22FWORKING METALLIC POWDER; MANUFACTURE OF ARTICLES FROM METALLIC POWDER; MAKING METALLIC POWDER; APPARATUS OR DEVICES SPECIALLY ADAPTED FOR METALLIC POWDER
    • B22F1/00Metallic powder; Treatment of metallic powder, e.g. to facilitate working or to improve properties
    • B22F1/10Metallic powder containing lubricating or binding agents; Metallic powder containing organic material
    • B22F1/107Metallic powder containing lubricating or binding agents; Metallic powder containing organic material containing organic material comprising solvents, e.g. for slip casting
    • BPERFORMING OPERATIONS; TRANSPORTING
    • B22CASTING; POWDER METALLURGY
    • B22FWORKING METALLIC POWDER; MANUFACTURE OF ARTICLES FROM METALLIC POWDER; MAKING METALLIC POWDER; APPARATUS OR DEVICES SPECIALLY ADAPTED FOR METALLIC POWDER
    • B22F1/00Metallic powder; Treatment of metallic powder, e.g. to facilitate working or to improve properties
    • B22F1/17Metallic particles coated with metal
    • BPERFORMING OPERATIONS; TRANSPORTING
    • B22CASTING; POWDER METALLURGY
    • B22FWORKING METALLIC POWDER; MANUFACTURE OF ARTICLES FROM METALLIC POWDER; MAKING METALLIC POWDER; APPARATUS OR DEVICES SPECIALLY ADAPTED FOR METALLIC POWDER
    • B22F3/00Manufacture of workpieces or articles from metallic powder characterised by the manner of compacting or sintering; Apparatus specially adapted therefor ; Presses and furnaces
    • B22F3/02Compacting only
    • BPERFORMING OPERATIONS; TRANSPORTING
    • B22CASTING; POWDER METALLURGY
    • B22FWORKING METALLIC POWDER; MANUFACTURE OF ARTICLES FROM METALLIC POWDER; MAKING METALLIC POWDER; APPARATUS OR DEVICES SPECIALLY ADAPTED FOR METALLIC POWDER
    • B22F3/00Manufacture of workpieces or articles from metallic powder characterised by the manner of compacting or sintering; Apparatus specially adapted therefor ; Presses and furnaces
    • B22F3/22Manufacture of workpieces or articles from metallic powder characterised by the manner of compacting or sintering; Apparatus specially adapted therefor ; Presses and furnaces for producing castings from a slip
    • BPERFORMING OPERATIONS; TRANSPORTING
    • B22CASTING; POWDER METALLURGY
    • B22FWORKING METALLIC POWDER; MANUFACTURE OF ARTICLES FROM METALLIC POWDER; MAKING METALLIC POWDER; APPARATUS OR DEVICES SPECIALLY ADAPTED FOR METALLIC POWDER
    • B22F9/00Making metallic powder or suspensions thereof
    • B22F9/02Making metallic powder or suspensions thereof using physical processes
    • B22F9/04Making metallic powder or suspensions thereof using physical processes starting from solid material, e.g. by crushing, grinding or milling
    • CCHEMISTRY; METALLURGY
    • C04CEMENTS; CONCRETE; ARTIFICIAL STONE; CERAMICS; REFRACTORIES
    • C04BLIME, MAGNESIA; SLAG; CEMENTS; COMPOSITIONS THEREOF, e.g. MORTARS, CONCRETE OR LIKE BUILDING MATERIALS; ARTIFICIAL STONE; CERAMICS; REFRACTORIES; TREATMENT OF NATURAL STONE
    • C04B14/00Use of inorganic materials as fillers, e.g. pigments, for mortars, concrete or artificial stone; Treatment of inorganic materials specially adapted to enhance their filling properties in mortars, concrete or artificial stone
    • C04B14/02Granular materials, e.g. microballoons
    • C04B14/04Silica-rich materials; Silicates
    • C04B14/22Glass ; Devitrified glass
    • CCHEMISTRY; METALLURGY
    • C04CEMENTS; CONCRETE; ARTIFICIAL STONE; CERAMICS; REFRACTORIES
    • C04BLIME, MAGNESIA; SLAG; CEMENTS; COMPOSITIONS THEREOF, e.g. MORTARS, CONCRETE OR LIKE BUILDING MATERIALS; ARTIFICIAL STONE; CERAMICS; REFRACTORIES; TREATMENT OF NATURAL STONE
    • C04B14/00Use of inorganic materials as fillers, e.g. pigments, for mortars, concrete or artificial stone; Treatment of inorganic materials specially adapted to enhance their filling properties in mortars, concrete or artificial stone
    • C04B14/02Granular materials, e.g. microballoons
    • C04B14/30Oxides other than silica
    • C04B14/303Alumina
    • CCHEMISTRY; METALLURGY
    • C04CEMENTS; CONCRETE; ARTIFICIAL STONE; CERAMICS; REFRACTORIES
    • C04BLIME, MAGNESIA; SLAG; CEMENTS; COMPOSITIONS THEREOF, e.g. MORTARS, CONCRETE OR LIKE BUILDING MATERIALS; ARTIFICIAL STONE; CERAMICS; REFRACTORIES; TREATMENT OF NATURAL STONE
    • C04B14/00Use of inorganic materials as fillers, e.g. pigments, for mortars, concrete or artificial stone; Treatment of inorganic materials specially adapted to enhance their filling properties in mortars, concrete or artificial stone
    • C04B14/02Granular materials, e.g. microballoons
    • C04B14/34Metals, e.g. ferro-silicon
    • CCHEMISTRY; METALLURGY
    • C04CEMENTS; CONCRETE; ARTIFICIAL STONE; CERAMICS; REFRACTORIES
    • C04BLIME, MAGNESIA; SLAG; CEMENTS; COMPOSITIONS THEREOF, e.g. MORTARS, CONCRETE OR LIKE BUILDING MATERIALS; ARTIFICIAL STONE; CERAMICS; REFRACTORIES; TREATMENT OF NATURAL STONE
    • C04B26/00Compositions of mortars, concrete or artificial stone, containing only organic binders, e.g. polymer or resin concrete
    • C04B26/02Macromolecular compounds
    • C04B26/04Macromolecular compounds obtained by reactions only involving carbon-to-carbon unsaturated bonds
    • C04B26/06Acrylates
    • CCHEMISTRY; METALLURGY
    • C04CEMENTS; CONCRETE; ARTIFICIAL STONE; CERAMICS; REFRACTORIES
    • C04BLIME, MAGNESIA; SLAG; CEMENTS; COMPOSITIONS THEREOF, e.g. MORTARS, CONCRETE OR LIKE BUILDING MATERIALS; ARTIFICIAL STONE; CERAMICS; REFRACTORIES; TREATMENT OF NATURAL STONE
    • C04B30/00Compositions for artificial stone, not containing binders
    • CCHEMISTRY; METALLURGY
    • C08ORGANIC MACROMOLECULAR COMPOUNDS; THEIR PREPARATION OR CHEMICAL WORKING-UP; COMPOSITIONS BASED THEREON
    • C08KUse of inorganic or non-macromolecular organic substances as compounding ingredients
    • C08K3/00Use of inorganic substances as compounding ingredients
    • C08K3/02Elements
    • C08K3/08Metals
    • CCHEMISTRY; METALLURGY
    • C23COATING METALLIC MATERIAL; COATING MATERIAL WITH METALLIC MATERIAL; CHEMICAL SURFACE TREATMENT; DIFFUSION TREATMENT OF METALLIC MATERIAL; COATING BY VACUUM EVAPORATION, BY SPUTTERING, BY ION IMPLANTATION OR BY CHEMICAL VAPOUR DEPOSITION, IN GENERAL; INHIBITING CORROSION OF METALLIC MATERIAL OR INCRUSTATION IN GENERAL
    • C23CCOATING METALLIC MATERIAL; COATING MATERIAL WITH METALLIC MATERIAL; SURFACE TREATMENT OF METALLIC MATERIAL BY DIFFUSION INTO THE SURFACE, BY CHEMICAL CONVERSION OR SUBSTITUTION; COATING BY VACUUM EVAPORATION, BY SPUTTERING, BY ION IMPLANTATION OR BY CHEMICAL VAPOUR DEPOSITION, IN GENERAL
    • C23C24/00Coating starting from inorganic powder
    • C23C24/02Coating starting from inorganic powder by application of pressure only
    • C23C24/04Impact or kinetic deposition of particles
    • CCHEMISTRY; METALLURGY
    • C23COATING METALLIC MATERIAL; COATING MATERIAL WITH METALLIC MATERIAL; CHEMICAL SURFACE TREATMENT; DIFFUSION TREATMENT OF METALLIC MATERIAL; COATING BY VACUUM EVAPORATION, BY SPUTTERING, BY ION IMPLANTATION OR BY CHEMICAL VAPOUR DEPOSITION, IN GENERAL; INHIBITING CORROSION OF METALLIC MATERIAL OR INCRUSTATION IN GENERAL
    • C23CCOATING METALLIC MATERIAL; COATING MATERIAL WITH METALLIC MATERIAL; SURFACE TREATMENT OF METALLIC MATERIAL BY DIFFUSION INTO THE SURFACE, BY CHEMICAL CONVERSION OR SUBSTITUTION; COATING BY VACUUM EVAPORATION, BY SPUTTERING, BY ION IMPLANTATION OR BY CHEMICAL VAPOUR DEPOSITION, IN GENERAL
    • C23C4/00Coating by spraying the coating material in the molten state, e.g. by flame, plasma or electric discharge
    • C23C4/04Coating by spraying the coating material in the molten state, e.g. by flame, plasma or electric discharge characterised by the coating material
    • C23C4/06Metallic material
    • C23C4/08Metallic material containing only metal elements
    • CCHEMISTRY; METALLURGY
    • C23COATING METALLIC MATERIAL; COATING MATERIAL WITH METALLIC MATERIAL; CHEMICAL SURFACE TREATMENT; DIFFUSION TREATMENT OF METALLIC MATERIAL; COATING BY VACUUM EVAPORATION, BY SPUTTERING, BY ION IMPLANTATION OR BY CHEMICAL VAPOUR DEPOSITION, IN GENERAL; INHIBITING CORROSION OF METALLIC MATERIAL OR INCRUSTATION IN GENERAL
    • C23CCOATING METALLIC MATERIAL; COATING MATERIAL WITH METALLIC MATERIAL; SURFACE TREATMENT OF METALLIC MATERIAL BY DIFFUSION INTO THE SURFACE, BY CHEMICAL CONVERSION OR SUBSTITUTION; COATING BY VACUUM EVAPORATION, BY SPUTTERING, BY ION IMPLANTATION OR BY CHEMICAL VAPOUR DEPOSITION, IN GENERAL
    • C23C4/00Coating by spraying the coating material in the molten state, e.g. by flame, plasma or electric discharge
    • C23C4/12Coating by spraying the coating material in the molten state, e.g. by flame, plasma or electric discharge characterised by the method of spraying
    • C23C4/129Flame spraying
    • BPERFORMING OPERATIONS; TRANSPORTING
    • B22CASTING; POWDER METALLURGY
    • B22FWORKING METALLIC POWDER; MANUFACTURE OF ARTICLES FROM METALLIC POWDER; MAKING METALLIC POWDER; APPARATUS OR DEVICES SPECIALLY ADAPTED FOR METALLIC POWDER
    • B22F2301/00Metallic composition of the powder or its coating
    • B22F2301/05Light metals
    • B22F2301/052Aluminium
    • BPERFORMING OPERATIONS; TRANSPORTING
    • B22CASTING; POWDER METALLURGY
    • B22FWORKING METALLIC POWDER; MANUFACTURE OF ARTICLES FROM METALLIC POWDER; MAKING METALLIC POWDER; APPARATUS OR DEVICES SPECIALLY ADAPTED FOR METALLIC POWDER
    • B22F2301/00Metallic composition of the powder or its coating
    • B22F2301/10Copper
    • BPERFORMING OPERATIONS; TRANSPORTING
    • B22CASTING; POWDER METALLURGY
    • B22FWORKING METALLIC POWDER; MANUFACTURE OF ARTICLES FROM METALLIC POWDER; MAKING METALLIC POWDER; APPARATUS OR DEVICES SPECIALLY ADAPTED FOR METALLIC POWDER
    • B22F2304/00Physical aspects of the powder
    • B22F2304/10Micron size particles, i.e. above 1 micrometer up to 500 micrometer
    • BPERFORMING OPERATIONS; TRANSPORTING
    • B22CASTING; POWDER METALLURGY
    • B22FWORKING METALLIC POWDER; MANUFACTURE OF ARTICLES FROM METALLIC POWDER; MAKING METALLIC POWDER; APPARATUS OR DEVICES SPECIALLY ADAPTED FOR METALLIC POWDER
    • B22F2998/00Supplementary information concerning processes or compositions relating to powder metallurgy
    • B22F2998/10Processes characterised by the sequence of their steps
    • BPERFORMING OPERATIONS; TRANSPORTING
    • B22CASTING; POWDER METALLURGY
    • B22FWORKING METALLIC POWDER; MANUFACTURE OF ARTICLES FROM METALLIC POWDER; MAKING METALLIC POWDER; APPARATUS OR DEVICES SPECIALLY ADAPTED FOR METALLIC POWDER
    • B22F3/00Manufacture of workpieces or articles from metallic powder characterised by the manner of compacting or sintering; Apparatus specially adapted therefor ; Presses and furnaces
    • B22F3/22Manufacture of workpieces or articles from metallic powder characterised by the manner of compacting or sintering; Apparatus specially adapted therefor ; Presses and furnaces for producing castings from a slip
    • B22F3/227Manufacture of workpieces or articles from metallic powder characterised by the manner of compacting or sintering; Apparatus specially adapted therefor ; Presses and furnaces for producing castings from a slip by organic binder assisted extrusion
    • CCHEMISTRY; METALLURGY
    • C04CEMENTS; CONCRETE; ARTIFICIAL STONE; CERAMICS; REFRACTORIES
    • C04BLIME, MAGNESIA; SLAG; CEMENTS; COMPOSITIONS THEREOF, e.g. MORTARS, CONCRETE OR LIKE BUILDING MATERIALS; ARTIFICIAL STONE; CERAMICS; REFRACTORIES; TREATMENT OF NATURAL STONE
    • C04B2111/00Mortars, concrete or artificial stone or mixtures to prepare them, characterised by specific function, property or use
    • C04B2111/00034Physico-chemical characteristics of the mixtures
    • C04B2111/00146Sprayable or pumpable mixtures
    • C04B2111/00155Sprayable, i.e. concrete-like, materials able to be shaped by spraying instead of by casting, e.g. gunite

Definitions

  • the present invention relates to particle-containing cylinders which can be separated by simple methods and converted into aerosol form. These aerosols are particularly suitable to be in the form of an aerosol stream in one
  • Uniformity depends. This is especially true when a thin and yet reliable coating should be obtained.
  • Known methods use for generating the coatings, for example, kinetic energy, thermal energy or mixtures thereof, wherein the thermal energy may for example come from a conventional combustion flame or a plasma flame.
  • the latter are further distinguished in thermal and non-thermal plasmas, which have in common that a gas is partially or completely separated into free charge carriers such as ions or electrons.
  • the formation of the coating takes place by applying a powder to a substrate surface, the powder particles being greatly accelerated.
  • a heated process gas by expansion in a Laval nozzle For this purpose, a heated process gas by expansion in a Laval nozzle
  • WO 2010/003396 A1 discloses the use of cold gas spraying as a coating method for applying wear protection coatings.
  • Flame spraying belongs to the group of thermal coating processes.
  • a powdery coating material is introduced into the flame of a fuel gas-oxygen mixture.
  • acetylene oxygen flames temperatures of up to about 3200 ° C can be achieved.
  • Details of the method may include publications such as e.g. EP 830 464 B1 and US 5,207,382 A are taken.
  • thermal plasma spraying a powdery coating material is injected into a thermal plasma.
  • temperatures of up to about 20,000 K are reached, whereby the injected powder is melted and deposited as a coating on a substrate.
  • thermal plasma spraying and specific embodiments as well as process parameters are known to the person skilled in the art.
  • EP 0 344 781 discloses the use of flame spraying and thermal plasma spraying as a coating method using a tungsten carbide powder mixture.
  • Specific devices for use in plasma spraying methods are widely described in the literature, such as in EP 0 342 428 A2, US 7,678,428 B2, US 7,928,338 B2 and EP 1 287 898 A2.
  • High speed flame spraying is well known to those skilled in the art and has been described in numerous publications.
  • EP 0 825 272 A2 discloses a substrate coating with a copper alloy using the high-speed flame spraying.
  • WO 2010/037548 A1 and EP 0 492 384 A1 disclose the method of high speed flame spraying and apparatus for use herein.
  • the non-thermal plasma spraying is largely analogous to the thermal
  • a powder coating material is injected into a non-thermal plasma and applied to a substrate surface.
  • this method is characterized by a particularly low thermal load of the coated
  • particulate coating material it is, however, that to produce a homogeneous, but thin coating, a very high homogeneity of the particle aerosol used is required.
  • a very high homogeneity of the particle aerosol used is required.
  • An object of the present invention is therefore to provide a simple process for the uniform promotion of particles and the means required for this purpose.
  • aerosol streams are to be obtained which are advantageous in
  • Coating process can be used. At the same time as small as possible apparatus requirements are placed on the powder delivery and broad spectra of particles can be used without major equipment adjustments. This object is achieved by the objects, methods and uses specified in the claims and aspects.
  • the present invention relates to a process for producing a particle-containing aerosol, wherein the cylinder has a volume of at least 5 cm 3 and is dimensionally stable,
  • the proportion of particles is in the range from 10% by weight to 99.9% by weight, based on the total weight of the cylinder,
  • the particles are selected from the group consisting of metal particles,
  • the particles contained in the cylinder have a d 50 of at most 300 ⁇ and the cylinder has at least 0.01 wt .-% binder, based on the
  • the binder is selected from the group consisting of inorganic binders, organic binders and mixtures thereof.
  • the sum of all wt .-% of the components of a cylinder according to the invention can be a total of at most 100 wt .-%.
  • the inorganic binders are selected from the group consisting of calcium sulfate, talc, calcium hydroxide, silica, alumina, calcium carbonate, calcium silicate hydrates,
  • the organic binders are preferably selected from the group consisting of cellulose, cellulose derivatives, polysaccharides, gelatin, polyvinyls, polyacrylates, polyethylene oxides,
  • polyacrylate copolymers in the context of the present invention denotes corresponding copolymers which are not included in the term polyacrylate, examples of which are styrene-acrylate copolymers
  • polyaldehyde copolymers for the purposes of the present invention denotes corresponding copolymers which are not of the term polyaldehyde are included. Examples of these are cyclohexanone-formaldehyde copolymers.
  • polyolefin copolymers in the context of the present invention denotes corresponding copolymers which are not included in the term polyolefin.
  • polyolefin refers to corresponding polymers which are not included in the term polyvinyl
  • cylinder in the context of the present invention is understood in principle to mean the geometric basic form known as cylinder, i. one of two parallel, flat, congruent surfaces (base and top surface) and a shell or
  • Cylindrical surface of limited body wherein the lateral surface is formed by parallel straight lines.
  • the term cylinder in the sense of the present invention also theoretically includes endless cylindrical shapes, which are for example by means of a
  • the cylinders of the present invention are individual cylinders, the length of which is preferably less than 2 meters, more preferably less than 1 meter.
  • the cylinder according to the invention can of course be considered as a real body of the ideal structure of a geometrically perfect cylinder.
  • the real structure can be approximated to 5 vol%, more preferably up to 3 vol%, by means of a geometrically ideal cylinder.
  • pieces of the cylinder are separated and measured at random selection to determine the average volume.
  • the length of the pieces is in this case at least 7 cm, preferably 7 cm, provided that the arithmetic mean of the base and top surface is at least 7 cm 2 .
  • the length is at least x cm, preferably x cm.
  • the determination of the volume is carried out by methods familiar to the person skilled in the art, for example the determination of the displaced volume of the relevant cylinder in a liquid.
  • the term "dimensionally stable" is understood to mean that the cylinder does not disintegrate, ie crumble or break, under typical conditions such as storage, transport and insertion into corresponding devices at least 0.006 N / mm 2 .
  • a test specimen is preferably in the form of a cuboid with a square base (2 cm) edge length and a height of at least 9 cm on two parallel
  • Support rods arranged at a distance of 8 cm in the middle. If the cylinder to be tested does not have a cuboid shape, it can be brought into the cuboid shape, for example, by grinding, sawing, cutting, etc.
  • pressure is exerted from above by means of a load rod and the applied force is recorded.
  • Support rods and load rod are cylindrical bodies with circular base and a diameter of 5 mm. The support rods and the load rod are freely supported to minimize friction.
  • the measuring instrument used is preferably an Instron 5565 universal testing machine at 22 ° C. and 45% relative humidity. The measurement is carried out by means of a
  • the arithmetic mean of at least 5 samples, preferably 5 samples, is used. Individual faulty samples are naturally discarded and not used in the calculation. For example, a lower flexural strength may be caused by an air bubble trapped in the column.
  • the flexural strength of individual samples is disregarded, provided that their flexural strength deviates by at least 10% from the arithmetic mean of the remaining samples, with the most deviant samples discarded. In this case, up to 10% of the samples, the number of these 10% rounded up to an integer, can be discarded. Instead of these discarded samples become unique
  • glass particles are understood in particular to be particles having silicon dioxide as the main constituent.
  • An example of a particularly advantageous glass to be used is borosilicate glass.
  • microparticles is preferably understood as meaning particles of mica, such as, for example, fluorophlogopite. Although have natural mica
  • Composition must be respected, for example, in the food sector or the semiconductor industry, to prefer synthetic mica.
  • An example of ceramic particles are particles of alumina ceramics.
  • the present invention relates to a particle-containing cylinder, wherein the cylinder has a volume of at least 5 cm 3 and is dimensionally stable,
  • the particles are selected from the group consisting of metal particles,
  • the particles contained in the cylinder have a d 50 of at most 300 ⁇ and the cylinder has at least 0.01 wt .-% binder, based on the
  • the binder is selected from the group consisting of inorganic binders, organic binders and mixtures thereof.
  • the inorganic binders are selected from the group consisting of calcium sulfate, talc, calcium hydroxide, silica, alumina, calcium carbonate, calcium silicate hydrates, calcium aluminate hydrates, and mixtures thereof.
  • the organic binders are preferably selected from the group consisting of cellulose, cellulose derivatives, polysaccharides, gelatin, polyvinyls, polyacrylates, polyethylene oxides, polyethylene glycols, polyamides,
  • Epoxy resins polyurethanes, polyaldehydes, polyolefins, polyacrylate copolymers,
  • Polyaldehyde copolymers polyesters, polyolefin copolymers, the salts of the abovementioned substances and mixtures thereof, more preferably from the group consisting of cellulose, cellulose derivatives, polysaccharides, gelatin, polyvinyls, polyacrylates,
  • Polyethylene oxides polyethylene glycols, polyamides, epoxy resins, polyurethanes, polyacrylate copolymers, polyaldehyde copolymers, polyesters, polyolefin copolymers, the salts of the abovementioned substances and mixtures thereof, more preferably from the group consisting of cellulose, cellulose derivatives, polysaccharides, gelatin,
  • Epoxy resins the salts of the aforementioned substances and mixtures thereof.
  • Preferred developments of the cylinders according to the invention can be found, for example, in aspects 30 to 50 and claim 14. Furthermore, the present invention relates to the use of a cylinder according to the invention for producing a particle-containing aerosol. Preferred developments of the uses according to the invention can be found, for example, in aspect 52.
  • the present invention relates to an article by means of a
  • Aerosol produced according to the invention was coated.
  • the present invention relates to a process for producing a particle-containing aerosol, wherein a particle-containing cylinder is comminuted.
  • the comminution of the cylinder can be carried out by means of methods familiar to the person skilled in the art.
  • devices using a brush or sanding belt have been proven.
  • Corresponding devices using a brush are also widely used, for example, for transferring a loose powder in aerosol form.
  • Conveyors use rotating milling heads such as roughing or face milling cutters. Further, abrasive wheels or abrasive rollers may be used with abrasive grains such as silicon carbide, tungsten carbide or diamond.
  • a particular advantage of the present invention is that particularly easy to process columns can be obtained, which can be used by means of simple conveying method such as the brush promotion without heavy wear on the conveyor.
  • the average particle size (D 50 ) of the aerosol is preferably at most 5 times, more preferably at most 3 times, even more preferably at most 2 times the size of the particles.
  • the measurement of the mean particle size of the particles contained in the column and the aerosol particles is preferably carried out by means of laser granulometry using a particle size analyzer HELOS of the Fa.
  • the dispersion of a dry powder can in this case with a dispersing unit of the type Rodos T4.1 in a Primary pressure of 4 bar, for example.
  • the evaluation of the scattered light signals is carried out according to the Fraunhofer method.
  • the aerosol according to the invention is preferably converted directly into the desired application as an aerosol stream.
  • Plasma spraying can be used. It is believed that coating processes which typically cause only very little activation of the incorporated particles benefit particularly strongly from the particularly homogeneous aerosol flow, resulting in very homogeneous and high quality coatings.
  • the aerosol prepared according to the invention can be used for coating a wide variety of substances using a wide variety of coating methods. Coating processes which are selected from the group consisting of cold gas spraying, flame spraying, high-speed flame spraying, thermal plasma spraying and non-thermal plasma spraying have proved particularly advantageous in this connection.
  • the invention has
  • the cold gas spraying is characterized in that a particulate material to be applied is not melted in the gas jet, but that the particles are greatly accelerated and form a coating on the surface of the substrate due to their kinetic energy.
  • gases known to those skilled in the art can be used as the carrier gas, for example nitrogen, helium, argon, air, krypton, neon, xenon, carbon dioxide, oxygen or mixtures thereof. In certain variants, it is particularly preferred that the gas used is air, helium or mixtures thereof.
  • the particles can be accelerated up to 2000 m / s. In certain variants of cold gas spraying, however, it is preferred that the particles have, for example, speeds between 300 m / s and 1600 m / s, preferably between 1000 m / s and 1600 m / s, more preferably between 1250 m / s and 1600 m / s.
  • a particulate material is converted into the liquid or plastic state by means of a flame and then applied as a coating to a substrate.
  • a substrate e.g. a mixture of oxygen and a combustible gas such as acetylene or hydrogen burned.
  • part of the oxygen is used to make the powdery one
  • a particulate material is converted into a liquid or plastic state by means of a flame during high-speed flame spraying.
  • the particles are accelerated significantly faster compared to the aforementioned method.
  • a velocity of the gas stream of 1220 to 1525 m / s is called with a velocity of the particles of about 550 to 795 m / s.
  • gas velocities of over 2000 m / s are achieved.
  • the speed of the flame is between 1000 and 2500 m / s.
  • the speed of the flame is between 1000 and 2500 m / s.
  • the speed of the flame is between 1000 and 2500 m / s.
  • the speed of the flame is between 1000 and 2500 m / s.
  • the speed of the flame is between 1000 and 2500 m / s.
  • the speed of the flame is between 1000 and 2500 m / s.
  • the common variants that the speed of the flame is between 1000 and 2500 m / s
  • Flame temperature between 2200 ° C and 3000 ° C is.
  • the temperature of the flame is thus comparable to the temperature during flame spraying. This is achieved by
  • the detonation / explosive flame spraying can be classified as subspecies of the
  • High velocity flame spraying This becomes a particulate Material greatly accelerated by repeated detonations of a gas mixture such as acetylene / oxygen, for example, particle velocities of about 730 m / s are achieved.
  • the detonation frequency of the method is in this case, for example, between about 4 to 10 Hz.
  • detonation frequencies are selected by about 100 Hz.
  • the resulting layers should usually have a particularly high hardness, strength, density and good bonding to the substrate surface. Disadvantages of the above-mentioned methods are the increased safety expenditure, and for example the high noise pollution due to the high gas velocities.
  • a primary gas such as argon at a rate of 40 l / min and a secondary gas such as hydrogen with a
  • the feed of 40 g / min of the powdery coating material by means of a carrier gas stream, which is passed at a rate of 4 l / min in the plasma flame.
  • the delivery rate of the powdered coating material is between 5 g / min and 60 g / min, more preferably between 10 g / min and 40 g / min.
  • it is preferably argon, helium or
  • the total gas flow is also preferably 30 to 150 SLPM (standard liters per minute) for certain variants.
  • the electrical power used for the ionization of the gas flow without the heat energy dissipated as a result of cooling can be selected, for example, between 5 and 100 kW, preferably between 40 and 80 kW.
  • Plasma temperatures between 4000 K and a few 10000 K can be achieved.
  • a non-thermal plasma is used to activate the powdery coating material.
  • the plasma used in this case is generated for example with a barrier discharge or corona discharge with a frequency of 50 Hz to 1 MHz.
  • the temperature of the plasma is preferably less than 3000 K, preferably less than 2500 K and more preferably less than 2000 K. This minimizes the technical complexity and keeps the energy input in the applied coating material as low as possible, which in turn allows a gentle coating of the substrate ,
  • the magnitude of the temperature of the plasma flame is thus preferably comparable to that in flame spraying or in
  • High velocity flame spraying Targeted choice of parameters also allows the generation of nonthermal plasmas with core temperatures below 1 173 K or even below 773 K in the core region.
  • the measurement of the temperature in the core region takes place here, for example, with a thermocouple type NiCr / Ni and a tip diameter of 3 mm in 10 mm distance from the nozzle exit in the core of the exiting plasma jet at ambient pressure.
  • Such non-thermal plasmas are especially for
  • Coatings of very temperature-sensitive substrates suitable.
  • Coating with the best possible utilization of the coating material used As a distance of the spray lance to the substrate, for example, a distance of 1 mm is selected. This allows for the greatest possible flexibility of the coatings while ensuring high-quality coatings. Conveniently, the distance between the spray lance and the substrate is between 1 mm and 35 mm.
  • ionizable gas various gases known to those skilled in the art and mixtures thereof can be used in the non-thermal plasma process. Examples include helium, argon, xenon, nitrogen, oxygen, hydrogen or air,
  • argon or air.
  • a particularly preferred ionizable gas is air.
  • the speed of the plasma flow is below 200 m / s.
  • Flow rate can, for example, a value between 0.01 m / s and 100 m / s, preferably between 0.2 m / s and 10 m / s are selected.
  • the volume flow of the carrier gas is between 10 and 25 l / min, more preferably between 15 and 19 l / min.
  • the cylinders according to the invention allow a particularly uniform delivery of the particles and thus the generation of a particularly homogeneous aerosol.
  • an aerosol flow is generated whose variation is less than 20%, preferably less than 10%, more preferably less than 5%.
  • Such a uniform promotion can be maintained, for example, over a period of at least 10 minutes, preferably at least 20 minutes, more preferably at least 40 minutes.
  • the embodiments are at least 2 times, preferably at least 3 times, more preferably at least 4 times, the arithmetic mean of the longest axes along the base surface and the top surface.
  • “height" of the cylinder is meant the distance between base and top surface, for example, the height of a cylindrical base and top surface of the invention having a diameter of 5 cm is advantageously at least 10 cm, preferably at least 15 cm, more preferably at least 20 cm ,
  • the base and top surfaces of the particle-containing cylinders are substantially elliptical or circular, preferably circular.
  • the surface area of the base surface and top surface to a deviation of at most 10%, more preferably of at most 7%, even more preferably of at most 4%, of the
  • the deviation is less than 3 °, more preferably less than 2 °.
  • the present invention relates to particle-containing cylinders, wherein the cylinder has a volume of at least 5 cm 3 and is dimensionally stable,
  • the proportion of particles is in the range from 10% by weight to 99.9% by weight, based on the total weight of the cylinder,
  • the particles are selected from the group consisting of metal particles,
  • the particles contained in the cylinder have a d 50 of at most 300 ⁇ and the cylinder has at least 0.01 wt .-% binder, based on the
  • the binder is selected from the group consisting of inorganic binders, organic binders and mixtures thereof.
  • the inorganic binders are selected from the group consisting of calcium sulfate, talc, calcium hydroxide,
  • the organic binders will preferably be selected from the group consisting of cellulose,
  • Polyethylene oxides polyethylene glycols, polyamides, epoxy resins, polyurethanes, Polyaldehydes, polyolefins, polyacrylate copolymers, polyaldehyde copolymers,
  • the determination of the amount of particles and amount of binder is carried out by methods familiar to the person skilled in the art, such as AAS, EDX and RFA.
  • the total weight of the cylinder is determined in the dry state. Preferably after at least 24 hours, more preferably 24 hours, storage under STPD conditions (0 ° C, 101 kPa and
  • the cylinders preferably have a flexural strength of at least 0.0075 N / mm 2 , more preferably at least 0.0105 N / mm 2 , even more preferably at least 0.012 N / mm 2 , even more preferably at least 0.015 N / mm 2 , It also showed that by using cylinders with lower
  • the flexural strength is preferably at most 2.1 N / mm 2, more preferably at most 1, 2 N / mm 2, even more preferably at most 0.675 N / mm 2.
  • the flexural strength be in the range of 0.0075 to 3.75 N / mm 2 , more preferably in the range of 0.0105 to 2, 1 N / mm 2 , even more preferably in the range of 0.012 is to 1, 2 N / mm 2 and even more preferably in the range from 0.015 to 0.675 N / mm 2.
  • the bending strength of the skilled person for example, on the choice of
  • Binder its amount, the amount of optionally contained fillers, etc. are set specifically.
  • An increase in the bending strength can be achieved, for example, by using a high-strength binder, increasing the binder ratio, pressure when compressing respective cylinders, etc.
  • a Humiliation can be achieved, for example, by choosing a binder with lower
  • Binding effect the lowering of the binder content, the increase of the
  • Solvent the addition of a filler, etc. can be achieved. It has also been observed that in order to achieve identical flexural strength, the more binder the more particles are required, the more typically the binder must be used
  • Ideal shape deviate and the lower the density of the material of the particles. Furthermore, it has proved to produce homogeneous cylinder advantageous if, for example, in manufacturing processes such as slip casting, the amount of solvent is kept as low as possible. A corresponding suspension should be flowable, but should contain as little solvent as possible. Further, various additives can be used to make the cylinders of the present invention. For example, rheology-modifying additives can be used which impart thixotropic behavior to the corresponding suspensions. In addition, wetting aids can be used to facilitate, for example, incorporation of the particles and / or the binder in the desired solvent. Examples of these are surfactants or organic solvents.
  • the particles may also be coated with binder prior to preparation of the column. This has the advantage that a particularly homogeneous distribution of the binder, even at low binder amounts without strong mixing steps or
  • Solvent can be achieved.
  • Such a coating for example consisting of a monomer, is optionally polymerized with further binder in order to effect the cohesion of the column. It can, however
  • the coated particulate material without further binder transferred into a mold and cured thermally.
  • coatings of the particles which are at least one of the binder are at least one of the binder
  • Polyacrylate coating at a polyacrylate binder or a silicon oxide-containing coating with silica binder counted to the amount of binder Preferably, however, only coatings of the particles are counted to the amount of binder, which have also formed a covalent bond to the binder.
  • Rheology-modifying additives may include, for example, polymeric materials such as polyacrylamides, polyacrylic acids, carboxymethylcelluloses, Hydroxypropyl methylcelluloses, methylcelluloses, alginates, polyethylene glycols,
  • Polyvinyl alcohols polyvinylpyrrolidones, polyurethanes and polysaccharides and
  • inorganic additives such as silica and organoclay
  • silica and organoclay can be used.
  • BYK-Chemie, BYK-410, BYK-1 1, BYK-415, BYK-420, BYK-425, BYK ⁇ 128, BYK-430 and BYK-431 are available as polymeric rheology-modifying additives.
  • An example of the organociays are bentonites.
  • a rheology modifying additive from the group of silicas for example, pyrogenic silica can be used.
  • the particles used in the cylinders according to the invention preferably have a d 50 in a range of 1 ⁇ to 300 ⁇ , preferably in a range of 1, 5 ⁇ to 230 ⁇ , more preferably in a range of 2 ⁇ to 180 ⁇ , even more preferably in a range of 2.5 ⁇ to 150 ⁇ , on. These showed a good and homogeneous under a wide range of delivery conditions and flow rates
  • the content of particles is preferably in a range of
  • the aerosol stream according to the invention is to be used in an application in which, for example, a small amount of energy is to be introduced, such as non-thermal plasma spraying, it proved to be difficult with the non-platelet-shaped coating material to be particularly mild
  • the particles of the cylinders of the invention are platelet-shaped particles, wherein the proportion of platelet-shaped particles in the particle-containing cylinder in a range of 30 wt .-% to 75 wt .-%, preferably in a range of 40 wt % to 70% by weight, more preferably in a range of 50 wt .-% to 65 wt .-%, in each case based on the total weight of the cylinder.
  • These cylinders provided good results in terms of particle conveyability and in subsequent applications such as non-thermal plasma spraying. The good results even under very mild coating conditions are attributed to the fact that the significantly larger surface area of these particles is a stronger one
  • platelet-shaped means that corresponding particles have an aspect ratio of at least 10. Particles having an aspect ratio of less than 10 are referred to as “non-platelet-shaped" in the context of the present invention.
  • the term "aspect ratio” for the purposes of the present invention denotes the ratio of mean particle diameter (d 50 ) to average particle thickness (h 50 ).
  • the term “d 50 " or else "d 5 o value” denotes the value at which 50%
  • the measurements are preferably carried out using the particle size analyzer HELOS from Sympatec GmbH, Clausthal-Zellerfeld, Germany, in which the dispersion of a dry powder can be carried out with a dispersion unit from the Type Rodos T4.1 at a primary pressure of 4 bar, for example, Alternatively, the size distribution curve of the particles, for example, with a device of the Fa.
  • Quantachrome (device: Cilas 1064) according to the manufacturer's instructions. For this purpose, 1, 5 g of the powdered coating material are dispersed in about 100 ml of ethanol, 300 seconds in an ultrasonic bath (device: Sonorex IK 52, Fa. Bandelin) treated and then added by means of a Pasteur pipette in the sample preparation cell of the meter and measured several times. From the individual
  • the thickness of the particles can be determined, for example, by means of SEM as follows.
  • the platelet-shaped particles according to the invention are first washed with acetone and then dried out.
  • a conventional in electron microscopy resin such as TEMPFIX (Gerhard Neubauer chemicals, D-48031 Weg, Germany) is applied to a sample plate and heated on a hot plate until softening. Subsequently, the sample tray is removed from the hot plate and the particles are sprinkled on the softened resin.
  • the resin solidifies again and the scattered particles can - due to the interplay between adhesion and gravity - be prepared almost vertically and fixed on the sample tray.
  • the particles are easy to measure laterally in the electron microscope.
  • h ef rWerten is based on the relative frequencies of the
  • the amount of the particles in the cylinder is in the range of (50 wt .-% - (0.2 ⁇ 0.9), depending on the amount of platelet-shaped particles at x wt .-% platelet-shaped particles, based on the total weight of the particles )% by weight) to (99.9 wt .-% - (0.249 x ⁇ ) wt .-%), preferably in the range of (wt .-% 60 - (0.2 x)% by weight) to (98 Wt .-% - (0.28 ⁇ x) wt .-%), more preferably in the range of (70 wt .-% - (0.2 ⁇ x) wt%) to (97 wt .-% - ( 0.32 ⁇ x) wt .-%), based on the total weight of the cylinder.
  • the cylinder according to the invention comprises fillers which are preferably selected from the group consisting of sheet silicates, clay minerals, metal oxides, silica gel, glass beads and mixtures thereof.
  • the cylinders according to the invention comprise boron nitride.
  • boron nitride for example, an increased abrasion resistance and thermal conductivity could be achieved.
  • the amount of boron nitride is in a range of from 0.1% to 50%, more preferably in a range of from 0.1% to 20%, more preferably in a range from 0.1 wt .-% to 15 wt .-%, each based on the total weight of the cylinder.
  • the total amount of particles and binders in the particle-containing cylinder is at least 90% by weight, preferably at least 95% by weight, more preferably at least 99.9% by weight, based in each case on the total weight of the cylinder.
  • the reduction of contained non-reactive fillers has proved to be advantageous, since hereby improved coating formation could be achieved with, for example, reduced overspray.
  • the particles of the particle-containing cylinder are selected to be at least 90% by weight, preferably at least 95% by weight, more preferably at least 99.9% by weight, of either metal particles or glass particles or Microparticles or ceramic particles, based on the total weight of the particles. Particularly advantageous has the
  • the cylinders according to the invention can be used in the form of individual cylinders or as theoretically endless cylinders.
  • the latter are available for example by means of a direct extrusion of the cylinder material, wherein the extruded cylinder is fed directly into the conveyor.
  • Binders which provide rapid solidification of the cylinder material after the molding step, such as microcrystalline cellulose, are preferred.
  • the use of such a combination of a forming step with the conveying step allows a nearly unlimited, continuous promotion.
  • the use of individual cylinders allows, for example, a simpler device design and a simpler change between different column types.
  • the particle-containing cylinder according to the invention it has typically proven to be advantageous for the particle-containing cylinder according to the invention to have a volume of at least 8 cm 3 , preferably at least 11 cm 3 , more preferably at least 19 cm 3 , even more preferably at least 30 cm 3 , having.
  • the amount of the binders used in further embodiments is in a range from 0.05% to 70%, preferably in a range from 0.07% to 60%, more preferably in one Range from 0.1% to 45% by weight. Further, in other embodiments, preferably the amount of inorganic binder ranges from 1.5% to 70% by weight and the amount of organic binder ranges from 0.05% to 50% by weight. %, more preferably, the amount of inorganic binder in a range of 1.9% by weight to 60% by weight and the amount of organic binder in a range of
  • At least one binder of the particle-containing cylinder is selected from the inorganic binders.
  • These binders have been found to be advantageous for providing particularly stable cylinders which, for example, provide high shelf life and stability under UV radiation.
  • examples of such inorganic binders are calcium sulfate, talc, calcium hydroxide, silica, alumina, calcium carbonate, calcium silicate hydrates, calcium aluminate hydrates, and mixtures thereof, which materials may comprise water, especially in the form of water of crystallization.
  • the particle-containing cylinder preferably comprises at least 1.5% by weight, more preferably at least 1.9% by weight, even more preferably at least 2.2% by weight, of inorganic binders.
  • Calcium sulfate and its hydrates are commercially available, for example, under the name gypsum.
  • gypsum for the applications of the invention have high quality
  • Plaster variants such as dental plasters and model plasters, especially dental plasters, proved to be advantageous. It has shown that low-quality gypsum types such as building gypsum provided significantly worse results. It is believed that controlled setting is required to achieve a homogeneous cylinder structure. Constructions on the other hand seem more uneven due to price-driven mass production
  • substantially means at least 95%, preferably at least 99%. "As far as a material feature is concerned, such as the amount of a constituent material, so are Wt% meant.
  • a particularly preferred inorganic binder is calcium sulfate, wherein the calcium sulfate may comprise water, especially in the form of water of crystallization.
  • the term "calcium sulfate” is also understood as meaning the hydrates of calcium sulphate. This binder has proved to be particularly advantageous because under the typical conditions below
  • Coating can be applied without appreciable impairment of resulting coatings and is suitable due to its low reactivity for the formulation with a wide range of particles of the invention.
  • calcium sulfate has 2 water-bound molecules of water each
  • silica has been found to be a beneficial binder in other embodiments, and the term "silica" within the meaning of the present invention also includes the hydrates of the silica
  • the silica of the present invention is essentially silica
  • the stability of cylinders obtained in this way can be broad Spectrum can be determined by procedural details such as the conditions of curing and the variation of the educts. For example, only when curing at room temperature, different results can be achieved by using a defined gas flow such as air or C0 2 , the duration of the gas flow, and the amount of gas used.
  • water glass can also be varied, for example, by the addition of amorphous silicon, the hardness of the resulting cylinder.
  • At least one binder of the particle-containing cylinder is an organic binder selected from the group consisting of cellulose; Cellulose derivatives such as methylcellulose, ethylcellulose, microcrystalline cellulose, hydroxyethylcellulose, hydroxypropylcellulose,
  • carboxymethyl cellulose carboxymethyl cellulose
  • Polysaccharides such as alginic acid, alginic acid derivatives, starch, starch derivatives, xanthan, dextrins, dextrans, guar gum, locust bean gum, carrageenan and pullulan; Gelatin; Polyvinyls such as polyvinyl alcohols, polyvinyl pyrrolidones and polyvinyl butyrals; Polyacrylates such as polyacrylic acids and polyacrylic acid esters;
  • Polyethylene oxides Polyethylene glycols; polyamides; epoxy resins; the salts of the aforementioned substances and mixtures thereof.
  • These binders have, for example, the advantage that they can burn in the flame of a coating process at least partially, preferably completely, and the resulting gas is not incorporated into the coating and thus can be easily separated.
  • Preferred salts are alkali and alkaline earth salts such as sodium salts, potassium salts, ammonium salts and calcium salts. Further, it is preferred that the cellulose derivatives are water-soluble.
  • the particle-containing cylinder preferably comprises at least 0.05% by weight, more preferably at least 0.07% by weight, even more preferably at least 0.1% by weight, of organic binders.
  • the cellulose derivatives are selected from the group consisting of methylcellulose, ethylcellulose, microcrystalline cellulose, hydroxyethylcellulose, hydroxypropylcellulose, hydroxypropylmethylcellulose,
  • the organic binder is preferably selected from the group consisting of cellulose; Cellulose derivatives such as
  • Hydroxypropylcellulose hydroxypropylmethylcellulose, carboxyethylcellulose and carboxymethylcellulose
  • Polysaccharides such as alginic acid, alginic acid derivatives, starch, starch derivatives, xanthan, dextrins, dextrans, guar gum, locust bean gum, carrageenan and pullulan; Gelatin; Polyvinyls such as polyvinyl alcohols, polyvinyl pyrrolidones and polyvinyl butyrals;
  • Polyacrylates such as polyacrylic acids and polyacrylic acid esters;
  • Polyethylene oxides Polyethylene glycols; polyamides; the salts of the aforementioned substances and mixtures thereof, more preferably selected from the group consisting of cellulose; Cellulose derivatives such as methylcellulose, ethylcellulose, microcrystalline
  • Polysaccharides such as alginic acid, alginic acid derivatives, starch, starch derivatives, xanthan, dextrins, dextrans, guar gum, locust bean gum, carrageenan and pullulan; the salts of the aforementioned substances and mixtures thereof.
  • Particularly preferred polyvinyls are polyvinyl alcohols and polyvinylpyrrolidones.
  • the aforementioned group is also an independent group which is very advantageous for certain embodiments.
  • the polymers according to the invention such as, for example, cellulose derivatives, polysaccharides, polyvinyls, polyacrylates and polyethylene glycols have at least 10 monomer units, more preferably at least 20 monomer units more preferably at least 60 monomer units.
  • the binder is selected from the group consisting of calcium sulfate, talc, calcium carbonate, silica, mixtures of calcium silicate hydrates and calcium aluminate hydrates, mixtures of calcium hydroxide and calcium carbonate, cellulose, cellulose derivatives, polysaccharides, polyvinyls, polyacrylates, polyethylene oxides, Polyethylene glycols, polyamides, the salts of the aforementioned substances and mixtures thereof, preferably from the group consisting of calcium sulfate, silica, cellulose, cellulose derivatives, polysaccharides, polyvinyls, the salts of the aforementioned substances and mixtures thereof, more preferably from the group consisting of calcium sulfate, silica , Cellulosederivaten, polysaccharides, the salts of the aforementioned substances and
  • binders calcium sulfate and silicon oxide may comprise water in bound form, in particular as water of crystallization.
  • Calcium sulphate and cellulose derivatives have proved to be particularly advantageous binders according to the invention.
  • the particles of the particle-containing cylinder are at least 75 wt .-%, preferably at least 87 wt .-%, more preferably at least 98 wt .-% metal particles, based on the total weight of the particles.
  • metal particles is understood to mean that the particles consist of at least 80% by weight, more preferably at least 90% by weight, of elemental metal, metal mixtures or metal alloys.
  • the metal of the metal particles becomes at least
  • the metal of the metal particles comprises at most 5 wt%, more preferably at most 2 wt%, more preferably at most 1 wt%, metals selected from the group consisting of silver,
  • the metal particles are preferably selected from uncoated metal particles and coated metal particles, wherein the amount of the coating of the coated metal pigments is at most 15 wt .-%, preferably at most 12 wt .-%, more preferably at most 10 wt .-%, based on the total weight of the coated metal pigments.
  • the production of the cylinders according to the invention can be carried out, for example, by producing a paste comprising particles, gypsum (calcium sulfate) and water, filling the paste into a mold and curing the paste. To facilitate the processing, a disproportionate amount of water can also be used, which can subsequently be removed again by means of drying processes.
  • the drying can
  • Polysaccharides, cellulose and cellulose derivatives are prepared and solidified by compression.
  • organic binders by means of a
  • Solvent such as water or an organic solvent are converted into a paste form and brought into the desired shape.
  • the cylinders according to the invention can subsequently be obtained by drying the pastes.
  • cylinders produced by in-situ powder pressing, and subsequently used in a conveying process exhibit a very inhomogeneous composition, in particular density gradients, whereby the
  • the cylinders according to the invention have a very homogeneous composition, in particular with regard to the distribution of the particles contained therein.
  • the particularly homogeneous structure of the cylinders according to the invention can be detected, for example, by means of the average density.
  • the average density For this purpose, at least 3, preferably three, slices are cut out of the column perpendicular to the longitudinal axis, the thickness of the slices being at least 1 cm, preferably 1 cm. following the slices are cut into three, preferably approximately equal, sections and their average density determined.
  • the determination of the average density is carried out for example by means of a helium pycnometer type Multipycnometer (Fa.
  • the deviation of the average density of the samples is at most 10%, more preferably at most 7%, even more preferably at most 3%, based on the arithmetic mean of the samples.
  • the present invention relates to the use of a particle-containing cylinder according to the invention for producing a particle-containing aerosol.
  • a particle-containing cylinder according to the invention for producing a particle-containing aerosol.
  • one of the aforementioned specific shapes of the cylinders is used.
  • the present invention relates to a coated article, wherein the coating was carried out using an aerosol, which by means of a method according to one of claims 1 to 12 or one of the aspects 1 to 28 and / or using at least one cylinder according to any one of claims 13 to 14 or one of the aspects 29 to 50 was generated.
  • the present invention preferably relates to a process for producing a particle-containing aerosol, wherein a particle-containing cylinder is comminuted,
  • the bending strength ⁇ is at most 3.75 N / mm 2 , more preferably at most 2, 1 N / mm 2 , even more preferably at most 1.2 N / mm 2 , even more preferably at most 0.675 N / mm 2 , where ⁇ is calculated according to formula (I)
  • the proportion of particles is in the range from 10% by weight to 99.9% by weight, based on the total weight of the cylinder,
  • the particles are selected from the group consisting of metal particles,
  • Glass particles, microparticles, ceramic particles and mixtures thereof, the particles contained in the cylinder have a d 50 of at most 300 ⁇ and the cylinder has at least 0.01 wt .-% binder, based on the
  • the binder is selected from the group consisting of inorganic binders, organic binders and mixtures thereof.
  • the present invention preferably relates to a method according to aspect 1, wherein the inorganic binders are selected from
  • the present invention preferably relates to a process according to one of the aspects 1 to 2, wherein the organic binders are selected from the group consisting of cellulose, cellulose derivatives, polysaccharides, gelatin, polyvinyls, polyacrylates, polyethylene oxides, polyethylene glycols, polyamides,
  • Epoxy resins polyurethanes, polyaldehydes, polyolefins, polyacrylate copolymers, polyaldehyde copolymers, polyesters, polyolefin copolymers, the salts of the abovementioned substances and mixtures thereof, more preferably from the group consisting of cellulose, cellulose derivatives, polysaccharides, gelatin, polyvinyls, polyacrylates,
  • Polyethylene oxides polyethylene glycols, polyamides, epoxy resins, polyurethanes,
  • Polyacrylate copolymers polyaldehyde copolymers, polyesters, polyolefin copolymers, the salts of the abovementioned substances and mixtures thereof, more preferably from the group consisting of cellulose, cellulose derivatives, polysaccharides, gelatin,
  • Epoxy resins the salts of the aforementioned substances and mixtures thereof.
  • the present invention preferably relates to a method according to any of aspects 1 to 3, wherein the cylinder has a flexural strength of at least 0.0075 N / mm 2 , more preferably at least 0.0105 N / mm 2 , even more preferably at least 0.012 N / mm 2 , more preferably at least 0.015 N / mm 2 .
  • the present invention preferably relates to a method according to any of aspects 1 to 4, wherein the particle-containing aerosol is passed on as a continuous aerosol stream.
  • the present invention preferably relates to a method according to any one of the aspects 1 to 5, wherein the particle-containing aerosol in a
  • a coating method is used which is selected from the group consisting of cold gas spraying, flame spraying, high-speed flame spraying, thermal plasma spraying and non-thermal plasma spraying, preferably selected from the group consisting of thermal plasma spraying and non-thermal
  • Plasma spraying In particular, it is preferred that the coating process be non-thermal plasma spraying.
  • the present invention preferably relates to a method according to any of aspects 1 to 6, wherein the comminution of the particle-containing cylinder is effected by means of a brush or an abrasive belt.
  • the present invention preferably relates to a method according to any of aspects 1 to 7, wherein the height of the particle-containing cylinder is at least 2 times, preferably at least 3 times, more preferably at least 4 times, the arithmetic mean of the longest axes along the
  • Base area and the top surface is.
  • the present invention preferably relates to a method according to any one of aspects 1 to 8, wherein the cylinder is at least 1, 5 wt .-%
  • the present invention preferably relates to a method according to any one of aspects 1 to 9, wherein the proportion of non-platelet-shaped particles in the particle-containing cylinder in a range of 50 wt .-% to 99.9 wt .-%, preferably in one Range from 60% to 98% by weight, more preferably in a range from 70% to 97% by weight, based in each case on the total weight of the cylinder.
  • the present invention preferably relates to a method according to any one of aspects 1 to 10, wherein the particles contained in the cylinder d 50 in a range of 1 ⁇ to 300 ⁇ , preferably in a range of 1, 5 ⁇ to 230 ⁇ , preferably in a range of 2 ⁇ to 180 ⁇ , more preferably in a range of 2.5 ⁇ to 150 ⁇ have.
  • the present invention preferably relates to a method according to one of the aspects 1 to 9 or according to aspect 1 1, wherein the proportion of
  • platelet-shaped particles in the particle-containing cylinder in a range from 30% to 75% by weight, preferably in a range from 40% to 70% by weight, more preferably in a range of 50% by weight. to 65 wt .-%, in each case based on the total weight of the cylinder.
  • the present invention preferably relates to a method according to any one of aspects 1 to 12, wherein the amount of the particles in the cylinder in
  • platelet-shaped particles based on the total weight of the particles, in the range of (50 wt .-% - (0.2 x)% by weight) to (99.9 wt .-% - (0.249 x ⁇ ) wt .-%) , based on the total weight of the cylinder.
  • the amount of the particles in the range of (wt .-% 60 - (0.2 x ⁇ )% by weight) to (98 wt .-% - (0.28 x ⁇ ) wt .-%), more preferably in the range of (70 wt .-% - (0.2 x ⁇ )% by weight) to (97 wt .-% - (0.32 x ⁇ ) wt .-%), based on the total weight of the cylinder.
  • the present invention preferably relates to a method according to any one of aspects 1 to 13, wherein the total amount of particles and
  • Binders in the particle-containing cylinder at least 90 wt .-%, preferably at least 95 wt .-%, more preferably at least 99.9 wt .-%, based on the total weight of the cylinder.
  • the present invention preferably relates to a method according to any one of aspects 1 to 14, wherein the particles of the particle-containing cylinder to at least 90 wt .-%, preferably at least 95 wt .-%, more preferably at least 99.9 wt .-%, be selected from either metal particles or
  • the particles of the particle-containing cylinder to at least 90 wt .-%, preferably at least 95 wt .-%, more preferably at least 99.9 wt .-%, selected from either metal particles or glass particles, more preferably metal particles, based on the total weight of the particles.
  • the present invention preferably relates to a method according to any of aspects 1 to 15, wherein the particle-containing cylinder has a volume of at least 8 cm 3 , preferably at least 1 1 cm 3 , more preferably at least 19 cm 3 , even more preferred of at least 30 cm 3 .
  • the present invention preferably relates to a method according to any one of aspects 1 to 16, wherein the amount of the binder in the
  • the present invention preferably relates to a method according to any one of aspects 1 to 17, wherein the particle-containing cylinder is at least 1, 5 wt .-%, preferably at least 1, 9 wt .-%, more preferably at least
  • inorganic binder comprises.
  • the present invention preferably relates to a method according to any of aspects 1 to 18, wherein the inorganic binder is selected from the group consisting of calcium sulfate and silica.
  • the present invention preferably relates to a method according to any one of aspects 1 to 19, wherein the particle-containing cylinder at least 0.05 wt .-%, preferably at least 0.07 wt .-%, more preferably at least 0, 1 wt. -%, organic binder.
  • the present invention preferably relates to a method according to any of aspects 1 to 20, wherein the organic binder is selected from the group consisting of cellulose derivatives and polysaccharides.
  • the organic binder is selected from the group consisting of starch and cellulose derivatives. Examples of the cellulose derivatives are methylcellulose and
  • the present invention preferably relates to a method according to one of the aspects 1 to 21, wherein at least one binder of the particle-containing cylinder is selected from the group consisting of calcium sulfate, talc,
  • Calciumaluminate hydrates mixtures of calcium hydroxide and calcium carbonate, cellulose, cellulose derivatives, polysaccharides, gelatin, polyvinyls, polyacrylates, polyethylene oxides, polyethylene glycols, polyamides, the salts of the aforementioned substances and mixtures thereof, preferably from the group consisting of calcium sulfate, silica, cellulose, cellulose derivatives, polysaccharides , Polyvinylen, the salts of the aforementioned substances and mixtures thereof, more preferably from the group consisting of calcium sulfate, silica, cellulose derivatives, polysaccharides, the salts of the aforementioned substances and mixtures thereof.
  • the binder is selected from the group consisting of calcium sulfate and
  • the present invention preferably relates to a method according to any one of aspects 1 to 22, wherein the particles of the particle-containing cylinder to at least 75 wt .-%, preferably at least 87 wt .-%, more preferably at least 98 wt. %, Metal particles are based on the total weight of the particles.
  • the present invention preferably relates to a method according to one of the aspects 1 to 23, wherein the metal of the metal particles is selected to at least 90 wt .-% from the group consisting of aluminum, copper, tin, zinc, iron, silver, Titanium, nickel, gold, platinum, magnesium, tungsten, molybdenum,
  • Vanadium Vanadium, mixtures thereof and alloys thereof.
  • the present invention preferably relates to a method according to any of aspects 1 to 24, wherein the metal of the metal particles is at most 5 wt%, more preferably at most 2 wt%, more preferably at most
  • the present invention preferably relates to a method according to any of aspects 1 to 25, wherein the metal particles are selected from uncoated metal particles and coated metal particles, the amount of the coating averaging at most 15% by weight, preferably at most 12% by weight. %, more preferably at most 10 wt .-%, based on the total weight of the coated metal pigments.
  • the present invention preferably relates to a method of coating a substrate, comprising the following steps
  • the coating process according to step b) is the non-thermal plasma spraying.
  • the present invention preferably relates to a method according to aspect 27, wherein the particle-containing aerosol from step a) is fed as a continuous aerosol stream to the coating method according to step b).
  • the present invention preferably relates to a
  • particle-containing cylinder wherein the cylinder has a volume of at least 5 cm 3 and is dimensionally stable
  • the proportion of particles is in the range from 10% by weight to 99.9% by weight, based on the total weight of the cylinder,
  • the bending strength ⁇ not more than 3.75 N / mm 2, more preferably at most 2, 1 N / mm 2, even more preferably at most 1, 2 N / mm 2, even more preferably at most 0.675 N / mm 2, is where ⁇ calculated is according to formula (I)
  • the particles contained in the cylinder have a d 5 o of a maximum of 300 ⁇ and the cylinder has at least 0.01 wt .-% binder, based on the
  • the binder is selected from the group consisting of inorganic binders, organic binders and mixtures thereof
  • the present invention preferably relates to a particle-containing cylinder according to aspect 29, wherein the inorganic binders are selected from calcium sulfate, talc, calcium hydroxide, silicon oxide,
  • the present invention preferably relates to a particle-containing cylinder according to any of aspects 29 to 30, wherein the organic binders are selected from the group consisting of cellulose,
  • Polyethylene oxides polyethylene glycols, polyamides, epoxy resins, polyurethanes, polyaldehydes, polyolefins, polyacrylate copolymers, polyaldehyde copolymers,
  • the present invention preferably relates to a particle-containing cylinder according to any one of aspects 29 to 31, wherein the cylinder has a flexural strength of at least 0.0075 N / mm 2 , more preferably at least 0.0105 N / mm 2 , more preferably at least 0.012 N / mm 2 , even more preferably at least 0.015 N / mm 2 .
  • the present invention preferably relates to a particle-containing cylinder according to any of aspects 29 to 32, wherein the height of the particle-containing cylinder is at least 2 times, preferably at least 3 times, more preferably at least 4 times, the arithmetic mean the longest axis along the base and the top surface is.
  • the present invention preferably relates to a particle-containing cylinder according to any one of aspects 29 to 33, wherein the proportion of non-platelet particles in the particle-containing cylinder in a range of 50 wt .-% to 99.9 wt .-%, preferably in a range of from 60% to 98% by weight, more preferably in a range of from 70% to 97% by weight, based in each case on the total weight of the cylinder.
  • the present invention preferably relates to a particle-containing cylinder according to one of the aspects 29 to 34, wherein the particles contained in the cylinder d 5 o in a range of 1 ⁇ to 300 ⁇ , preferably in a range of 1, 5 ⁇ to 230 ⁇ , preferably in a range of 2 ⁇ to 180 ⁇ , more preferably in a range of 2.5 ⁇ to 150 ⁇ have.
  • the present invention preferably relates to a particle-containing cylinder according to any one of the aspects 29 to 35, wherein the proportion of platelet-shaped metal particles in the particle-containing cylinder in a range of 30 wt .-% to 75 wt .-%, preferably in a range from 40% by weight to 70% by weight, more preferably in a range from 50% by weight to 65% by weight, based in each case on the total weight of the cylinder.
  • the present invention preferably relates to a particle-containing cylinder according to any one of the aspects 29 to 36, wherein the amount of the particles in the cylinder, depending on the amount of the platelet-shaped particles at x wt .-% platelet-shaped particles, based on the total weight of the particles , in the range of (50% by weight - (0.2 x)% by weight) to (99.9% by weight - (0.249 * x)% by weight), based on the Total weight of the cylinder is.
  • the amount of the particles in the range of (wt .-% 60 - (0.2 x ⁇ )% by weight) to (98 wt .-% - (0.28 x ⁇ ) wt .-%), more preferably in the range of (70 wt .-% - (0.2 x ⁇ )% by weight) to (97 wt .-% - (0.32 x ⁇ ) wt .-%), based on the total weight of the cylinder.
  • the present invention preferably relates to a particle-containing cylinder according to one of the aspects 29 to 37, wherein the total amount of particles and binders in the particle-containing cylinder is at least 90% by weight, preferably at least 95% by weight, more preferably at least 99, 9 wt .-%, is based on the total weight of the cylinder.
  • the present invention preferably relates to a particle-containing cylinder according to any one of aspects 29 to 38, wherein the particles of the particle-containing cylinder to at least 90 wt .-%, preferably at least 95 wt .-%, more preferably at least 99.9 Wt .-% are selected from either metal particles or glass particles or microparticles or ceramic particles, based on the total weight of the particles.
  • the particles of the particle-containing cylinder are at least 90 wt .-%, preferably at least 95 wt .-%, more preferably at least 99.9 wt .-%, selected from either metal particles or glass particles, more preferably metal particles, based on the Total weight of the particles.
  • the present invention preferably relates to a particle-containing cylinder according to any one of the aspects 29 to 39, wherein the particle-containing cylinder has a volume of at least 8 cm 3 , preferably at least 1 1 cm 3 , more preferably at least 19 cm 3 , even more preferably of at least 30 cm 3 , having
  • the present invention preferably relates to a particle-containing cylinder according to any one of aspects 29 to 40, wherein the amount of the binder in the particle-containing cylinder in a range of 0.05 wt .-% to 70 wt .-%, preferably in one Range from 0.07 wt.% To 60 wt.%, More preferably in a range of 0.1 wt.% To 45 wt.%.
  • the present invention preferably relates to a particle-containing cylinder according to any one of aspects 29 to 41, wherein the particle-containing cylinder at least 1, 5 wt .-%, preferably at least 1, 9 wt .-%, more preferably at least 2.2 wt .-%, inorganic binder.
  • the present invention preferably relates to a particle-containing cylinder according to any of aspects 29 to 42, wherein the inorganic binder is selected from the group consisting of calcium sulfate and
  • the present invention preferably relates to a particle-containing cylinder according to any one of aspects 29 to 43, wherein the particle-containing cylinder is at least 0.05% by weight, preferably at least 0.07% by weight, more preferably at least 0.1% by weight .-%, organic binder comprises.
  • the present invention preferably relates to a particle-containing cylinder according to any of aspects 29 to 44, wherein the organic binder is selected from the group consisting of cellulose derivatives and polysaccharides.
  • the organic binder is selected from the group consisting of starch and cellulose derivatives such as methyl cellulose and
  • the present invention preferably relates to a particle-containing cylinder according to any of aspects 29 to 45, wherein at least one binder of the particle-containing cylinder is selected from the group consisting of calcium sulfate, talc, calcium carbonate, silicon oxide, mixtures of
  • Calcium silicate hydrates and calcium aluminate hydrates mixtures of calcium hydroxide and calcium carbonate, cellulose, cellulose derivatives, polysaccharides, polyvinyls, polyacrylates, polyethylene oxides, polyethylene glycols, polyamides, the salts of the abovementioned substances and mixtures thereof, preferably from the group consisting of calcium sulfate, silicon oxide, cellulose, cellulose derivatives, polysaccharides .
  • Polyvinyls, the salts of the aforementioned substances and mixtures thereof more preferably from the group consisting of Caiciumsulfat, silica, cellulose derivatives, polysaccharides, the salts of the aforementioned substances and mixtures thereof.
  • the binder is selected from the group consisting of calcium sulfate and cellulose derivatives.
  • the present invention preferably relates to a particle-containing cylinder according to any one of aspects 29 to 46, wherein the particles of the particle-containing cylinder to at least 75 wt .-%, preferably at least 87 wt .-%, more preferably at least 98 wt. -% metal particles are based on the total weight of the particles.
  • the present invention preferably relates to a particle-containing cylinder according to any one of the aspects 29 to 47, wherein the metal of the metal particles is selected at least 90 wt .-% from the group consisting of aluminum, copper, tin, zinc, iron, silver , Titanium, nickel, gold, platinum, magnesium, tungsten, molybdenum, vanadium, mixtures thereof, and alloys thereof.
  • the present invention preferably relates to a particle-containing cylinder according to any of aspects 29 to 48, wherein the metal of the metal particles is at most 5% by weight, more preferably at most 2% by weight, more preferably at most 1% by weight. %, selected from the group consisting of silver, palladium, platinum, gold, mixtures thereof and alloys thereof.
  • the present invention preferably relates to a particle-containing cylinder according to any of aspects 29 to 49, wherein the metal particles are selected from uncoated metal particles and coated
  • Metal particles wherein the amount of the coating averages at most 15% by weight, preferably at most 12 wt .-%, more preferably at most 10 wt .-%, based on the total weight of the coated metal pigments.
  • the present invention preferably relates to the use of a particle-containing cylinder for producing a particle-containing aerosol, wherein the cylinder has a volume of at least 5 cm 3 and is dimensionally stable,
  • the proportion of particles is in the range from 10% by weight to 99.9% by weight, based on the total weight of the cylinder, the bending strength ⁇ not more than 3.75 N / mm 2, more preferably at most 2, 1 N / mm 2, even more preferably at most 1, 2 N / mm 2, even more preferably at most 0.675 N / mm 2, is where ⁇ calculated is according to formula (I)
  • the particles are selected from the group consisting of metal particles,
  • the particles contained in the cylinder have a d 50 of at most 300 ⁇ and the cylinder has at least 0.01 wt .-% binder, based on the
  • the binder is selected from the group consisting of inorganic binders, organic binders and mixtures thereof.
  • the particle-containing aerosol is in a
  • Used coating method which is selected from the group consisting of cold gas spraying, flame spraying, high-velocity flame spraying, thermal plasma spraying and non-thermal plasma spraying, preferably from the group consisting of thermal plasma spraying and non-thermal plasma spraying.
  • the coating process be non-thermal plasma spraying.
  • the present invention preferably relates to the use according to aspect 51, wherein the inorganic binders are selected from the group consisting of calcium sulfate, talc, calcium hydroxide, silica, alumina, calcium carbonate, calcium silicate hydrates, calcium aluminate hydrates and mixtures thereof.
  • the inorganic binders are selected from the group consisting of calcium sulfate, talc, calcium hydroxide, silica, alumina, calcium carbonate, calcium silicate hydrates, calcium aluminate hydrates and mixtures thereof.
  • the present invention preferably relates to the use according to any one of aspects 51 to 52, wherein the organic binders are selected from the group consisting of cellulose, cellulose derivatives, polysaccharides, gelatin, polyvinyls, polyacrylates, polyethylene oxides, polyethylene glycols, polyamides, epoxy resins, Polyurethanes, polyacrylate copolymers, polyaldehyde copolymers, Polyester, polyolefin copolymers, the salts of the aforementioned substances and
  • Mixtures thereof more preferably from the group consisting of cellulose,
  • Polyethylene oxides polyethylene glycols, polyamides, epoxy resins, polyurethanes, polyacrylate copolymers, polyaldehyde copolymers, polyesters, polyolefin copolymers, the salts of the aforementioned substances and mixtures thereof, more preferably from the group consisting of cellulose, cellulose derivatives, polysaccharides, gelatin, polyvinyls, polyacrylates, polyethylene oxides, polyethylene glycols , Polyamides, epoxy resins, salts of the aforementioned substances and mixtures thereof.
  • the present invention preferably relates to the use according to any one of aspects 51 to 53, wherein a cylinder according to any of aspects 29 to 50 is used.
  • the present invention relates to a coated one
  • Figure 2 Curve of the three-point measurement of a cylinder according to Example 1-13 (force in N (y-axis) versus traverse path in mm (x-axis))
  • Example 1 Production of particle-containing cylinders using gypsum
  • Type A / Quick Rock gypsum grade 4 (Quick Dental) or B / Quick Dur S (Quick Dental) and various particles according to Table 1 were first mixed with each other and subsequently with DI water (demineralised water) and ethanol.
  • DI water demineralised water
  • the now easily flowable material was placed in a paper-lined cylindrical shape (circular base, diameter 32 mm). After the cylinder had hardened sufficiently to be dimensionally stable, it was removed from the mold. Subsequently, the obtained cylinder was dried in a drying oven at 50 ° C.
  • Table 1 Particle-containing cylinders with binder Gypsum: VB: Comparative Example, Ex .: Example, (G): non-platelet-shaped particles, (F): platelet-shaped particles
  • Example 2 Preparation of particle-containing cylinders using ethylcellulose Ethocel Standard 200 Premium (Example 2-1, DOW), Aqualon Ethylcellulose N100
  • Example 2-2 Ashland
  • Ethocel Std 300 Industrial Example 2-3, DOW
  • particles were first mixed together and subsequently with acetone.
  • the material was placed in a paper-lined cylindrical mold (circular base, diameter 32 mm). After the cylinder had hardened sufficiently to be dimensionally stable, it was removed from the mold. Subsequently, the obtained cylinder was dried in a drying oven at 50 ° C.
  • Example 3 Preparation of particle-containing cylinders using microcrystalline cellulose
  • Avicel PH-101 and particles were first mixed together and then filled into a Vaneox (Fluxana) tablet press.
  • the compression was carried out in compression tools with a diameter of 40 mm by means of a pressure of 3 tons for 10 seconds.
  • Sakret PU is distributed by SAKRETrbaustoffe Europa GmbH & Co. KG.
  • Epoxy Resin Binder 2000 EP is sold by Solipur - Höfer & Stankowska GbR.
  • CAB 531-1 cellulose acetate butyrate
  • Butavar B-76 polyvinyl butyral
  • Degalan P24 (polyacrylate) is manufactured by Evonik. distributed.
  • Trimethylolpropane trimethacrylate are mixed in 50 ml of isopropanol.
  • the cylinders obtained proved to be suitable for the method according to the invention in initial tests.

Landscapes

  • Chemical & Material Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Organic Chemistry (AREA)
  • Materials Engineering (AREA)
  • Mechanical Engineering (AREA)
  • Ceramic Engineering (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Metallurgy (AREA)
  • Physics & Mathematics (AREA)
  • Plasma & Fusion (AREA)
  • Structural Engineering (AREA)
  • Manufacturing & Machinery (AREA)
  • Civil Engineering (AREA)
  • Inorganic Chemistry (AREA)
  • Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Polymers & Plastics (AREA)
  • Paints Or Removers (AREA)
  • Glanulating (AREA)
  • Application Of Or Painting With Fluid Materials (AREA)

Abstract

Die vorliegende Erfindung betrifft ein Verfahren zur Herstellung eines partikelhaltigen Aerosols. Diese Aerosole sind beispielsweise besonders geeignet, um in der Form eines Aerosolstroms in einem Beschichtungsverfahren eingesetzt zu werden. Ferner betrifft die vorliegende Erfindung partikelhaltige Zylinder, welche mittels einfacher Verfahren vereinzelt und in Aerosolform überführt werden können.

Description

Verfahren zur Herstellung eines partikelhaltigen Aerosols
Die vorliegende Erfindung betrifft partikelhaltige Zylinder, welche mittels einfacher Verfahren vereinzelt und in Aerosolform überführt werden können. Diese Aerosole sind besonders geeignet, um in der Form eines Aerosolstroms in einem
Beschichtungsverfahren eingesetzt zu werden.
Die Überführung eines pulverförmigen Materials in ein Aerosol, um es beispielsweise im Flammspritzen einzusetzen, ist Gegenstand verschiedener Anmeldungen wie
US 4,997,318 B1 und US 6,331 ,689 B1. Auch die US 4,660,986 A behandelt die
Förderung eines Pulvers, was jedoch mit einem sehr großen apparativen Aufwand verbunden ist.
Es hat sich gezeigt, dass mit bekannten Förderverfahren eine gleichmäßige Förderung von Partikeln insbesondere zur Erzielung homogener Beschichtungen schwer bis nicht realisierbar ist.
Eine derartig gleichmäßige Förderung ist jedoch wichtig beispielsweise für
Beschichtungsverfahren, da die Qualität einer Beschichtung auch von ihrer
Gleichmäßigkeit abhängig ist. Dies gilt insbesondere, wenn eine möglichst dünne und dennoch zuverlässige Beschichtung erhalten werden soll. Bekannte Verfahren nutzen zur Erzeugung der Beschichtungen beispielsweise kinetische Energie, thermische Energie oder Mischungen hiervon, wobei die thermische Energie beispielsweise aus einer konventionellen Verbrennungsflamme oder einer Plasmaflamme stammen kann. Letztere werden weiter unterschieden in thermische und nichtthermische Plasmen, denen gemein ist, dass ein Gas partiell oder vollständig in freie Ladungsträger wie Ionen oder Elektronen aufgetrennt wird.
Beim Kaltgasspritzen erfolgt die Bildung der Beschichtung durch Aufbringen eines Pulvers auf eine Substratoberfläche, wobei die Pulverpartikel stark beschleunigt werden. Hierzu wird ein erhitztes Prozessgas durch Expansion in einer Lavaldüse auf
Überschallgeschwindigkeit beschleunigt und anschließend das Pulver injiziert. Infolge der hohen kinetischen Energie bilden die Partikel beim Auftreffen auf der Substratoberfläche eine dichte Schicht. Beispielsweise offenbart die WO 2010/003396 A1 die Verwendung des Kaltgasspritzens als Beschichtungsverfahren zum Aufbringen von Verschleißschutzbeschichtungen.
Weiterhin finden sich Offenbarungen des Kaltgasspritzverfahrens beispielsweise in EP 1 363 811 A1 , EP 0 91 1 425 B1 und US 7,740,905 B2.
Das Flammspritzen gehört zur Gruppe der thermischen Beschichtungsverfahren. Hierbei wird ein pulverförmiges Beschichtungsmaterial in die Flamme eines Brenngas-Sauerstoff- Gemisches eingebracht. Hierbei können beispielsweise mit Acetylen-Sauerstoffflammen Temperaturen von bis zu ungefähr 3200 °C erreicht werden. Details zum Verfahren können Publikationen wie z.B. EP 830 464 B1 und US 5,207,382 A entnommen werden.
Beim thermischen Plasmaspritzen wird ein pulverförmiges Beschichtungsmaterial in ein thermisches Plasma injiziert. Im typischerweise verwendeten thermischen Plasma werden Temperaturen von bis zu ca. 20000 K erreicht, wodurch das injizierte Pulver aufschmilzt und als Beschichtung auf einem Substrat abgeschieden wird.
Das Verfahren des thermischen Plasmaspritzens und spezifische Ausführungsformen sowie Verfahrensparameter sind dem Fachmann bekannt. Exemplarisch wird auf die WO 2004/016821 verwiesen, die den Einsatz des thermischen Plasmaspritzens zum
Aufbringen einer amorphen Beschichtung beschreibt. Ferner offenbart beispielsweise EP 0 344 781 den Einsatz des Flammspritzens und des thermischen Plasmaspritzens als Beschichtungsverfahren unter Einsatz eines Wolframcarbidpulvergemisches. Spezifische Geräte zur Verwendung in Plasmaspritzverfahren sind vielfach in der Literatur beschrieben, wie beispielsweise in EP 0 342 428 A2, US 7,678,428 B2, US 7,928,338 B2 und EP 1 287 898 A2.
Beim Hochgeschwindigkeitsflammspritzen wird ein Kraftstoff unter hohem Druck verbrannt, wobei als Kraftstoff sowohl Brenngase, flüssige Brennstoffe und Mischungen hiervon eingesetzt werden können. In die hochbeschleunigte Flamme wird ein pulverförmiges Beschichtungsmaterial injiziert. Dieses Verfahren ist bekannt dafür, dass es sich durch verhältnismäßig dichte Spritzschichten auszeichnen soll. Auch das
Hochgeschwindigkeitsflammspritzen ist dem Fachmann gut bekannt und wurde bereits in zahlreichen Veröffentlichungen beschrieben. Beispielsweise offenbart EP 0 825 272 A2 eine Substratbeschichtung mit einer Kupferlegierung unter Einsatz des Hochgeschwindigkeitsflammspritzens. Ferner offenbaren beispielsweise WO 2010/037548 A1 und EP 0 492 384 A1 das Verfahren des Hochgeschwindigkeitsflammspritzens und Geräte zur Verwendung hierin.
Das nichtthermische Plasmaspritzen erfolgt weitgehend analog zum thermischen
Plasmaspritzen und Flammspritzen. Ein pulverförmiges Beschichtungsmaterial wird in ein nichtthermisches Plasma injiziert und hiermit auf eine Substratoberfläche aufgetragen. Wie beispielsweise der EP 1 675 971 B1 entnommen werden kann, zeichnet sich dieses Verfahren durch eine besonders niedrige thermische Belastung des beschichteten
Substrats aus. Auch dieses Verfahren, besondere Ausführungsformen und entsprechende Verfahrensparameter sind dem Fachmann aus verschiedenen Publikationen bekannt. Beispielsweise beschreibt die EP 2 104 750 A2 die Anwendung dieses Verfahrens und eine Vorrichtung zu dessen Durchführung. Beispielsweise DE 103 20 379 A1 beschreibt die Herstellung eines elektrisch beheizbaren Elementes unter Einsatz dieses Verfahrens. Weitere Offenbarungen hinsichtlich des Verfahrens oder Vorrichtungen für das nichtthermische Plasmaspritzen finden sich beispielsweise in EP 1 675 971 B1 , DE 10 2006 061 435 A1 , WO 03/064061 A1 , WO 2005/031026 A1 , DE 198 07 086 A1 ,
DE 101 16 502 A1 , WO 01/32949 A1 , EP 0 254 424 B1 , EP 1 024 222 A2, DE 195 32 412 A1 , DE 199 55 880 A1 und DE 198 56 307 C1.
Ein allgemeines Problem von Beschichtungsverfahren unter Einsatz eines
partikelförmigen Beschichtungsmaterials ist es jedoch, dass zur Erzeugung einer homogenen, jedoch dünnen Beschichtung, eine sehr hohe Homogenität des eingesetzten Partikelaerosols erforderlich ist. Zwar werden beispielsweise in den anfangs diskutierten Dokumenten spezielle apparative Verfahren zur Erzielung homogener Aerosole beschrieben. Praktisch zeigte sich die technische Umsetzung zumindest in den industriellen Maßstab als schwierig oder war zumindest angesichts des apparativen Aufwands von geringem Interesse.
Eine Aufgabe der vorliegenden Erfindung ist es mithin ein einfaches Verfahren zur gleichmäßigen Partikelförderung sowie die hierzu benötigten Mittel zur Verfügung zu stellen. Hierbei sollen Aerosolströme erhalten werden, welche vorteilhaft in
Beschichtungsverfahren eingesetzt werden können. Gleichzeitig sollen möglichst geringe apparative Anforderungen an die Pulverförderung gestellt werden und breite Spektren an Partikeln ohne größere apparative Anpassungen verwendbar sein. Diese Aufgabe wird durch die in den Ansprüchen und Aspekten angegebenen Gegenstände, Verfahren und Verwendungen gelöst.
Die vorliegende Erfindung betrifft ein Verfahren zur Herstellung eines partikelhaltigen Aerosols, wobei der Zylinder ein Volumen von mindestens 5 cm3 aufweist und formstabil ist,
der Anteil an Partikeln im Bereich von 10 Gew.-% bis 99,9 Gew.-% liegt, bezogen auf das Gesamtgewicht des Zylinders,
die Biegefestigkeit σ höchstens 3,75 N/mm2 beträgt, wobei σ berechnet wird gemäß Formel (I)
3 x F x l
mit F = maximale Kraft, B = Breite des Zylinders in Quaderform, D = Höhe des Zylinders in Quaderform, I = Abstand zwischen den beiden Auflagepunkten
die Partikel ausgewählt werden aus der Gruppe bestehend aus Metallpartikeln,
Glaspartikeln, Micapartikeln, Keramikpartikeln und Mischungen hiervon
die in dem Zylinder enthaltenen Partikel einen d50 von maximal 300 μηι aufweisen und der Zylinder mindestens 0,01 Gew.-% Bindemittel aufweist, bezogen auf das
Gesamtgewicht des partikelhaltigen Zylinders, wobei das Bindemittel ausgewählt wird aus der Gruppe bestehend aus anorganischen Bindemitteln, organischen Bindemitteln und Mischungen hiervon. Im Rahmen der Erfindung gilt naturgemäß, dass die Summe aller Gew.-% der Bestandteile eines erfindungsgemäßen Zylinders insgesamt maximal 100 Gew.-% betragen kann. Vorzugsweise werden die anorganischen Bindemittel ausgewählt aus der Gruppe bestehend aus Calciumsulfat, Talk, Calciumhydroxid, Siliciumoxid, Aluminiumoxid, Calciumcarbonat, Calciumsilikathydrate,
Calciumaluminathydrate und Mischungen hiervon. Die organischen Bindemittel werden vorzugsweise ausgewählt aus der Gruppe bestehend aus Cellulose, Cellulosederivaten, Polysacchariden, Gelatine, Polyvinylen, Polyacrylaten, Polyethylenoxiden,
Polyethylenglykolen, Polyamiden, Epoxidharzen, Polyurethanen, Polyaldehyden, Polyolefinen, Polyacrylatcopolymeren, Polyaldehydcopolymeren, Polyester, Polyolefincopolymere, den Salzen der vorgenannten Stoffe und Mischungen hiervon, mehr bevorzugt aus der Gruppe bestehend aus Cellulose, Cellulosederivaten,
Polysacchariden, Gelatine, Polyvinylen, Polyacrylaten, Polyethylenoxiden,
Polyethylenglykolen, Polyamiden, Epoxidharzen, Polyurethanen, Polyacrylatcopolymeren, Polyaldehydcopolymeren, Polyester, Polyolefincopolymere, den Salzen der vorgenannten Stoffe und Mischungen hiervon, noch mehr bevorzugt aus der Gruppe bestehend aus Cellulose, Cellulosederivaten, Polysacchariden, Gelatine, Polyvinylen, Polyacrylaten, Polyethylenoxiden, Polyethylenglykolen, Polyamiden, Epoxidharzen, den Salzen der vorgenannten Stoffe und Mischungen hiervon.
Der Begriff„Polyacrylatcopolymere" im Sinne der vorliegenden Erfindung bezeichnet entsprechende Copolymere, welche nicht vom Begriff Polyacrylat umfasst sind. Beispiele hierfür sind Styrol-Acrylat-Copolymere. Der Begriff„Polyaldehydcopolymere" im Sinne der vorliegenden Erfindung bezeichnet entsprechende Copolymere, welche nicht vom Begriff Polyaldehyd umfasst sind. Beispiele hierfür sind Cyclohexanon-Formaldehyd-Copolymere.
Der Begriff„Polyolefincopolymere" im Sinne der vorliegenden Erfindung bezeichnet entsprechende Copolymere, welche nicht vom Begriff Polyolefin umfasst sind.
Der Begriff„Polyolefin" im Sinne der vorliegenden Erfindung bezeichnet entsprechende Polymere, welche nicht vom Begriff Polyvinyl umfasst sind. Unter dem Begriff„Zylinder" im Sinne der vorliegenden Erfindung wird grundsätzlich die geometrische Grundform bekannt als Zylinder verstanden, d.h. ein von zwei parallelen, ebenen, kongruenten Flächen (Grund- und Deckfläche) und einer Mantel- bzw.
Zylinderfläche begrenzter Körper, wobei die Mantelfläche von parallelen Geraden gebildet wird. Erfindungsgemäß umfasst der Begriff Zylinder im Sinne der vorliegenden Erfindung auch theoretisch endlose Zylinderformen, welche beispielsweise mittels einer
kontinuierlichen Extrusion erhalten werden. Vorzugsweise handelt es sich bei den Zylindern der vorliegenden Erfindung jedoch um einzelne Zylinder, wobei deren Länge bevorzugt weniger als 2 Meter, mehr bevorzugt weniger als 1 Meter, beträgt. Allerdings kann der erfindungsgemäße Zylinder naturgemäß als Realkörper von der idealen Struktur eines geometrisch perfekten Zylinders abweichen. Vorzugsweise kann die reale Struktur bis auf 5 Vol-%, mehr bevorzugt bis auf 3 Vol-% mittels eines geometrisch idealen Zylinders angenähert werden. Bei einer Ausformung ohne definiertes Ende werden zur Bestimmung des durchschnittlichen Volumens mindestens 4, vorzugsweise 4, Stücke des Zylinders nach zufälliger Auswahl abgetrennt und vermessen. Die Länge der Stücke beträgt hierbei mindestens 7 cm, vorzugsweise 7 cm, sofern das arithmetische Mittel von Grundfläche und Deckfläche mindestens 7 cm2 beträgt. Sofern das arithmetische Mittel von Grundfläche und Deckfläche x cm2 beträgt, wobei x < 7 ist, beträgt die Länge mindestens x cm, vorzugsweise x cm. Die Bestimmung des Volumens erfolgt mittels des Fachmanns geläufiger Verfahren wie beispielsweise die Bestimmung des verdrängten Volumens des betreffenden Zylinders in einer Flüssigkeit. Unter dem Begriff„formstabil" wird verstanden, dass der Zylinder bei typischer Beanspruchung wie Lagerung, Transport und dem Einsetzen in entsprechende Vorrichtungen nicht zerfällt, das heißt zerbröckelt oder zerbricht. Vorzugsweise wird unter dem Begriff„formstabil" verstanden, dass die Zylinder eine Biegefestigkeit von mindestens 0,006 N/mm2 aufweisen.
Die Bestimmung der Biegefestigkeit erfolgt mittels einer Dreipunktmessung. Hierbei wird ein Prüfkörper vorzugsweise in Form eines Quaders mit quadratischer Grundfläche (2 cm) Kantenlänge und einer Höhe von mindestens 9 cm auf zwei parallel angeordnete
Auflagestäbe mit einem Abstand von 8 cm mittig angeordnet. Sofern der zu prüfende Zylinder keine Quaderform aufweist, kann er beispielsweise durch Schleifen, Sägen, Schneiden, etc. in die Quaderform gebracht werden. In der Mitte des Prüfkörpers (jeweils 4 cm Abstand von den Auflagestäben) wird von oben mittels eines Belastungsstabes Druck ausgeübt und die ausgeübte Kraft aufgezeichnet. Auflagestäbe und Belastungsstab sind zylindrische Körper mit kreisrunder Grundfläche und einem Durchmesser von 5 mm. Die Auflagestäbe und der Belastungsstab sind frei gelagert, um Reibungseinflüsse zu minimieren. Als Messgerät dient vorzugsweise eine Instron 5565 Universalprüfmaschine bei 22 °C und 45 % relativer Luftfeuchtigkeit. Die Messung erfolgt mittels einer
Kompressionsrate von 2 mm pro Minute unter Verwendung einer 1000 N Kraftmessdose. Die Datenaufnahme und Auswertung kann hierbei mittels dem Instron Programm Bluehill Vers. 3.42 unter Aufzeichnung des Verfahrweges und der dabei gemessenen Kraft bis zum Zerbrechen der Probe erfolgen. Die Biegefestigkeit ergibt sich gemäß Formel (I) 3 x F x l
a = 2 x B x D /) mit F = maximale Kraft, B = Breite des Zylinders in Quaderform, D = Höhe des Zylinders in Quaderform, I = Abstand zwischen den beiden Auflagepunkten, aus dem Maximum der Kurven. Hierbei wird das arithmetisches Mittel von mindestens 5 Proben, vorzugsweise 5 Proben, verwendet. Einzelne fehlerhafte Proben werden naturgemäß verworfen und nicht bei der Berechnung verwendet. Beispielsweise kann eine niedrigere Biegefestigkeit durch eine in der Säule eingeschlossene Luftblase verursacht werden. Vorzugsweise wird die Biegefestigkeit einzelner Proben außer Acht gelassen, sofern deren Biegefestigkeit um mindestens 10 % vom arithmetischen Mittel der verbleibenden Proben abweicht, wobei die am stärksten abweichenden Proben verworfen werden. Hierbei können bis zu 10 % der Proben, wobei die Anzahl dieser 10 % auf eine ganze Zahl aufgerundet wird, verworfen werden. Anstelle dieser verworfenen Proben werden einmalig
Ersatzmessungen durchgeführt. Als Glaspartikel werden im Sinne der Erfindung insbesondere Partikel mit Siliciumdioxid als Hauptbestandteil verstanden. Ein Beispiel eines besonders vorteilhaft einzusetzenden Glases ist Borosilikatglas.
Unter dem Begriff Micapartikel werden vorzugsweise Partikel aus Glimmer, wie beispielsweise Fluorophlogopit, verstanden. Zwar weisen natürliche Glimmer
Kostenvorteile auf, jedoch sind für Verwendungszwecke bei denen eine genaue
Zusammensetzung eingehalten werden muss, beispielsweise im Lebensmittelsektor oder der Halbleiterindustrie, synthetische Glimmer zu bevorzugen. Ein Beispiel von Keramikpartikeln sind Partikel aus Aluminiumoxidkeramiken.
Bevorzugte Weiterbildungen des erfindungsgemäßen Verfahrens finden sich
beispielsweise in den Aspekten 2 bis 28 und den Ansprüchen 2 bis 12. Ferner betrifft die vorliegende Erfindung einen partikelhaltigen Zylinder, wobei der Zylinder ein Volumen von mindestens 5 cm3 aufweist und formstabil ist,
der Anteil an Partikeln im Bereich von 10 Gew.-% bis 99,9 Gew.-% liegt, bezogen auf das Gesamtgewicht des Zylinders,
die Biegefestigkeit σ höchstens 3,75 N/mm2 beträgt, wobei σ berechnet wird gemäß Formel (I)
3 x F x l
mit F = maximale Kraft, B = Breite des Zylinders in Quaderform, D = Höhe des Zylinders in Quaderform, I = Abstand zwischen den beiden Auflagepunkten,
die Partikel ausgewählt werden aus der Gruppe bestehend aus Metallpartikeln,
Glaspartikeln, Micapartikeln, Keramikpartikeln und Mischungen hiervon,
die in dem Zylinder enthaltenen Partikel einen d50 von maximal 300 μηι aufweisen und der Zylinder mindestens 0,01 Gew.-% Bindemittel aufweist, bezogen auf das
Gesamtgewicht des partikelhaltigen Zylinders, wobei das Bindemittel ausgewählt wird aus der Gruppe bestehend aus anorganischen Bindemitteln, organischen Bindemitteln und Mischungen hiervon. Vorzugsweise werden die anorganischen Bindemittel ausgewählt aus der Gruppe bestehend aus Calciumsulfat, Talk, Calciumhydroxid, Siliciumoxid, Aluminiumoxid, Calciumcarbonat, Calciumsilikathydrate, Calciumaluminathydrate und Mischungen hiervon. Die organischen Bindemittel werden vorzugsweise ausgewählt aus der Gruppe bestehend aus Cellulose, Cellulosederivaten, Polysacchariden, Gelatine, Polyvinylen, Polyacrylaten, Polyethylenoxiden, Polyethylenglykolen, Polyamiden,
Epoxidharzen, Polyurethanen, Polyaldehyden, Polyolefinen, Polyacrylatcopolymeren,
Polyaldehydcopolymeren, Polyester, Polyolefincopolymere, den Salzen der vorgenannten Stoffe und Mischungen hiervon, mehr bevorzugt aus der Gruppe bestehend aus Cellulose, Cellulosederivaten, Polysacchariden, Gelatine, Polyvinylen, Polyacrylaten,
Polyethylenoxiden, Polyethylenglykolen, Polyamiden, Epoxidharzen, Polyurethanen, Polyacrylatcopolymeren, Polyaldehydcopolymeren, Polyester, Polyolefincopolymere, den Salzen der vorgenannten Stoffe und Mischungen hiervon, noch mehr bevorzugt aus der Gruppe bestehend aus Cellulose, Cellulosederivaten, Polysacchariden, Gelatine,
Polyvinylen, Polyacrylaten, Polyethylenoxiden, Polyethylenglykolen, Polyamiden,
Epoxidharzen, den Salzen der vorgenannten Stoffe und Mischungen hiervon.
Bevorzugte Weiterbildungen der erfindungsgemäßen Zylinder finden sich beispielsweise in den Aspekten 30 bis 50 und Anspruch 14. Weiterhin betrifft die vorliegende Erfindung die Verwendung eines erfindungsgemäßen Zylinders zur Erzeugung eines partikelhaltigen Aerosols. Bevorzugte Weiterbildungen der erfindungsgemäßen Verwendungen finden sich beispielsweise in Aspekt 52.
Ferner betrifft die vorliegende Erfindung einen Gegenstand, der mittels eines
erfindungsgemäß erzeugten Aerosols beschichtet wurde.
Die vorliegende Erfindung betrifft ein Verfahren zur Herstellung eines partikelhaltigen Aerosols, wobei ein partikelhaltiger Zylinder zerkleinert wird. Die Zerkleinerung des Zylinders kann mittels des Fachmanns geläufiger Verfahren erfolgen. Beispielsweise haben sich Vorrichtungen unter Einsatz einer Bürste oder eines Schleifbandes bewährt. Entsprechende Vorrichtungen unter Einsatz einer Bürste werden beispielsweise auch vielfach zur Überführung eines losen Pulvers in Aerosolform eingesetzt. Weitere
Fördervorrichtungen verwenden rotierende Fräsköpfe wie Schruppfräser oder Stirnfräser. Ferner können Schleifscheiben oder Schleifwalzen mit Schleifkörnern wie beispielsweise Siliciumcarbid, Wolframcarbid oder Diamant verwendet werden. Ein besonderer Vorteil der vorliegenden Erfindung ist jedoch, dass besonders leicht verarbeitbare Säulen erhalten werden können, die mittels simpler Förderverfahren wie der Bürstenförderung ohne starken Verschleiß an der Fördereinrichtung eingesetzt werden können.
Es hat sich gezeigt, dass die Partikel mittels des erfindungsgemäßen Verfahrens wieder hervorragend vereinzelt werden können. Beispielsweise zeigten Messungen der
Partikelgrößen nur eine geringfügig höhere mittlere Partikelgröße der Aerosolpartikel nach Vereinzelung der Säule verglichen mit den ursprünglichen Partikeln. Bei weiteren Ausführungsformen beträgt die mittlere Partikelgröße (D50) des Aerosols vorzugsweise höchstens das 5-fache, mehr bevorzugt höchstens das 3-fache, noch mehr bevorzugt höchstens das 2-fache der Partikel. Die Messung der mittleren Partikelgröße der in der Säule enthaltenen Partikel sowie der Aerosolpartikel erfolgt hierbei vorzugsweise mittels Lasergranulometrie unter Einsatz eines Partikelgrößenanalysator HELOS der Fa.
Sympatec GmbH, Clausthal-Zellerfeld, Deutschland. Die Dispergierung eines trockenen Pulvers kann hierbei mit einer Dispergiereinheit vom Typ Rodos T4.1 bei einem Primärdruck von beispielsweise 4 bar erfolgen. Die Auswertung der Streulichtsignale erfolgt dabei nach der Fraunhofer Methode.
Das erfindungsgemäße Aerosol wird vorzugsweise direkt in die gewünschte Applikation als Aerosolstrom überführt. Mittels des erfindungsgemäßen Verfahrens kann
überraschenderweise ein äußerst gleichmäßiger Aerosolstrom erzeugt werden, der insbesondere vorteilhaft in Beschichtungsverfahren wie dem nichtthermischen
Plasmaspritzen eingesetzt werden kann. Es wird vermutet, dass Beschichtungsverfahren welche typischerweise nur eine sehr geringe Aktivierung der eingebrachten Partikel verursachen, besonders stark von dem besonders homogenen Aerosolstrom profitieren, wodurch sehr homogene und hochqualitative Beschichtungen erhalten werden. Das erfindungsgemäße hergestellte Aerosol kann jedoch zur Beschichtung verschiedenster Stoffe unter Einsatz verschiedenster Beschichtungsverfahren eingesetzt werden. In diesem Zusammenhang haben sich Beschichtungsverfahren als besonders vorteilhaft erwiesen, welche ausgewählt werden aus der Gruppe bestehend aus Kaltgasspritzen, Flammspritzen, Hochgeschwindigkeitsflammspritzen, thermischem Plasmaspritzen und nichtthermischem Plasmaspritzen. Insbesondere hat sich das erfindungsgemäße
Verfahren als vorteilhaft in Kombination mit dem nichtthermischen Plasmaspritzen erwiesen.
Das Kaltgasspritzen zeichnet sich dadurch aus, dass ein aufzubringendes partikuläres Material nicht im Gasstrahl aufgeschmolzen wird, sondern dass die Partikel stark beschleunigt werden und infolge ihrer kinetischen Energie eine Beschichtung auf der Oberfläche des Substrats bilden. Hierbei können verschiedene dem Fachmann bekannte Gase als Trägergas eingesetzt werden wie zum Beispiel Stickstoff, Helium, Argon, Luft, Krypton, Neon, Xenon, Kohlenstoffdioxid, Sauerstoff oder Mischungen davon. Bei bestimmten Varianten ist es insbesondere bevorzugt, dass als Gas Luft, Helium oder Gemische davon eingesetzt werden.
Durch eine kontrollierte Expansion der vorgenannten Gase in einer entsprechenden Düse werden Gasgeschwindigkeiten von bis zu 3000 m/s erreicht. Die Partikel können hierbei auf bis zu 2000 m/s beschleunigt werden. Bei bestimmten Varianten des Kaltgasspritzens ist es jedoch bevorzugt, dass die Partikel beispielsweise Geschwindigkeiten zwischen 300 m/s und 1600 m/s, vorzugsweise zwischen 1000 m/s und 1600 m/s, mehr bevorzugt zwischen 1250 m/s und 1600 m/s erreichen.
Nachteilig ist beispielsweise die große Lärmentwicklung, die durch die hohen
Geschwindigkeiten der verwendeten Gasströme hervorgerufen wird.
Beim Flammspritzen wird beispielsweise ein partikuläres Material mittels einer Flamme in den flüssigen oder plastischen Zustand überführt und dann als Beschichtung auf ein Substrat aufgetragen. Hierbei wird z.B. eine Mischung aus Sauerstoff und einem brennbaren Gas wie Acetylen oder Wasserstoff verbrannt. In bestimmten Varianten des Flammspritzens wird ein Teil des Sauerstoff genutzt, um das pulverförmige
Beschichtungsmaterial in die Verbrennungsflamme zu befördern. Die Partikel erreichen bei gebräuchlichen Varianten dieses Verfahrens Geschwindigkeiten zwischen 24 bis 31 m/s.
Ähnlich wie bei Flammspritzen wird auch beim Hochgeschwindigkeitsflammspritzen beispielsweise ein partikuläres Material mittels einer Flamme in einen flüssigen oder plastischen Zustand überführt. Die Partikel werden jedoch im Vergleich zum vorgenannten Verfahren bedeutend höher beschleunigt. Bei spezifischen Beispielen des vorgenannten Verfahrens wird beispielsweise eine Geschwindigkeit des Gasstroms von 1220 bis 1525 m/s mit einer Geschwindigkeit der Partikel von ca. 550 bis 795 m/s genannt. Bei weiteren Varianten dieses Verfahrens werden jedoch auch Gasgeschwindigkeiten von über 2000 m/s erreicht. Im Allgemeinen ist es bei gebräuchlichen Varianten des voranstehenden Verfahrens bevorzugt, dass die Geschwindigkeit der Flamme zwischen 1000 und 2500 m/s liegt. Ferner ist es bei gebräuchlichen Varianten bevorzugt, dass die
Flammentemperatur zwischen 2200 °C und 3000 °C liegt. Die Temperatur der Flamme ist somit vergleichbar zur Temperatur beim Flammspritzen. Dies wird erreicht durch
Verbrennung der Gase unter einem Druck von ca. 515 bis 621 kPa gefolgt von der Expansion der Verbrennungsgase in einer Düse. Im Allgemeinen wird die Auffassung vertreten, dass hierbei erzeugte Beschichtungen eine höhere Dichte aufweisen, verglichen mit beispielsweise Beschichtungen erhalten durch das Flammspritzverfahren.
Das Detonations/Explosivflammspritzen kann als Unterart des
Hochgeschwindigkeitsflammspritzens betrachtet werden. Hierbei wird ein partikuläres Material durch wiederholte Detonationen eines Gasgemisches wie Acetylen/Sauerstoff stark beschleunigt, wobei beispielsweise Partikelgeschwindigkeiten von ca. 730 m/s erreicht werden. Die Detonationsfrequenz des Verfahrens liegt hierbei beispielsweise zwischen ca. 4 bis 10 Hz. Bei Varianten wie dem sogenannten Hochfrequenz- Gasdetonationsspritzen werden jedoch auch Detonationsfrequenzen um ca. 100 Hz gewählt.
Die erhaltenen Schichten sollen gewöhnlicherweise eine besonders hohe Härte, Stärke, Dichte und gute Bindung an die Substratoberfläche aufweisen. Nachteilig sind bei den vorgenannten Verfahren der erhöhte Sicherheitsaufwand, sowie beispielsweise die große Lärmbelastung aufgrund der hohen Gasgeschwindigkeiten.
Beim thermischen Plasmaspritzen wird beispielsweise ein Primärgas wie Argon mit einer Geschwindigkeit von 40 l/min und ein Sekundärgas wie Wasserstoff mit einer
Geschwindigkeit von 2,5 l/min durch einen Gleichstromlichtbogenofen geleitet, wobei ein thermisches Plasma erzeugt wird. Anschließend erfolgt beispielsweise die Zuführung von 40 g/min des pulverförmigen Beschichtungsmaterials unter Hilfe eines Trägergasstromes, der mit einer Geschwindigkeit von 4 l/min in die Plasmaflamme geleitet wird. Bei gebräuchlichen Varianten des thermischen Plasmaspritzens beträgt die Förderrate des pulverförmigen Beschichtungsmaterials zwischen 5 g/min und 60 g/min, mehr bevorzugt zwischen 10 g/min und 40 g/min.
Bei bestimmten Varianten des Verfahrens ist es bevorzugt Argon, Helium oder
Mischungen davon als ionisierbares Gas einzusetzen. Der gesamte Gasstrom beträgt bei bestimmten Varianten ferner bevorzugt 30 bis 150 SLPM (Standard liters per minute). Die zur Ionisation des Gasstromes eingesetzte elektrische Leistung ohne die infolge einer Kühlung abgeführte Wärmeenergie kann beispielsweise zwischen 5 und 100 kW, vorzugsweise zwischen 40 und 80 kW, gewählt werden. Hierbei können
Plasmatemperaturen zwischen 4000 K und einigen 10000 K erreicht werden.
Beim nichtthermischen Plasmaspritzen wird ein nichtthermisches Plasma zur Aktivierung des pulverförmigen Beschichtungsmaterials eingesetzt. Das hierbei verwendete Plasma wird beispielsweise mit einer Barriereentladung oder Coronaentladung mit einer Frequenz von 50 Hz bis 1 MHz erzeugt. In bestimmten Varianten des nichtthermischen Plasmaspritzens ist es bevorzugt, dass bei einer Frequenz von 10 kHz bis 100 kHz gearbeitet wird. Die Temperatur des Plasmas beträgt hierbei bevorzugt weniger als 3000 K, vorzugsweise weniger als 2500 K und noch mehr bevorzugt weniger als 2000 K. Dies minimiert den technischen Aufwand und hält den Energieeintrag in das aufzubringende Beschichtungsmaterial möglichst gering, was wiederum eine schonende Beschichtung des Substrats erlaubt. Die Größenordnung der Temperatur der Plasmaflamme ist somit bevorzugt vergleichbar mit der beim Flammspritzen oder beim
Hochgeschwindigkeitsflammspritzen. Durch gezielte Wahl der Parameter lassen sich auch nichtthermische Plasmen erzeugen, deren Kerntemperatur unter 1 173 K oder sogar unter 773 K im Kernbereich beträgt. Die Messung der Temperatur im Kernbereich erfolgt hierbei beispielsweise mit einem Thermoelement Typ NiCr/Ni und einem Spitzendurchmesser von 3 mm in 10 mm Abstand vom Düsenaustritt im Kern des austretenden Plasmastrahls bei Umgebungsdruck. Derartige nichtthermische Plasmen sind insbesondere für
Beschichtungen von sehr temperaturempfindlichen Substraten geeignet.
Diese Verfahren erlauben ferner die Erzeugung von Beschichtungen mit scharfen
Begrenzungen ohne die Notwendigkeit gezielt Bereiche abzudecken. In diesem Kontext hat es sich als vorteilhaft erwiesen insbesondere die Austrittöffnung der Plasmaflamme derart zu gestalten, dass die Bahnbreiten der erzeugten Beschichtungen zwischen 0,2 mm und 10 mm liegen. Dies ermöglicht eine sehr genaue, flexible, energieeffiziente
Beschichtung unter bestmöglicher Ausnutzung des eingesetzten Beschichtungsmaterials. Als Abstand der Spritzlanze zum Substrat wird beispielsweise eine Distanz von 1 mm gewählt. Dies ermöglicht eine größtmögliche Flexibilität der Beschichtungen und gewährleistet gleichzeitig qualitativ hochwertige Beschichtungen. Zweckdienlicherweise liegt der Abstand zwischen Spritzlanze und Substrat zwischen 1 mm und 35 mm.
Als ionisierbares Gas können im nichtthermischen Plasmaverfahren verschiedene, dem Fachmann bekannte Gase und deren Mischungen eingesetzt werden. Beispiele hierfür sind Helium, Argon, Xenon, Stickstoff, Sauerstoff, Wasserstoff oder Luft,
vorzugsweiseweise Argon oder Luft. Ein besonders bevorzugtes ionisierbares Gas ist Luft.
Beispielsweise zur Verminderung der Lärmbelastung kann es auch hier bevorzugt sein, dass die Geschwindigkeit des Plasmastromes unter 200 m/s liegt. Als
Strömungsgeschwindigkeit kann beispielsweise ein Wert zwischen 0,01 m/s und 100 m/s, vorzugsweise zwischen 0,2 m/s und 10 m/s gewählt werden. Insbesondere ist es bei bestimmten Ausführungsformen beispielsweise bevorzugt, dass der Volumenstrom des Trägergases zwischen 10 und 25 l/min, mehr bevorzugt zwischen 15 und 19 l/min liegt. Die erfindungsgemäßen Zylinder ermöglichen eine besonders gleichmäßige Förderung der Partikel und damit die Erzeugung eines besonders homogenen Aerosols. Bei weiteren Ausführungsformen wird bei dem erfindungsgemäßen Verfahren ein Aerosolstrom erzeugt, dessen Schwankung unter 20 %, vorzugsweise unter 10 %, mehr bevorzugt unter 5 %, liegt. Eine derartig gleichmäßige Förderung kann beispielsweise über einen Zeitraum von mindestens 10 min, vorzugsweise mindestens 20 min, mehr bevorzugt mindestens 40 min aufrecht erhalten werden.
Es hat sich gezeigt, dass die Höhe der erfindungsgemäßen Zylinder bei weiteren
Ausführungsformen vorteilhafterweise das mindestens 2-fache, vorzugsweise das mindestens 3-fache, mehr bevorzugt das mindestens 4-fache, des arithmetischen Mittels der längsten Achsen entlang der Grundfläche und der Deckfläche beträgt. Unter der „Höhe" des Zylinders wird der Abstand zwischen Grundfläche und Deckfläche bezeichnet. Beispielsweise beträgt die Höhe eines erfindungsgemäßen Zylinders mit kreisrunder Grundfläche und Deckfläche mit einem Durchmesser von jeweils 5 cm vorteilhafterweise mindestens 10 cm, vorzugsweise mindestens 15 cm, mehr bevorzugt mindestens 20 cm.
Bei weiteren Ausführungsformen ist es bevorzugt, dass die Grundfläche und Deckfläche der partikelhaltigen Zylinder im Wesentlichen elliptisch oder kreisförmig, vorzugsweise kreisförmig, sind. Insbesondere ist es hierbei bevorzugt, dass der Flächeninhalt der Grundfläche und Deckfläche bis zu einer Abweichung von höchstens 10 %, mehr bevorzugt von höchstens 7 %, noch mehr bevorzugt von höchstens 4 %, von dem
Flächeninhalt einer idealen geometrischen Ellipsoidfläche bzw. Kreisfläche abweicht.
Ferner ist es bei weiteren Ausführungsformen bevorzugt, dass die Längsachse im
Wesentlichen senkrecht zur Grundfläche und Deckfläche steht. Vorzugsweise beträgt die Abweichung weniger als 3°, mehr bevorzugt weniger als 2°.
Mittels des erfindungsgemäßen Verfahrens können insbesondere besonders homogene Beschichtungen auch unter sehr milden Bedingungen hergestellt werden. Beispielsweise können unter bereits sehr milden Beschichtungsbedingungen unter Einsatz des nichtthermischen Plasmaspritzens Beschichtungen erhalten werden, welche sich durch eine äußerst homogene Dicke auch bei sehr dünnen Schichtdicken auszeichnen, siehe beispielsweise Abbildung 3. So betragen die Unterschiede zwischen Minima und Maxima vorzugsweise höchstens 5 μηι, mehr bevorzugt höchstens 3 μηι. Bei weiteren
Ausführungsformen betragen die Unterschiede zwischen Minima und Maxima
vorzugsweise höchstens 20 %, mehr bevorzugt höchstens 14 %, noch mehr bevorzugt höchstens 9 %, bezogen auf die Gesamtdicke der Beschichtung. Ferner betrifft die vorliegende Erfindung partikelhaltige Zylinder, wobei der Zylinder ein Volumen von mindestens 5 cm3 aufweist und formstabil ist,
der Anteil an Partikeln im Bereich von 10 Gew.-% bis 99,9 Gew.-% liegt, bezogen auf das Gesamtgewicht des Zylinders,
die Biegefestigkeit σ höchstens 3,75 N/mm2 beträgt, wobei σ berechnet wird gemäß Formel (I)
3 x F x l
a = 2 x B x D /) mit F = maximale Kraft, B = Breite des Zylinders in Quaderform, D = Höhe des Zylinders in Quaderform, I = Abstand zwischen den beiden Auflagepunkten,
die Partikel ausgewählt werden aus der Gruppe bestehend aus Metallpartikeln,
Glaspartikeln, Micapartikeln, Keramikpartikeln und Mischungen hiervon,
die in dem Zylinder enthaltenen Partikel einen d50 von maximal 300 μηι aufweisen und der Zylinder mindestens 0,01 Gew.-% Bindemittel aufweist, bezogen auf das
Gesamtgewicht des partikelhaltigen Zylinders, wobei das Bindemittel ausgewählt wird aus der Gruppe bestehend aus anorganischen Bindemitteln, organischen Bindemitteln und Mischungen hiervon. Vorzugsweise werden die anorganischen Bindemittel ausgewählt werden aus der Gruppe bestehend aus Calciumsulfat, Talk, Calciumhydroxid,
Siliciumoxid, Aluminiumoxid, Calciumcarbonat, Calciumsilikathydrate,
Calciumaluminathydrate und Mischungen hiervon. Die organischen Bindemittel werden vorzugsweise ausgewählt werden aus der Gruppe bestehend aus Cellulose,
Cellulosederivaten, Polysacchariden, Gelatine, Polyvinylen, Polyacrylaten,
Polyethylenoxiden, Polyethylenglykolen, Polyamiden, Epoxidharzen, Polyurethanen, Polyaldehyden, Polyolefinen, Polyacrylatcopolymeren, Polyaldehydcopolymeren,
Polyester, Polyolefincopolymere, den Salzen der vorgenannten Stoffe und Mischungen hiervon, mehr bevorzugt aus der Gruppe bestehend aus Cellulose, Cellulosederivaten, Polysacchariden, Gelatine, Polyvinylen, Polyacrylaten, Polyethylenoxiden,
Polyethylenglykolen, Polyamiden, Epoxidharzen, den Salzen der vorgenannten Stoffe und Mischungen hiervon. Die Bestimmung der Partikelmenge und Bindemittelmenge erfolgt mittels dem Fachmann geläufiger Verfahren wie AAS, EDX und RFA. Das Gesamtgewicht des Zylinders wird im trockenen Zustand bestimmt. Vorzugsweise nach mindestens 24 h, mehr bevorzugt 24 h, Lagerung unter STPD-Bedingungen (0 °C, 101 kPa und
Wasserdampfpartialdruck = 0 kPa). Soweit nicht anders angegeben, werden auch die sonstigen Gewichtsangaben dieser Erfindung unter diesen Bedingungen vermessen.
Es zeigte sich, dass bei Zylindern mit sehr geringer Formstabilität bzw. mit einer sehr geringen Biegefestigkeit die Lagerung, der Transport und die Handhabung der Zylinder drastisch erschwert wurde. Bei weiteren Ausführungsformen weisen die Zylinder vorzugsweise eine Biegefestigkeit von mindestens 0,0075 N/mm2, mehr bevorzugt mindestens 0,0105 N/mm2, noch mehr bevorzugt mindestens 0,012 N/mm2, noch mehr bevorzugt mindestens 0,015 N/mm2 auf. Ferner zeigte sich, dass durch die Verwendung von Zylinder mit niedrigerer
Biegefestigkeit die Förderbarkeit weiter vereinfacht werden konnte. Bei weiteren
Ausführungsformen beträgt die Biegefestigkeit daher vorzugsweise höchstens 2,1 N/mm2, mehr bevorzugt höchstens 1 ,2 N/mm2, noch mehr bevorzugt höchstens 0,675 N/mm2. Insbesondere ist es bei weiteren Ausführungsformen bevorzugt, dass die Biegefestigkeit im Bereich von 0,0075 bis 3,75 N/mm2, mehr bevorzugt im Bereich von 0,0105 bis 2, 1 N/mm2, noch mehr bevorzugt im Bereich von 0,012 bis 1 ,2 N/mm2 und noch mehr bevorzugt im Bereich von 0,015 bis 0,675 N/mm2 liegt. Hierbei kann die Biegefestigkeit vom Fachmann zum Beispiel über die Wahl des
Bindemittels, dessen Menge, die Menge gegebenenfalls enthaltener Füllstoffe, etc. gezielt eingestellt werden. Eine Erhöhung der Biegefestigkeit kann beispielsweise mittels des Einsatzes eines Bindemittels mit hoher Festigkeit, der Erhöhung des Bindemittelanteils, dem Druck beim Komprimieren entsprechender Zylinder, etc. erreicht werden. Eine Erniedrigung kann beispielsweise durch Wahl eines Bindemittels mit niedriger
Bindewirkung, der Erniedrigung des Bindemittelanteils, der Erhöhung des
Lösemittelanteils, dem Zusatz eines Füllstoffs, etc. erreicht werden. Ferner wurde beobachtet dass zur Erzielung einer identischen Biegefestigkeit typischerweise umso mehr Bindemittel eingesetzt werden muss, je mehr die Partikel von der sphärischen
Idealform abweichen und je niedriger die Dichte des Materials der Partikel ist. Ferner hat es sich zur Erzeugung homogene Zylinder als vorteilhaft erwiesen, wenn beispielsweise bei Herstellverfahren wie dem Schlickerguss die Lösungsmittelmenge möglichst gering gehalten wird. Eine entsprechende Suspension sollte fließfähig sein, jedoch möglichst wenig Lösungsmittel enthalten. Ferner können verschiedene Additive eingesetzt werden, um die erfindungsgemäßen Zylinder herzustellen. Beispielsweise können Rheologie modifizierende Additive eingesetzt werden, welche den entsprechenden Suspensionen ein thixotropes Verhalten verleihen. Ferner können Benetzungshilfsmittel eingesetzt werden, um beispielsweise eine Einarbeitung der Partikel und/oder des Bindemittels in das gewünschte Lösungsmittel zu erleichtern. Beispiele hierfür sind Tenside oder organische Lösungsmittel.
Die Partikel können vor der Herstellung der Säule auch mit Bindemittel beschichtet werden. Dies hat den Vorteil, dass eine besonders homogene Verteilung des Bindemittels auch bei geringen Bindemittelmengen ohne starke Durchmischungsschritte oder
Lösungsmittel erreicht werden kann. Eine derartige Beschichtung beispielsweise bestehend aus einem Monomer wird hierbei gegebenenfalls mit weiterem Bindemittel polymerisiert, um den Zusammenhalt der Säule zu bewirken. Es kann jedoch
beispielsweise auch das beschichtete Partikelmaterial ohne weiteres Bindemittel in eine Form überführt und thermisch ausgehärtet werden. Gemäß der vorliegenden Erfindung werden Beschichtungen der Partikel, welche eine dem Bindemittel zumindest
vergleichbare Zusammensetzung aufweisen, wie beispielsweise eine
Polyacrylatbeschichtung bei einem Polyacrylatbindemittel oder eine siliciumoxidhaltige Beschichtung bei Siliciumoxidbindemittel zur Bindemittelmenge gezählt. Vorzugsweise werden jedoch nur Beschichtungen der Partikel zur Bindemittelmenge gezählt, welche auch eine kovalente Bindung zum Bindemittel ausgebildet haben.
Als Rheologie modifizierende Additive können beispielsweise polymere Materialien wie Polyacrylamide, Polyacrylsäuren, Carboxymethylcellulosen, Hydroxypropylmethylcellulosen, Methylcellulosen, Alginate, Polyethylenglykole,
Polyvinylalkohole, Polyvinylpyrrolidone, Polyurethane und Polysaccharide und
anorganische Additive wie Siliciumdioxid und Organociays eingesetzt werden. So sind von der Firma BYK-Chemie beispielsweise BYK-410, BYK- 1 1 , BYK-415, BYK-420, BYK-425, BYK^128, BYK-430 und BYK-431 als polymere Rheologie modifizierende Additive erhältlich. Ein Beispiel der Organociays sind Bentonite. Als Rheologie modifizierendes Additiv aus der Gruppe der Siliciumdioxide kann beispielsweise pyrogene Kieselsäure eingesetzt werden. Die in den erfindungsgemäßen Zylindern eingesetzten Partikel weisen vorzugsweise einen d50 in einem Bereich von 1 μηι bis 300 μηι, vorzugsweise in einem Bereich von 1 ,5 μηι bis 230 μηι, mehr bevorzugt in einem Bereich von 2 μηι bis 180 μηι, noch mehr bevorzugt in einem Bereich von 2,5 μηι bis 150 μηι, auf. Diese zeigten unter einem breiten Spektrum an Förderbedingungen und Fördermengen eine gute und homogene
Aerosolbildung und gute Ergebnisse bei den geläufigen Beschichtungsverfahren.
Zur Erzielung möglichst großer Partikelgehalte in den partikelhaltigen Zylindern hat es sich als vorteilhaft erwiesen nichtplättchenförmige Partikel einzusetzen. Überraschenderweise hat sich gezeigt, dass hiermit sehr einfach hohe Pigmentierungshöhen erreicht werden können, ohne dass beispielsweise Additive bei der Verarbeitung eingesetzt werden müssen. Hierbei liegt der Gehalt an Partikeln vorzugsweise in einem Bereich von
50 Gew.-% bis 99,9 Gew.-%, mehr bevorzugt in einem Bereich von 60 Gew.-% bis 98 Gew.-%, noch mehr bevorzugt in einem Bereich von 70 Gew.-% bis 97 Gew.-%, jeweils bezogen auf das Gesamtgewicht des Zylinders.
Sofern der erfindungsgemäße Aerosolstrom in einer Applikation verwendet werden soll, bei der beispielsweise eine geringe Energiemenge eingebracht werden soll, wie dem nichtthermischen Plasmaspritzen, erwies es sich als schwierig mit dem nicht- plättchenförmigen Beschichtungsmaterial unter besonders milden
Beschichtungsbedingungen eine homogene Beschichtung zu erzeugen. Bei weiteren Ausführungsformen ist es bevorzugt, dass die Partikel der erfindungsgemäßen Zylinder plättchenförmige Partikel sind, wobei der Anteil an plättchenförmigen Partikeln in dem partikelhaltigen Zylinder in einem Bereich von 30 Gew.-% bis 75 Gew.-%, vorzugsweise in einem Bereich von 40 Gew.-% bis 70 Gew.-%, mehr bevorzugt in einem Bereich von 50 Gew.-% bis 65 Gew.-%, liegt, jeweils bezogen auf das Gesamtgewicht des Zylinders. Diese Zylinder lieferten gute Ergebnisse hinsichtlich der Förderbarkeit der Partikel sowie in nachfolgenden Applikationen wie dem nichtthermischen Plasmaspritzen. Die guten Ergebnisse auch unter sehr milden Beschichtungsbedingungen werden darauf zurückgeführt, dass die deutlich größere Oberfläche dieser Partikel eine stärkere
Aktivierung ermöglicht. Bei einem zu großen Gehalt an plättchenförmigen Partikeln erwies es sich jedoch als problematisch eine ausreichende Stabilität der Zylinder zu
gewährleisten. Unter dem Begriff„plättchenförmig" wird im Sinne der vorliegenden Erfindung verstanden, dass entsprechende Partikel ein Aspektverhältnis von mindestens 10 aufweisen. Partikel mit einem Aspektverhältnis von weniger als 10 werden im Sinne der vorliegenden Erfindung als„nichtplättchenförmig" bezeichnet.
Der Begriff„Aspektverhältnis" bezeichnet im Sinne der vorliegenden Erfindung das Verhältnis von mittlerem Partikeldurchmesser (d50) zu mittlerer Partikeldicke (h50). Der Begriff„d50" oder auch„d5o-Wert" bezeichnet den Wert bei dem 50 % der Partikel in der Summenhäufigkeitsverteilung einen Durchmesser aufweisen, der gleich oder kleiner diesem Wert ist. Die Messungen werden vorzugsweise mit dem Partikelgrößenanalysator HELOS der Fa. Sympatec GmbH, Clausthal-Zellerfeld, Deutschland, durchgeführt. Die Dispergierung eines trockenen Pulvers kann hierbei mit einer Dispergiereinheit vom Typ Rodos T4.1 bei einem Primärdruck von beispielsweise 4 bar erfolgen. Alternativ kann die Größenverteilungskurve der Partikel beispielsweise mit einem Gerät der Fa.
Quantachrome (Gerät: Cilas 1064) gemäß Herstellerangaben vermessen werden. Hierzu werden 1 ,5 g des pulverförmigen Beschichtungsmaterials in ca. 100 ml Ethanol dispergiert, 300 Sekunden im Ultraschallbad (Gerät: Sonorex IK 52, Fa. Bandelin) behandelt und anschließend mittels einer Pasteurpipette in die Probenvorbereitungszelle des Messgerätes gegeben und mehrmals vermessen. Aus den einzelnen
Messergebnissen werden die resultierenden Mittelwerte gebildet. Die Auswertung der Streulichtsignale erfolgt dabei nach der Fraunhofer Methode. Die Dicke der Partikel kann beispielsweise mittels REM wie folgt ermittelt werden. Die erfindungsgemäßen plättchenförmigen Partikel werden zunächst mit Aceton gewaschen und dann ausgetrocknet. Ein in der Elektronenmikroskopie übliches Harz, beispielsweise TEMPFIX (Gerhard Neubauer Chemikalien, D-48031 Münster, Deutschland), wird auf einen Probenteller aufgebracht und auf einer Heizplatte bis zum Erweichen erhitzt. Nachfolgend wird der Probenteller von der Heizplatte genommen und die Partikel werden auf das erweichte Harz gestreut. Das Harz wird durch die Abkühlung wieder fest und die aufgestreuten Partikel können - bedingt durch das Wechselspiel zwischen Adhäsion und Schwerkraft - nahezu senkrecht stehend und fixiert auf dem Probenteller präpariert werden. Dadurch sind die Partikel im Elektronenmikroskop seitlich gut zu vermessen. Bei der Vermessung der Dicke wird der azimuthale Winkel α des Partikels zu einer zur Oberfläche normalen Ebene geschätzt und bei der Dickenauswertung nach der Formel heff = hmess cosa berücksichtigt. Von den hefrWerten wird anhand der relativen Häufigkeiten die
Summenverteilungskurve erstellt. Es werden ca. 100 Partikel, vorzugsweise 100 Partikel, gezählt. Sofern die vorgenannte Verfahrensvariante nicht einsetzbar ist, können die Dicken der Partikel beispielsweise auch anhand von Querschliffen von lackierten Proben gezählt werden. Diese Methode sollte jedoch nur bei einer sehr guten planparallelen Orientierung der Partikel angewandt werden. Andernfalls können die Partikel im Querschliff mit einem azimuthalen Neigungswinkel, der jedoch für den Beobachter nicht erkennbar ist, orientiert sein. Dies führt systematisch zu der Messung von höheren Dicken.
Bei weiteren Ausführungsformen liegt die Menge der Partikel im Zylinder in Abhängigkeit von der Menge der plättchenförmigen Partikeln bei x Gew.-% plättchenförmiger Partikel, bezogen auf das Gesamtgewicht der Partikel, im Bereich von (50 Gew.-% - (0,2 χ x) Gew- %) bis (99,9 Gew.-% - (0,249 χ x) Gew.-%), vorzugsweise im Bereich von (60 Gew.-% - (0,2 x) Gew-%) bis (98 Gew.-% - (0,28 χ x) Gew.-%), mehr bevorzugt im Bereich von (70 Gew.-% - (0,2 χ x) Gew-%) bis (97 Gew.-% - (0,32 χ x) Gew.-%), bezogen auf das Gesamtgewicht des Zylinders. Bei weiteren Ausführungsformen umfasst der erfindungsgemäße Zylinder Füllstoffe, die vorzugsweise ausgewählt werden aus der Gruppe bestehend aus Schichtsilikaten, Tonmineralien, Metalloxiden, Kieselgel, Glaskugeln und Mischungen davon. Ferner ist es bei weiteren Ausführungsformen bevorzugt, dass die erfindungsgemäßen Zylinder Bornitrid umfassen. Durch den Zusatz von Bornitrid konnte beispielsweise eine erhöhte Abriebbeständigkeit und Wärmeleitfähigkeit erzielt werden. Vorzugsweise liegt die Menge des Bornitrids in einem Bereich von 0,1 Gew.-% bis 50 Gew.-%, mehr bevorzugt in einem Bereich von 0,1 Gew.-% bis 20 Gew.-%, noch mehr bevorzugt in einem Bereich von 0,1 Gew.-% bis 15 Gew.-%, jeweils bezogen auf das Gesamtgewicht der Zylinder.
Bei weiteren Ausführungsformen ist es bevorzugt, dass die Gesamtmenge an Partikeln und Bindemitteln im partikelhaltigen Zylinder mindestens 90 Gew.-%, vorzugsweise mindestens 95 Gew.-%, mehr bevorzugt mindestens 99,9 Gew.-% beträgt, jeweils bezogen auf das Gesamtgewicht des Zylinders. Insbesondere die Verringerung enthaltener nichtreaktiver Füllstoffe hat sich als vorteilhaft erwiesen, da hiermit eine verbesserte Beschichtungsbildung bei beispielsweise verringertem Overspray erzielt werden konnte.
Ferner ist es bei weiteren Ausführungsformen bevorzugt, dass die Partikel des partikelhaltigen Zylinders zu mindestens 90 Gew.-%, vorzugsweise zu mindestens 95 Gew.-%, mehr bevorzugt zu mindestens 99,9 Gew.-% ausgewählt werden aus entweder Metallpartikeln oder Glaspartikeln oder Micapartikeln oder Keramikpartikeln, bezogen auf das Gesamtgewicht der Partikel. Besonders vorteilhaft hat sich die
Verwendung von Metallpartikeln und Glaspartikeln, insbesondere Metallpartikeln, erwiesen.
Die erfindungsgemäßen Zylinder können in der Form einzelner Zylinder oder als theoretisch endlose Zylinder eingesetzt werden. Letztere sind beispielsweise mittels einer direkten Extrusion des Zylindermaterials erhältlich, wobei der extrudierte Zylinder direkt in die Fördereinrichtung eingespeist wird. Hierbei sind Bindemittel bevorzugt, welche eine schnelle Verfestigung des Zylindermaterials nach dem Ausformungsschritt bieten, wie beispielsweise mikrokristalline Cellulose. Die Verwendung einer derartigen Kombination eines Ausformungsschrittes mit dem Förderungsschritt ermöglicht eine nahezu unbegrenzte, kontinuierliche Förderung.
Die Verwendung einzelner Zylinder ermöglicht hingegen beispielsweise einen einfacheren Geräteaufbau und ein einfacheres Wechseln zwischen verschiedenen Säulentypen. Hierbei erwies es sich zur Erzielung einer vereinfachten Förderung typischerweise als vorteilhaft, wenn der erfindungsgemäße partikelhaltige Zylinder ein Volumen von mindestens 8 cm3, vorzugsweise von mindestens 1 1 cm3, mehr bevorzugt von mindestens 19 cm3, noch mehr bevorzugt von mindestens 30 cm3, aufweist.
Die Menge der eingesetzten Bindemittel liegt bei weiteren Ausführungsformen in einem Bereich von 0,05 Gew.-% bis 70 Gew.-%, vorzugsweise in einem Bereich von 0,07 Gew.- % bis 60 Gew.-%, mehr bevorzugt in einem Bereich von 0,1 Gew.-% bis 45 Gew.-%. Ferner liegt bei weiteren Ausführungsformen vorzugsweise die Menge von anorganischem Bindemittel in einem Bereich von 1 ,5 Gew.-% bis 70 Gew.-% und die Menge von organischen Bindemittel in einem Bereich von 0,05 Gew.-% bis 50 Gew.-%, mehr bevorzugt die Menge von anorganischem Bindemittel in einem Bereich von 1 ,9 Gew.-% bis 60 Gew.-% und die Menge von organischen Bindemittel in einem Bereich von
0,07 Gew.-% bis 35 Gew.-%, noch mehr bevorzugt die Menge von anorganischem
Bindemittel in einem Bereich von 2,2 Gew.-% bis 45 Gew.-% und die Menge von organischen Bindemittel in einem Bereich von 0,1 Gew.-% bis 25 Gew.-%.
Bei weiteren Ausführungsformen ist es bevorzugt, dass mindestens ein Bindemittel des partikelhaltigen Zylinders aus den anorganischen Bindemitteln ausgewählt wird. Diese Bindemittel erwiesen sich als vorteilhaft zur Bereitstellung besonders stabiler Zylinder, welche beispielsweise eine hohe Lagerfähigkeit und Stabilität unter UV-Strahlung bereitstellen. Beispiele derartiger anorganischer Bindemittel sind Calciumsulfat, Talk, Calciumhydroxid, Siliciumoxid, Aluminiumoxid, Calciumcarbonat, Calciumsilikathydrate, Calciumaluminathydrate und Mischungen hiervon, wobei die vorgenannten Stoffe Wasser, insbesondere in der Form von Kristallwasser, umfassen können. Vorzugsweise umfasst der partikelhaltige Zylinder hierbei mindestens 1 ,5 Gew.-%, mehr bevorzugt mindestens 1 ,9 Gew.-%, noch mehr bevorzugt mindestens 2,2 Gew.-%, anorganische Bindemittel.
Calciumsulfat und dessen Hydrate sind beispielsweise unter dem Namen Gips käuflich erhältlich. Für die erfindungsgemäßen Applikationen haben sich hochwertige
Gipsvarianten wie Dentalgipse und Modellgipse, insbesondere Dentalgipse, als vorteilhaft erwiesen. Es hat gezeigt, dass niederqualitative Gipssorten wie Baugips deutlich schlechtere Ergebnisse lieferten. Es wird vermutet, dass ein kontrolliertes Abbinden zum Erreichen einer homogenen Struktur der Zylinder erforderlich ist. Baugipse hingegen scheinen infolge der preisgetriebenen Massenproduktion eine ungleichmäßigere
Zusammensetzung aufzuweisen, wodurch kein einheitliches Abbinden gewährleistet werden kann. Es wird vermutet, dass die unterschiedlichen Gipsmodifikationen, welche durch Variation der Temperatur und Umgebungsbedingungen wie Druck erhalten werden, infolge ihrer unterschiedlichen Eigenschaften nicht die Herstellung hochwertiger erfindungsgemäßer Säulen ermöglichen.
Soweit nicht anderweitig spezifiziert, ist es in der vorliegenden Erfindung besonders bevorzugt, dass„im Wesentlichen" mindestens 95 %, vorzugsweise mindestens 99 %, bedeutet. Soweit es sich auf ein stoffliches Merkmal bezieht, wie beispielsweise die Menge eines stofflichen Bestandteils, so sind hiermit Gew.-% gemeint.
Als vorteilhaft für die meisten Applikationen haben sich Calciumsulfat, Talk,
Calciumcarbonat, Siliciumoxid, Mischungen von Calciumsilikathydraten und
Calciumaluminathydraten und Mischungen von Calciumhydroxid und Calciumcarbonat, insbesondere Calciumsulfat und Siliciumoxid erwiesen, wobei die vorgenannten Stoffe Wasser, insbesondere in der Form von Kristallwasser, umfassen können. Ein besonders bevorzugtes anorganisches Bindemittel ist Calciumsulfat, wobei das Calciumsulfat Wasser, insbesondere in der Form von Kristallwasser, umfassen kann.
Unter dem Begriff„Calciumsulfat" im Sinne der vorliegenden Erfindung werden auch die Hydrate des Calciumsulfats verstanden. Dieses Bindemittel hat sich als besonders vorteilhaft erwiesen, da es unter den typischen Bedingungen nachfolgender
Beschichtungsverfahren ohne merkliche Beeinträchtigung resultierender Beschichtungen appliziert werden kann und infolge seiner geringen Reaktivität für die Formulierung mit einem breiten Spektrum an erfindungsgemäßen Partikeln geeignet ist. Typischerweise weist Calciumsulfat 2 als Kristallwasser gebundene Moleküle Wasser je
Calciumsulfatmolekül auf. Ferner hat sich Siliciumoxid bei weiteren Ausführungsformen als vorteilhaftes Bindemittel erwiesen, wobei der Begriff„Siliciumoxid" im Sinne der vorliegenden Erfindung auch die Hydrate des Siliciumoxids umfasst. Vorzugsweise handelt es sich bei dem Siliciumoxid der vorliegenden Erfindung im Wesentlichen um Siliciumdioxid. Bei der Verwendung von Siliciumoxid kann beispielsweise die Stabilität hiermit erhaltener Zylinder in einem breiten Spektrum durch verfahrenstechnische Details wie den Bedingungen des Aushärtens sowie der Variation der Edukte bestimmt werden. Beispielsweise können allein bei Aushärtung unter Raumtemperatur unterschiedliche Ergebnisse durch Einsatz eines definierten Gasstroms wie Luft oder C02, der Dauer des Gasstroms, sowie der eingesetzten Menge des Gases erzielt werden. Bei der Verwendung von Wasserglas kann ferner beispielsweise durch den Zusatz von amorphen Silicium die Härte des erhaltenen Zylinders variiert werden. Somit kann aus einem einfachen und kostengünstigen
Grundsystem das vom Kunden gewünschte Produkt gezielt hergestellt werden. Bei weiteren Ausführungsformen ist es ferner bevorzugt, dass mindestens ein Bindemittel des partikelhaltigen Zylinders ein organisches Bindemittel ist, das ausgewählt wird aus der Gruppe bestehend aus Cellulose; Cellulosederivaten wie Methylcellulose, Ethylcellulose, mikrokristalline Cellulose, Hydroxyethylcellulose, Hydroxypropylcellulose,
Hydroxypropylmethylcellulose, Carboxyethylcellulose, Celluloseacetatbutyrat und
Carboxymethylcellulose; Polysacchariden wie Alginsäure, Alginsäurederivate, Stärke, Stärkederivate, Xanthan, Dextrine, Dextrane, Guarkernmehl, Johannisbrotkernmehl, Carageen und Pullulan; Gelatine; Polyvinylen wie Polyvinylalkohole, Polyvinylpyrrolidone und Polyvinylbutyrale; Polyacrylaten wie Polyacrylsäuren und Polyacrylsäureester;
Polyethylenoxiden; Polyethylenglykolen; Polyamiden; Epoxidharzen; den Salzen der vorgenannten Stoffe und Mischungen hiervon. Diese Bindemittel weisen beispielsweise den Vorteil auf, dass sie in der Flamme eines Beschichtungsverfahrens zumindest teilweise, bevorzugt vollständig, verbrennen können und das entstehende Gas nicht in die Beschichtung eingebaut wird und somit leicht abgetrennt werden kann. Bevorzugte Salze sind Alkali und Erdalkalisalze wie Natriumsalze, Kaliumsalze, Ammoniumsalze und Calciumsalze. Ferner ist es bevorzugt, dass die Cellulosederivate wasserlöslich sind.
Polyacrylsäuren sind beispielsweise unter dem Namen CARBOPOL wie CARBOPOL 941 und CARBOPOL 934 erhältlich. Vorzugsweise umfasst der partikelhaltige Zylinder hierbei mindestens 0,05 Gew.-%, mehr bevorzugt mindestens 0,07 Gew.-%, noch mehr bevorzugt mindestens 0, 1 Gew.-%, organische Bindemittel. Bei weiteren
Ausführungsformen ist es bevorzugt, dass die Cellulosederivate ausgewählt werden aus der Gruppe bestehend aus Methylcellulose, Ethylcellulose, mikrokristalline Cellulose, Hydroxyethylcellulose, Hydroxypropylcellulose, Hydroxypropylmethylcellulose,
Carboxyethylcellulose und Carboxymethylcellulose Bei weiteren Ausführungsformen wird das organische Bindemittel vorzugsweise ausgewählt aus der Gruppe bestehend aus Cellulose; Cellulosederivaten wie
Methylcellulose, Ethylcellulose, mikrokristalline Cellulose, Hydroxyethylcellulose,
Hydroxypropylcellulose, Hydroxypropylmethylcellulose, Carboxyethylcellulose und Carboxymethylcellulose; Polysacchariden wie Alginsäure, Alginsäurederivate, Stärke, Stärkederivate, Xanthan, Dextrine, Dextrane, Guarkernmehl, Johannisbrotkernmehl, Carageen und Pullulan; Gelatine; Polyvinylen wie Polyvinylalkohole, Polyvinylpyrrolidone und Polyvinylbutyrale; Polyacrylaten wie Polyacrylsäuren und Polyacrylsäureester;
Polyethylenoxiden; Polyethylenglykolen; Polyamiden; den Salzen der vorgenannten Stoffe und Mischungen hiervon, mehr bevorzugt ausgewählt aus der Gruppe bestehend aus Cellulose; Cellulosederivaten wie Methylcellulose, Ethylcellulose, mikrokristalline
Cellulose, Hydroxyethylcellulose, Hydroxypropylcellulose, Hydroxypropylmethylcellulose, Carboxyethylcellulose und Carboxymethylcellulose; Polysacchariden wie Alginsäure, Alginsäurederivate, Stärke, Stärkederivate, Xanthan, Dextrine, Dextrane, Guarkernmehl, Johannisbrotkernmehl, Carageen und Pullulan; den Salzen der vorgenannten Stoffe und Mischungen hiervon. Besonders bevorzugte Polyvinyle sind Polyvinylalkohole und Polyvinylpyrrolidone.
Beispiele weiterer organischer Bindemittel, welche bei weiteren Ausführungsformen insbesondere als Erweiterung der vorgenannten Gruppen zu verstehen sind, sind
Harnstoff-Formaldehyd-Copolymere, Melamin-Formaldehyd-Copolymere, Acrylsäureester- Acrylnitril-Copolymere, Polyester von Polycarbonsäuren und mehrwertigen Alkoholen, Acrylsäureester-Acrylnitril-Copolymere, Acrylsäureester-Styrol-Copolymere, Acrylamid- Copolymere und Butadien-Styrol-Copolymere. Jedoch stellt die vorgenannte Gruppe auch eine eigenständige, für bestimmte Ausführungsformen sehr vorteilhafte, Gruppe dar. Beispiele hierfür sind Styrofan D 780 S, Acronal 12 DE, Acronal 32 D, Acronal S 888 S, Acronal LN 838 S, Aerodur DS 3530, Acronal LN 579 S, Saduren 163 und Urecoll 135 und Aerodur DS 3515. Der Begriff„Polymere" umfasst erfindungsgemäß auch Oligomere. Vorzugsweise weisen die erfindungsgemäßen Polymere wie beispielsweise Cellulosederivate, Polysaccharide, Polyvinyle, Polyacrylate und Polyethylenglykole mindestens 10 Monomereinheiten, mehr bevorzugt mindestens 20 Monomereinheiten, noch mehr bevorzugt mindestens 60 Monomereinheinten auf. Insbesondere ist es bei weiteren Ausführungsformen bevorzugt, dass das Bindemittel ausgewählt wird aus der Gruppe bestehend aus Calciumsulfat, Talk, Calciumcarbonat, Siliciumoxid, Mischungen von Calciumsilikathydraten und Calciumaluminathydraten, Mischungen von Calciumhydroxid und Calciumcarbonat, Cellulose, Cellulosederivaten, Polysacchariden, Polyvinylen, Polyacrylaten, Polyethylenoxiden, Polyethylenglykolen, Polyamiden, den Salzen der vorgenannten Stoffe und Mischungen hiervon, vorzugsweise aus der Gruppe bestehend aus Calciumsulfat, Siliciumoxid, Cellulose, Cellulosederivaten, Polysacchariden, Polyvinylen, den Salzen der vorgenannten Stoffe und Mischungen hiervon, mehr bevorzugt aus der Gruppe bestehend aus Calciumsulfat, Siliciumoxid, Cellulosederivaten, Polysacchariden, den Salzen der vorgenannten Stoffe und
Mischungen hiervon. Die vorgenannten Bindemittel Calciumsulfat und Siliciumoxid können Wasser in gebundener Form, insbesondere als Kristallwasser, umfassen. Als erfindungsgemäß besonders vorteilhafte Bindemittel haben sich Calciumsulfat und Cellulosederivate erwiesen.
Bei weiteren Ausführungsformen sind die Partikel des partikelhaltigen Zylinders zu mindestens 75 Gew.-%, vorzugsweise zu mindestens 87 Gew.-%, mehr bevorzugt zu mindestens 98 Gew.-% Metallpartikel, bezogen auf das Gesamtgewicht der Partikel. Unter dem Begriff„Metallpartikel" wird im Sinne der vorliegenden Erfindung verstanden, dass die Partikel zu mindestens 80 Gew.-%, mehr bevorzugt zu mindestens 90 Gew.-% aus elementaren Metall, Metallgemischen oder Metalllegierungen bestehen.
Bei weiteren Ausführungsformen wird das Metall der Metallpartikel zu mindestens
90 Gew.-% ausgewählt aus der Gruppe bestehend aus Aluminium, Kupfer, Zinn, Zink, Eisen, Silber, Titan, Nickel, Gold, Platin, Magnesium, Wolfram, Molybdän, Vanadium, Mischungen hiervon und Legierungen hiervon.
Bei weiteren Ausführungsformen umfasst das Metall der Metallpartikel zu höchstens 5 Gew.-%, mehr bevorzugt zu höchstens 2 Gew.-%, mehr bevorzugt zu höchstens 1 Gew.-%, Metalle die ausgewählt werden aus der Gruppe bestehend aus Silber,
Palladium, Platin, Gold, Mischungen davon und Legierungen davon. Bei weiteren Ausführungsformen werden die Metallpartikel vorzugsweise ausgewählt aus unbeschichteten Metallpartikeln und beschichteten Metallpartikeln, wobei die Menge der Beschichtung der beschichteten Metallpigmente höchstens 15 Gew.-%, vorzugsweise höchstens 12 Gew.-%, mehr bevorzugt höchstens 10 Gew.-% beträgt, bezogen auf das Gesamtgewicht der beschichteten Metallpigmente.
Die Herstellung der erfindungsgemäßen Zylinder kann beispielsweise erfolgen durch Herstellung einer Paste umfassend Partikel, Gips (Calciumsulfat) und Wasser, Einfüllen der Paste in eine Form und Aushärten der Paste. Zur Erleichterung der Verarbeitung kann auch eine überproportionale Menge an Wasser eingesetzt werden, welches nachfolgend mittels Trockenvorgängen wieder entfernt werden kann. Die Trocknung kann
beispielsweise auch unter Verwendung eines Trockenschrankes beschleunigt werden. Hierbei werden zur Herstellung der Zylinder unter Einsatz anorganischer Bindemittel vorzugsweise reaktive Formen wie Calciumsulfat Semihydrat verwendet. Ferner können beispielsweise Gemische aus Partikeln mit organischen Bindemitteln wie
Polysacchariden, Cellulose und Cellulosederivaten hergestellt und mittels Kompression verfestigt werden. Zudem können auch organische Bindemittel mittels eines
Lösungsmittels wie Wasser oder einem organischen Lösungsmittel in eine Pastenform überführt und in die gewünschte Form gebracht werden. Die erfindungsgemäßen Zylinder können nachfolgend durch Trocknen der Pasten erhalten werden.
Hingegen zeigen beispielsweise Zylinder, die durch in-situ Pulverpressungen hergestellt werden, und welche anschließend in einem Förderverfahren eingesetzt werden, eine sehr inhomogene Zusammensetzung mit insbesondere Dichtegradienten, wodurch die
Erzeugung eines gleichmäßigen Aerosolstroms schwer bis unmöglich wird. Die erfindungsgemäßen Zylinder besitzen eine sehr homogene Zusammensetzung insbesondere hinsichtlich der Verteilung der hierin enthaltenen Partikel. Somit wird die gleichmäßige und reproduzierbare Förderung der enthaltenen Partikel ermöglicht, während gleichzeitig die geförderten Partikel in verschiedenster Art variiert werden können, ohne eine spezifische Anpassung der Förderparameter zu erfordern. Die besonders homogene Struktur der erfindungsgemäßen Zylinder kann beispielsweise mittels der mittleren Dichte nachgewiesen werden. Hierzu werden mindestens 3, vorzugsweise drei, Scheiben aus der Säule senkrecht zur Längsachse geschnitten, wobei die Dicke der Scheiben mindestens 1 cm, vorzugsweise 1 cm, beträgt. Nachfolgend werden die Scheiben in drei, vorzugsweise ungefähr gleichgroße, Teilstücke zerschnitten und deren mittlere Dichte bestimmt. Die Bestimmung der mittleren Dichte erfolgt beispielsweise mittels eines Heliumpyknometers Typ Multipycnometer (Fa.
Quantachrome). Vorzugsweise beträgt die Abweichung der mittleren Dichte der Proben höchstens 10 %, mehr bevorzugt höchstens 7 %, noch mehr bevorzugt höchstens 3 %, bezogen auf das arithmetische Mittel der Proben.
Ferner betrifft die vorliegende Erfindung die Verwendung eines erfindungsgemäßen partikelhaltigen Zylinders zur Erzeugung eines partikelhaltigen Aerosols. Vorzugsweise wird eine der vorgenannten spezifischen Formen der Zylinder verwendet.
Ferner betrifft die vorliegende Erfindung einen beschichteten Gegenstand, wobei die Beschichtung unter Einsatz eines Aerosols erfolgte, welches mittels eines Verfahrens gemäß einem der Ansprüche 1 bis 12 oder einem der Aspekte 1 bis 28 und/oder unter Verwendung mindestens eines Zylinders gemäß einem der Ansprüche 13 bis 14 oder einem der Aspekte 29 bis 50 erzeugt wurde.
Gemäß einem Aspekt 1 betrifft die vorliegenden Erfindung vorzugsweise ein Verfahren zur Herstellung eines partikelhaltigen Aerosols, wobei ein partikelhaltiger Zylinder zerkleinert wird,
wobei der Zylinder ein Volumen von mindestens 5 cm3 aufweist und formstabil ist, die Biegefestigkeit σ höchstens 3,75 N/mm2, mehr bevorzugt höchstens 2, 1 N/mm2, noch mehr bevorzugt höchstens 1 ,2 N/mm2, noch mehr bevorzugt höchstens 0,675 N/mm2, beträgt, wobei σ berechnet wird gemäß Formel (I)
3 x F x l
a = 2 x B x D /) mit F = maximale Kraft, B = Breite des Zylinders in Quaderform, D = Höhe des Zylinders in Quaderform, I = Abstand zwischen den beiden Auflagepunkten,
der Anteil an Partikeln im Bereich von 10 Gew.-% bis 99,9 Gew.-% liegt, bezogen auf das Gesamtgewicht des Zylinders,
die Partikel ausgewählt werden aus der Gruppe bestehend aus Metallpartikeln,
Glaspartikeln, Micapartikeln, Keramikpartikeln und Mischungen hiervon, die in dem Zylinder enthaltenen Partikel einen d50 von maximal 300 μηι aufweisen und der Zylinder mindestens 0,01 Gew.-% Bindemittel aufweist, bezogen auf das
Gesamtgewicht des partikelhaltigen Zylinders, wobei das Bindemittel ausgewählt wird aus der Gruppe bestehend aus anorganischen Bindemitteln, organischen Bindemitteln und Mischungen hiervon.
Gemäß einem Aspekt 2 betrifft die vorliegende Erfindung vorzugsweise ein Verfahren gemäß Aspekt 1 , wobei die anorganischen Bindemittel ausgewählt werden aus
Calciumsulfat, Talk, Calciumhydroxid, Siliciumoxid, Aluminiumoxid, Calciumcarbonat, Calciumsilikathydrate, Calciumaluminathydrate und Mischungen hiervon.
Gemäß einem Aspekt 3 betrifft die vorliegende Erfindung vorzugsweise ein Verfahren gemäß einem der Aspekte 1 bis 2, wobei die organischen Bindemittel ausgewählt werden aus der Gruppe bestehend aus Cellulose, Cellulosederivaten, Polysacchariden, Gelatine, Polyvinylen, Polyacrylaten, Polyethylenoxiden, Polyethylenglykolen, Polyamiden,
Epoxidharzen, Polyurethanen, Polyaldehyden, Polyolefinen, Polyacrylatcopolymeren, Polyaldehydcopolymeren, Polyester, Polyolefincopolymere, den Salzen der vorgenannten Stoffe und Mischungen hiervon, mehr bevorzugt aus der Gruppe bestehend aus Cellulose, Cellulosederivaten, Polysacchariden, Gelatine, Polyvinylen, Polyacrylaten,
Polyethylenoxiden, Polyethylenglykolen, Polyamiden, Epoxidharzen, Polyurethanen,
Polyacrylatcopolymeren, Polyaldehydcopolymeren, Polyester, Polyolefincopolymere, den Salzen der vorgenannten Stoffe und Mischungen hiervon, noch mehr bevorzugt aus der Gruppe bestehend aus Cellulose, Cellulosederivaten, Polysacchariden, Gelatine,
Polyvinylen, Polyacrylaten, Polyethylenoxiden, Polyethylenglykolen, Polyamiden,
Epoxidharzen, den Salzen der vorgenannten Stoffe und Mischungen hiervon.
Gemäß einem Aspekt 4 betrifft die vorliegende Erfindung vorzugsweise ein Verfahren gemäß einem der Aspekte 1 bis 3, wobei der Zylinder eine Biegefestigkeit von mindestens 0,0075 N/mm2, mehr bevorzugt mindestens 0,0105 N/mm2, noch mehr bevorzugt mindestens 0,012 N/mm2, noch mehr bevorzugt mindestens 0,015 N/mm2, aufweist.
Gemäß einem Aspekt 5 betrifft die vorliegende Erfindung vorzugsweise ein Verfahren gemäß einem der Aspekte 1 bis 4, wobei das partikelhaltige Aerosol als kontinuierlicher Aerosolstrom weitergeleitet wird. Gemäß einem Aspekt 6 betrifft die vorliegende Erfindung vorzugsweise ein Verfahren gemäß einem der Aspekte 1 bis 5, wobei das partikelhaltige Aerosol in einem
Beschichtungsverfahren eingesetzt wird, das ausgewählt wird aus der Gruppe bestehend aus Kaltgasspritzen, Flammspritzen, Hochgeschwindigkeitsflammspritzen, thermischem Plasmaspritzen und nichtthermischem Plasmaspritzen, vorzugsweise ausgewählt aus der Gruppe bestehend aus thermischem Plasmaspritzen und nichtthermischem
Plasmaspritzen. Insbesondere ist es bevorzugt, dass das Beschichtungsverfahren das nichtthermische Plasmaspritzen ist.
Gemäß einem Aspekt 7 betrifft die vorliegende Erfindung vorzugsweise ein Verfahren gemäß einem der Aspekte 1 bis 6, wobei das Zerkleinern des partikelhaltigen Zylinders mittels einer Bürste oder eines Schleifbandes erfolgt. Gemäß einem Aspekt 8 betrifft die vorliegende Erfindung vorzugsweise ein Verfahren gemäß einem der Aspekte 1 bis 7, wobei die Höhe des partikelhaltigen Zylinders das mindestens 2-fache, vorzugsweise das mindestens 3-fache, mehr bevorzugt das mindestens 4-fache, des arithmetischen Mittels der längsten Achsen entlang der
Grundfläche und der Deckfläche beträgt.
Gemäß einem Aspekt 9 betrifft die vorliegende Erfindung vorzugsweise ein Verfahren gemäß einem der Aspekte 1 bis 8, wobei der Zylinder mindestens 1 ,5 Gew.-%
anorganische Bindemittel oder mindestens 0,01 Gew.-% organische Bindemittel aufweist. Gemäß einem Aspekt 10 betrifft die vorliegende Erfindung vorzugsweise ein Verfahren gemäß einem der Aspekte 1 bis 9, wobei der Anteil an nichtplättchenförmigen Partikeln in dem partikelhaltigen Zylinder in einem Bereich von 50 Gew.-% bis 99,9 Gew.-%, vorzugsweise in einem Bereich von 60 Gew.-% bis 98 Gew.-%, mehr bevorzugt in einem Bereich von 70 Gew.-% bis 97 Gew.-%, liegt, jeweils bezogen auf das Gesamtgewicht des Zylinders.
Gemäß einem Aspekt 1 1 betrifft die vorliegende Erfindung vorzugsweise ein Verfahren gemäß einem der Aspekte 1 bis 10, wobei die in dem Zylinder enthaltenen Partikel einen d50 in einem Bereich von 1 μηι bis 300 μηι, vorzugsweise in einem Bereich von 1 ,5 μηι bis 230 μΓΠ, vorzugsweise in einem Bereich von 2 μηι bis 180 μηι, mehr bevorzugt in einem Bereich von 2,5 μηι bis 150 μηι, aufweisen.
Gemäß einem Aspekt 12 betrifft die vorliegende Erfindung vorzugsweise ein Verfahren gemäß einem der Aspekte 1 bis 9 oder gemäß Aspekt 1 1 , wobei der Anteil an
plättchenförmigen Partikeln in dem partikelhaltigen Zylinder in einem Bereich von 30 Gew.-% bis 75 Gew.-%, vorzugsweise in einem Bereich von 40 Gew.-% bis 70 Gew.- %, mehr bevorzugt in einem Bereich von 50 Gew.-% bis 65 Gew.-%, liegt, jeweils bezogen auf das Gesamtgewicht des Zylinders.
Gemäß einem Aspekt 13 betrifft die vorliegende Erfindung vorzugsweise ein Verfahren gemäß einem der Aspekte 1 bis 12, wobei die Menge der Partikel im Zylinder in
Abhängigkeit von der Menge der plättchenförmigen Partikel bei x Gew.-%
plättchenförmiger Partikel, bezogen auf das Gesamtgewicht der Partikel, im Bereich von (50 Gew.-% - (0,2 x) Gew-%) bis (99,9 Gew.-% - (0,249 χ x) Gew.-%), bezogen auf das Gesamtgewicht des Zylinders, liegt. Vorzugsweise liegt die Menge der Partikel im Bereich von (60 Gew.-% - (0,2 χ x) Gew-%) bis (98 Gew.-% - (0,28 χ x) Gew.-%), mehr bevorzugt im Bereich von (70 Gew.-% - (0,2 χ x) Gew-%) bis (97 Gew.-% - (0,32 χ x) Gew.-%), bezogen auf das Gesamtgewicht des Zylinders.
Gemäß einem Aspekt 14 betrifft die vorliegende Erfindung vorzugsweise ein Verfahren gemäß einem der Aspekte 1 bis 13, wobei die Gesamtmenge an Partikeln und
Bindemitteln im partikelhaltigen Zylinder mindestens 90 Gew.-%, vorzugsweise mindestens 95 Gew.-%, mehr bevorzugt mindestens 99,9 Gew.-%, beträgt, bezogen auf das Gesamtgewicht des Zylinders.
Gemäß einem Aspekt 15 betrifft die vorliegende Erfindung vorzugsweise ein Verfahren gemäß einem der Aspekte 1 bis 14, wobei die Partikel des partikelhaltigen Zylinders zu mindestens 90 Gew.-%, vorzugsweise zu mindestens 95 Gew.-%, mehr bevorzugt zu mindestens 99,9 Gew.-%, ausgewählt werden aus entweder Metallpartikeln oder
Glaspartikeln oder Micapartikeln oder Keramikpartikeln, bezogen auf das Gesamtgewicht der Partikel. Vorzugsweise werden die Partikel des partikelhaltigen Zylinders zu mindestens 90 Gew.-%, vorzugsweise zu mindestens 95 Gew.-%, mehr bevorzugt zu mindestens 99,9 Gew.-%, ausgewählt aus entweder Metallpartikeln oder Glaspartikeln, mehr bevorzugt Metallpartikeln, bezogen auf das Gesamtgewicht der Partikel.
Gemäß einem Aspekt 16 betrifft die vorliegende Erfindung vorzugsweise ein Verfahren gemäß einem der Aspekte 1 bis 15, wobei der partikelhaltige Zylinder ein Volumen von mindestens 8 cm3, vorzugsweise von mindestens 1 1 cm3, mehr bevorzugt von mindestens 19 cm3, noch mehr bevorzugt von mindestens 30 cm3, aufweist.
Gemäß einem Aspekt 17 betrifft die vorliegende Erfindung vorzugsweise ein Verfahren gemäß einem der Aspekte 1 bis 16, wobei die Menge des Bindemittels in dem
partikelhaltigen Zylinder in einem Bereich von 0,05 Gew.-% bis 70 Gew.-%, vorzugsweise in einem Bereich von 0,07 Gew.-% bis 60 Gew.-%, mehr bevorzugt in einem Bereich von 0, 1 Gew.-% bis 45 Gew.-%, liegt. Gemäß einem Aspekt 18 betrifft die vorliegende Erfindung vorzugsweise ein Verfahren gemäß einem der Aspekte 1 bis 17, wobei der partikelhaltige Zylinder mindestens 1 ,5 Gew.-%, vorzugsweise mindestens 1 ,9 Gew.-%, mehr bevorzugt mindestens
2,2 Gew.-%, anorganische Bindemittel umfasst. Gemäß einem Aspekt 19 betrifft die vorliegende Erfindung vorzugsweise ein Verfahren gemäß einem der Aspekte 1 bis 18, wobei das anorganische Bindemittel ausgewählt wird aus der Gruppe bestehend aus Calciumsulfat und Siliciumoxid.
Gemäß einem Aspekt 20 betrifft die vorliegende Erfindung vorzugsweise ein Verfahren gemäß einem der Aspekte 1 bis 19, wobei der partikelhaltige Zylinder mindestens 0,05 Gew.-%, vorzugsweise mindestens 0,07 Gew.-%, mehr bevorzugt mindestens 0, 1 Gew.-%, organische Bindemittel umfasst.
Gemäß einem Aspekt 21 betrifft die vorliegende Erfindung vorzugsweise ein Verfahren gemäß einem der Aspekte 1 bis 20, wobei das organische Bindemittel ausgewählt wird aus der Gruppe bestehend aus Cellulosederivaten und Polysacchariden. Vorzugsweise wird das organische Bindemittel ausgewählt aus der Gruppe bestehend aus Stärke und Cellulosederivaten. Beispiele der Cellulosederivate sind Methylcellulose und
Ethylcellulose. Gemäß einem Aspekt 22 betrifft die vorliegende Erfindung vorzugsweise ein Verfahren gemäß einem der Aspekte 1 bis 21 , wobei mindestens ein Bindemittel des partikelhaltigen Zylinders ausgewählt wird aus der Gruppe bestehend aus Calciumsulfat, Talk,
Calciumcarbonat, Siliciumoxid, Mischungen von Calciumsilikathydraten und
Calciumaluminathydraten, Mischungen von Calciumhydroxid und Calciumcarbonat, Cellulose, Cellulosederivaten, Polysacchariden, Gelatine, Polyvinylen, Polyacrylaten, Polyethylenoxiden, Polyethylenglykolen, Polyamiden, den Salzen der vorgenannten Stoffe und Mischungen hiervon, vorzugsweise aus der Gruppe bestehend aus Calciumsulfat, Siliciumoxid, Cellulose, Cellulosederivaten, Polysacchariden, Polyvinylen, den Salzen der vorgenannten Stoffe und Mischungen hiervon, mehr bevorzugt aus der Gruppe bestehend aus Calciumsulfat, Siliciumoxid, Cellulosederivaten, Polysacchariden, den Salzen der vorgenannten Stoffe und Mischungen hiervon. Insbesondere ist es bevorzugt, dass das Bindemittel ausgewählt wird aus der Gruppe bestehend aus Calciumsulfat und
Cellulosederivaten.
Gemäß einem Aspekt 23 betrifft die vorliegende Erfindung vorzugsweise ein Verfahren gemäß einem der Aspekte 1 bis 22, wobei die Partikel des partikelhaltigen Zylinders zu mindestens 75 Gew.-%, vorzugsweise zu mindestens 87 Gew.-%, mehr bevorzugt zu mindestens 98 Gew.-%, Metallpartikel sind, bezogen auf das Gesamtgewicht der Partikel.
Gemäß einem Aspekt 24 betrifft die vorliegende Erfindung vorzugsweise ein Verfahren gemäß einem der Aspekte 1 bis 23, wobei das Metall der Metallpartikel zu mindestens 90 Gew.-% ausgewählt wird aus der Gruppe bestehend aus Aluminium, Kupfer, Zinn, Zink, Eisen, Silber, Titan, Nickel, Gold, Platin, Magnesium, Wolfram, Molybdän,
Vanadium, Mischungen hiervon und Legierungen hiervon.
Gemäß einem Aspekt 25 betrifft die vorliegende Erfindung vorzugsweise ein Verfahren gemäß einem der Aspekte 1 bis 24, wobei das Metall der Metallpartikel zu höchstens 5 Gew.-%, mehr bevorzugt zu höchstens 2 Gew.-%, mehr bevorzugt zu höchstens
1 Gew.-%, ausgewählt wird aus der Gruppe bestehend aus Silber, Palladium, Platin, Gold, Mischungen davon und Legierungen davon. Gemäß einem Aspekt 26 betrifft die vorliegende Erfindung vorzugsweise ein Verfahren gemäß einem der Aspekte 1 bis 25, wobei die Metallpartikel ausgewählt werden aus unbeschichteten Metallpartikeln und beschichteten Metallpartikeln, wobei die Menge der Beschichtung durchschnittlich höchstens 15 Gew.-%, vorzugsweise höchstens 12 Gew.- %, mehr bevorzugt höchstens 10 Gew.-% beträgt, bezogen auf das Gesamtgewicht der beschichteten Metallpigmente.
Gemäß einem Aspekt 27 betrifft die vorliegende Erfindung vorzugsweise ein Verfahren zur Beschichtung eines Substrats, wobei es die folgenden Schritte umfasst
a) Herstellung eines partikelhaltigen Aerosols gemäß einem der Aspekte 1 bis 26, b) Abscheidung der Partikel auf einem Substrat durch ein Beschichtungsverfahren das ausgewählt wird aus der Gruppe bestehend aus Kaltgasspritzen, Flammspritzen,
Hochgeschwindigkeitsflammspritzen, thermischem Plasmaspritzen und nichtthermischem Plasmaspritzen. Vorzugsweise ist das Beschichtungsverfahren gemäß Schritt b) das nichtthermische Plasmaspritzen.
Gemäß einem Aspekt 28 betrifft die vorliegende Erfindung vorzugsweise ein Verfahren gemäß Aspekt 27, wobei das partikelhaltige Aerosol von Schritt a) als kontinuierlicher Aerosolstrom dem Beschichtungsverfahren gemäß Schritt b) zugeführt wird.
Gemäß einem Aspekt 29 betrifft die vorliegende Erfindung vorzugsweise einen
partikelhaltigen Zylinder, wobei der Zylinder ein Volumen von mindestens 5 cm3 aufweist und formstabil ist,
der Anteil an Partikeln im Bereich von 10 Gew.-% bis 99,9 Gew.-% liegt, bezogen auf das Gesamtgewicht des Zylinders,
die Biegefestigkeit σ höchstens 3,75 N/mm2, mehr bevorzugt höchstens 2, 1 N/mm2, noch mehr bevorzugt höchstens 1 ,2 N/mm2, noch mehr bevorzugt höchstens 0,675 N/mm2, beträgt, wobei σ berechnet wird gemäß Formel (I)
3 x F x l
2 x B x D2 mit F = maximale Kraft, B = Breite des Zylinders in Quaderform, D
Quaderform, I = Abstand zwischen den beiden Auflagepunkten, die Partikel ausgewählt werden aus der Gruppe bestehend aus Metallpartikeln,
Glaspartikeln, Micapartikeln, Keramikpartikeln und Mischungen hiervon,
die in dem Zylinder enthaltenen Partikel einen d5o von maximal 300 μηι aufweisen und der Zylinder mindestens 0,01 Gew.-% Bindemittel aufweist, bezogen auf das
Gesamtgewicht des partikelhaltigen Zylinders, wobei das Bindemittel ausgewählt wird aus der Gruppe bestehend aus anorganischen Bindemitteln, organischen Bindemitteln und Mischungen hiervon
Gemäß einem Aspekt 30 betrifft die vorliegende Erfindung vorzugsweise einen partikelhaltigen Zylinder gemäß Aspekt 29, wobei die anorganischen Bindemittel ausgewählt werden aus Calciumsulfat, Talk, Calciumhydroxid, Siliciumoxid,
Aluminiumoxid, Calciumcarbonat, Calciumsilikathydrate, Calciumaluminathydrate und Mischungen hiervon. Gemäß einem Aspekt 31 betrifft die vorliegende Erfindung vorzugsweise einen partikelhaltigen Zylinder gemäß einem der Aspekte 29 bis 30, wobei die organischen Bindemittel ausgewählt werden aus der Gruppe bestehend aus Cellulose,
Cellulosederivaten, Polysacchariden, Gelatine, Polyvinylen, Polyacrylaten,
Polyethylenoxiden, Polyethylenglykolen, Polyamiden, Epoxidharzen, Polyurethanen, Polyaldehyden, Polyolefinen, Polyacrylatcopolymeren, Polyaldehydcopolymeren,
Polyester, Polyolefincopolymere, den Salzen der vorgenannten Stoffe und Mischungen hiervon, mehr bevorzugt aus der Gruppe bestehend aus Cellulose, Cellulosederivaten, Polysacchariden, Gelatine, Polyvinylen, Polyacrylaten, Polyethylenoxiden,
Polyethylenglykolen, Polyamiden, Epoxidharzen, Polyurethanen, Polyacrylatcopolymeren, Polyaldehydcopolymeren, Polyester, Polyolefincopolymere, den Salzen der vorgenannten Stoffe und Mischungen hiervon, noch mehr bevorzugt aus der Gruppe bestehend aus Cellulose, Cellulosederivaten, Polysacchariden, Gelatine, Polyvinylen, Polyacrylaten, Polyethylenoxiden, Polyethylenglykolen, Polyamiden, Epoxidharzen, den Salzen der vorgenannten Stoffe und Mischungen hiervon.
Gemäß einem Aspekt 32 betrifft die vorliegende Erfindung vorzugsweise einen partikelhaltigen Zylinder gemäß einem der Aspekte 29 bis 31 , wobei der Zylinder eine Biegefestigkeit von mindestens 0,0075 N/mm2, mehr bevorzugt, mindestens 0,0105 N/mm2, noch mehr bevorzugt mindestens 0,012 N/mm2, noch mehr bevorzugt mindestens 0,015 N/mm2, aufweist.
Gemäß einem Aspekt 33 betrifft die vorliegende Erfindung vorzugsweise einen partikelhaltigen Zylinder gemäß einem der Aspekt 29 bis 32, wobei die Höhe des partikelhaltigen Zylinders das mindestens 2-fache, vorzugsweise das mindestens 3-fache, mehr bevorzugt das mindestens 4-fache, des arithmetischen Mittels der längsten Achsen entlang der Grundfläche und der Deckfläche beträgt. Gemäß einem Aspekt 34 betrifft die vorliegende Erfindung vorzugsweise einen partikelhaltigen Zylinder gemäß einem der Aspekt 29 bis 33, wobei der Anteil an nichtplättchenförmigen Partikeln in dem partikelhaltigen Zylinder in einem Bereich von 50 Gew.-% bis 99,9 Gew.-%, vorzugsweise in einem Bereich von 60 Gew.-% bis 98 Gew.- %, mehr bevorzugt in einem Bereich von 70 Gew.-% bis 97 Gew.-%, liegt, jeweils bezogen auf das Gesamtgewicht des Zylinders.
Gemäß einem Aspekt 35 betrifft die vorliegende Erfindung vorzugsweise einen partikelhaltigen Zylinder gemäß einem der Aspekt 29 bis 34, wobei die in dem Zylinder enthaltenen Partikel einen d5o in einem Bereich von 1 μηι bis 300 μηι, vorzugsweise in einem Bereich von 1 ,5 μηι bis 230 μηι, vorzugsweise in einem Bereich von 2 μηι bis 180 μηι, mehr bevorzugt in einem Bereich von 2,5 μηι bis 150 μηι, aufweisen.
Gemäß einem Aspekt 36 betrifft die vorliegende Erfindung vorzugsweise einen partikelhaltigen Zylinder gemäß einem der Aspekt 29 bis 35, wobei der Anteil an plättchenförmigen Metallpartikeln in dem partikelhaltigen Zylinder in einem Bereich von 30 Gew.-% bis 75 Gew.-%, vorzugsweise in einem Bereich von 40 Gew.-% bis 70 Gew.- %, mehr bevorzugt in einem Bereich von 50 Gew.-% bis 65 Gew.-%, liegt, jeweils bezogen auf das Gesamtgewicht des Zylinders. Gemäß einem Aspekt 37 betrifft die vorliegende Erfindung vorzugsweise einen partikelhaltigen Zylinder gemäß einem der Aspekt 29 bis 36, wobei die Menge der Partikel im Zylinder in Abhängigkeit von der Menge der plättchenförmigen Partikeln bei x Gew.-% plättchenförmiger Partikel, bezogen auf das Gesamtgewicht der Partikel, im Bereich von (50 Gew.-% - (0,2 x) Gew-%) bis (99,9 Gew.-% - (0,249 * x) Gew.-%), bezogen auf das Gesamtgewicht des Zylinders, beträgt. Vorzugsweise liegt die Menge der Partikel im Bereich von (60 Gew.-% - (0,2 χ x) Gew-%) bis (98 Gew.-% - (0,28 χ x) Gew.-%), mehr bevorzugt im Bereich von (70 Gew.-% - (0,2 χ x) Gew-%) bis (97 Gew.-% - (0,32 χ x) Gew.-%), bezogen auf das Gesamtgewicht des Zylinders.
Gemäß einem Aspekt 38 betrifft die vorliegende Erfindung vorzugsweise einen partikelhaltigen Zylinder gemäß einem der Aspekt 29 bis 37, wobei die Gesamtmenge an Partikeln und Bindemitteln im partikelhaltigen Zylinder mindestens 90 Gew.-%, vorzugsweise mindestens 95 Gew.-%, mehr bevorzugt mindestens 99,9 Gew.-%, beträgt, bezogen auf das Gesamtgewicht des Zylinders.
Gemäß einem Aspekt 39 betrifft die vorliegende Erfindung vorzugsweise einen partikelhaltigen Zylinder gemäß einem der Aspekt 29 bis 38, wobei die Partikel des partikelhaltigen Zylinders zu mindestens 90 Gew.-%, vorzugsweise zu mindestens 95 Gew.-%, mehr bevorzugt zu mindestens 99,9 Gew.-% ausgewählt werden aus entweder Metallpartikeln oder Glaspartikeln oder Micapartikeln oder Keramikpartikeln, bezogen auf das Gesamtgewicht der Partikel. Vorzugsweise werden die Partikel des partikelhaltigen Zylinders zu mindestens 90 Gew.-%, vorzugsweise zu mindestens 95 Gew.-%, mehr bevorzugt zu mindestens 99,9 Gew.-%, ausgewählt aus entweder Metallpartikeln oder Glaspartikeln, mehr bevorzugt Metallpartikeln, bezogen auf das Gesamtgewicht der Partikel.
Gemäß einem Aspekt 40 betrifft die vorliegende Erfindung vorzugsweise einen partikelhaltigen Zylinder gemäß einem der Aspekt 29 bis 39, wobei der partikelhaltige Zylinder ein Volumen von mindestens 8 cm3, vorzugsweise von mindestens 1 1 cm3, mehr bevorzugt von mindestens 19 cm3, noch mehr bevorzugt von mindestens 30 cm3, aufweist
Gemäß einem Aspekt 41 betrifft die vorliegende Erfindung vorzugsweise einen partikelhaltigen Zylinder gemäß einem der Aspekt 29 bis 40, wobei die Menge des Bindemittels in dem partikelhaltigen Zylinder in einem Bereich von 0,05 Gew.-% bis 70 Gew.-%, vorzugsweise in einem Bereich von 0,07 Gew.-% bis 60 Gew.-%, mehr bevorzugt in einem Bereich von 0,1 Gew.-% bis 45 Gew.-%, liegt. Gemäß einem Aspekt 42 betrifft die vorliegende Erfindung vorzugsweise einen partikelhaltigen Zylinder gemäß einem der Aspekt 29 bis 41 , wobei der partikelhaltige Zylinder mindestens 1 ,5 Gew.-%, vorzugsweise mindestens 1 ,9 Gew.-%, mehr bevorzugt mindestens 2,2 Gew.-%, anorganische Bindemittel umfasst.
Gemäß einem Aspekt 43 betrifft die vorliegende Erfindung vorzugsweise einen partikelhaltigen Zylinder gemäß einem der Aspekt 29 bis 42, wobei das anorganische Bindemittel ausgewählt wird aus der Gruppe bestehend aus Caiciumsulfat und
Siliciumoxid.
Gemäß einem Aspekt 44 betrifft die vorliegende Erfindung vorzugsweise einen partikelhaltigen Zylinder gemäß einem der Aspekt 29 bis 43, wobei der partikelhaltige Zylinder mindestens 0,05 Gew.-%, vorzugsweise mindestens 0,07 Gew.-%, mehr bevorzugt mindestens 0, 1 Gew.-%, organische Bindemittel umfasst.
Gemäß einem Aspekt 45 betrifft die vorliegende Erfindung vorzugsweise einen partikelhaltigen Zylinder gemäß einem der Aspekt 29 bis 44, wobei das organische Bindemittel ausgewählt wird aus der Gruppe bestehend aus Cellulosederivaten und Polysacchariden. Vorzugsweise wird das organische Bindemittel ausgewählt aus der Gruppe bestehend aus Stärke und Cellulosederivaten wie Methylcellulose und
Ethylcellulose.
Gemäß einem Aspekt 46 betrifft die vorliegende Erfindung vorzugsweise einen partikelhaltigen Zylinder gemäß einem der Aspekt 29 bis 45, wobei mindestens ein Bindemittel des partikelhaltigen Zylinders ausgewählt wird aus der Gruppe bestehend aus Caiciumsulfat, Talk, Calciumcarbonat, Siliciumoxid, Mischungen von
Calciumsilikathydraten und Calciumaluminathydraten, Mischungen von Calciumhydroxid und Calciumcarbonat, Cellulose, Cellulosederivaten, Polysacchariden, Polyvinylen, Polyacrylaten, Polyethylenoxiden, Polyethylenglykolen, Polyamiden, den Salzen der vorgenannten Stoffe und Mischungen hiervon, vorzugsweise aus der Gruppe bestehend aus Caiciumsulfat, Siliciumoxid, Cellulose, Cellulosederivaten, Polysacchariden,
Polyvinylen, den Salzen der vorgenannten Stoffe und Mischungen hiervon, mehr bevorzugt aus der Gruppe bestehend aus Caiciumsulfat, Siliciumoxid, Cellulosederivaten, Polysacchariden, den Salzen der vorgenannten Stoffe und Mischungen hiervon. Insbesondere ist es bevorzugt, dass das Bindemittel ausgewählt wird aus der Gruppe bestehend aus Calciumsulfat und Cellulosederivaten.
Gemäß einem Aspekt 47 betrifft die vorliegende Erfindung vorzugsweise einen partikelhaltigen Zylinder gemäß einem der Aspekt 29 bis 46, wobei die Partikel des partikelhaltigen Zylinders zu mindestens 75 Gew.-%, vorzugsweise zu mindestens 87 Gew.-%, mehr bevorzugt zu mindestens 98 Gew.-% Metallpartikel sind, bezogen auf das Gesamtgewicht der Partikel.
Gemäß einem Aspekt 48 betrifft die vorliegende Erfindung vorzugsweise einen partikelhaltigen Zylinder gemäß einem der Aspekt 29 bis 47, wobei das Metall der Metallpartikel zu mindestens 90 Gew.-% ausgewählt wird aus der Gruppe bestehend aus Aluminium, Kupfer, Zinn, Zink, Eisen, Silber, Titan, Nickel, Gold, Platin, Magnesium, Wolfram, Molybdän, Vanadium, Mischungen hiervon und Legierungen hiervon.
Gemäß einem Aspekt 49 betrifft die vorliegende Erfindung vorzugsweise einen partikelhaltigen Zylinder gemäß einem der Aspekt 29 bis 48, wobei das Metall der Metallpartikel zu höchstens 5 Gew.-%, mehr bevorzugt zu höchstens 2 Gew.-%, mehr bevorzugt zu höchstens 1 Gew.-%, ausgewählt wird aus der Gruppe bestehend aus Silber, Palladium, Platin, Gold, Mischungen davon und Legierungen davon.
Gemäß einem Aspekt 50 betrifft die vorliegende Erfindung vorzugsweise einen partikelhaltigen Zylinder gemäß einem der Aspekt 29 bis 49, wobei die Metallpartikel ausgewählt werden aus unbeschichteten Metallpartikeln und beschichteten
Metallpartikeln, wobei die Menge der Beschichtung durchschnittlich höchstens 15 Gew.- %, vorzugsweise höchstens 12 Gew.-%, mehr bevorzugt höchstens 10 Gew.-% beträgt, bezogen auf das Gesamtgewicht der beschichteten Metallpigmente.
Gemäß einem Aspekt 51 betrifft die vorliegende Erfindung vorzugsweise die Verwendung eines partikelhaltigen Zylinders zur Erzeugung eines partikelhaltigen Aerosols, wobei der Zylinder ein Volumen von mindestens 5 cm3 aufweist und formstabil ist,
der Anteil an Partikeln im Bereich von 10 Gew.-% bis 99,9 Gew.-% liegt, bezogen auf das Gesamtgewicht des Zylinders, die Biegefestigkeit σ höchstens 3,75 N/mm2, mehr bevorzugt höchstens 2, 1 N/mm2, noch mehr bevorzugt höchstens 1 ,2 N/mm2, noch mehr bevorzugt höchstens 0,675 N/mm2, beträgt, wobei σ berechnet wird gemäß Formel (I)
3 x F x l
mit F = maximale Kraft, B = Breite des Zylinders in Quaderform, D = Höhe des Zylinders in Quaderform, I = Abstand zwischen den beiden Auflagepunkten,
die Partikel ausgewählt werden aus der Gruppe bestehend aus Metallpartikeln,
Glaspartikeln, Micapartikeln, Keramikpartikeln und Mischungen hiervon,
die in dem Zylinder enthaltenen Partikel einen d50 von maximal 300 μηι aufweisen und der Zylinder mindestens 0,01 Gew.-% Bindemittel aufweist, bezogen auf das
Gesamtgewicht des partikelhaltigen Zylinders, wobei das Bindemittel ausgewählt wird aus der Gruppe bestehend aus anorganischen Bindemitteln, organischen Bindemitteln und Mischungen hiervon. Vorzugsweise wird das partikelhaltige Aerosol in einem
Beschichtungsverfahren eingesetzt, das ausgewählt wird aus der Gruppe bestehend aus Kaltgasspritzen, Flammspritzen, Hochgeschwindigkeitsflammspritzen, thermischem Plasmaspritzen und nichtthermischem Plasmaspritzen, vorzugsweise aus der Gruppe bestehend aus thermischem Plasmaspritzen und nichtthermischem Plasmaspritzen.
Insbesondere ist es bevorzugt, dass das Beschichtungsverfahren das nichtthermische Plasmaspritzen ist.
Gemäß einem Aspekt 52 betrifft die vorliegende Erfindung vorzugsweise die Verwendung gemäß Aspekt 51 , wobei die anorganischen Bindemittel ausgewählt werden aus der Gruppe bestehend aus Caiciumsulfat, Talk, Caiciumhydroxid, Siliciumoxid, Aluminiumoxid, Calciumcarbonat, Calciumsilikathydrate, Calciumaluminathydrate und Mischungen hiervon.
Gemäß einem Aspekt 53 betrifft die vorliegende Erfindung vorzugsweise die Verwendung gemäß einem der Aspekte 51 bis 52, wobei die organischen Bindemittel ausgewählt werden aus der Gruppe bestehend aus Cellulose, Cellulosederivaten, Polysacchariden, Gelatine, Polyvinylen, Polyacrylaten, Polyethylenoxiden, Polyethylenglykolen, Polyamiden, Epoxidharzen, Polyurethanen, Polyacrylatcopolymeren, Polyaldehydcopolymeren, Polyester, Polyolefincopolymere, den den Salzen der vorgenannten Stoffe und
Mischungen hiervon, mehr bevorzugt aus der Gruppe bestehend aus Cellulose,
Cellulosederivaten, Polysacchariden, Gelatine, Polyvinylen, Polyacrylaten,
Polyethylenoxiden, Polyethylenglykolen, Polyamiden, Epoxidharzen, Polyurethanen, Polyacrylatcopolymeren, Polyaldehydcopolymeren, Polyester, Polyolefincopolymere, den Salzen der vorgenannten Stoffe und Mischungen hiervon, noch mehr bevorzugt aus der Gruppe bestehend aus Cellulose, Cellulosederivaten, Polysacchariden, Gelatine, Polyvinylen, Polyacrylaten, Polyethylenoxiden, Polyethylenglykolen, Polyamiden, Epoxidharzen, Salzen der vorgenannten Stoffe und Mischungen hiervon.
Gemäß einem Aspekt 54 betrifft die vorliegende Erfindung vorzugsweise die Verwendung gemäß einem der Aspekte 51 bis 53, wobei ein Zylinder gemäß einem der Aspekte 29 bis 50 verwendet wird. Gemäß einem Aspekt 55 betrifft die vorliegende Erfindung einen beschichteten
Gegenstand, wobei die Beschichtung unter Einsatz eines Aerosols erfolgte, welches mittels eines Verfahrens gemäß einem der Aspekte 1 bis 28 und/oder unter Verwendung mindestens eines Zylinders gemäß einem der Aspekte 29 bis 50 erzeugt wurde. Abbildungen
Abbildung 1 : schematischer Aufbau der Messung der Biegefestigkeit (1 = partikelhaltiger Zylinder, 2 = Auflagestäbe, 3 = Belastungsstab)
Abbildung 2: Kurve der Dreipunktmessung eines Zylinder gemäß Beispiel 1-13 (Kraft in N (y-Achse) gegen Traversenweg in mm (x-Achse))
Abbildung 3: REM-Aufnahme senkrecht zur Beschichtung eines beschichteten
Glasträgers, wobei dieser im Bereich der Beschichtung auseinandergebrochen wurde. Durch die Basisfläche und die Oberfläche der Beschichtung wurden Ausgleichsgeraden gelegt. Die Dicke der Beschichtung beträgt 25 μηι. Beispiel 1 : Herstellung partikelhaltiger Zylinder unter Verwendung von Gips
Gips der Sorte A/Quick Rock Klasse 4 (Firma Quick Dental) oder der Sorte B/Quick Dur S (Firma Quick Dental) und verschiedenste Partikel gemäß Tabelle 1 wurden zunächst miteinander und nachfolgend mit VE-Wasser (demineralisiertes Wasser) und Ethanol vermischt. Das nun leicht fließfähige Material wurde in eine mit Papier ausgekleidete zylindrische Form (kreisrunde Grundfläche, Durchmesser 32 mm) gegeben. Nachdem der Zylinder ausreichend ausgehärtet war, um formstabil zu sein, wurde er aus der Form entnommen. Nachfolgend wurde der erhaltene Zylinder in einem Trockenschrank bei 50 °C getrocknet.
Tabelle 1 : partikelhaltige Zylinder mit Bindemittel Gips: VB: Vergleichsbeispiel, Bsp.: Beispiel, (G): nichtplättchenförmige Partikel, (F): plättchenförmige Partikel
Tabelle 2: mittlere Dichten von Beispiel 1-1
Beispiel 2: Herstellung partikelhaltiger Zylinder unter Verwendung von Ethylcellulose Ethocel Standard 200 Premium (Beispiel 2-1 , DOW), Aqualon Ethylcellulose N100
(Beispiel 2-2, Ashland) bzw. Ethocel Std 300 Industrial (Beispiel 2-3, DOW) und Partikel wurden zunächst miteinander und nachfolgend mit Aceton vermischt. Das Material wurde in eine mit Papier ausgekleidete zylindrische Form (kreisrunde Grundfläche, Durchmesser 32 mm) gegeben. Nachdem der Zylinder ausreichend ausgehärtet war, um formstabil zu sein, wurde er aus der Form entnommen. Nachfolgend wurde der erhaltene Zylinder in einem Trockenschrank bei 50 °C getrocknet.
Partikel dso Pigment Ethylcellulose Aceton
Bsp. 2-1 Zinn (G) 15 Mm 199,9 g 0,3 g 14,0 g
Bsp. 2-2 Zinn (G) 15 Mm 199,9 g 0,3 g 14,0 g
Bsp. 2-3 Zinn (G) 15 Mm 199,9 g 0,3 g 14,0 g Tabelle 3: partikelhaltiger Zylinder mit Bindemittel Ethylcellulose: Bsp.: Beispiel, (G): nichtplättchenförmige Partikel
Beispiel 3: Herstellung partikelhaltiger Zylinder unter Verwendung von mikrokristalliner Cellulose
Avicel PH-101 und Partikel wurden zunächst miteinander vermischt und nachfolgend in eine Tablettenpresse des Typs Vaneox (Firma Fluxana) gefüllt. Die Komprimierung erfolgte in Presswerkzeugen mit einem Durchmesser von 40 mm mittels eines Druckes von 3 Tonnen über 10 Sekunden.
Tabelle 4: partikelhaltige Zylinder mit Bindemittel mikrokristalline Cellulose: Bsp.: Beispiel, (G): nichtplättchenförmige Partikel
Beispiel 4: Herstellung partikelhaltiger Zylinder unter Verwendung verschiedener
Bindemittel
Die nachstehenden Bindemittel wurden zunächst mit den nichtplättchenförmigen
Metallpartikeln (G: nichtplättchenförmige Partikel, F: plättchenförmige Partikel) und nachfolgend mit Lösungsmittel (E: Ethanol, W: Wasser, Am: 90 %-ige Ameisensäure, EA: Ethylacetat) vermischt. Das Material wurde in eine mit Papier ausgekleidete zylindrische Form (kreisrunde Grundfläche, Durchmesser 32 mm) gegeben. Nachdem der Zylinder ausreichend ausgehärtet war, um formstabil zu sein, wurde er aus der Form entnommen. Nachfolgend wurde der erhaltene Zylinder in einem Trockenschrank bei 50 °C getrocknet. Bei Versuch 4-1 wurde nachfolgend bei 70 °C getrocknet. Bei Versuch 4-2 wurde bei 170 °C getrocknet.
Tabelle 5: partikelhaltiger Zylinder mit verschiedenen Bindemitteln Acronal 12 DE, Acronal S747 S (Polyacrylate), Acronal 32 D, Styrofan D 780 S, Urecoll 135, Saduren 163, Aerodur DS 3530, Acronal LN 838 S, Aerodur DS 3515, Acronal LN 579 S, Acronal S 888 S und Ultramid A (Polyamid) werden vertrieben von der BASF. Cellulose Verdickungsmittel C 6000 (Natriumcarboxyethyl-Cellulose) wird vertrieben von Kremer Pigmente. Gelita Imagel wird von der Firma Gelita vertrieben. Polyglykol 10000 S und Polyglykol 1500 S werden von der Firma Clariant vertrieben. Sakret PU wird von der Firma SAKRET Trockenbaustoffe Europa GmbH & Co. KG vertrieben. Epoxidharz Bindemittel 2000 EP wird von der Firma Solipur - Höfer & Stankowska GbR vertrieben. CAB 531-1 (Cellulose-Acetat-Butyrat) wird von der Firma Eastman vertrieben. Butavar B- 76 (Polyvinylbutyral) wird von der Eastman Chemical B.V. vertrieben. Degalan P24 (Polyacrylat) wird von der Evonik. vertrieben.
Die erhaltenen Zylinder erwiesen sich in ersten Abprüfungen als geeignet für das erfindungsgemäße Verfahren.
Beispiel 5: Herstellung partikelhaltiger Zylinder unter Verwendung von Acrylatmonomeren
0,5 g Dimethyl- 2,2'-azobis(2-methylpropionat) (Handelsname V 601 ; erhältlich bei WAKO Chemicals GmbH, Fuggerstraße 12, 41468 Neuss) und 10 g
Trimethylolpropantrimethacrylat werden in 50 ml Isopropanol vermischt. Die erhaltene Lösung wird unter 190 g nichtplättchenförmige Kupferpartikel (d50 = 15 μηι) gemischt und in eine mit Papier ausgekleidete zylindrische Form (kreisrunde Grundfläche, Durchmesser 32 mm) gegeben. Nachfolgend wird der Zylinder 3 h bei 90°C gehärtet. Die erhaltenen Zylinder erwiesen sich in ersten Abprüfungen als geeignet für das erfindungsgemäße Verfahren.
Anwendungsbeispiel 1 : Vereinzelung Erfindungsgemäße Zylinder wurden mittels einem Aerosolgenerator (Palas RBG 10001) in ein Aerosol überführt. Der erzeugte Aerosolstrom wurde aufgefangen und die darin enthaltenen Feststoffpartikel wurden in einem Partikelgrößenmessgerät HELOS der Fa. Sympatec GmbH, Clausthal-Zellerfeld, Deutschland vermessen. Ferner wurde das in den Zylindern eingearbeitete Partikelmaterial mittels einer Dispergiereinheit vom Typ Rodos T4.1 bei einem Primärdruck von beispielsweise 4 bar dispergiert und vermessen. Die Auswertung der Streulichtsignale erfolgt dabei nach der Fraunhofer Methode.
Tabelle 6: Vereinzelungsversuche

Claims

Patentansprüche
1. Verfahren zur Herstellung eines partikelhaltigen Aerosols, wobei ein partikelhaltiger Zylinder zerkleinert wird,
wobei der Zylinder ein Volumen von mindestens 5 cm3 aufweist und formstabil ist, der Anteil an Partikeln im Bereich von 10 Gew.-% bis 99,9 Gew.-% liegt, bezogen auf das
Gesamtgewicht des Zylinders,
die Biegefestigkeit σ höchstens 3,75 N/mm2 beträgt, wobei σ berechnet wird gemäß Formel (I)
3 x F x l
σ = ~ (/)
2 x B x D2 mit F = maximale Kraft, B = Breite des Zylinders in Quaderform, D = Höhe des Zylinders in Quaderform, I = Abstand zwischen den beiden Auflagepunkten,
die Partikel ausgewählt werden aus der Gruppe bestehend aus Metallpartikeln,
Glaspartikeln, Micapartikeln, Keramikpartikeln und Mischungen hiervon,
die in dem Zylinder enthaltenen Partikel einen d50 von maximal 300 μηι aufweisen und der Zylinder mindestens 0,01 Gew.-% Bindemittel aufweist, bezogen auf das
Gesamtgewicht des partikelhaltigen Zylinders, wobei das Bindemittel ausgewählt wird aus der Gruppe bestehend aus anorganischen Bindemitteln, organischen Bindemitteln und Mischungen hiervon.
2. Verfahren gemäß Anspruch 1 , wobei das anorganische Bindemittel ausgewählt wird aus der Gruppe bestehend aus Calciumsulfat, Talk, Calciumhydroxid, Siliciumoxid, Aluminiumoxid, Calciumcarbonat, Calciumsilikathydrate, Calciumaluminathydrate und Mischungen hiervon.
3. Verfahren gemäß einem der Ansprüche 1 bis 2, wobei das organische Bindemittel ausgewählt wird aus der Gruppe bestehend aus Cellulose, Cellulosederivaten,
Polysacchariden, Gelatine, Polyvinylen, Polyacrylaten, Polyethylenoxiden,
Polyethylenglykolen, Polyamiden, Epoxidharzen, Polyurethanen, Polyaldehyden, Polyolefinen, Polyacrylatcopolymeren, Polyaldehydcopolymeren,
Polycarbonylcopolymere, Polyester, Polyolefincopolymere, den Salzen der vorgenannten Stoffe und Mischungen hiervon. 4. Verfahren gemäß einem der Ansprüche 1 bis 3, wobei der Zylinder eine
Biegefestigkeit von mindestens 0,0075 N/mm2 aufweist.
5. Verfahren gemäß einem der Ansprüche 1 bis 4, wobei der Zylinder mindestens
I , 5 Gew.-% anorganische Bindemittel oder mindestens 0,01 Gew.-% organische
Bindemittel aufweist.
6. Verfahren gemäß einem der Ansprüche 1 bis 5, wobei der Anteil an
nichtplättchenförmigen Partikeln in dem partikelhaltigen Zylinder in einem Bereich von 50 Gew.-% bis 99,9 Gew.-% liegt, jeweils bezogen auf das Gesamtgewicht des Zylinders.
7. Verfahren gemäß einem der Ansprüche 1 bis 5, wobei der Anteil an
plättchenförmigen Partikeln in dem partikelhaltigen Zylinder in einem Bereich von
30 Gew.-% bis 75 Gew.-% liegt, jeweils bezogen auf das Gesamtgewicht des Zylinders. 8. Verfahren gemäß einem der Ansprüche 1 bis 7, wobei die Gesamtmenge an Partikeln und Bindemitteln im partikelhaltigen Zylinder mindestens 90 Gew beträgt, bezogen auf das Gesamtgewicht des Zylinders.
9. Verfahren gemäß einem der Ansprüche 1 bis 8, wobei die Menge des Bindemittels in dem partikelhaltigen Zylinder in einem Bereich von 0,05 Gew.-% bis 70 Gew.-% liegt.
10. Verfahren gemäß einem der Ansprüche 1 bis 9, wobei mindestens ein Bindemittel des partikelhaltigen Zylinders ausgewählt wird aus der Gruppe bestehend aus
Calciumsulfat und Cellulosederivaten.
I I . Verfahren gemäß einem der Ansprüche 1 bis 10, wobei die Partikel des
partikelhaltigen Zylinders zu mindestens 75 Gew.-% Metallpartikel sind, bezogen auf das Gesamtgewicht der Partikel.
12. Verfahren zur Beschichtung eines Substrats, wobei es die folgenden Schritte umfasst
a) Herstellung eines partikelhaltigen Aerosols gemäß einem der Ansprüche 1 bis 1 1 , b) Abscheidung der Partikel auf einem Substrat durch ein Beschichtungsverfahren das ausgewählt wird aus der Gruppe bestehend aus Kaltgasspritzen, Flammspritzen,
Hochgeschwindigkeitsflammspritzen, thermischem Plasmaspritzen und nichtthermischem Plasmaspritzen.
13. Partikelhaltiger Zylinder, wobei der Zylinder ein Volumen von mindestens 5 cm3 aufweist und formstabil ist,
der Anteil an Partikeln im Bereich von 10 Gew.-% bis 99,9 Gew.-% liegt, bezogen auf das Gesamtgewicht des Zylinders,
die Biegefestigkeit σ höchstens 3,75 N/mm2 beträgt, wobei σ berechnet wird gemäß Formel (I)
3 x F x l
2 x B x D2 mit F = maximale Kraft, B = Breite des Zylinders in Quaderform, D = Höhe des Zylinders in Quaderform, I = Abstand zwischen den beiden Auflagepunkten, die Partikel ausgewählt werden aus der Gruppe bestehend aus Metallpartikeln, Glaspartikeln, Micapartikeln, Keramikpartikeln und Mischungen hiervon,
die in dem Zylinder enthaltenen Partikel einen d50 von maximal 300 μηι aufweisen und der Zylinder mindestens 0,01 Gew.-% Bindemittel aufweist, bezogen auf das
Gesamtgewicht des partikelhaltigen Zylinders, wobei das Bindemittel ausgewählt wird aus der Gruppe bestehend aus anorganischen Bindemitteln, organischen Bindemitteln und Mischungen hiervon.
14. Partikelhaltiger Zylinder gemäß Anspruch 13, wobei der Zylinder eine Biegefestigkeit von mindestens 0,0075 N/mm2 aufweist, das anorganische Bindemittel ausgewählt wird aus der Gruppe bestehend aus Calciumsulfat, Talk, Calciumhydroxid, Siliciumoxid, Aluminiumoxid, Calciumcarbonat, Calciumsilikathydrate, Calciumaluminathydrate und Mischungen hiervon und das organische Bindemittel ausgewählt wird aus der Gruppe bestehend aus Cellulose, Cellulosederivaten, Polysacchariden, Gelatine, Polyvinylen, Polyacrylaten, Polyethylenoxiden, Polyethylenglykolen, Polyamiden, Epoxidharzen, Polyurethanen, Polyaldehyden, Polyolefinen, Polyacrylatcopolymeren,
Polyaldehydcopolymeren, Polycarbonylcopolymere, Polyester, Polyolefincopolymere, den Salzen der vorgenannten Stoffe und Mischungen hiervon.
15. Verwendung eines partikelhaltigen Zylinders zur Erzeugung eines partikelhaltigen Aerosols, wobei der Zylinder ein Volumen von mindestens 5 cm3 aufweist und formstabil ist,
der Anteil an Partikeln im Bereich von 10 Gew.-% bis 99,9 Gew.-% liegt, bezogen auf das Gesamtgewicht des Zylinders,
die Biegefestigkeit σ höchstens 3,75 N/mm2 beträgt, wobei σ berechnet wird gemäß Formel (I)
3 x F x l
mit F = maximale Kraft, B = Breite des Zylinders in Quaderform, D = Höhe des Zylinders in Quaderform, I = Abstand zwischen den beiden Auflagepunkten,
die Partikel ausgewählt werden aus der Gruppe bestehend aus Metallpartikeln,
Glaspartikeln, Micapartikeln, Keramikpartikeln und Mischungen hiervon,
die in dem Zylinder enthaltenen Partikel einen d50 von maximal 300 μηι aufweisen und der Zylinder mindestens 0,01 Gew.-% Bindemittel aufweist, bezogen auf das
Gesamtgewicht des partikelhaltigen Zylinders, wobei das Bindemittel ausgewählt wird aus der Gruppe bestehend aus anorganischen Bindemitteln, organischen Bindemitteln und Mischungen hiervon.
EP15733419.4A 2014-06-26 2015-06-25 Verfahren zur herstellung eines partikelhaltigen aerosols Withdrawn EP3160671A1 (de)

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
EP14174601.6A EP2959992A1 (de) 2014-06-26 2014-06-26 Verfahren zur Herstellung eines partikelhaltigen Aerosols
PCT/EP2015/064470 WO2015197802A1 (de) 2014-06-26 2015-06-25 Verfahren zur herstellung eines partikelhaltigen aerosols

Publications (1)

Publication Number Publication Date
EP3160671A1 true EP3160671A1 (de) 2017-05-03

Family

ID=51176088

Family Applications (2)

Application Number Title Priority Date Filing Date
EP14174601.6A Withdrawn EP2959992A1 (de) 2014-06-26 2014-06-26 Verfahren zur Herstellung eines partikelhaltigen Aerosols
EP15733419.4A Withdrawn EP3160671A1 (de) 2014-06-26 2015-06-25 Verfahren zur herstellung eines partikelhaltigen aerosols

Family Applications Before (1)

Application Number Title Priority Date Filing Date
EP14174601.6A Withdrawn EP2959992A1 (de) 2014-06-26 2014-06-26 Verfahren zur Herstellung eines partikelhaltigen Aerosols

Country Status (5)

Country Link
US (1) US20170130314A1 (de)
EP (2) EP2959992A1 (de)
CN (1) CN106660117A (de)
TW (1) TW201631213A (de)
WO (1) WO2015197802A1 (de)

Families Citing this family (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN112872350A (zh) * 2021-01-13 2021-06-01 太原理工大学 一种陶瓷/金属复合耐磨材料网状预制体的制备方法

Family Cites Families (30)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
ZA841337B (en) 1983-03-02 1984-10-31 Leschonski K A method of and an apparatus for producing a gas-solid two phase flow jet having a constant mass or volume flow rate and predetermined velocity
CA1327769C (en) 1986-06-20 1994-03-15 Shoji Ikeda Powder treating method and apparatus used therefor
DE3816585A1 (de) 1988-05-16 1989-11-23 Thyssen Guss Ag Vorrichtung zum plasmaspritzen
US4872904A (en) 1988-06-02 1989-10-10 The Perkin-Elmer Corporation Tungsten carbide powder and method of making for flame spraying
DE3831256C1 (de) 1988-09-14 1990-05-10 The Perkin-Elmer Corp., Norwalk, Conn., Us
DE8908954U1 (de) 1989-06-03 1990-09-27 Castolin S.A., Lausanne-St. Sulpice, Waadt/Vaud Autogenes Flammspritzgerät zum Flammspritzen von pulverförmigen Werkstoffen bzw. Spritzpulver
DE4041623A1 (de) 1990-12-22 1992-06-25 Osu Maschinenbau Gmbh Duese fuer eine vorrichtung und ein verfahren zum hochgeschwindigkeitsflammenspritzen
DE19532412C2 (de) 1995-09-01 1999-09-30 Agrodyn Hochspannungstechnik G Vorrichtung zur Oberflächen-Vorbehandlung von Werkstücken
US5716422A (en) 1996-03-25 1998-02-10 Wilson Greatbatch Ltd. Thermal spray deposited electrode component and method of manufacture
JPH1060617A (ja) 1996-08-22 1998-03-03 Suruzaa Meteko Japan Kk 高速フレーム溶射方法
DE19747386A1 (de) 1997-10-27 1999-04-29 Linde Ag Verfahren zum thermischen Beschichten von Substratwerkstoffen
DE19807086A1 (de) 1998-02-20 1999-08-26 Fraunhofer Ges Forschung Verfahren zum Beschichten von Oberflächen eines Substrates, Vorrichtung zur Durchführung des Verfahrens, Schichtsystem sowie beschichtetes Substrat
DE19856307C1 (de) 1998-12-07 2000-01-13 Bosch Gmbh Robert Vorrichtung zur Erzeugung eines freien kalten Plasmastrahles
EP1024222A3 (de) 1999-01-27 2000-09-13 eybl International AG Verfahren zur Ausrüstung von textilen Substraten
US6331689B1 (en) 1999-06-15 2001-12-18 Siemens Aktiengesellschaft Method and device for producing a powder aerosol and use thereof
DE29919142U1 (de) 1999-10-30 2001-03-08 Agrodyn Hochspannungstechnik GmbH, 33803 Steinhagen Plasmadüse
DE19955880A1 (de) 1999-11-20 2001-05-23 Henkel Kgaa Plasmabeschichtung von Metallen bei Atmosphärendruck
DE10109087A1 (de) 2001-02-24 2002-10-24 Leoni Bordnetz Sys Gmbh & Co Verfahren zum Herstellen eines Formbauteils mit einer integrierten Leiterbahn
DE10116502B4 (de) 2001-04-03 2004-02-19 Viöl, Wolfgang, Prof. Dr. Verfahren und Vorrichtung zur Ausbildung eines Plasmastrahls
JP3543149B2 (ja) 2001-09-03 2004-07-14 島津工業有限会社 プラズマ溶射用のトーチヘッド
US7455891B2 (en) 2002-01-29 2008-11-25 Ciba Specialty Chemicals Corporation Process for the production of strongly adherent coatings
CA2482085C (en) 2002-04-12 2010-09-28 Sulzer Metco Ag A plasma spraying method
US7179526B2 (en) 2002-08-02 2007-02-20 3M Innovative Properties Company Plasma spraying
DE10320379A1 (de) 2003-05-06 2004-12-02 Leoni Ag Elektrisch beheizbares Element und Verfahren zum Herstellen eines elektrisch beheizbaren Elements
CH696811A5 (de) 2003-09-26 2007-12-14 Michael Dvorak Dr Ing Dipl Phy Verfahren zur Beschichtung einer Substratoberfläche unter Verwendung eines Plasmastrahles.
EP1806183A1 (de) 2006-01-10 2007-07-11 Siemens Aktiengesellschaft Düsenanordnung und Verfahren zum Kaltgasspritzen
DE102006061435A1 (de) 2006-12-23 2008-06-26 Leoni Ag Verfahren und Vorrichtung zum Aufspritzen insbesondere einer Leiterbahn, elektrisches Bauteil mit einer Leiterbahn sowie Dosiervorrichtung
US7928338B2 (en) 2007-02-02 2011-04-19 Plasma Surgical Investments Ltd. Plasma spraying device and method
DE102008031843A1 (de) 2008-07-05 2010-01-07 Mtu Aero Engines Gmbh Verfahren und Vorrichtung zum Kaltgasspritzen
DE102008050184B4 (de) 2008-10-01 2011-04-21 Technische Universität Chemnitz Verfahren und Vorrichtung zum Hochgeschwindigkeitsflammspritzen

Also Published As

Publication number Publication date
CN106660117A (zh) 2017-05-10
US20170130314A1 (en) 2017-05-11
TW201631213A (zh) 2016-09-01
EP2959992A1 (de) 2015-12-30
WO2015197802A1 (de) 2015-12-30

Similar Documents

Publication Publication Date Title
EP2737101B1 (de) Beschichtungsverfahren nutzend spezielle pulverförmige beschichtungsmaterialien und verwendung derartiger beschichtungsmaterialien
EP3216545B2 (de) Edelmetallpulver und dessen verwendung zur herstellung von bauteilen
EP3412640B1 (de) Hochfeste und grosse keramische platte mit geringer schrumpfung und herstellungsverfahren dafür
EP2737100A2 (de) Verfahren zur substratbeschichtung und verwendung additivversehener, pulverförmiger beschichtungsmaterialien in derartigen verfahren
DE69008003T2 (de) Dünne Kieselsäureschuppen und Verfahren zu ihrer Herstellung.
WO2013014212A2 (de) Verfahren zum aufbringen einer beschichtung auf einem substrat, beschichtung und verwendung von partikeln
EP2737102A2 (de) Verwendung speziell belegter, pulverförmiger beschichtungsmaterialien und beschichtungsverfahren unter einsatz derartiger beschichtungsmaterialien
EP2014392A2 (de) Formstoffmischung, Formling für Giessereizwecke und Verfahren zur Herstellung eines Formlings
DE2752752C2 (de) Verfahren zur Herstellung von Körpern mit Bienenwabenstruktur aus Keramikstoffen der Bariumtitanatgruppe mit positiven Temperatur-Widerstands-Koeffizienten des elektrischen Widerstandes
EP3535215B1 (de) Verfahren zum mahlen von silizium enthaltenden feststoffen
WO2011089130A2 (de) Verfahren zur herstellung von hohlkörpern mit eingeschlossenen frei beweglichen partikeln
JP3247952B2 (ja) 軽金属用フィルター
DE102011014875B3 (de) Verfahren für die Herstellung poröser Granulatteilchen aus anorganischem Werkstoff sowie deren Verwendung
Polani et al. Large-scale synthesis of polyhedral Ag nanoparticles for printed electronics
DE19529863B4 (de) Siliciumnitrid-Pulver
DE19603196A1 (de) Anorganische Hohlkugeln, Verfahren zu ihrer Herstellung und ihre Verwendung
EP3160671A1 (de) Verfahren zur herstellung eines partikelhaltigen aerosols
Anna et al. Coating zinc oxide submicron crystals on poly (methyl methacrylate) chips and spheres via ultrasound irradiation
JP5190327B2 (ja) 鉛蓄電池極板用格子体の鋳造用離型剤
DE202020107404U1 (de) Strahlmittel auf Basis von kornförmiger Aktivkohle
DE1471032C3 (de) Mischung zur Herstellung eines feuerfesten Körpers, Mörtels u.dgl
CN111662578A (zh) 一种球形氧化铬复合团聚粉末的制备工艺及其制得的产品
Zhang Densification process of silica microspheres by multi-step sintering
DE2057054C3 (de) Verfahren zum Herstellen poröser Metallfaser-Werkstücke
EP0180924A2 (de) Werkstoff aus in Gegenwart von Kohlenstoff reaktiongebundenen, elementares Silicium enthaltenden Partikeln und Verfahren zu seiner Herstellung

Legal Events

Date Code Title Description
PUAI Public reference made under article 153(3) epc to a published international application that has entered the european phase

Free format text: ORIGINAL CODE: 0009012

17P Request for examination filed

Effective date: 20170126

AK Designated contracting states

Kind code of ref document: A1

Designated state(s): AL AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HR HU IE IS IT LI LT LU LV MC MK MT NL NO PL PT RO RS SE SI SK SM TR

AX Request for extension of the european patent

Extension state: BA ME

DAV Request for validation of the european patent (deleted)
DAX Request for extension of the european patent (deleted)
STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: THE APPLICATION IS DEEMED TO BE WITHDRAWN

18D Application deemed to be withdrawn

Effective date: 20170822