EP2268671A1 - Nouveaux anticorps utiles pour le traitement du cancer - Google Patents
Nouveaux anticorps utiles pour le traitement du cancerInfo
- Publication number
- EP2268671A1 EP2268671A1 EP09742268A EP09742268A EP2268671A1 EP 2268671 A1 EP2268671 A1 EP 2268671A1 EP 09742268 A EP09742268 A EP 09742268A EP 09742268 A EP09742268 A EP 09742268A EP 2268671 A1 EP2268671 A1 EP 2268671A1
- Authority
- EP
- European Patent Office
- Prior art keywords
- cdr
- sequence
- sequence seq
- antibody
- identity
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Withdrawn
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2896—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against molecules with a "CD"-designation, not provided for elsewhere
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/30—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
- A61K39/39533—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
- A61K39/39558—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against tumor tissues, cells, antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K45/00—Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
- A61K45/06—Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/34—Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/565—Complementarity determining region [CDR]
Definitions
- the present invention relates to novel antibodies, in particular monoclonal antibodies of murine origin, chimeric and humanized, capable of inhibiting tumor growth as well as the amino acid and nucleic acid sequences coding for these antibodies.
- the subject of the invention is novel antibodies, derived compounds or functional fragments capable of inhibiting the proliferation of tumor cells.
- the invention also includes the use of these antibodies as a medicament for the prophylactic and / or therapeutic treatment of cancers as well as in methods or kits for diagnosing cancers.
- the invention finally comprises products and / or compositions comprising such antibodies in combination, for example, with antibodies and / or anticancer agents or conjugated with toxins and their use for the prevention and / or treatment of certain cancers. .
- CD151 also called PET A-3 or SFA-I
- PET A-3 is a membrane protein belonging to the family of tetraspanins (Boucheix and Rubinstein, 2001, Molecular Life Sci 58, 1189-1205, Hemler, 2001, J. CeIl Biol 155, 1103-1107).
- CD151 has 253 amino acids, and contains 4 membrane fragments and 2 extracellular domains EC1 (18 amino acids, sequence [40-57]) and EC2 (109 amino acids, sequence [113-221]), also called extracellular loops.
- a mutation in the peptide sequence can be observed, namely a mutation of residues K (Lys) and P (Pro) respectively at positions 132 and 137 into residues R Arg) and S (Ser) [Fitter et al., 1995, Blood 86 (4), 1348-1355 / Hasegawa et al., 1996, J. Virol. 70 (5), 3258-3263].
- CD1 51 is overexpressed in many cancers, such as for example lung cancers [Tokuhara et al, 2001, Clin. Cancer Res. 7, 4109-4114], colon [Hashida et al, 2003, Br. J. Cancer 89, 158-167], prostate [Ang et al, 2004, Cancer Epidemiol. Biomarkers Prev. 13, 1717-1721] or pancreas [Gesierich et al, 2005, Clin. Cancer Res. 11, 2840-2852].
- lung cancers [Tokuhara et al, 2001, Clin. Cancer Res. 7, 4109-4114]
- colon Hoashida et al, 2003, Br. J. Cancer 89, 158-167
- prostate Ang et al, 2004, Cancer Epidemiol. Biomarkers Prev. 13, 1717-1721] or pancreas [Gesierich et al, 2005, Clin. Cancer Res. 11, 2840-2852].
- CD151 is involved. in several cancer-related phenomena, such as cell adhesion (Nishiuchi et al, 2005, Proc Natl Acad Sci USA 102, 1939-1944, Winterwood et al, 2006, Mol Biol, Cell 17, 2707-2721). cell motility (Kohno et al., 2002, Int J. Cancer 97, 336-343), cell migration (Yauch et al., 1998, Mol Biol., 9, 2751-2765, Testa et al. Cancer Res 59, 3812-3820, Penas et al., 2000, J.
- tetraspanins One of the remarkable properties of tetraspanins is their ability to associate with each other, as well as a large number of other surface molecules to form structured macromolecular complexes.
- each tetraspanol is specifically associated with one or more surface molecules thus forming primary complexes, consisting of a tetraspinanine and a partner molecule.
- Tetraspanins can organize particular microdomains of the plasma membrane within which they would recruit their molecular partners that could be functionally coupled.
- the set of interactions involving tetraspanins has been referred to as the "tetraspanin network" or "Tetraspanin Web".
- CD151 interacts on the cell surface with different membrane proteins.
- CD151 is able to regulate the adhesion, migration and cellular invasion phenomena by modulating different signaling pathways, such as the phosphoinositide pathway via an association with PI4-kinase (Yauch et al, 1998, Mol Biol., 9, 2751-2765), the c-Jun signaling pathway via phosphorylation of FAK, Src, p38-MAPK and JNK (Hong et al, 2006, J. Biol Chem.
- signaling pathways such as the phosphoinositide pathway via an association with PI4-kinase (Yauch et al, 1998, Mol Biol., 9, 2751-2765), the c-Jun signaling pathway via phosphorylation of FAK, Src, p38-MAPK and JNK (Hong et al, 2006, J. Biol Chem.
- Homophilic interactions between cells are also responsible for an increase in cell motility and the expression of metalloproteinase
- the monoclonal antibody 50-6 (isotype IgG1) directed against CD 151 was generated in mice by subtractive immunizations with human squamous cell carcinoma HEp-3 cells (Testa et al., 1999, Cancer Res 59, 3812-3820). .
- the 50-6 antibody is able to inhibit in vitro the migration of transfected human HeLa cervical carcinoma cells to overexpress CD151 and HEp-3 cells, and angiogenesis in a bFGF-induced chorioallantoic membrane neovascularization model. (basic fibroblast growth factor).
- bFGF-induced chorioallantoic membrane neovascularization model (basic fibroblast growth factor).
- metastases induced by inoculation of HEp-3 cells in 2 mouse embryo models chicken (Testa et al., 1999, Cancer Res 59, 3812-3820).
- the inhibitory activity of the 50-6 antibody is determined by measuring the activity of huPA protein (human urokinase-type plasminogen activator) in lung extracts.
- this dosage reflects the presence of human cells in the lungs.
- metastases spread of HEp-3 cells in the lungs of chicken embryos
- the reduction of metastases is estimated, compared to a control antibody, to 74% in a so-called "metastasis” model.
- spontaneous "in which the inoculation of the cells is followed by an injection of the antibody, and 57% in a so-called model of” experimental metastasis in which the cells and the antibody are inoculated together.
- the anti-tumor properties of the antibody 50-6 observed in vivo do not seem to be related to a cytostatic or cytotoxic effect since it showed no effect on the in vitro proliferation of HEp-3 cells.
- the hybridoma producing antibody 50-6 is available to ATCC as CRL-2696 (hybridoma initially deposited as 50-6 [PTA-227]).
- Anti-CD151 SFA1.2B4 monoclonal antibody (IgG1 isotype) was generated in mice after intraperitoneal immunization with NIH 3T3 cells transfected with the human CD151 gene (Hasegawa et al, 1996, J. Virol. 70, 3258-3263).
- the SFA1.2B4 antibody is capable of inhibiting in vitro the invasion and cell motility of various human tumor lines (Kohno et al., 2002, Int J. Cancer 97, 336-343). It inhibits in vivo the pulmonary metastases induced by colon cancer lines RPMI14788 and fibrosarcoma HT1080 transfected to overexpress CD151 (Kohn et al., 2002, Int J.
- CD9 and CD82 are less expressed on primary tumors when There is metastasis and their decline in expression predicts a lower survival rate.
- lung cancer the combined decrease in CD9 and CD82 expression was correlated with greater metastatic potential than when expression of only one of these two antigens was reduced.
- CD 151 is associated with the aggressiveness of certain cancers, such as lung, colon and prostate cancers, and could be considered a factor of poor prognosis (Tokuhara et al, 2001 Clin Cancer Res, 7, 4109-4114, Hashida et al, 2003, Br.
- the average survival is indeed decreased in patients whose tumor expresses CD151, compared to those whose tumor does not express CD151.
- the subject of the invention is an isolated antibody, or one of its derivative compounds or functional fragments, capable of binding to the CD151 protein, said antibody being characterized in that it comprises at least one CDR selected from the CDRs of sequence SEQ ID No.
- ком ⁇ онент of an antibody according to the invention is meant in particular an antibody fragment, such as fragments Fv, scFv (whether for single chain), Fab, F (ab ') 2, Fab', scFv-Fc or diabodies, or any fragment whose half-life duration would have been increased.
- an antibody fragment such as fragments Fv, scFv (whether for single chain), Fab, F (ab ') 2, Fab', scFv-Fc or diabodies, or any fragment whose half-life duration would have been increased.
- Such functional fragments will be described in detail later in this specification.
- derivative compounds are well known to those skilled in the art and will be described in more detail in the following description.
- the invention comprises the antibodies, their derived compounds or their functional fragments, according to the present invention, in particular chimeric or humanized, obtained by genetic recombination or by chemical synthesis.
- the antibody, or one of its derivative compounds or functional fragments, according to the invention is characterized in that it consists of a monoclonal antibody.
- a monoclonal antibody means an antibody derived from a substantially homogeneous antibody population. More particularly, the individual antibodies of a population are identical with the exception of a few possible mutations that can occur naturally which can be found in minute proportions.
- a monoclonal antibody consists of a homogeneous antibody resulting from the proliferation of a single cell clone (for example a hybridoma, a eukaryotic host cell transfected with a DNA molecule encoding the homogeneous antibody, a cell prokaryotic host transfected with a DNA molecule encoding the homogeneous antibody, etc.) and which is generally characterized by heavy chains of one and the same class and subclass, and light chains of a single type .
- the monoclonal antibodies are highly specific and are directed against a single antigen.
- each monoclonal antibody is directed against a single epitope of the antigen.
- the invention does not relate to antibodies in natural form, that is to say that they are not taken in their natural environment but that they could be isolated or obtained by purification from from natural sources, or obtained by genetic recombination, or by chemical synthesis, and they may then include non-natural amino acids as will be described later.
- a first antibody which is characterized in that it comprises i) a light chain comprising at least one CDR chosen from CDR-L1,
- CDR-L1 chosen from the CDRs of sequence SEQ ID No. 1 or 59, or at least one sequence that has at least 80% identity after optimal alignment with the sequence SEQ ID No. 1 or 59
- CDR-L2 chosen from the CDRs of sequence SEQ ID No. 2 or 60, or at least one sequence that has at least 80% identity after optimal alignment with the sequence SEQ ID No. 2 or 60;
- CDR-H1 chosen from CDRs of sequence SEQ ID No. 4 or 61, or at least one sequence that has at least 80% identity after optimal alignment with the sequence SEQ ID No. 4 or 61;
- CDR-H2 chosen from the CDRs of sequence SEQ ID No. 5 or 62, or at least one sequence that has at least 80% identity after optimal alignment with the sequence SEQ ID No. 5 or 62;
- - CDR-H3 chosen from CDRs of sequence SEQ ID No. 6 or 63, or at least one sequence that has at least 80% identity after optimal alignment with the sequence SEQ ID No. 6 or 63.
- a second antibody which is characterized in that it comprises i) a light chain comprising at least one CDR chosen from CDR-L1, CDR-L2 and CDR-L L3, with
- CDR-L1 chosen from the CDRs of sequence SEQ ID No. 17 or 69, or at least one sequence that has at least 80% identity after optimal alignment with the sequence SEQ ID No. 17 or 69
- CDR-L2 chosen from the CDRs of sequence SEQ ID No. 18 or 70, or at least one sequence that has at least 80% identity after optimal alignment with the sequence SEQ ID No. 18 or 70;
- CDR-H1 chosen from CDRs of sequence SEQ ID No. 20 or 71, or at least one sequence that has at least 80% identity after optimal alignment with the sequence SEQ ID No. 20 or 71;
- CDR-H2 chosen from CDRs having the sequence SEQ ID No. 21 or 72, or at least one sequence that has at least 80% identity after optimal alignment with the sequence SEQ ID No. 21 or 72;
- CDR-H3 chosen from the CDRs of sequence SEQ ID No. 22 or 73, or at least one sequence that has at least 80% identity after optimal alignment with the sequence SEQ ID No. 22 or 73.
- a third antibody which is characterized in that it comprises i) a light chain comprising at least one CDR chosen from CDR-L1,
- CDR-L1 chosen from the CDRs of sequence SEQ ID No. 33 or 79, or at least one sequence which has at least 80% identity after optimal alignment with the sequence SEQ ID No. 33 or 79
- CDR-L2 chosen from the CDRs of sequence SEQ ID No. 2 or 60, or at least one sequence that has at least 80% identity after optimal alignment with the sequence SEQ ID No. 2 or 60;
- CDR-H2 chosen from the CDRs of sequence SEQ ID No. 34 or 80, or at least one sequence which has at least 80% identity after optimal alignment with the sequence SEQ ID No. 34 or 80;
- a fourth antibody which is characterized in that it comprises i) a light chain comprising at least one CDR chosen from CDR-L1, CDR-L2 and CDR-L3, with
- CDR-L1 chosen from the CDRs of sequence SEQ ID No. 43 or 85, or at least one sequence that has at least 80% identity after optimal alignment with the sequence SEQ ID No. 43 or 85;
- CDR-L2 chosen from the CDRs of sequence SEQ ID No. 44 or 86, or at least one sequence that has at least 80% identity after optimal alignment with the sequence SEQ ID No. 44 or 86; CDR-L3 of sequence SEQ ID No. 45, or at least one sequence which has at least 80% identity after optimal alignment with the sequence SEQ ID No. 45; and / or ii) a heavy chain comprising at least one CDR chosen from CDR-H1,
- CDR-H2 and CDR-H3 with - CDR-H1 selected from the CDRs of sequence SEQ ID No. 46 or 87, or at least one sequence which has at least 80% identity after optimal alignment with the sequence SEQ ID No. 46 or 87;
- CDR-H2 chosen from CDRs of sequence SEQ ID No. 47 or 88, or at least one sequence which has at least 80% identity after optimal alignment with the sequence SEQ ID No. 47 or 88;
- CDR-H3 chosen from the CDRs of sequence SEQ ID No. 48 or 89, or at least one sequence which has at least 80% identity after optimal alignment with the sequence SEQ ID No. 48 or 89.
- region CDR or CDR hypervariable regions of the heavy and light chains of immunoglobulins. There are 3 heavy chain CDRs and 3 light chain CDRs.
- the term CDR or CDRs is used herein to designate, as appropriate, one or more or all of these regions which contain the majority of the amino acid residues responsible for the affinity binding of the antibody for the antigen or epitope that it recognizes.
- the CDRs can be defined according to the IMGT system.
- the unique IMGT numbering system has been defined to compare variable domains regardless of antigen, chain type, or species [Lefranc M.-P., Immunology Today 18, 509 (1997); Lefranc M.-P., The Immunologist, 7, 132-136 (1999); Lefranc, M.-P., Pommie, C, Ruiz, M., Giudicelli, V., Foulquier, E., Truong, L., Thouvenin-Contet, V. and Lefranc, Dev. Comp. Immunol., 27, 55-77 (2003)].
- the single numbering system IMGT thus provides a standardized delimitation of the framework regions (FRl-IMGT: positions 1 to 26, FR2-IMGT: positions 39 to 55, FR3-IMGT: positions 66 to 104 and FR4 IMGT: positions 118 to 128) as well as complementarity determining regions or CDRs (CDR1-IMGT: positions 27 to 38, CDR2-IMGT: positions 56 to 65 and CDR3-IMGT: positions 105 to 117). Since "holes" or "spaces" represent unoccupied positions, the length of CDRs according to IMGT becomes crucial information.
- the IMGT system is used in 2D graphical representations, referred to as IMGT bead collars [Ruiz, M.
- the first antibody, or one of its derivative compounds or functional fragments, according to the invention comprises a light chain comprising at least one CDR chosen from CDR-L1, CDR-L2 and CDR-L3 respectively. sequence SEQ ID No.
- the antibody, or one of its derivative compounds or functional fragments, according to the invention comprises a light chain comprising the three CDRs, as defined according to IMGT, respectively of sequence SEQ ID Nos. 1, 2 and 3, or having at least 80%, preferably 85%, 90%, 95% and 98% identity after optimal alignment with SEQ ID No. 1, 2 and 3.
- the antibody, or one of its derivative compounds or functional fragments, according to the invention comprises a heavy chain comprising the three CDRs, as defined according to IMGT, respectively of sequence SEQ ID No. 4, and 6, or having at least 80%, preferably 85%, 90%, 95% and 98% identity after optimal alignment with SEQ ID No. 4, 5 and 6.
- the second antibody, or one of its derivative compounds or functional fragments, according to the invention comprises a light chain comprising at least one CDR chosen from CDR-L1, CDR-L2 and CDR-L3 respectively.
- SEQ ID No. 17 ATPRIGTGF AY
- SEQ ID No. 18 SEQ ID SEQ ID SEQ ID 19: QQYSSNPT
- SEQ ID No. 20 GFTLSTSGMG
- SEQ ID No. 21 IYWDDDK
- the antibody, or one of its derivative compounds or functional fragments, according to the invention comprises a light chain comprising the three CDRs, as defined according to IMGT, respectively of sequence.
- the antibody, or one of its derivative compounds or functional fragments, according to the invention comprises a heavy chain comprising the three CDRs, as defined according to IMGT, respectively of sequence SEQ ID No. 20, 21 and 22, or having at least 80%, preferably 85%, 90%, 95% and 98% identity after optimal alignment with SEQ ID No. 20, 21 and 22.
- the third antibody, or one of its derivative compounds or functional fragments, according to the invention comprises a light chain comprising at least one CDR chosen from CDR-L1, CDR-L2 and CDR-L3 respectively. of sequence SEQ ID No. 33, 2 and 3, or having at least 80%, preferably 85%, 90%, 95% and 98% identity after optimal alignment with SEQ ID No. 33, 2 and 3 sequences. ; and / or a heavy chain comprising at least one CDR chosen from CDR-H1, CDR-H2 and CDR-H3 respectively of sequence SEQ ID No. 4, 34 and 35, or having at least 80%, preferably 85%, 90%, 95% and 98% identity after optimal alignment with sequences SEQ ID Nos. 4, 34 and 35.
- SEQ ID No. 33 ASVD YYGTSL
- SEQ ID No. 34 ISSGGVTT
- SEQ ID No. 35 TSPRTGTGFAY
- the antibody, or one of its derivative compounds or functional fragments, according to the invention comprises a light chain.
- a light chain comprising the three CDRs, as defined according to IMGT, respectively of sequence SEQ ID Nos. 33, 2 and 3, or having at least 80%, preferably 85%, 90%, 95% and 98% identity after optimal alignment with SEQ ID No. 33, 2 and 3.
- the antibody, or one of its derivative compounds or functional fragments, according to the invention comprises a heavy chain comprising the three CDRs, as defined according to IMGT, respectively of sequence SEQ ID No. 4, 34 and 35, or having at least 80%, preferably 85%, 90%, 95% and 98% identity after optimal alignment with SEQ ID Nos. 4, 34 and 35.
- the fourth and last antibody, or one of its derivative compounds or functional fragments comprises a light chain comprising at least one CDR chosen from CDR-L1, CDR-L2 and CDR-L3 respectively of sequence SEQ ID No. 43, 44 and 45, or having at least 80%, preferably 85%, 90%, 95% and 98% identity after optimal alignment with the sequences SEQ ID No. 43 , 44 and 45; and / or a heavy chain comprising at least one CDR chosen from CDR-H1, CDR-H2 and CDR-H3 respectively of sequence SEQ ID No. 46, 47 and 48, or having at least 80%, preferably 85%, 90%, 95% and 98% identity after optimal alignment with SEQ ID No. 46, 47 and 48 sequences.
- SEQ ID No. 43 ENVGTY SEQ ID No. 44: GAS SEQ ID No. 45: GQTYSFPYT SEQ ID No. 46: GYTFTSSS SEQ ID No. 47: IHPNSGNT SEQ ID No. 48: ARARSFYY CDMA
- the antibody, or one of its derivative compounds or functional fragments, according to the invention comprises a light chain comprising the three CDRs, as defined according to IMGT, respectively of sequence SEQ ID Nos. 43, 44 and 45, or having at least 80%, preferably 85%, 90%, 95% and 98% identity after optimal alignment with SEQ ID NOs 43, 44 and 45.
- the antibody, or one of its derivative compounds or functional fragments, according to the invention comprises a heavy chain comprising the three CDRs, as defined according to IMGT, respectively of sequence SEQ ID No. 46, 47 and 48, or having at least 80%, preferably 85%, 90%, 95% and 98% identity after optimal alignment with the sequences SEQ ID No. 46, 47 and 48.
- the CDRs can be defined according to the traditional approach of Kabat et al. (Kabat et al, Sequences of Proteins of Immunological Interest, 5 th Ed., US Department of Health and Human Services, NIH, 1991, and later editions).
- the first antibody, or one of its derivative compounds or functional fragments, according to the invention comprises a light chain comprising at least one CDR chosen from CDR-L1, CDR-L2 and CDR-L3 respectively.
- the antibody, or one of its derivative compounds or functional fragments, according to the invention comprises a light chain comprising the three CDRs, as defined according to Kabat, respectively of sequence.
- SEQ ID Nos. 59, 60 and 3 or having at least 80%, preferably 85%, 90%, 95% and
- the antibody, or one of its derivative compounds or functional fragments, according to the invention comprises a heavy chain comprising the three CDRs, as defined according to Kabat, respectively of sequence SEQ ID No. 61,
- the second antibody, or one of its derivative compounds or functional fragments, according to the invention comprises a light chain comprising at least one CDR chosen from CDR-L1, CDR-L2 and CDR-L3 respectively.
- the protein sequences mentioned are as follows:
- SEQ ID No. 69 KASQNVGIAVA
- SASNRYT SEQ ID No. 71: STSGMGVS
- SEQ ID No. 72 HIYWDDDKRYNPSLKS
- SEQ ID NO: 73 RDHYGDYS YAMDY
- the antibody, or one of its derivative compounds or functional fragments, according to the invention comprises a light chain comprising the three CDRs, as defined according to Kabat, respectively of sequence SEQ ID Nos. 69, 70 and 19, or having at least 80%, preferably 85%, 90%, 95% and 98% identity after optimal alignment with SEQ ID No. 69, 70 and 19.
- the antibody, or one of its derivative compounds or functional fragments, according to the invention comprises a heavy chain comprising the three CDRs, as defined according to Kabat, respectively of sequence SEQ ID No. 71, 72 and 73, or having at least 80%, preferably 85%, 90%, 95% and 98% identity after optimal alignment with SEQ ID No. 71, 72 and 73 sequences.
- the third antibody, or one of its derivative compounds or functional fragments, according to the invention comprises a light chain comprising at least one CDR chosen from CDR-L1, CDR-L2 and CDR-L3 respectively. of sequence SEQ ID No. 79, 60 and 3, or having at least 80%, preferably 85%, 90%, 95% and 98% identity after optimal alignment with SEQ ID No. 79, 60 and 3 sequences. ; and / or a heavy chain comprising at least one CDR chosen from CDR-H1, CDR-H2 and CDR-H3 respectively of SEQ sequence ID No. 61, 80 and 81, or having at least 80%, preferably 85%, 90%, 95% and 98% identity after optimal alignment with SEQ ID No.
- SEQ ID No. 79 ASVD YYGTSL
- SEQ ID No. 80 YISSGGVTTYYPDTIKG
- SEQ ID No. 81 PRTGTGFAY
- the antibody, or one of its derivative compounds or functional fragments, according to the invention comprises a light chain comprising the three CDRs, as defined according to Kabat, respectively of sequence SEQ ID Nos. 79, 60 and 3, or having at least 80%, preferably 85%, 90%, 95% and 98% identity after optimal alignment with SEQ ID Nos. 79, 60 and 3.
- the antibody, or one of its derivative compounds or functional fragments, according to the invention comprises a heavy chain comprising the three CDRs, as defined according to Kabat, respectively of sequence SEQ ID No. 61, 80 and 81, or having at least 80%, preferably 85%, 90%, 95% and 98% identity after optimal alignment with SEQ ID No. 61, 80 and 81.
- the fourth and last antibody, or one of its derivative compounds or functional fragments comprises a light chain comprising at least one CDR chosen from CDR-L1, CDR-L2 and CDR-L3 respectively of sequence SEQ ID No. 85, 86 and 45, or having at least 80%, preferably 85%, 90%, 95% and 98% identity after optimal alignment with the sequences SEQ ID No. 85 , 86 and 45; and / or a heavy chain comprising at least one CDR chosen from CDR-H1, CDR-H2 and CDR-H3 respectively of sequence SEQ ID No. 87, 88 and 89, or having at least 80%, preferably 85%, 90%, 95% and 98% identity after optimal alignment with SEQ ID Nos. 87, 88 and 89.
- the antibody, or one of its derivative compounds or functional fragments, according to the invention comprises a light chain comprising the three CDRs, as defined according to Kabat, respectively of sequence SEQ ID Nos. 85, 86 and 45, or having at least 80%, preferably 85%, 90%, 95% and 98% identity after optimal alignment with SEQ ID Nos. 85, 86 and 45.
- the antibody, or one of its derivative compounds or functional fragments, according to the invention comprises a heavy chain comprising the three CDRs, as defined according to Kabat, respectively of sequence SEQ ID No. 87, 88 and 89, or having at least 80%, preferably 85%, 90%, 95% and 98% identity after optimal alignment with SEQ ID No. 87, 88 and 89.
- polypeptides polypeptide sequences, peptides and proteins attached to the antibody compounds or their sequence are interchangeable. It should be understood here that the invention does not relate to antibodies in natural form, that is to say that they are not taken in their natural environment but that they could be isolated or obtained by purification from from natural sources, or obtained by genetic recombination, or by chemical synthesis, and they may then include non-natural amino acids as will be described later.
- percent identity between two nucleic acid or amino acid sequences in the sense of the present invention, it is meant to designate a percentage of nucleotides or identical amino acid residues between the two sequences to be compared, obtained after the best alignment (optimal alignment), this percentage being purely statistical and the differences between the two sequences being randomly distributed over their entire length.
- sequence comparisons between two nucleic acid or amino acid sequences are traditionally performed by comparing these sequences after optimally aligning them, said comparison being possible by segment or by "comparison window”.
- the optimal alignment of the sequences for comparison can be realized, besides manually, by means of the local homology algorithm of Smith and Waterman (1981) [Ad. App. Math.
- the percentage identity between two nucleic acid or amino acid sequences is determined by comparing these two optimally aligned sequences in which the nucleic acid or amino acid sequence to be compared may comprise additions or deletions. relative to the reference sequence for optimal alignment between these two sequences.
- the percentage of identity is calculated by determining the number of identical positions for which the nucleotide or amino acid residue is identical between the two sequences, by dividing this number of identical positions by the total number of positions in the comparison window. and multiplying the result obtained by 100 to obtain the percentage identity between these two sequences.
- the BLAST program "BLAST 2 sequences” (Tatusova et al., "Blast 2 sequences - a new tool for comparing protein and nucleotide sequences", FEMS Microbiol Lett., 174: 247-250) can be used on the site http://www.ncbi.nlm.nih.gov/gorf/bl2.html, the parameters used being those given by default (in particular for the parameters "open gap penalty”: 5, and “extension gap penalty”: 2, the chosen matrix being for example the "BLOSUM 62" matrix proposed by the program), the percentage of identity between the two sequences to be compared being calculated directly by the program.
- amino acid sequence having at least 80%, preferably 85%, 90%, 95% and 98% identity with a reference amino acid sequence those with respect to the reference sequence are preferred.
- certain modifications in particular deletion, addition or substitution of at least one amino acid, truncation or elongation.
- substitutions in which the substituted amino acids are replaced by "equivalent” amino acids are preferred.
- the expression "equivalent amino acids” is intended herein to designate any amino acid capable of being substituted for one of the amino acids of the basic structure without, however, essentially modifying the biological activities of the corresponding antibodies and as they will be defined by following, especially in the examples.
- These equivalent amino acids can be determined either by relying on their structural homology with the amino acids to which they are substituted, or on results of comparative tests of biological activity between the different antibodies that may be carried out.
- Table 1 shows the possibilities of substitution that can be carried out without resulting in a thorough modification of the biological activity of the corresponding modified antibody, the reverse substitutions being naturally occurring. under the same conditions.
- the preferred characteristic CDRs of the antibody according to the invention will be the 3 CDRs of the heavy chain and, even more preferably, the CDR corresponding to CDR-H3.
- the present invention relates to a murine antibody, or one of its derivative compounds or functional fragments, according to the invention.
- said first antibody, or one of its derivative compounds or functional fragments comprises a light chain comprising the three CDRs, as defined according to IMGT, respectively of sequence SEQ ID No. 1, 2 and 3, or having at least 80%, preferably 85%, 90%, 95% and 98% identity after optimal alignment with SEQ ID No. 1, 2 and 3; and a heavy chain comprising the three CDRs respectively of sequence SEQ ID Nos. 4, 5 and 6, or having at least 80%, preferably 85%, 90%, 95% and 98% identity after optimal alignment with SEQ ID No. 4, 5 and 6.
- said first antibody, or one of its derivative compounds or functional fragments comprises a light chain comprising the three CDRs, as defined according to Kabat, respectively of sequence SEQ ID No. 59, 60 and 3, or having at least 80%, preferably 85%, 90%, 95% and 98% identity after optimal alignment with SEQ ID No. 59, 60 and 3; and a heavy chain comprising the three CDRs respectively of sequence SEQ ID Nos. 61, 62 and 63, or having at least 80%, preferably 85%, 90%, 95% and 98% identity after optimal alignment with SEQ ID No. 61, 62 and 63.
- the antibody, or one of its derivative compounds or functional fragments, according to the invention comprises a sequence light chain comprising the amino acid sequence SEQ ID No. 7 or having at least 80%, preferably 85%, 90%, 95% and 98% identity after optimal alignment with the sequence SEQ ID No. 7, and / or comprising a sequence heavy chain comprising the sequence of amino acid SEQ ID No. 8 or having at least 80%, preferably 85%, 90%, 95% and 98% identity after optimal alignment with SEQ ID No. 8.
- said second antibody, or one of its derivative compounds or functional fragments comprises a light chain comprising the three CDRs, as defined according to IMGT, respectively of sequence SEQ ID No. 17, 18 and 19, or having at least 80%, preferably 85%, 90%, 95% and 98% identity after optimal alignment with SEQ ID No. 17, 18 and 19; and a heavy chain comprising the three CDRs respectively of sequence SEQ ID Nos. 20, 21 and 22, or having at least 80%, preferably 85%, 90%, 95% and 98% identity after optimal alignment with SEQ ID No. 20, 21 and 22.
- said second antibody, or one of its derivative compounds or functional fragments comprises a light chain comprising the three CDRs, as defined according to Kabat, respectively of sequence SEQ ID No. 69 , 70 and 19, or having at least 80%, preferably 85%, 90%, 95% and 98% identity after optimal alignment with SEQ ID No. 69, 70 and 19; and a heavy chain comprising the three CDRs respectively of sequence SEQ ID Nos. 71, 72 and 73, or having at least 80%, preferably 85%, 90%, 95% and 98% identity after optimal alignment with SEQ ID No. 71, 72 and 73.
- the antibody, or one of its derivative compounds or functional fragments, according to the invention comprises a sequence light chain comprising the amino acid sequence SEQ ID No. 23 or having at least 80%, preferably 85%, 90%, 95% and 98% identity after optimal alignment with the sequence SEQ ID No. 23, and / or comprising a sequence heavy chain comprising the sequence of amino acid SEQ ID No. 24 or having at least 80% of preferably 85%, 90%, 95% and 98% identity after optimal alignment with the sequence SEQ ID No. 24.
- SEQ ID No. 23 DIVMTQSQKFMSTSEGDRVSITCKASQNVGIAVAWYQQKPGQSPKLLIYSASNR YTGVPDRFTGSGSGTDFTLTISNMQSEDLADYFCQQYSSNPTFGAGTKLELK
- SEQ ID NO. 24 DIVMTQSQKFMSTSEGDRVSITCKASQNVGIAVAWYQQKPGQSPKLLIYSASNR YTGVPDRFTGSGSGTDFTLTISNMQSEDLADYFCQQYSSNPTFGAGTKLELK
- said third antibody, or one of its derivative compounds or functional fragments comprises a light chain comprising the three CDRs, as defined according to IMGT, respectively of sequence SEQ ID No. 33, 2 and 3, or having at least 80%, preferably 85%, 90%, 95% and 98% identity after optimal alignment with SEQ ID No. 33, 2 and 3; and a heavy chain comprising the three CDRs respectively of sequence SEQ ID Nos. 4, 34 and 35, or having at least 80%, preferably 85%, 90%, 95% and 98% identity after optimal alignment with SEQ ID No. 4, 34 and 35.
- said third antibody, or one of its derivative compounds or functional fragments comprises a light chain comprising the three CDRs, as defined according to Kabat, respectively of sequence SEQ ID No. 79, 60 and 3, or having at least 80%, preferably 85%, 90%, 95% and 98% identity after optimal alignment with SEQ ID Nos. 79, 60 and 3; and a heavy chain comprising the three CDRs respectively of sequence SEQ ID Nos. 61, 80 and 81, or having at least 80%, preferably 85%, 90%, 95% and 98% identity after optimal alignment with SEQ ID No. 61, 80 and 81.
- the antibody, or one of its derivative compounds or functional fragments, according to the invention comprises a sequence light chain comprising the amino acid sequence SEQ ID No. 36 or having at least 80%, preferably 85%, 90%, 95% and 98% identity after optimal alignment with the sequence SEQ ID No. 36, and / or in that it comprises a heavy sequence chain comprising the amino acid sequence SEQ ID No. 37 or having at least 80%, preferably 85%, 90%, 95% and 98% identity after optimal alignment with the sequence SEQ ID No. 37.
- SEQ ID No. 37 EVKLVESGGDLVQPGGSLKLSCAASGFTFSTYTMSWVRQTPEKRLEWVAYISS GGVTTYYPDTIKGRFTISRDNAKNTLFLQMNSLKSEDTAMYYCTSPRTGTGFAY WGQGTLVTVSA
- said fourth antibody, or one of its derivative compounds or functional fragments comprises a light chain comprising the three CDRs, as defined according to IMGT, respectively of sequence SEQ ID No. 43, 44 and 45, or having at least 80%, preferably 85%, 90%, 95% and 98% identity after optimal alignment with SEQ ID NOs 43, 44 and 45; and a heavy chain comprising the three CDRs respectively of sequence SEQ ID Nos. 46, 47 and 48, or having at least 80%, preferably 85%, 90%, 95% and 98% identity after optimal alignment with SEQ ID No. 46, 47 and 48.
- said fourth antibody, or one of its derivative compounds or functional fragments comprises a light chain comprising the three CDRs, as defined according to Kabat, respectively of sequence SEQ ID No. 85 , 86 and 45, or having at least 80%, preferably 85%, 90%, 95% and 98% identity after optimal alignment with SEQ ID Nos. 85, 86 and 45; and a heavy chain comprising the three CDRs respectively of sequence SEQ ID Nos. 87, 88 and 89, or having at least 80%, preferably 85%, 90%, 95% and 98% identity after optimal alignment with SEQ ID Nos. 87, 88 and 89.
- the antibody, or one of its derivative compounds or functional fragments, according to the invention comprises a sequence light chain comprising the amino acid sequence SEQ ID No. 49 or having at least 80%, preferably 85%, 90%, 95% and 98% identity after optimal alignment with the sequence SEQ ID No. 49, and / or in that it comprises a sequence heavy chain comprising the sequence of amino acid SEQ ID No. 50 or having at least 80%, preferably 85%, 90%, 95% and 98% identity after optimal alignment with the sequence SEQ ID No. 50.
- the invention also relates to any compound derived from an antibody according to the invention.
- the antibody, or one of its derivative compounds or functional fragments, according to the invention is characterized in that said derivative compound consists of a binding protein comprising a peptide framework on which is grafted at least one CDR of to retain all or part of the paratopic properties of recognition of the initial antibody.
- One or more of the sequences of the CDRs described in this invention can also be presented on protein frames (or "scaffolds" according to the English nomenclature) different from immunoglobulins.
- the protein sequence makes it possible to recreate a peptide backbone that is favorable to the folding of the grafted CDR (s), enabling it (them) to retain their paratopic properties of recognition of the antigen.
- the origin of such proteinaceous frameworks can be, but is not limited to structures selected from: fibronectin and preferentially the 10th domain of fibronectin type 3, lipocalin, anticalin (Skerra A., J. Biotechnol 2001, 74 (4): 251 -IS), the protein Z derived from the B domain of Staphylococcus aureus protein A, thioredoxin A or the repeat-motif proteins of the "ankyrin repeat" type (Kohi et al, PNAS, 2003, vol.100, No. 4, 1700-1705), "armadillo repeat", “leucine-rich repeat” or "tetratricopeptide repeat”.
- frameworks derived from toxins such as, for example, the following toxins derived from scorpions, insects, plants, molluscs, etc.) or protein inhibitors of neuronal NO synthase (PIN).
- such peptide frameworks may comprise from 1 to 6 CDR (s) derived from the original antibody.
- CDR derived from the original antibody.
- those skilled in the art will select at least one CDR from the heavy chain, the latter being known to be mainly responsible for the specificity of the antibody.
- the selection of the relevant CDR (s) is obvious to those skilled in the art, the latter then implementing known techniques (Bes et al., FEBS Letters 508, 2001 67-74).
- the subject of the present invention is therefore an antibody, or one of its derivative compounds or functional fragments, characterized in that the peptide framework is selected from the proteins a) phylogenetically well conserved, b) of robust architecture, c) with a well-known three-dimensional molecular organization, d) of small size and / or e) comprising regions which can be modified by deletion and / or insertion without modifications of the stability properties.
- the antibody, or one of its derivative compounds or functional fragments, according to the invention is characterized in that said peptide framework is selected from i) the frameworks derived from fibronectin, preferentially the 10th fibronectin type 3, lipocalin, anticalin, protein Z derived from domain B of Staphylococcus aureus protein A, thioredoxin A, ii) repetitive pattern proteins of the "ankyrin repeat” type, "armadillo repeat ",” leucine-rich repeat “or” tetratricopeptide repeat ", or iii) protein inhibitors of neuronal NO synthase (PIN).
- the functional fragments of the antibody described above are also made to the functional fragments of the antibody described above.
- the invention is directed to an antibody, or one of its derivative compounds or functional fragments, the invention characterized in that the said functional fragment is chosen from the Fv, Fab, (Fab ') 2, Fab' fragments, scFv, scFv-Fc and diabodies, or any fragment whose half life was increased as pegylated fragments.
- Such functional fragments of antibodies according to the invention consist, for example, of fragments Fv, scFv (for simple chain), Fab, F (ab ') 2 , Fab', scFv-Fc or diabodies, or any fragment whose half-life time would have been increased by chemical modification, such as the addition of poly (alkylene) glycol such as poly (ethylene) glycol (“PEGylation") (PEGylated fragments called Fv-PEG, scFv-PEG, Fab -PEG, F (ab ') 2 -PEG or Fab'-PEG) ("PEG” according to the English nomenclature Poly (Ethylene) Glycol), or by incorporation into a liposome, microspheres or PLGA, said fragments exhibiting at least one of the characteristic CDRs according to the invention, and in particular, in that it is capable of generally exercising a very partial activity of the antibody from which it is derived.
- poly (alkylene) glycol
- said functional fragments will be constituted or will comprise a partial sequence of the heavy or light variable chain of the antibody of which they are derivatives, said partial sequence being sufficient to retain the same binding specificity as the antibody from which it is derived and a sufficient affinity, preferably at least equal to 1/100, more preferably at least 1/10 that of the antibody from which it is derived.
- Such a functional fragment will comprise at least 5 amino acids, preferably 10, 15, 25, 50 and 100 consecutive amino acids of the sequence of the antibody from which it is derived.
- these functional fragments will be fragments of the Fv, scFv, Fab, F (ab ') 2, F (ab'), scFv-Fc or diabodies type, which generally have the same binding specificity as the antibody for which they are present. are from.
- antibody fragments of the invention can be obtained from antibodies as previously described by methods such as digestion with enzymes, such as pepsin or papain and / or by cleavage of disulfide bridges. by chemical reduction.
- the antibody fragments included in the present invention may be obtained by genetic recombination techniques well known to those skilled in the art or by peptide synthesis using, for example, automatic peptide synthesizers such as than those provided by Applied Biosystems, etc.
- the present invention relates to a chimeric antibody, or one of its derivative compounds or functional fragments, according to the invention, characterized in that said antibody further comprises the constant regions of light chain and of heavy chain derived from an antibody of a mouse heterologous species, in particular from humans.
- the humanized antibody or one of its derivative compounds or functional fragments, is characterized in that the light chain and heavy chain constant regions derived from a human antibody are respectively the lambda region or kappa and gamma-1, gamma-2 or gamma-4.
- the invention relates to a first murine hybridoma capable of secreting a monoclonal antibody according to the present invention, in particular the hybridoma of murine origin as deposited at the National Microorganism Culture Center (CNCM) (Pasteur Institute). , Paris, France) on February 22, 2008 under number 1-3920.
- Said hybridoma was obtained by fusion of splenocytes of immunized Balb / c mice and Sp 20 Ag 14 myeloma cell lines.
- monoclonal called here 203B6, or one of its derivative compounds or functional fragments is secreted by said hybridoma deposited at the CNCM February 22, 2008 under the number 1-3920.
- the invention relates to a second murine hybridoma capable of secreting a monoclonal antibody according to the present invention, in particular the hybridoma of murine origin as deposited at the National Center for Culture of Microorganism (CNCM) (Institut Pasteur , Paris, France) on February 22, 2008 under number 1-3921.
- Said hybridoma was obtained by fusion of splenocytes from Balb / c immunized mice and Sp 20 Ag 14 myeloma cell lines.
- the monoclonal antibody referred to herein as 205H8, or one of its derivative compounds or functional fragments, is secreted by said hybridoma. filed with the CNCM on February 22, 2008 under the number 1-3921.
- the invention relates to a third murine hybridoma capable of secreting a monoclonal antibody according to the present invention, in particular the hybridoma of murine origin as deposited at the National Center for Microorganism Culture (CNCM) (Institut Pasteur , Paris, France) on February 21, 2008 under number 1-3918.
- Said hybridoma was obtained by fusion of splenocytes from Balb / c immunized mice and Sp 20 Ag 14 myeloma cell lines.
- the monoclonal antibody referred to herein as 211F3, or one of its derivative compounds or functional fragments, is secreted by said hybridoma. filed with the CNCM on February 21, 2008 under number 1-3918.
- the invention relates to a fourth murine hybridoma capable of secreting a monoclonal antibody according to the present invention, in particular the hybridoma of murine origin as deposited at the National Microorganism Culture Center (CNCM) ( Institut Pasteur, Paris, France) on February 21, 2008 under number 1-3919.
- Said hybridoma was obtained by fusion of Balb / c immunized mouse splenocytes and Sp 20 Ag 14 myeloma cell lines.
- the monoclonal antibody designated here 214B2, or one of its derivative compounds or functional fragments, is secreted by said hybridoma. filed with the CNCM on February 21, 2008 under number 1-3919.
- Table 2 groups the different amino acid sequences corresponding to the different antibodies according to the invention with the CDR sequences defined according to IMGT in bold and those defined according to Kabat in italics.
- Antibodies according to the present invention also include chimeric or humanized antibodies.
- chimeric antibody an antibody which contains a naturally occurring variable (light chain and heavy chain) derived from an antibody of a given species in association with the light chain and heavy chain constant regions of an antibody of a heterologous species to said given species.
- the antibodies or their chimeric-like fragments according to the invention can be prepared using genetic recombination techniques.
- the chimeric antibody may be made by cloning a recombinant DNA comprising a promoter and a sequence coding for the variable region of a non-human monoclonal antibody, in particular murine monoclonal antibody, according to the invention and a sequence coding for the constant region.
- human antibody A chimeric antibody of the invention encoded by such a recombinant gene will for example be a mouse-human chimera, the specificity of this antibody being determined by the variable region derived from murine DNA and its isotype determined by the constant region derived from the murine DNA. Human DNA.
- Verhoeyn et al. BioEssays, 8:74, 1988.
- humanized antibodies is meant an antibody which contains CDRs regions derived from an antibody of non-human origin, the other parts of the antibody molecule being derived from one (or more) human antibodies.
- some of the skeletal segment residues (referred to as FR) may be modified to maintain binding affinity (Jones et al., Nature, 321: 522-525, 1986; Verhoeyen et al., Science, 239: 1534-1536 1988, Riechmann et al., Nature 332: 323-327, 1988).
- the humanized antibodies according to the invention or their fragments may be prepared by techniques known to those skilled in the art (as for example those described in the documents Singer et al., J.
- Such humanized antibodies according to the invention are preferred for use in in vitro diagnostic methods, or in vivo prophylactic and / or therapeutic treatment.
- Other humanization techniques are also known to those skilled in the art, for example the "CDR Grafting" technique described by PDL which is the subject of patents EP 0 451 261, EP 0 682 040 and EP 0 939. 127, EP 0 566 647 or US 5,530,101, US 6,180,370, US 5,585,089 and US 5,693,761. It is also possible to mention US Pat. Nos. 5,639,641, 6,054,297, 5,886,152 and 5,877,293.
- the invention also relates to the humanized antibodies derived from the murine antibodies described above.
- the light chain and heavy chain constant regions derived from a human antibody are respectively the lambda or kappa region and gamma-1, gamma-2 or gamma-4.
- an additional feature of the antibody is to exhibit effector functions such as ADCC (according to the English nomenclature “Antibody Dependent Cellular Cytotoxicity”) and / or the CDC (according to the English nomenclature “Complement Depends Cytotoxicity”).
- the antibody that is the subject of the present invention is characterized by antibodies known to date in that it is capable of inhibiting the proliferation of tumor cells.
- the CD 151 protein belongs to the family of tetraspanins and, as such, comprises 2 extracellular domains EC1 (18 amino acids, sequence [40-57]) and EC2 (109 amino acids, sequence [113-221]), also called extracellular loops.
- the antibodies used are capable of binding to at least one epitope located in the extracellular domain.
- said antibody will bind at the EC1 and / or EC2 loops.
- EC2 extracellular loop 1
- EC2 EC2
- amino acids 40-57 and 113-221 respectively of the CD151 protein.
- the loop EC1 [40-57] comprises 18 amino acids and has a theoretical mass of 2002.2 Da.
- the EC2 loop [113-221] has a N-glycosylation site (Asn159 residue) and 6 Cysteine residues forming 3 disulfide bridges.
- a structural model of the EC2 loop of tetraspanins, and in particular of CD151, has been proposed from the three-dimensional structure of the EC2 loop of CD81 tetraspinanine (Seigneuret et al., 2001, J. Biol Chem 276, 40055- 40064). According to this model, tetraspanins have a common, relatively conserved framework consisting of 3 ⁇ -helices and a variable specific domain. For CD151, this framework would consist of the regions [113-157] and [209-221], and the variable domain of the region [158-208].
- variable domain of the EC2 loop would be more specifically involved in the specific interactions of CD151 with proteins of the family of integrins.
- the present invention is directed to the use of at least one anti-CD151 antibody, or a functional fragment thereof, capable of binding to an epitope of the EC2 region.
- the present invention relates to an isolated nucleic acid characterized in that it is selected from the following nucleic acids: a) a nucleic acid, DNA or RNA, encoding an antibody, or one of its derived compounds or functional fragments, as defined above; b) a nucleic acid complementary to a nucleic acid as defined above in a); c) a nucleic acid of at least 18 nucleotides capable of hybridizing under conditions of high stringency with at least one of the nucleic acid sequences SEQ ID No.
- Table 3 below groups the different nucleotide sequences relating to the antibodies according to the invention with the CDR sequences defined according to IMGT in bold and those defined according to Kabat in italics.
- nucleic acid nucleic or nucleic acid sequence, polynucleotide, oligonucleotide, polynucleotide sequence, nucleotide sequence, terms which will be used indifferently in the present description, is meant to designate a precise sequence of nucleotides, modified or otherwise, to define a fragment or a region of a nucleic acid, with or without unnatural nucleotides, and which may correspond to both a double-stranded DNA, a single-stranded DNA and transcripts of said DNAs.
- nucleotide sequences in their natural chromosomal environment i.e., in the natural state.
- sequences that have been isolated and / or purified that is to say that they have been taken directly or indirectly, for example by copy, their environment has been at least partially modified. It is thus also meant here to designate isolated nucleic acids obtained by genetic recombination by means of, for example, host cells or obtained by chemical synthesis.
- nucleic sequences having an identity percentage of at least 80%, preferably 85%, 90%, 95% and 98%, after optimal alignment with a sequence of preference are meant nucleic sequences having, relative to the reference nucleic sequence, certain modifications such as in particular a deletion, a truncation, an elongation, a chimeric fusion and / or a substitution, in particular punctual. These are preferably sequences whose sequences encode the same amino acid sequences as the reference sequence, this linked to the degeneracy of the genetic code, or complementary sequences that are likely to hybridize specifically with the sequences. reference preferably under conditions of high stringency especially as defined below.
- Hybridization under high stringency conditions means that the temperature and ionic strength conditions are chosen such that they allow the maintenance of hybridization between two complementary DNA fragments.
- conditions of high stringency of the hybridization step for the purpose of defining the polynucleotide fragments described above are advantageously as follows.
- DNA-DNA or DNA-RNA hybridization is carried out in two steps: (1) prehybridization at 42 ° C for 3 hours in phosphate buffer (20 mM, pH 7.5) containing 5 x SSC (1 x SSC corresponds to one solution 0.15 M NaCl + 0.015 M sodium citrate), 50% formamide, 7% sodium dodecyl sulfate (SDS), 10 x Denhardt's, 5% dextran sulfate and 1% salmon sperm DNA; (2) hybridization proper for 20 hours at a temperature dependent on the size of the probe (ie: 42 ° C, for a probe size> 100 nucleotides) followed by 2 washes of 20 minutes at 20 0 C in 2 x SSC + 2% SDS, 1 wash for 20 minutes at 20 ° C.
- the invention also relates to a vector comprising a nucleic acid according to the present invention.
- the invention particularly relates to the cloning and / or expression vectors which contain a nucleotide sequence according to the invention.
- the vectors according to the invention preferably comprise elements which allow the expression and / or the secretion of the nucleotide sequences in a specific host cell.
- the vector must then include a promoter, translation initiation and termination signals, as well as appropriate transcriptional regulatory regions. It must be able to be stably maintained in the host cell and may possibly have particular signals that specify the secretion of the translated protein. These different elements are chosen and optimized by those skilled in the art depending on the cellular host used.
- nucleotide sequences according to the invention can be inserted into vectors with autonomous replication within the chosen host, or be integrative vectors of the chosen host.
- vectors are prepared by methods commonly used by those skilled in the art, and the resulting clones can be introduced into a suitable host by standard methods, such as lipofection, electroporation, heat shock, or chemical methods. .
- the vectors according to the invention are for example vectors of plasmid or viral origin. They are useful for transforming host cells in order to clone or express the nucleotide sequences according to the invention.
- the invention also includes host cells transformed with or comprising a vector according to the invention.
- the cellular host may be chosen from prokaryotic or eukaryotic systems, for example bacterial cells, but also yeast cells or animal cells, in particular mammalian cells. Insect cells or plant cells can also be used.
- the invention also relates to animals, except humans, which comprise a transformed cell according to the invention.
- the subject of the invention is a method for producing an antibody, or one of its functional fragments according to the invention, characterized in that it comprises the following steps: a) culturing in a suitable medium and culture conditions of a host cell according to the invention; and b) recovering said antibodies, or a functional fragment thereof, thereby produced from the culture medium or said cultured cells.
- the cells transformed according to the invention can be used in processes for preparing recombinant polypeptides according to the invention.
- the methods for preparing a polypeptide according to the invention in recombinant form characterized in that they implement a vector and / or a cell transformed with a vector according to the invention are themselves included in the present invention.
- a cell transformed with a vector according to the invention is cultured under conditions which allow the expression of said polypeptide and said recombinant peptide is recovered.
- the cellular host may be selected from prokaryotic or eukaryotic systems.
- a vector according to the invention carrying such a sequence can therefore be advantageously used for the production of recombinant proteins, intended to be secreted. Indeed, the purification of these recombinant proteins of interest will be facilitated by the fact that they are present in the supernatant of the cell culture rather than inside the host cells.
- the polypeptides according to the invention can also be prepared by chemical synthesis. Such a preparation method is also an object of the invention.
- the antibodies, or one of their derivative compounds or functional fragments, obtainable by a process according to the invention are also included in the present invention.
- the present invention relates to an antibody as described above, characterized in that it is, in addition, bispecific, that is to say capable to bind specifically to a human protein or a human receptor other than CD151.
- Bispecific or bifunctional antibodies are a second generation of monoclonal antibodies in which two different variable regions are combined in the same molecule (Hollinger and Bohlen 1999 Cancer and Metastasis Rev. 18: 411-419). Their utility has been demonstrated both in the field of diagnosis and in the field of therapy by their ability to recruit new effector functions or to target several molecules on the surface of tumor cells.
- These antibodies can be obtained by chemical methods (Glennie MJ et al., 1987 J. Immunol 139, 2367-2375, Repp R. et al., 1995 J. Hemat 377-382) or somatic (Staerz UD and Bevan MJ.
- bispecific antibodies can be constructed as whole IgG, as bispecific Fab'2, as Fab'PEG or as diabodies or as bispecific scFv but also as a bispecific tetravalent antibody where two binding sites are present for each antigen targeted (Park et al., Mol Mol., Immunol 37 (18): 1123-30) or fragments thereof as described above.
- bispecific antibodies In addition to the economic advantage that the production and administration of a bispecific antibody is less expensive than the production of two specific antibodies, the use of such bispecific antibodies has the advantage of reducing the toxicity of the treatment. Indeed, the use of a bispecific antibody makes it possible to reduce the overall quantity of circulating antibodies and, consequently, the possible toxicity.
- the bispecific antibody is a divalent or tetravalent antibody.
- the present invention relates to the antibody, or one of its derivative compounds or functional fragments, as described above as a drug.
- the invention also relates to a pharmaceutical composition comprising as active principle a compound consisting of an antibody, or one of its derivative compounds or functional fragments, according to the invention.
- said antibody is supplemented with an excipient and / or a pharmaceutically acceptable vehicle.
- the present invention also relates to a pharmaceutical composition as described above which further comprises, as a combination product for simultaneous, separate or spread use, at least one other antibody, a cytotoxic / cytostatic agent, a cellular toxin or a radioelement.
- the composition according to the invention considerably increases the effectiveness of cancer treatment.
- the therapeutic effect of the antibody according to the invention is unexpectedly potentiated by the administration of a cytotoxic agent.
- Another major subsequent advantage produced by a composition according to the invention concerns the possibility of using lower effective doses of active ingredient, which makes it possible to avoid or reduce the risks of occurrence of side effects, in particular the effect of the cytotoxic agent.
- this composition according to the invention would make it possible to achieve the desired therapeutic effect more rapidly.
- Anti-cancer therapeutics or "cytotoxic agents” means a substance that, when administered to a patient, treats or prevents the development of cancer in the patient.
- cytotoxic agents By way of non-limiting example for such agents, mention may be made of “alkylating” agents, antimetabolites, anti-tumor antibiotics, mitotic inhibitors, chromatin function inhibitors, anti-angiogenesis agents, estrogen, anti-androgens or immunomodulators.
- alkylating agents antimetabolites, anti-tumor antibiotics, mitotic inhibitors, chromatin function inhibitors, anti-angiogenesis agents, estrogen, anti-androgens or immunomodulators.
- Such agents are, for example, cited in VIDAL, on the page dedicated to the compounds attached to oncology and hematology column "Cytotoxic", these cytotoxic compounds cited with reference to this document are cited here as preferred cytotoxic agents.
- Alkylating agents refers to any substance that can covalently couple or alkylate any molecule, preferentially a nucleic acid (eg, DNA), within a cell.
- nitrogen mustards such as mechlorethamine, chlorambucil, melphalan, hydrochloride, pipobroman, prednimustine, disodium phosphate or estramustine; oxazaphosphorines such as cyclophosphamide, altretamine, trofosfamide, sulfofosfamide or ifosfamide; aziridines or ethylenimines such as thiotepa, triethyleneamine or altetramine; nitrosoureas such as carmustine, streptozocin, fotemustine or lomustine; alkyl sulfonates such as busulfan, treosulfan or improvosulfan; triazenes such as
- Antimetabolites refers to substances that block growth and / or cell metabolism by interfering with certain activities, usually DNA synthesis.
- antimetabolite mention may be made of methotrexate, 5-fluorouracil, floxuridine, 5-fluorodeoxyuridine, capecitabine, cytarabine, fludarabine, cytosine arabinoside, 6-mercaptopurine (6-MP), 6-thioguanine (6- TG), chlorodeoxyadenosine, 5-azacytidine, gemcitabine, cladribine, deoxycoformycin and pentostatin.
- Anti-tumor antibiotics refers to compounds that can prevent or inhibit the synthesis of DNA, RNA and / or proteins.
- anti-tumor antibiotics examples include doxorubicin, daunorubicin, idarubicin valrubicin, mitoxantrone, dactinomycin, mithramycin, plicamycin, mitomycin C, bleomycin, and procarbazine.
- Mitotic inhibitors prevent normal progression of the cell cycle and mitosis.
- inhibitors of microtubules or "taxoids” such as paclitaxel and docetaxel are capable of inhibiting mitosis.
- Vinca alkaloids such as vinblsatin, vincristine, vindesine and vinorelbine are also able to inhibit mitosis.
- Chroisomerase inhibitors refer to substances that inhibit the normal function of chromatin-forming proteins such as topoisomerases I and IL.
- examples of such inhibitors include, for topoisomerase I, camptothecin and its derivatives such as irinotecan or topotecan and, for topoisomerase II, etoposide, etposide phosphate and teniposide.
- Anti-angiogenesis agents refer to any drug, compound, substance or agent that inhibits the growth of blood vessels.
- anti-angiogenesis agents include, without limitation, razoxin, marimastat, batimastat, prinomastat, tanomastat, ilomastat, CGS-27023A, halofuginone, COL-3, neovastat, BMS-275291, thalidomide, CDC 501, DMXAA, L-651582, squalamine, endostatin, SU5416, SU6668, interferon-alpha, EMD121974, interleukin-12, IM862, angiostatin and vitaxine.
- Anti-estrogen or “anti-estrogenic agents” refers to any substance that decreases, antagonizes or inhibits the action of estrogen. Examples of such agents are tamoxifen, toremifene, raloxifene, droloxifene, iodoxyfen, anastrozole, letrozole, and exemestane.
- Anti-androgens or “anti-androgenic agents” refer to any substance that reduces, antagonizes or inhibits the action of an androgen.
- anti-androgens are flutamide, nilutamide, bicalutamide, sprironolactone, cyproterone acetate, fmasteride and cimitidine.
- Immunomodulators are substances that stimulate the immune system.
- immunomodulators include interferons, interleukins such as aldesleukin, OCT-43, denileukin diflitox or interleukin-2, tumor necrosis factors such as tasonermin, or other types of immunomodulators such as lentinan, sizofran, roquinimex, pidotimod, pegademase, thymopentine, poly I: C, or levamisole in combination with 5-fluorouracil.
- interferons interleukins such as aldesleukin, OCT-43, denileukin diflitox or interleukin-2
- tumor necrosis factors such as tasonermin
- other types of immunomodulators such as lentinan, sizofran, roquinimex, pidotimod, pegademase, thymopentine, poly I: C, or levamisole
- said composition as a combination product according to the invention is characterized in that said cytotoxic agent is chemically coupled to said antibody for simultaneous use.
- said composition according to the invention is characterized in that said cytotoxic / cyto static agent is chosen among the spindle inhibitory or stabilizing agents, preferably vinorelbine and / or vinflunine and / or vincristine.
- the invention is, in another aspect, relating to a composition characterized in that at least one of said antibodies, or one of their derivative compound or functional fragment, is conjugated with a cellular toxin and / or a radioissement
- said toxin or said radioelement is capable of preventing growth or proliferation of the tumor cell, in particular completely inactivating said tumor cell.
- said toxin is an enterobacterial toxin, especially exotoxin A of Pseudomonas.
- the radioelements preferably conjugated to the antibody used in therapy are radioisotopes that emit gamma rays and preferably iodine 131 , yttrium 90 , gold 199 , palladium 100 , copper 67 , bismuth 217 and antimony 211 . Radioisotopes that emit beta and alpha rays can also be used in therapy.
- toxin or radioelement conjugated to at least one antibody, or one of their functional fragment is meant any means for linking said toxin or said radioelement to said at least one antibody, in particular by covalent coupling between the two compounds, with or without introduction of binding molecule.
- benzoquinone carbodiimide and more particularly EDC (1-ethyl-3- [3] may be mentioned in particular.
- bridging agents having one or more groups, having one or more phenylase groups, reacting with ultraviolet (UV) and most preferably N - [(4- (azidosalicylamino) butyl] -3 '- (2'-pyridyldithio) ) - propionamide (APDP), N-succinimid-3-yl (2-pyridyldithio) propionate (SPDP) and 6-hydrazino-nicotinamide (HYNIC).
- UV ultraviolet
- APDP N-succinimid-3-yl (2-pyridyldithio) propionate
- HYNIC 6-hydrazino-nicotinamide
- Another form of coupling especially for radioelements, may be the use of a bifunctional ion chelator.
- chelates derived from EDTA ethylenediaminetetraacetic acid
- DTPA diethylenetriaminepentaacetic acid
- DTPA and its derivatives can be substituted by different groups on the carbon chain so as to increase the stability and rigidity of the ligand-metal complex (Krejcarek et al (1977), Brechbiel et al (1991), Gansow (1991) US Patent 4,831,175).
- DTPA diethylenetriaminepentaacetic acid
- its derivatives which has been widely used in medicine and biology for a long time either in its free form or in the form of a complex with a metal ion, has the remarkable characteristic of form stable chelates with metal ions and be coupled to proteins of therapeutic or diagnostic interest as antibodies for the development of radioimmunoconjugates in cancer therapy (Meases et al., (1984), Gansow et al. 1990)).
- said at least one antibody forming said conjugate according to the invention is chosen from among its functional fragments, in particular fragments having their Fc component amputated, such as scFv fragments.
- the present invention further comprises the use of the composition according to the invention for the preparation of a medicament for the prevention or treatment of cancer.
- the present invention also relates to the use of an antibody, or one of its derived compounds or functional fragments, preferably humanized, and / or a composition according to the invention for the preparation of a medicinal product intended for to inhibit the proliferation of tumor cells.
- the subject of the present invention is the use of an antibody, or one of its derivative compounds or fragments functional, preferably humanized, and / or a composition according to the invention, for the preparation of a medicament for the prevention or treatment of cancer
- prostate cancer Of the cancers that can be prevented and / or treated, prostate cancer, osteosarcomas, lung cancer, breast cancer, endometrial cancer, colon cancer, multiple myeloma or ovarian cancer, pancreatic cancer or any other cancer.
- said cancer is a cancer selected from prostate cancer, lung cancer, colon cancer and / or pancreatic cancer.
- the present invention relates to the use of the antibody according to the invention in a diagnostic method, preferably in vitro, diseases related to a CD151 expression level. More particularly, the invention relates to a method for the in vitro diagnosis of diseases exhibiting overexpression or under-expression of the CD151 protein from a biological sample whose abnormal presence of CD151 protein is suspected, said method consisting in contacting said biological sample with an antibody according to the invention, said antibody possibly being labeled.
- said diseases linked to the CD 151 protein in said diagnostic method will be cancers.
- the antibody, or a functional fragment thereof may be in the form of an immunoconjugate or labeled antibody to provide a detectable and / or quantifiable signal.
- the labeled antibodies according to the invention or their functional fragments include, for example, so-called immunoconjugated antibodies which may be conjugated for example with enzymes such as peroxidase, alkaline phosphatase, ⁇ -D-galactosidase, glucose oxidase, glucose amylase, carbonic anhydrase, acetylcholinesterase, lysozyme, malate dehydrogenase or glucose-6 phosphate dehydrogenase or by a molecule such as biotin, digoxigenin or 5-bromodeoxyuridine.
- enzymes such as peroxidase, alkaline phosphatase, ⁇ -D-galactosidase, glucose oxidase, glucose amylase, carbonic anhydrase, acetylcholinesterase, lysozyme, malate dehydrogenase or glucose-6 phosphate dehydrogenase or by a molecule such as biotin, digoxi
- Fluorescent markers may also be conjugated to the antibodies or their functional fragments according to the invention and include, in particular, fluorescein and its derivatives, fluorochrome, rhodamine and its derivatives, GFP (GFP for "Green Fluorescent Protein”), dansyl, umbelliferone etc.
- fluorescein and its derivatives include fluorochrome, rhodamine and its derivatives, GFP (GFP for "Green Fluorescent Protein"
- dansyl dansyl
- umbelliferone etc.
- the antibodies of the invention or their functional fragments can be prepared by methods known to those skilled in the art.
- Conjugates having fluorescein labels may be prepared by reaction with isothiocyanate.
- conjugates may also include chemiluminescent markers such as luminol and dioxetanes, bioluminescent markers such as luciferase and luciferin, or radioactive labels such as iodine 123 , iodine 125 , iodine 126 , iodine 133 , bromine 77 , technetium 99m , indium 111 , indium 113m , gallium 67 , gallium 68 , ruthenium 95 , ruthenium 97 , ruthenium 103 , ruthenium 105 , mercury 107 , mercury 203 , rhenium 99m , rhenium 101 , rhenium 105 , scandium 47 , tellurium 121m , tellurium 122m , tellurium 125m , thulium 165 , thulium 167 , thulium 168 , fluorine 18 , yttrium
- the subject of the invention is also the use of an antibody according to the invention, for the preparation of a medicinal product intended for the specific targeting of a logically active organic compound to cells expressing or overexpressing the CD 151 protein.
- biologically active compound is meant here any compound capable of modulating, in particular of inhibiting, cell activity, in particular their growth, proliferation, transcription or translation of genes.
- the subject of the invention is also an in vivo diagnostic reagent comprising an antibody according to the invention, or one of its functional fragments, preferably labeled, in particular radiolabelled, and its use in medical imaging, in particular for the detection of cancer related to the expression or overexpression by a cell of the CD151 protein.
- the invention also relates to a composition as a combination product or an anti-CD151 / toxin or radioelement conjugate, according to the invention, as a medicament.
- composition as a combination product or said conjugate according to the invention will be supplemented with an excipient and / or a pharmaceutically acceptable vehicle.
- the term "pharmaceutically acceptable carrier” is intended to denote a compound or combination of compounds used in a pharmaceutical composition that does not cause side reactions and that makes it possible, for example, to facilitate the administration of the active compound or compounds. increase its life and / or effectiveness in the body, increase its solubility in solution or improve its conservation.
- these compounds will be administered systemically, in particular intravenously, intramuscularly, intradermally, intraperitoneally or subcutaneously, or orally. More preferably, the composition comprising the antibodies according to the invention will be administered several times, spread over time.
- dosages and optimal dosage forms can be determined according to the criteria generally taken into account in the establishment of a treatment adapted to a patient such as the age or the body weight of the patient, the severity of his general condition, tolerance to treatment and side effects noted.
- the invention thus relates to the use of an antibody, or a functional fragment thereof, for the preparation of a medicament for the specific targeting of a bio-logically active compound to cells expressing or overexpressing CD151.
- FIG. 1 shows the nucleotide and protein sequences of the CD151 protein, sequences on which are highlighted the EC1 and EC2 loops.
- FIG. 2 is a diagram illustrating the structure of the tetraspanins to which the CD151 protein belongs, and more particularly the two extra-cellular loops EC1 and EC2.
- FIG. 3 shows the respective sequences of the heavy and light chains of the antibody 203B6 according to the invention.
- the CDRs defined according to the IMGT system appear underlined and in bold while the CDRs defined according to Kabat appear framed.
- FIG. 4 shows the respective sequences of the heavy and light chains of the antibody 205H8 according to the invention.
- the CDRs defined according to the IMGT system appear underlined and in bold while the CDRs defined according to Kabat appear framed.
- FIG. 5 shows the respective sequences of the heavy and light chains of the 211F3 antibody according to the invention.
- the CDRs defined according to the IMGT system appear underlined and in bold while the CDRs defined according to Kabat appear framed.
- FIG. 6 shows the respective sequences of the heavy and light chains of the antibody 214B2 according to the invention.
- the CDRs defined according to the IMGT system appear underlined and in bold while the CDRs defined according to Kabat appear framed.
- Figure 7 illustrates the expression of the CD151 molecule in patients with prostate cancer.
- Each letter corresponds to the study of a patient and for each patient the upper panel corresponds to the normal tissue adjacent to the tumor and the lower panel corresponds to the tumor tissue.
- Figure 8 illustrates the expression of the CD151 molecule in patients with lung cancer.
- Each letter corresponds to the study of a patient and for each patient the upper panel corresponds to the normal tissue adjacent to the tumor and the lower panel corresponds to the tumor tissue.
- Figure 9 shows the flow cytometry analysis of the recognition of CD151 by the antibody 203B6 on the surface of NIH 3T3-CD151, PC3 and A549 cells.
- Figure 10 shows flow cytometric analysis of CD151 recognition by antibody 205H8 on the surface of NIH 3T3-CD151, PC3 and A549 cells.
- Figure 11 shows the flow cytometry analysis of the recognition of CD151 by the 211F3 antibody on the surface of NIH 3T3-CD151, PC3 and A549 cells.
- Figure 12 shows the flow cytometry analysis of the recognition of
- Figure 13 shows the results of the evaluation of the specificity of antibodies 203B6, 205H8, 211F3 and 214B2 by western blot.
- Figure 14 illustrates the anti-tumor activity of anti-CD151 monoclonal antibodies in the PC3 prostate tumor xenograft model. Swiss mice
- the tumor volume is evaluated by the formula ⁇ / 6 x Length x width x thickness.
- Figure 15 shows the analysis of iodine 125-labeled antibodies 203B6 and 214B2 with (A) Autoradiography after SDS-PAGE electrophoresis under reducing conditions, and (B) Analysis by molecular sieve chromatography.
- FIG. 16 illustrates the study of the binding of the radiolabeled antibody 203B6 on PC3 cells: Determination of the equilibrium affinity constant with (A) saturation curve and (B) Scatchard plot.
- FIG. 17 illustrates the study of the binding of the radiolabeled antibody 214B2 on PC3 cells: Determination of the equilibrium affinity constant with (A) saturation curve and (B) Scatchard plot.
- Figure 18 shows the effect of anti-CD151 antibodies on platelet functions with (A) Platelet Aggregation and (B) Platelet Activation (Serotonin Release).
- Figure 19 shows the effect of anti-CD151 antibodies on in vivo tumor growth of NCI-H441 cells.
- Figure 20 illustrates phenotype A) and differentiation markers B) of THP-I cells cultured in the absence or presence of LDCs.
- the 9G4 antibody is used as a control isotype and LPS as a positive activation control.
- Figure 21 shows the effect of antibodies 241B2 and 203 B6 on antigen presentation.
- the expression of the CD151 protein has been investigated by immunohistochemistry (IHC) in human tissue samples from patients with prostate cancer or lung cancer. For these patients, normal tissue slides adjacent to the tumor were available and were therefore included to calibrate the level of expression in tumor versus normal tissues.
- IHC immunohistochemistry
- a murine IgG1 control isotype antibody (DakoCytomation, Ref X0931) is used as a negative test of experience. Revelation of the labeling is done with the Envision Dual Link Disclosure System (DakoCytomation, Ref K4061) and the reference of DAB, peroxidase substrate is S3309 from DakoCytomation.
- mice were immunized subcutaneously with 20 ⁇ 10 6 NIH 3T3 cells expressing human CD151 on their surface, cells generated by transfection with the CD151 gene.
- the first immunization was carried out in the presence of Freund's complete adjuvant and then the following 2 in the presence of incomplete Freund's adjuvant.
- a final booster injection of 10 ⁇ 10 6 NIH 3T3-CD151 cells was carried out intraperitoneally.
- Spleen cells from a mouse were then fused to SP2 / 0-Agl4 myeloma cells in a 1: 1 ratio by the techniques conventionally described by Kohler and Milstein.
- the antibodies secreted in the hybridoma supernatants resulting from the fusion were then screened for their ability to recognize the recombinant extracellular EC2 loop of CD151 by ELISA, and CD151 expressed on the surface of the PC3 prostate cancer human tumor cell line by cytometry. of flow.
- 96-well plates are sensitized for 1 night at + 4 ° C. with the recombinant EC2 extracellular loop at 5 ⁇ g / ml in PBS. After washing with PBS, the wells are saturated with 0.5% gelatin solution in PBS for 1 h at 37 ° C and then washed again with PBS. The culture supernatants of the hybridomas are evaluated without dilution (incubation for 1 h at 37 ° C.).
- Bound antibodies on immobilized EC2 loop are detected by successive incubation with anti-IgG goat polyclonal antibody conjugated mouse peroxidase (Jackson / USA, dilution of l / 5000 th, 1 h at 37 ° C) and then with a peroxidase substrate (TMB, Interchim / France, 10 min at room temperature). The reaction is stopped by addition of 1M sulfuric acid and the optical density (OD) is measured at 450 nm. The flow cytometric analyzes are carried out on 96-well plates. Undiluted hybridoma supernatants are added to 100,000 PC3 cells previously introduced into the wells.
- FIGS. 9, 10, 11 and 12 show the flow cytometry recognition profiles of the NIH 3T3-CD151, PC3 and A549 cells obtained for the antibodies 203B6, 205H8, 211F3 and 214B2. These profiles are comparable to those obtained with the anti-CD151 antibody 50-6 (ATCC CRL-2696) and demonstrate the specificity of these antibodies for CD151.
- the hybridomas were then deposited at the CNCM, National Collection of Cultures of Microorganisms, Pasteur Institute, 25 Rue du Dondel Roux, 75724 PARIS Cedex 15.
- the specificity of the antibodies 203B6, 205H8, 211F3 and 214B2 was evaluated by Western blot.
- the EC2 loop of CD151 was cloned into the pET22b vector for expression in soluble form in the periplasm of Escherichia coli.
- the protein produced comprises amino acids 130 to 221 of the human CD151 peptide sequence, to which was added a Poly-His tail at the C-terminal position to facilitate purification.
- the recombinant EC2 protein was purified by immobilized metal affinity chromatography (IMAC) on Chelating Sepharose HP support (GE Healthcare).
- the antibodies 203B6, 205H8, 211F3 and 214B2 recognize the complete CD151 protein and the recombinant EC2 loop by western blot ( Figure 13).
- the 205H8 antibody has lower reactivity for the complete CD151 protein under the assay conditions.
- the signal obtained for the antibody 205H8 proves to be weaker. This difference is not observed for the recognition of the recombinant EC2 protein.
- Example 4 Antitumor activity of anti-CD151 antibodies in the PC3 xenograft model Materials and methods
- PC3 line is an ATCC-derived androgen-independent prostate line grown in F12K medium (Invitrogen Corporation, Scotland, United Kingdom), 10% FCS (Invitrogen Corporation).
- F12K medium Invitrogen Corporation, Scotland, United Kingdom
- FCS Invitrogen Corporation
- the cells are divided two days before the transplant so that they are in the exponential growth phase.
- Five million PC3 cells are grafted subcutaneously into six weeks old Swiss Nude male mice. Five days after implantation, the tumor volumes are measured, the mice are randomized to constitute non-statistically different batches and the treatment is initiated by the i.p. injection. a dose of 2 mg of antibody per mouse.
- the animals are then treated twice a week with a dose of 1 mg of antibody per mouse and the tumors measured twice a week.
- Animals in the control group receive an injection of PBS.
- the tumor volumes are calculated according to the formula ⁇ / 6 x length x width x height. Statistical analysis is performed at each measurement using a Mann-Whitney test.
- results presented in FIG. 14 show that the antibodies 203B6, 214B2 and 211F3 indicate significant inhibitions of the in vivo tumor growth of the PC3 cells.
- Antibody 205H8 although inhibitory, shows a more modest antitumor activity in this model.
- the anti-CD151 antibodies 203B6 and 214B2 were firstly labeled with 125 I by the method using chloramine T. After labeling, the antibodies were purified by molecular sieve chromatography on a PD-10 column (GE Healthcare) to eliminate free iodine 125. The radiochemical purity of the radiolabelled antibodies was determined, after purification, by thin layer chromatography of silica, analytical molecular sieve chromatography on Superdex 200 column (GE Healthcare) and by autoradiography after SDS-PAGE electrophoresis.
- Figure 15 shows that the heavy ( ⁇ 50 kDa) and light ( ⁇ 25 kDa) chains of the 2 antibodies are labeled equally (15A) and confirm the absence of free iodine 125 after purification (15B).
- the specific activity of radiolabelled antibodies was determined using a gamma counter (Wallace Wizard 1480, Perkin Elmer).
- the affinity of the 2 radiolabeled antibodies for their CD151 target at the cell surface was then measured on PC3 prostate cancer cells.
- the dissociation constant K D of the antibodies was determined by the Scatchard method.
- PC3 cells (1.10 6 cells / 50 ⁇ l of PBS buffer containing 0.5% BSA) were incubated in the presence of increasing concentrations of the radiolabelled antibodies of between 6 ng / ml and 27 ⁇ g / ml for 1 h at 4 ° C. (final volume: 150 ⁇ l). After incubation, the total radioactivity associated with the cells (fixed radiolabelled antibody) was measured using a gamma counter. Nonspecific binding was determined for each concentration tested in the presence of an excess of non-radiolabelled antibody (x 100).
- Aggregation is an essential function of platelets during the blood coagulation process, in response to vascular injury, for example. This phenomenon is usually preceded by platelet activation, which results in the exposure of certain proteins to their surface and the secretion of the contents of their storage granules (alpha granules and dense granules). Since CD141 is expressed on platelets (Goschnick and Jackson, 2007, Mini-Rev Med Chem 7: 1236-1247), the effect of anti-CD151 antibodies on platelet functions was evaluated in vitro using platelet aggregation and activation assays.
- Activation of platelets was measured on the PPP of 10 donors by measuring the secretion of serotonin (5-hydroxytryptamine or 5-HT) by HPLC with detection fluorimetric.
- the effect of antibodies on platelet functions was determined for a concentration of 10 ⁇ g / ml.
- PM6 / 248 anti-CD41, integrin (Xm,) and 14A2.H1 (anti-CD151) as positive control antibodies
- 9G4 isotype control (IgG1).
- Different compounds tested are estimated for each donor as a percentage of the thrombin-induced aggregation taken as a reference (100%)
- Figure 18A shows the average aggregation values obtained for each test compound.
- PM6 / 248 antibodies less potent inducing agents than thrombin, lead to comparable aggregations of 30.1 ⁇ 10.5% and 47.6 ⁇ 12.7% respectively.
- the differences obtained are typically observed in hemostasis and result from inter-individual variability
- the 9G4 antibody does not induce platelet aggregation: this antibody makes it possible to define a detection threshold (5 nM)
- These 2 antibodies induce a lower aggregation than that of the control antibody 14A2.H1.
- Figure 18B shows the average serotonin values released by platelets (in nM) in the presence of the various compounds tested. The results obtained for this platelet activation test are comparable to those described previously.
- the 9G4 antibody does not induce platelet activation whereas thrombin causes a very strong release of serotonin (-430 nM).
- the amounts of serotonin released are lower in the presence of ADP, PM6 / 248 and 14A2.H1 (mean values of 72.6 nM, 34.6 nM and 21.6 nM respectively), but these compounds can be considered as platelet activators.
- the release of serotonin induced by the anti-CD151 antibodies 203B6 and 214B2 is very weak: in fact, the average values determined for these 2 antibodies are respectively 2.4 and 3.6 times weaker than that of the antibody control anti- CD151 14A2.H1.
- the 2 tests confirm that the anti-integrin control antibodies dm, PM6 / 248 and anti-CD151 14A2.H1 are capable of inducing platelet aggregation in vitro and inducing their activation (Roberts et al., 1995). Br. J. Haematol 89: 853-860; Hornby et al., 1991, Br. J. Haematol 79: 277-285). Unlike the 14A2.H1 antibody, the anti-CD151 antibodies 203B6 and 214B2 induce levels aggregation and platelet activation very weak and insignificant in human clinical.
- the NCI-H441 cells from the ATCC are cultured in RPMI 1640 medium supplemented with 10% FCS and 1% L-Glutamine. The cells are divided two days before the transplant so as to obtain cells in the exponential phase of growth on the day of the transplant.
- Ten million NCI-H441 cells are implanted subcutaneously in athymic Nude mice. Five days after the transplant, the tumors are measurable and the animals bearing tumors of comparable size are divided into groups of 6.
- the mice are treated i.p. with an antibody dose of 2 mg / mouse and then twice a week with a dose of 1 mg of antibody per mouse.
- the tumor volume is evaluated twice a week and calculated using the formula: ⁇ / 6 X length X width X height. The specific analysis of the data is performed at each measurement using a Mann-Whitney test.
- TNF ⁇ being a marker of the activation of macrophages
- TNF ⁇ concentration of culture supernatant of THP-I cells, cultured in the presence or absence of the antibodies to be tested was evaluated by ELISA.
- the THP-I cell lines is a monocytic leukemia line capable of differentiating into a macrophage line in the presence of PMA-type agents or 25-Dihydroxy vitamin D3. This activation process is accompanied by a very significant secretion of TNF ⁇ .
- THP-I cells are seeded in 6-well plates in presence or absence of PMA (250 nM) for 72 hours. After this incubation time, part of the cells are recovered in order to control the differentiation in the presence of PMA by microscopic observation or by FACS analysis of the CD14 / CDl1b markers.
- the antibodies to be tested (241B2 and 203B6) are added to the other wells for an additional 24 hours.
- the 9G4 antibody is used under the same conditions as control isotype.
- LPS (1 ⁇ g / ml) is used as a positive control of the experiment. The culture supernatants are then removed, centrifuged and stored at -80 ° C. before being assayed for their TNF ⁇ content by an ELISA test.
- FIG. 20A The results presented in FIG. 20A show that, in the absence of PMA, the THP-I cells are non-adherent, refractive and round. In the presence of PMA, these cells become adherent which clearly signifies a differentiation of monocytes into macrophages.
- FACS analyzes FIG. 20B show that, in the absence of PMA, less than 20% of THP-I cells express CD1 Ib or CD14.
- the PMA-induced cell differentiation is, as expected, associated with a significant increase in CD1 Ib-expressing cells from 9 to 65%.
- the expression of CD14 is also significantly increased with a number of positive cells increasing from 20 to 37%.
- Figure 2OC shows that no TNF ⁇ production is observed when THP-I cells are cultured in the absence of differentiation inducer. On the other hand, a very significant production (100 to 200 ⁇ g / ml) of TNF ⁇ is observed.
- the LPS introduced as a positive control of experiment also causes the secretion of a high level of cytokine in this, in the presence or absence of differentiation inducer, presence of PMA. None of the anti-CD151 antibodies evaluated leads to secretions of TNF ⁇ whatever the state of cellular differentiation.
- Example 9 Evaluation of two anti-CD151 antibodies on antigen presentation function. Since the CD 151 molecule is widely expressed on antigen presenting cells, a study was conducted to verify the potential impact of a CD151-directed therapy on antigen presentation function. The experiment carried out consists of monitoring the specific lymphocyte proliferation of the TT antigen when the tetanus toxoid protein is introduced on PBMCs. In this conformation, the protein must be processed by the antigen presenting cells and presented by these same cells in association with the MHC molecules. This antigenic presentation to CD4 + or CD8 + lymphocytes will lead to proliferation of antigen-specific clones. Any impact on the antigenic presentation will therefore result in a modulation of lymphocyte proliferation.
- PBMCs are isolated by centrifugation of Ficoll gradient whole blood. The cells washed twice with PBS are counted and resuspended at a rate of 0.25 ⁇ 10 6 cells / ml in RPMI 1640 medium supplemented with 10% FCS and 1% glutamine. One hundred micro liters of the cell suspension are inoculated into each well of a 96-well plate in the presence of the antigen and the antibodies to be tested. The antibodies 214B2 and 203B6 are evaluated at the final concentration of 10 ⁇ g / ml. The 9G4 antibody is introduced at the same final concentration as isotype control experiment.
- PHA (2.5 ⁇ g / ml in the well), a polyclonal activator of lymphocyte proliferation, is used as a positive proliferation control.
- Tetanus toxoid (TT) was selected as test antigen and is used at the final concentration of 100 ⁇ g / ml.
- the plates are incubated at 37 ° C. for 96 hours at the end of which 0.25 ⁇ Ci of H-thymidine are added to each well for an additional 24 hours. After incubation the cells are collected on filters and the radioactivity evaluated.
- the results presented in FIG. 21A show that, as expected, the PHA used as a positive control leads to a very high lymphocyte proliferation. Signal strength is consistent with polyclonal activation of cell proliferation.
- the 9G4 introduced into the experiment as isotype control has no impact on the proliferation of cells in the absence or presence of PHA.
- the two anti-CD151 antibodies tested in no way modify the proliferation.
- TT antigen induces a significant proliferation of part of the lymphocyte population ( Figure 21B). This proliferation is not impacted in the presence of 9G4 or the two anti-CD151 antibodies tested indicating that under the conditions of the experiment the antigenic presentation is not affected by the compounds tested.
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Medicinal Chemistry (AREA)
- Organic Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Immunology (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Engineering & Computer Science (AREA)
- Biophysics (AREA)
- Biochemistry (AREA)
- Genetics & Genomics (AREA)
- Molecular Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Epidemiology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Cell Biology (AREA)
- Biomedical Technology (AREA)
- Oncology (AREA)
- Microbiology (AREA)
- Mycology (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
Abstract
Description
Claims
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| FR0801985A FR2929946B1 (fr) | 2008-04-11 | 2008-04-11 | Nouveaux anticorps anti-cd151 et leur utilisation pour le traitement du cancer |
| PCT/FR2009/050612 WO2009136070A1 (fr) | 2008-04-11 | 2009-04-08 | Nouveaux anticorps utiles pour le traitement du cancer |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| EP2268671A1 true EP2268671A1 (fr) | 2011-01-05 |
Family
ID=39645493
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| EP09742268A Withdrawn EP2268671A1 (fr) | 2008-04-11 | 2009-04-08 | Nouveaux anticorps utiles pour le traitement du cancer |
Country Status (23)
| Country | Link |
|---|---|
| US (3) | US8198413B2 (fr) |
| EP (1) | EP2268671A1 (fr) |
| JP (1) | JP2011517565A (fr) |
| KR (1) | KR20110010708A (fr) |
| CN (1) | CN102027014A (fr) |
| AR (1) | AR071304A1 (fr) |
| AU (1) | AU2009245587B2 (fr) |
| BR (1) | BRPI0909016A2 (fr) |
| CA (1) | CA2720904A1 (fr) |
| CL (1) | CL2009000862A1 (fr) |
| CO (1) | CO6311009A2 (fr) |
| FR (1) | FR2929946B1 (fr) |
| GE (1) | GEP20135826B (fr) |
| IL (1) | IL208595A0 (fr) |
| MA (1) | MA32288B1 (fr) |
| MX (1) | MX2010011147A (fr) |
| NZ (1) | NZ588887A (fr) |
| RU (1) | RU2010145063A (fr) |
| SA (1) | SA109300216B1 (fr) |
| TW (1) | TW201002347A (fr) |
| UA (1) | UA105630C2 (fr) |
| WO (1) | WO2009136070A1 (fr) |
| ZA (1) | ZA201007751B (fr) |
Families Citing this family (14)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| FR2907341B1 (fr) * | 2006-10-18 | 2012-08-17 | Pf Medicament | Utilisation d'un anticorps anti-cd151 pour le traitement du cancer |
| FR2929519B1 (fr) * | 2008-04-04 | 2010-04-23 | Pf Medicament | Utilisation d'un anticorps anti-cd151 pour le traitement precoce des cancers. |
| EP2308897A1 (fr) * | 2009-10-09 | 2011-04-13 | Pierre Fabre Medicament | Anticorps chimères spécifiques de CD151 et leurs utilisations pour le traitement du cancer |
| US9156917B2 (en) * | 2011-02-11 | 2015-10-13 | Research Corporation Technologies, Inc. | CH2 domain template molecules derived from rational grafting of donor loops onto CH2 scaffolds |
| WO2012131680A2 (fr) | 2011-03-28 | 2012-10-04 | Yeda Research And Development Co. Ltd. | Compositions et procédés pour le traitement de l'inflammation |
| FR3017936B1 (fr) | 2014-02-21 | 2019-03-15 | Thales | Systeme de regulation thermique d'au moins un module electronique embarque a bord d'un aeronef |
| KR20250099459A (ko) * | 2015-11-03 | 2025-07-01 | 얀센 바이오테크 인코포레이티드 | Pd-1과 특이적으로 결합하는 항체 및 그의 용도 |
| ITUB20154769A1 (it) | 2015-11-04 | 2017-05-04 | Centro Di Riferimento Oncologico Cro Irccs Aviano | Anticorpo monoclonale anti-BARF1 |
| US12398209B2 (en) | 2018-01-22 | 2025-08-26 | Janssen Biotech, Inc. | Methods of treating cancers with antagonistic anti-PD-1 antibodies |
| CN115925952A (zh) | 2018-03-13 | 2023-04-07 | 东莞凡恩世生物医药有限公司 | 抗叶酸受体1抗体及其用途 |
| US12173057B2 (en) | 2018-10-09 | 2024-12-24 | Ibex Biosciences, Inc. | Antibodies and therapeutic uses thereof |
| WO2023235666A2 (fr) * | 2022-05-31 | 2023-12-07 | Vanderbilt University | Anticorps humains contre bordetella pertussis et leurs utilisations |
| CN114790240B (zh) * | 2022-06-10 | 2023-06-06 | 郑州大学 | SARS-CoV-2中和性单克隆抗体及应用 |
| CN119306826B (zh) * | 2023-07-11 | 2025-06-20 | 东莞市朋志生物科技有限公司 | 抗白介素-6抗体、检测白介素-6的试剂和试剂盒 |
Family Cites Families (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| AU4441799A (en) * | 1998-06-15 | 2000-01-05 | Research Foundation Of The State University Of New York, The | Monoclonal antibodies that recognize antigens associated with tumor metastasis |
| US20070054278A1 (en) * | 2003-11-18 | 2007-03-08 | Applera Corporation | Polymorphisms in nucleic acid molecules encoding human enzyme proteins, methods of detection and uses thereof |
| US20080003605A1 (en) * | 2006-05-24 | 2008-01-03 | The University Of Chicago | Microarray analysis of light chain variable gene expression and methods of use |
| FR2907341B1 (fr) * | 2006-10-18 | 2012-08-17 | Pf Medicament | Utilisation d'un anticorps anti-cd151 pour le traitement du cancer |
-
2008
- 2008-04-11 FR FR0801985A patent/FR2929946B1/fr not_active Expired - Fee Related
-
2009
- 2009-04-08 MX MX2010011147A patent/MX2010011147A/es active IP Right Grant
- 2009-04-08 JP JP2011503478A patent/JP2011517565A/ja active Pending
- 2009-04-08 BR BRPI0909016A patent/BRPI0909016A2/pt not_active IP Right Cessation
- 2009-04-08 EP EP09742268A patent/EP2268671A1/fr not_active Withdrawn
- 2009-04-08 NZ NZ588887A patent/NZ588887A/xx not_active IP Right Cessation
- 2009-04-08 GE GEAP200911995A patent/GEP20135826B/en unknown
- 2009-04-08 CA CA2720904A patent/CA2720904A1/fr not_active Abandoned
- 2009-04-08 AU AU2009245587A patent/AU2009245587B2/en not_active Expired - Fee Related
- 2009-04-08 WO PCT/FR2009/050612 patent/WO2009136070A1/fr not_active Ceased
- 2009-04-08 KR KR1020107024503A patent/KR20110010708A/ko not_active Ceased
- 2009-04-08 UA UAA201013336A patent/UA105630C2/uk unknown
- 2009-04-08 RU RU2010145063/10A patent/RU2010145063A/ru not_active Application Discontinuation
- 2009-04-08 SA SA109300216A patent/SA109300216B1/ar unknown
- 2009-04-08 CN CN2009801169974A patent/CN102027014A/zh active Pending
- 2009-04-08 AR ARP090101245A patent/AR071304A1/es unknown
- 2009-04-09 CL CL2009000862A patent/CL2009000862A1/es unknown
- 2009-04-10 TW TW098111908A patent/TW201002347A/zh unknown
- 2009-10-09 US US12/576,824 patent/US8198413B2/en not_active Expired - Fee Related
-
2010
- 2010-10-10 IL IL208595A patent/IL208595A0/en unknown
- 2010-10-29 ZA ZA2010/07751A patent/ZA201007751B/en unknown
- 2010-11-03 MA MA33315A patent/MA32288B1/fr unknown
- 2010-11-11 CO CO10141712A patent/CO6311009A2/es active IP Right Grant
-
2012
- 2012-04-05 US US13/440,259 patent/US8697855B2/en not_active Expired - Fee Related
-
2013
- 2013-10-09 US US14/049,617 patent/US20140193329A1/en not_active Abandoned
Non-Patent Citations (1)
| Title |
|---|
| See references of WO2009136070A1 * |
Also Published As
| Publication number | Publication date |
|---|---|
| SA109300216B1 (ar) | 2013-04-20 |
| US8697855B2 (en) | 2014-04-15 |
| MX2010011147A (es) | 2011-10-10 |
| CN102027014A (zh) | 2011-04-20 |
| ZA201007751B (en) | 2011-08-31 |
| AU2009245587B2 (en) | 2014-11-27 |
| TW201002347A (en) | 2010-01-16 |
| CA2720904A1 (fr) | 2009-11-12 |
| JP2011517565A (ja) | 2011-06-16 |
| MA32288B1 (fr) | 2011-05-02 |
| UA105630C2 (uk) | 2014-06-10 |
| NZ588887A (en) | 2012-10-26 |
| AR071304A1 (es) | 2010-06-09 |
| US8198413B2 (en) | 2012-06-12 |
| WO2009136070A1 (fr) | 2009-11-12 |
| IL208595A0 (en) | 2010-12-30 |
| AU2009245587A1 (en) | 2009-11-12 |
| KR20110010708A (ko) | 2011-02-07 |
| FR2929946A1 (fr) | 2009-10-16 |
| RU2010145063A (ru) | 2012-05-20 |
| US20140193329A1 (en) | 2014-07-10 |
| GEP20135826B (en) | 2013-05-27 |
| FR2929946B1 (fr) | 2010-05-28 |
| US20120284810A1 (en) | 2012-11-08 |
| US20100150902A1 (en) | 2010-06-17 |
| CL2009000862A1 (es) | 2009-08-14 |
| BRPI0909016A2 (pt) | 2015-12-22 |
| CO6311009A2 (es) | 2011-08-22 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| WO2009136070A1 (fr) | Nouveaux anticorps utiles pour le traitement du cancer | |
| KR101671039B1 (ko) | 항 cxcr4 항체 및 그들의 암의 치료를 위한 용도 | |
| JP5808052B2 (ja) | Egfファミリーリガンドのアンタゴニストを成分とする医薬組成物 | |
| KR101504770B1 (ko) | 내성 항원에 대항하는 활성 항체의 생산 방법, 상기 방법에 의해 생산된 항체 및 이의 용도 | |
| CA2759836A1 (fr) | Anticorps axl humanises | |
| EP1461359A2 (fr) | Anticorps anti-igf-ir et leurs applications | |
| EP2079482B1 (fr) | Utilisation d'un anticorps anti-cd151 pour le traitement de cancer primaire | |
| FR2873699A1 (fr) | Nouveaux anticorps anti igf ir rt leurs utilisations | |
| FR2909092A1 (fr) | Nouveaux anticorps anti-proliferation | |
| EP2270053A1 (fr) | Anticorps AXL humanisés | |
| FR2971250A1 (fr) | Anticorps anti-gb3 utiles dans le traitement des maladies associees a l'angiogenese | |
| FR2834990A1 (fr) | Nouveaux anticorps anti-igf-ir et leurs applications | |
| FR2834991A1 (fr) | Nouveaux anticorps anti-igf-ir et leurs applications | |
| EP2308897A1 (fr) | Anticorps chimères spécifiques de CD151 et leurs utilisations pour le traitement du cancer | |
| US20120171114A1 (en) | Anti-cd151 antibodies and their use in the treatment of cancer | |
| TW202408584A (zh) | 抗體-藥物結合物與抗SIRPα抗體之組合 | |
| HK1156328A (en) | Novel antibodies used to treat cancer | |
| HK1132904B (en) | Use of an anti-cd151 antibody in the treatment of cancer | |
| EP2262839A1 (fr) | Utilisation d'un anticorps anti-cd151 pour le traitement precoce des cancers |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| PUAI | Public reference made under article 153(3) epc to a published international application that has entered the european phase |
Free format text: ORIGINAL CODE: 0009012 |
|
| 17P | Request for examination filed |
Effective date: 20101104 |
|
| AK | Designated contracting states |
Kind code of ref document: A1 Designated state(s): AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HR HU IE IS IT LI LT LU LV MC MK MT NL NO PL PT RO SE SI SK TR |
|
| AX | Request for extension of the european patent |
Extension state: AL BA RS |
|
| 17Q | First examination report despatched |
Effective date: 20110616 |
|
| RAX | Requested extension states of the european patent have changed |
Extension state: RS Payment date: 20101104 |
|
| STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: THE APPLICATION IS DEEMED TO BE WITHDRAWN |
|
| 18D | Application deemed to be withdrawn |
Effective date: 20150126 |