EP1569684A2 - Verwendung vonhmgb-fragmenten als entzündungshemmende mittel - Google Patents

Verwendung vonhmgb-fragmenten als entzündungshemmende mittel

Info

Publication number
EP1569684A2
EP1569684A2 EP03789973A EP03789973A EP1569684A2 EP 1569684 A2 EP1569684 A2 EP 1569684A2 EP 03789973 A EP03789973 A EP 03789973A EP 03789973 A EP03789973 A EP 03789973A EP 1569684 A2 EP1569684 A2 EP 1569684A2
Authority
EP
European Patent Office
Prior art keywords
box
hmgb
polypeptide
fragment
group
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Withdrawn
Application number
EP03789973A
Other languages
English (en)
French (fr)
Other versions
EP1569684A4 (de
Inventor
Walter Newman
Theresa L. O'keefe
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Chiesi USA Inc
Original Assignee
Critical Therapeutics Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Critical Therapeutics Inc filed Critical Critical Therapeutics Inc
Publication of EP1569684A2 publication Critical patent/EP1569684A2/de
Publication of EP1569684A4 publication Critical patent/EP1569684A4/de
Withdrawn legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/46Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • C07K14/47Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/1703Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • A61K38/1709Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00Drugs for disorders of the alimentary tract or the digestive system
    • A61P1/04Drugs for disorders of the alimentary tract or the digestive system for ulcers, gastritis or reflux esophagitis, e.g. antacids, inhibitors of acid secretion, mucosal protectants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00Drugs for disorders of the alimentary tract or the digestive system
    • A61P1/18Drugs for disorders of the alimentary tract or the digestive system for pancreatic disorders, e.g. pancreatic enzymes
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P11/00Drugs for disorders of the respiratory system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P11/00Drugs for disorders of the respiratory system
    • A61P11/06Antiasthmatics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P17/00Drugs for dermatological disorders
    • A61P17/02Drugs for dermatological disorders for treating wounds, ulcers, burns, scars, keloids, or the like
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P17/00Drugs for dermatological disorders
    • A61P17/06Antipsoriatics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P19/00Drugs for skeletal disorders
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P29/00Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • A61P3/04Anorexiants; Antiobesity agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/04Antibacterial agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • A61P37/04Immunostimulants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P43/00Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P9/00Drugs for disorders of the cardiovascular system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P9/00Drugs for disorders of the cardiovascular system
    • A61P9/02Non-specific cardiovascular stimulants, e.g. drugs for syncope, antihypotensives

Definitions

  • Inflammation is often induced by proinflammatory cytokines, such as tumor necrosis factor (TNF), inter leukin (IL)-l , IL-l ⁇ , IL-6, platelet-activating factor (PAF), macrophage migration inhibitory factor (MIF), and other compounds.
  • TNF tumor necrosis factor
  • IL inter leukin
  • PAF platelet-activating factor
  • MIF macrophage migration inhibitory factor
  • proinflammatory cytokines are produced by several different cell types, most importantly immune cells (for example, monocytes, macrophages and neutrophils), but also non-immune cells such as f ⁇ broblasts, osteoblasts, smooth muscle cells, epithelial cells, and neurons.
  • TNF tumor necrosis factor
  • IL-l inter leukin
  • IL-6 platelet-activating factor
  • MIF macrophage migration inhibitory factor
  • proinflammatory cytokines are produced by several different cell types, most importantly immune cells (for example, monocytes, macrophages
  • Inflammatory cytokine cascades contribute to deleterious characteristics, including inflammation and apoptosis, of numerous disorders. Included are disorders characterized by both localized and systemic reactions, including, without limitation, diseases involving the gastrointestinal tract and associated tissues (such as appendicitis, peptic, gastric and duodenal ulcers, peritonitis, pancreatitis, ulcerative, pseudomembranous, acute and ischemic colitis, diverticulitis, epiglottitis, achalasia, cholangitis, cholecystitis, coeliac disease, hepatitis, Crohn's disease, enteritis, and Whipple's disease); systemic or local inflammatory diseases and conditions (such as asthma, allergy, anaphylactic shock, immune complex disease, organ ischemia, reperfusion injury, organ necrosis, hay fever, sepsis, septicemia, endotoxic shock, cachexia, hyperpyrexia, eosinophilic granuloma
  • HMGB1 high mobility group box 1
  • HMG-1 and HMG1 a protein that accumulates in serum and mediates delayed lethality and further induction of early proinflammatory cytokines.
  • HMGBl was first identified as the founding member of a family of DNA- binding proteins termed high mobility group box (HMGB) proteins that are critical for DNA structure and stability. It was identified nearly 40 years ago as a ubiquitously expressed nuclear protein that binds double-stranded DNA without sequence specificity.
  • HMGBl binding bends DNA to promote formation and stability of nucleoprotein complexes that facilitate gene transcription of glucocorticoid receptors and RAG recombinase.
  • the HMGBl molecule has three domains: two DNA binding motifs termed HMGB A and HMGB B boxes, and an acidic carboxyl terminus.
  • the two HMGB boxes are highly conserved 80 amino acid, L-shaped domains.
  • HMGB boxes are also expressed in other transcription factors including the RNA polymerase I transcription factor human upstream-binding factor and lymphoid-specific factor.
  • HMGBl As a cytokine mediator of inflammatory conditions.
  • HMGBl has been implicated as a cytokine mediator of delayed lethality in endotoxemia. That work demonstrated that bacterial endotoxin (lipopolysaccharide (LPS)) activates monocytes/macrophages to release HMGBl as a late response to activation, resulting in elevated serum HMGBl levels that are toxic.
  • LPS lipopolysaccharide
  • Antibodies against HMGB 1 prevent lethality of endotoxin even when antibody administration is delayed until after the early cytokine response.
  • HMGBl is a potent activator of monocytes.
  • HMGBl Intratracheal application of HMGBl causes acute lung injury, and anti-HMGBl antibodies protect against endotoxin-induced lung edema. Serum HMGBl levels are elevated in critically ill patients with sepsis or hemorrhagic shock, and levels are significantly higher in non-survivors as compared to survivors.
  • HMGBl has also been implicated as a ligand for RAGE, a multi-ligand receptor ofthe immunoglobulin superfamily.
  • RAGE is expressed on endothelial cells, smooth muscle cells, monocytes, and nerves, and ligand interaction transduces signals through MAP kinase, P21 ras, andNF- ⁇ B.
  • the present invention is based on the discoveries that (1) the HMGB A box serves as a competitive inhibitor of HMGB proinflammatory action, (2) the HMGB B box has the predominant proinflammatory activity of HMGB, and (3) combination therapies involving agents that inhibit HMGB biological activity and agents that inhibit TNF biological activity can be used for the treatment of conditions characterized by activation ofthe inflammatory cytokine cascade.
  • Agents that inhibit HMGB biological activity include the HMGB A box, which serves as a competitive inhibitor of HMGB proinflammatory action, and antibodies to HMGB, for example, the HMGB B box.
  • the invention is a polypeptide comprising a high mobility group box protein (HMGB) A box or variant thereof, or an A box biologically active fragment or variant thereof, which can inhibit release of a proinflammatory cytokine from a cell treated with high mobility group box (HMGB) protein, wherein the HMGB A box is selected from the group consisting of an
  • HMG1L5 (formerly HMG1L10) A box, an HMG1L1 A box, an HMG1L4 A box, an HMGB A box polypeptide of BAC clone RP11-395A23, an HMG1L9 A box, an LOC122441 A box, an LOC139603 A box, and an HMG1L8 A box.
  • the polypeptide can be in a pharmaceutically acceptable carrier.
  • the invention is a purified preparation of antibodies that specifically bind to a high mobility group box protein (HMGB) B box but do not specifically bind to non-B box epitopes of HMGB, wherein the antibodies can inhibit release of a proinflammatory cytokine from a cell treated with HMGB, wherein the HMGB B box is selected from the group consisting of an HMG1L5 (formerly HMG1L10) B box, an HMG1L1 B box, an HMG1L4 B box, and an HMGB B box polypeptide of BAC clone RP11-395A23.
  • the antibodies can be in a pharmaceutically acceptable carrier.
  • the invention is a polypeptide comprising a high mobility group box protein (HMGB) B box or variant thereof, or a B box biologically active fragment or variant thereof, but not comprising a full length HMGB, wherein the polypeptide can cause release of a proinflammatory cytokine from a cell, and wherein the HMGB B box is selected from the group consisting of an HMG1L5 (formerly HMG1L10) B box, an HMG1L1 B box, an HMG1L4 B box, and an HMGB B box polypeptide of BAC clone RP11-395A23.
  • the polypeptide can be in a pharmaceutically acceptable carrier.
  • the invention comprises vectors encoding the polypeptides described above.
  • the invention is a method of inhibiting release of a proinflammatory cytokine from a mammalian cell, the method comprising treating the cell with an amount of a purified preparation of antibodies that specifically bind to a high mobility group box protein (HMGB) B box but do not specifically bind to non-B box epitopes of HMGB, wherein the HMGB B box is selected from the group consisting of an HMG1L5 (fonnerly HMG1L10) B box, an HMG1L1 B box, an HMG1L4 B box, and an HMGB B box polypeptide of BAC clone RP11-395A23.
  • HMGB high mobility group box protein
  • the invention is a method of inhibiting release of a proinflammatory cytokine from a mammalian cell, the method comprising treating the cell with a polypeptide comprising a high mobility group box protein (HMGB) A box or variant thereof, or an A box biologically active fragment or variant thereof, which can inhibit release of a proinflammatory cytokine from a cell treated with high mobility group box (HMGB) protein in an amount sufficient to inhibit release ofthe proinflammatory cytokine from the cell, wherein the HMGB A box is selected from the group consisting of an HMG1L5 (formerly HMG1L10) A box, an HMG1L1 A box, an HMG1L4 A box, an HMGB A box polypeptide of BAC clone RP11- 395A23, an HMG1L9 A box, an LOC122441 A box, an LOC139603 A box, and an HMG1L8 A box.
  • the cell can be treated with a vector encoding a polypeptide
  • the invention is a method of treating a condition in a patient characterized by activation of an inflammatory cytokine cascade, comprising administering to the patient a purified preparation of antibodies that specifically bind to a high mobility group box protein (HMGB) B box but do not specifically bind to non-B box epitopes of HMGB, in an amount sufficient to inhibit the inflammatory cytokine cascade, wherein the HMGB B box is selected from the group consisting of an HMG1L5 (formerly HMG1L10) B box, an HMG1L1 B box, an HMG1L4 B box, and an HMGB B box polypeptide of BAC clone RPl 1-395A23.
  • HMG1L5 originally HMG1L10
  • the invention is a method of treating a condition in a patient characterized by activation of an inflammatory cytokine cascade, comprising administering to the patient a polypeptide comprising a high mobility group box protein (HMGB) A box or variant thereof, or an A box biologically active fragment or variant thereof, which can inhibit release of a proinflammatory cytokine from a cell treated with high mobility group box (HMGB) protein, in an amount sufficient to inhibit release ofthe proinflammatory cytokine from the cell, wherein the HMGB A box is selected from the group consisting of an HMG1L5 (formerly HMG1L10) A box, an HMG1L1 A box, an HMG1L4 A box, an HMGB A box polypeptide of BAC clone RPl l-395A23, an HMGlL9 A box, an LOC122441 B box, an LOCI 39603 A box, and an HMG1L8 A box.
  • HMGB high mobility group box protein
  • the invention is a method of stimulating the release of a proinflammatory cytokine from a cell comprising treating the cell with a polypeptide comprising a high mobility group box protein (HMGB) B box or variant thereof, or a B box biologically active fragment thereof, but not comprising a full length HMGB, in an amount sufficient to stimulate the release ofthe proinflammatory cytokine from the cell, wherein the HMGB B box is selected from the group consisting of an HMG1L5 (formerly HMG1L10) B box, an HMG1L1 B box, an HMG1L4 B box, and an HMGB B box polypeptide of BAC clone RPl 1- 395A23.
  • the cell can be treated with a vector encoding a polypeptide comprising the B box polypeptide, B box biologically active fragment, or variant thereof.
  • the invention is a method for effecting weight loss or treating obesity in a patient, comprising administering to the patient an effective amount of a polypeptide comprising a high mobility group box protein (HMGB) B box or variant thereof, or a B box biologically active fragment or variant thereof, but not comprising a full length HMGB polypeptide, in an amount sufficient to stimulate the release of a proinflammatory cytokine from a cell, wherein the HMGB B box is selected from the group consisting of an HMG1L5 (formerly HMG1L10) B box, an HMG1L1 B box, an HMG1L4 B box, and an HMGB B box polypeptide of BAC clone RPl 1-395A23.
  • HMGB high mobility group box protein
  • the invention is a method of determining whether a compound inhibits inflammation, comprising combining the compound with a) a cell that releases a proinflammatory cytokine when exposed to a high mobility group box protein (HMGB) B box or a biologically active fragment thereof; and b) the HMGB B box or biologically active fragment thereof, wherein said HMGB B box is selected from the group consisting of an HMG1L5 (formerly HMG1L10) B box, an HMG1L1 B box, an HMG1L4 B box, and an HMGB B box polypeptide of BAC clone RPl 1-395A23; then determining whether the compound inhibits the release of the proinflammatory cytokine from the cell.
  • HMGB high mobility group box protein
  • the invention is a pharmaceutical composition
  • a pharmaceutical composition comprising a polypeptide comprising a high mobility group box (HMGB) A box, or a fragment or variant thereof, that can inhibit release of a proinflammatory cytokine from a cell treated with a high mobility group box (HMGB) protein and an agent that inhibits TNF biological activity, where the agent is selected from the group consisting of infliximab, etanercept, adalimumab, CDP870, CDP571, Lenercept, and Thalidomide, in a pharmaceutically acceptable carrier.
  • HMGB high mobility group box
  • the HMGB A box is preferably a vertebrate HMGB A box, for example, a mammalian HMGB A box, more preferably, a mammalian HMGBl A box, for example, a human HMGBl A box, and most preferably, the HMGBl A box comprising or consisting ofthe sequence of SEQ ID NO:4, SEQ ID NO:22, or SEQ ID NO:57.
  • the invention is a pharmaceutical composition
  • a pharmaceutical composition comprising an antibody that binds an HMGB polypeptide or a biologically active fragment thereof, for example, an HMGB B box polypeptide or biologically active fragment thereof, and an agent that inhibits TNF biological activity, where the agent is selected from the group consisting of infliximab, etanercept, adalimumab,
  • CDP870 CDP571, Lenercept, and Thalidomide, in a pharmaceutically acceptable carrier.
  • the invention is a method of treating a condition in a patient characterized by activation of an inflammatory cytokine cascade comprising administering to the patient a composition comprising a polypeptide comprising a high mobility group box (HMGB) A box or a fragment or variant thereof that can inhibit release of a proinflammatory cytokine from a cell treated with high mobility group box (HMGB) protein and an agent that inhibits TNF biological activity, where the agent is selected from the group consisting of infliximab, etanercept, adalimumab, CDP870, CDP571, Lenercept, and Thalidomide.
  • HMGB high mobility group box
  • the invention is a method of treating a condition in a patient characterized by activation of an inflammatory cytokine cascade comprising administering to the patient a composition comprising an antibody that binds an HMGB polypeptide or a biologically active fragment thereof, for example, an HMGB B box polypeptide or a biologically active fragment thereof, and an agent that inhibits TNF biological activity, where the agent is selected from the group consisting of infliximab, etanercept, adalimumab, CDP870, CDP571, Lenercept, and Thalidomide.
  • FIG. 1 is a schematic representation of HMGBl mutants and their activity in TNF release (pg/ml).
  • FIG. 2A is a histogram showing the effect of 0 ⁇ g/ml, 0.01 ⁇ g/ml, 0.1 ⁇ g/ml, 1 ⁇ g/ml or 10 ⁇ g/ml of B box on TNF release (pg/ml) in RAW 264.7 cells.
  • FIG. 2B is a histogram showing the effect of 0 ⁇ g/ml, 0.01 ⁇ g/ml, 0.1 ⁇ g/ml, 1 ⁇ g/ml or 10 ⁇ g/ml of B box on IL-l ⁇ release (pg/ml) in RAW 264.7 cells.
  • FIG. 2C is a histogram showing the effect of 0 ⁇ g/ml, 0.01 ⁇ g/ml, 0.1 ⁇ g/ml, 1 ⁇ g/ml or 10 ⁇ g/ml of B box on IL-6 release (pg/ml) in RAW 264.7 cells.
  • FIG. 2D a scanned image of a blot of an RNAse protection assay, showing the effect of B box (at 0 hours, 4 hours, 8 hours, or 24 hours after administration) or vector alone (at 4 hours after administration) on TNF mRNA expression in RAW 264.7 cells.
  • FIG. 2E is a histogram ofthe effect of HMGBl B box on TNF protein release (pg/ml) from RAW 264.7 cells at 0 hours, 4 hours, 8 hours, 24 hours, 32 hours or 48 hours after administration.
  • FIG. 2F is a histogram ofthe effect of vector on TNF protein release (pg/ml) from RAW 264.7 cells at 0 hours, 4 hours, 8 hours, 24 hours, 32 hours or 48 hours after administration.
  • FIG. 3 is a schematic representation of HMGB 1 B box mutants and their activity in TNF release (pg/ml).
  • FIG. 4A is a graph ofthe effect of 0 ⁇ g/ml, 5 ⁇ g/ml, 10 ⁇ g/ml, or 25 ⁇ g/ml of HMG1 A box protein on the release of TNF (as a percent of HMGBl mediated TNF release alone) from RAW 264.7 cells.
  • FIG. 4B is a histogram of the effect of HMGB 1 (0 or 1.5 ⁇ g/ml), HMGB 1 A box (0 or 10 ⁇ g/ml), or vector (0 or 10 ⁇ g/ml), alone, or in combination, on the release of TNF (as a percent of HMGBl mediated TNF release alone) from RAW 264.7 cells.
  • FIG. 5A is a graph of binding of 125 I-HMGB1 binding to RAW 264.7 cells (CPM/well) over time (minutes).
  • FIG. 5B is a histogram ofthe binding of 125 I-HMGB1 in the absence of unlabeled HMGBl or HMGBl A box for 2 hours at 4°C (Total), or in the presence of 5,000 molar excess of unlabeled HMGBl (HMGBl) or A box (A box), measured as a percent ofthe total CPM/well.
  • FIG. 5B is a histogram ofthe binding of 125 I-HMGB1 in the absence of unlabeled HMGBl or HMGBl A box for 2 hours at 4°C (Total), or in the presence of 5,000 molar excess of unlabeled HMGBl (HMGBl) or A box (A box), measured as a percent ofthe total CPM/well.
  • HMGB 1 HMG-1 ; 0 ⁇ g/ml or 1 ⁇ g/ml
  • HMGBl B box B Box; 0 ⁇ g/ml or 10 ⁇ g/ml
  • anti-B box antibody 25 ⁇ g/ml or 100 ⁇ g/ml
  • IgG 25 ⁇ g/ml or 100 ⁇ g/ml
  • FIG. 7A is a scanned image of a hematoxylin and eosin stained kidney section obtained from an untreated mouse.
  • FIG. 7B is a scanned image of a hematoxylin and eosin stained kidney section obtained from a mouse administered HMGBl B box.
  • FIG. 7C is a scanned image of a hematoxylin and eosin stained myocardium section obtained from an untreated mouse.
  • FIG. 7D is a scanned image of a hematoxylin and eosin stained myocardium section obtained from a mouse administered HMGBl B box.
  • FIG. 7E is a scanned image of a hematoxylin and eosin stained lung section obtained from an untreated mouse.
  • FIG. 7F is a scanned image of a hematoxylin and eosin stained lung section obtained from a mouse administered HMGB 1 B box.
  • FIG. 7G is a scanned image of a hematoxylin and eosin stained liver section obtained from an untreated mouse.
  • FIG. 7H is a scanned image of a hematoxylin and eosin stained liver section obtained from a mouse administered HMGBl B box.
  • FIG. 71 is a scanned image of a hematoxylin and eosin stained liver section
  • FIG. 7J is a scanned image of a hematoxylin and eosin stained liver section (high magnification) obtained from a mouse administered HMGBl B box.
  • FIG. 8 is a graph ofthe level of HMGBl (ng/ml) in mice subjected to cecal ligation and puncture (CLP) over time (hours).
  • FIG. 9 is a graph ofthe effect of HMGB A Box (60 ⁇ g/mouse or 600 ⁇ g/mouse) or no treatment on survival of mice over time (days) after cecal ligation and puncture (CLP).
  • FIG. 10A is a graph ofthe effect of anti-HMGBl antibody (dark circles) or no treatment (open circles) on survival of mice over time (days) after cecal ligation and puncture (CLP).
  • FIG. 1 OB is a graph ofthe effect of anti-HMGBl B box antiserum ( ⁇ ) or no treatment (*) on the survival (days) of mice administered lipopolysaccharide (LPS).
  • FIG. 11A is a histogram ofthe effect of anti-RAGE antibody or non-immune IgG on TNF release from RAW 264.7 cells treated with HMGBl (HMG-1), lipopolysaccharide (LPS), or HMGB 1 B box (B box).
  • HMG-1 HMGBl
  • LPS lipopolysaccharide
  • B box HMGB 1 B box
  • FIG. 11B is a histogram ofthe effect of HMGBl (HMG-1) or HMGBl B box (B Box) polypeptide stimulation on activation ofthe NF- ⁇ B-dependent ELAM promoter (measured by luciferase activity) in RAW 264.7 cells co-transfected with a murine MyD 88 -dominant negative (+MyD 88 DN) mutant (corresponding to amino acids 146-296), or empty vector (-MyD 88 DN). Data are expressed as the ratio
  • FIG. 12A is the amino acid sequence of a human HMG1 polypeptide (SEQ IDNO:l).
  • FIG. 12B is the amino acid sequence of rat and mouse HMG1 (SEQ ID NO:l).
  • FIG. 12C is the amino acid sequence of human HMG2 (SEQ ID NO:3).
  • FIG. 12D is the amino acid sequence of a human, mouse, and rat HMG1 A box polypeptide (SEQ ID NO:4).
  • FIG. 12E is the amino acid sequence of a human, mouse, and rat HMG1 B box polypeptide (SEQ ID NO:5).
  • FIG. 12F is the nucleic acid sequence of a forward primer for human HMG1 (SEQ ID NO:6).
  • FIG. 12G is the nucleic acid sequence of a reverse primer for human HMG1 (SEQ ID NO:7).
  • FIG. 12H is the nucleic acid sequence of a forward primer for the carboxy terminus mutant of human HMG1 (SEQ ID NO:8).
  • FIG. 121 is the nucleic acid sequence of a reverse primer for the carboxy terminus mutant of human HMG1 (SEQ ID NO:9).
  • FIG. 12J is the nucleic acid sequence of a forward primer for the amino terminus plus B box mutant of human HMG1 (SEQ ID NO:10).
  • FIG. 12K is the nucleic acid sequence of a reverse primer for the amino terminus plus B box mutant of human HMG1 (SEQ ID NO: 11).
  • FIG. 12L is the nucleic acid sequence of a forward primer for a B box mutant of human HMG1 (SEQ ID NO: 12).
  • FIG. 12M is the nucleic acid sequence of a reverse primer for a B box mutant of human HMG1 (SEQ ID NO: 13).
  • FIG. 12N is the nucleic acid sequence of a forward primer for the amino terminus plus A box mutant of human HMG1 (SEQ ID NO: 14).
  • FIG. 120 is the nucleic acid sequence of a reverse primer for the amino terminus plus A box mutant of human HMG1 (SEQ ID NO:15).
  • FIG. 13 is a sequence alignment of HMGBl polypeptide sequences from rat (SEQ ID NO:2), mouse (SEQ ID NO:2), and human (SEQ ID NO: 18).
  • FIG. 14A is the nucleic acid sequence of HMG1L5 (formerly HMG1L10) (SEQ ID NO: 32) encoding an HMGB polypeptide.
  • FIG. 14B is the polypeptide sequence of HMG1L5 (formerly HMG1L10)
  • FIG. 14C is the nucleic acid sequence of HMG1L1 (SEQ ID NO: 33) encoding an HMGB polypeptide.
  • FIG. 14D is the polypeptide sequence of HMG1L1 (SEQ ID NO: 25) encoding an HMGB polypeptide.
  • FIG. 14E is the nucleic acid sequence of HMG1L4 (SEQ ID NO: 34) encoding an HMGB polypeptide.
  • FIG. 14F is the polypeptide sequence of HMG1L4 (SEQ ID NO: 26) encoding an HMGB polypeptide.
  • FIG. 14G is the nucleic acid sequence ofthe HMG polypeptide sequence of the BAC clone RPl 1-395A23 (SEQ ID NO: 35).
  • FIG. 14H is the polypeptide sequence ofthe HMG polypeptide sequence of the BAC clone RPl 1-395A23 (SEQ ID NO: 27) encoding an HMGB polypeptide.
  • FIG. 141 is the nucleic acid sequence of HMG1L9 (SEQ ID NO: 36) encoding an HMGB polypeptide.
  • FIG. 14J is the polypeptide sequence of HMG1L9 (SEQ ID NO: 28) encoding an HMGB polypeptide.
  • FIG. 14K is the nucleic acid sequence of LOC122441 (SEQ ID NO: 37) encoding an HMGB polypeptide.
  • FIG. 14L is the polypeptide sequence of LOC122441 (SEQ ID NO: 29) encoding an HMGB polypeptide.
  • FIG. 14M is the nucleic acid sequence of LOC139603 (SEQ ID NO: 38) encoding an HMGB polypeptide.
  • FIG. 14N is the polypeptide sequence of LOC139603 (SEQ ID NO: 30) encoding an HMGB polypeptide.
  • FIG. 14O is the nucleic acid sequence of HMG1L8 (SEQ ID NO: 39) encoding an HMGB polypeptide.
  • FIG. 14P is the polypeptide sequence of HMG1L8 (SEQ ID NO: 31) encoding an HMGB polypeptide.
  • the present invention is based on a series of discoveries that further elucidate various characteristics ofthe ability of HMGBl to induce production of proinflammatory cytokines and inflammatory cytokine cascades.
  • the proinflammatory active domain of HMGBl is the B box (and in particular, the first 20 amino acids ofthe B box), and that antibodies specific to the B box will inhibit proinflammatory cytokine release and inflammatory cytokine cascades, with results that can alleviate deleterious symptoms caused by inflammatory cytokine cascades.
  • the A box is a weak agonist of inflammatory cytokine release, and competitively inhibits the proinflammatory activity ofthe B box and of HMGBl .
  • inhibitors of TNF biological activity can be combined with HMGB A boxes and/or antibodies to HMGB 1 , to form pharmaceutical compositions for use in treating conditions characterized by activation of an inflammatory cytokine cascade in patients.
  • an "HMGB polypeptide” or an “HMGB protein” is a substantially pure, or substantially pure and isolated polypeptide, that has been separated from components that naturally accompany it, or a synthetically or recombinantly produced polypeptide having the same amino acid sequence, and increases inflammation, and/or increases release of a proinflammatory cytokine from a cell, and/or increases the activity ofthe inflammatory cytokine cascade.
  • the HMGB polypeptide has one ofthe above biological activities.
  • the HMGB polypeptide has two ofthe above biological activities.
  • the HMGB polypeptide has all three ofthe above biological activities.
  • the HMGB polypeptide is a mammalian HMGB polypeptide, for example, a human HMGBl polypeptide.
  • an HMGB polypeptide include a polypeptide comprising or consisting ofthe sequence of SEQ ID NO:l, SEQ ID NO:2, SEQ ID NO:3, or SEQ ID NO: 18.
  • the HMGB polypeptide contains a B box DNA binding domain and/or an A box DNA binding domain, and/or an acidic carboxyl tenninus as described herein.
  • HMGB polypeptides are described in GenBank Accession Numbers AAA64970, AAB08987, P07155, AAA20508, S29857, P09429, NP_002119, CAA31110, S02826, U00431, X67668, NP_005333, NM_016957, and J04179, the entire teachings of which are incorporated herein by reference.
  • HMGB polypeptides include, but are not limited to mammalian HMG1 ((HMGBl) as described, for example, in GenBank Accession Number U51677), HMG2 ((HMGB 2) as described, for example, in GenBanlc Accession Number M83665), HMG-2A ((HMGB3, HMG-4) as described, for example, in GenBank Accession Numbers NM_005342 andNP_005333), HMG14 (as described, for example, in GenBank Accession Number P05114), HMG17 (as described, for example, in GenBank Accession Number X13546), HMGI (as described, for example, in GenBanlc Accession Number L17131), and HMGY (as described, for example, in GenBank Accession Number M23618); nonmammalian HMG Tl (as described, for example, in GenBank Accession Number X02666) and HMG T2 (as described, for example, in GenBank Accession Number L328
  • HMGB proteins are polypeptides encoded by HMGB nucleic acid sequences having GenBank Accession Numbers NG_000897 (HMG1L5 (formerly HMG1L10)) (and in particular by nucleotides 150-797 of NG_000897, as shown in FIGS. 14A and 14B); AF076674 (HMG1L1) (and in particular by nucleotides 1-633 of AF076674, as shown in FIGS. 14C and 14D; AF076676 (HMG1L4) (and in particular by nucleotides 1-564 of AF076676, as shown in FIGS.
  • AC010149 HMG sequence from BAC clone RPl 1-395A23 (and in particular by nucleotides 75503-76117 of AC010149), as shown in FIGS. 14G and 14H); AF165168 (HMG1L9) (and in particular by nucleotides 729-968 of AF165168, as shown in FIGS. 141 and 14J); XM_063129 (LOC122441) (and in particular by nucleotides 319-558 of XM_063129, as shown in FIGS.
  • XM_066789 LOC139603
  • AF165167 HMG1L8
  • HMGB polypeptides ofthe present invention also encompass sequence variants.
  • Variants include a substantially homologous polypeptide encoded by the same genetic locus in an organism, i.e., an allelic variant, as well as other variants.
  • Variants also encompass polypeptides derived from other genetic loci in an organism, but having substantial homology to a polypeptide encoded by an HMGB nucleic acid molecule, and complements and portions thereof, or having substantial homology to a polypeptide encoded by a nucleic acid molecule comprising the nucleotide sequence of an HMGB nucleic acid molecule.
  • Examples of HMGB nucleic acid molecules are known in the art and can be derived from HMGB polypeptides as described herein.
  • Variants also include polypeptides substantially homologous or identical to these polypeptides but derived from another organism, i.e., an ortholog. Variants also include polypeptides that are substantially homologous or identical to these polypeptides that are produced by chemical synthesis. Variants also include polypeptides that are substantially homologous or identical to these polypeptides that are produced by recombinant methods.
  • the HMGB polypeptide has at least 60%, more preferably, at least 70%, 75%, 80%, 85%, or 90%, and most preferably at least 95%, sequence identity to a sequence selected from the group consisting of SEQ ID NO:l, SEQ ID NO:2, SEQ ID NO:3 and SEQ ID NO.T8, as determined using the BLAST program and parameters described herein and one of more of the biological activities of an HMGB polypeptide.
  • the present invention is directed to an HMGB polypeptide fragment that has HMGB biological activity.
  • an HMGB polypeptide fragment that has HMGB biological activity or a “biologically active HMGB fragment” is meant a fragment of an HMGB polypeptide that has the activity of an HMGB polypeptide.
  • An example of such an HMGB polypeptide fragment is the HMGB B box, as described herein.
  • Biologically active HMGB fragments can be generated using standard molecular biology techniques and assaying the function of the fragment by determining if the fragment, when administered to a cell, increases release of a proinflammatory cytokine from the cell, compared to a suitable control, for example, using methods described herein.
  • an "HMGB A box”, also referred to herein as an “A box”, is a substantially pure, or substantially pure and isolated polypeptide, that has been separated from components that naturally accompany it, and consists of an amino acid sequence that is less than a full length HMGB polypeptide and which has one or more ofthe following biological activities: inhibiting inflammation, and/or inhibiting release of a proinflammatory cytokine from a cell, and/or decreasing the activity of the inflammatory cytokine cascade.
  • the HMGB A box polypeptide has one ofthe above biological activities.
  • the HMGB A box polypeptide has two ofthe above biological activities.
  • the HMGB A box polypeptide has all three ofthe above biological activities.
  • the HMGB A box has no more than 10%, 20%, 25%, 30%, 40%, 50%, 60%, 70%, 80%, or 90%, ofthe biological activity of a full length HMGB polypeptide.
  • the HMGB A box amino acid consists ofthe sequence of SEQ ID NO:4, SEQ ID NO:22, or SEQ ID NO:57, or the amino acid sequence in the corresponding region of an HMGB protein in a mammal.
  • An HMGB A box is also a recombinantly produced polypeptide having the same amino acid sequence as the A box sequences described above.
  • the HMGB A box is a mammalian HMGB A box, for example, a human HMG1 A box.
  • the HMGB A box polypeptides ofthe present invention preferably comprise or consist ofthe sequence of SEQ ID NO:4, SEQ ID NO:22, or SEQ ID NO:57, or the amino acid sequence in the corresponding region of an HMGB protein in a mammal.
  • An HMGB A box often has no more than about 85 amino acids and no fewer than about 4 amino acids.
  • polypeptides having A box sequences within them include, but are not limited to, the HMGB proteins and polypeptides described herein.
  • the A box sequences in such polypeptides can be determined and isolated using methods described herein, for example, by sequence comparisons to A boxes described herein and testing for A box biological activity using methods described herein or other methods known in the art.
  • HMGB A box polypeptide sequences include the following sequences: PDASVNFSEF SKKCSERWKT MSAKEKGKFE
  • DMAKADKARY EREMKTYIPP KGET human HMGBl; SEQ ID NO: 40
  • DSSVNFAEF SKKCSERWKT MSAKEKSKFE DMAKSDKARY DREMKNYVPP KGDK human HMGB2; SEQ ID NO: 41
  • PEVPVNFAEF SKKCSERWKT VSGKEKSKFD EMAKADKVRY DREMKDYGPA KGGK human HMGB3; SEQ ID NO: 42
  • PDASVNFSEF SKKCSERWKT MSAKEKGKFE DMAKADKARY EREMKTYIPP KGET HMG1L5 (formerly HMG1L10); SEQ ID NO: 43
  • SDASVNFSEF SNKCSERWKT MSAKEKGKFE DMAKADKTHY ERQMKTYIPP KGET HMG1L1; SEQ ID NO: 44
  • PDASVNFSEF SKKCSERWKA MSAKDKGKFE DMAKVDKADY EREMKTYIPP KGET
  • the HMGB A box polypeptides ofthe present invention also encompass sequence variants.
  • Variants include a substantially homologous polypeptide encoded by the same genetic locus in an organism, i.e., an allelic variant, as well as other variants.
  • Variants also encompass polypeptides derived from other genetic loci in an organism, but having substantial homology to a polypeptide encoded by an HMGB A box nucleic acid molecule, and complements and portions thereof, or having substantial homology to a polypeptide encoded by a nucleic acid molecule comprising the nucleotide sequence of an HMGB A box nucleic acid molecule.
  • HMGB A box nucleic acid molecules are known in the art and can be derived from HMGB A polypeptides as described herein. Variants also include polypeptides substantially homologous or identical to these polypeptides but derived from another organism, i.e., an ortholog. Variants also include polypeptides that are substantially homologous or identical to these polypeptides that are produced by chemical synthesis. Variants also include polypeptides that are substantially homologous or identical to these polypeptides that are produced by recombinant methods.
  • an HMGB A box has at least 60%, more preferably, at least 70%, 75%, 80%, 85%, or 90%, and most preferably at least 95%, sequence identity to an HMGB A box polypeptide described herein, for example, the sequence of SEQ ID NO:4, SEQ ID NO:22, or SEQ ID NO:57, as determined using the BLAST program and parameters described herein, and one of more ofthe biological activities of an HMGB A box, as determined using methods described herein or other method known in the art.
  • the present invention also features A box biologically active fragments.
  • an "A box fragment that has A box biological activity” or an "A box biologically active fragment” is meant a fragment of an HMGB A box that has the activity of an HMGB A box, as described herein.
  • the A box fragment can decrease release of a pro-inflammatory cytokine from a vertebrate cell, decrease inflammation, and/or decrease activity ofthe inflammatory cytokine cascade.
  • a box fragments can be generated using standard molecular biology techniques and assaying the function ofthe fragment by determining if the fragment, when administered to a cell inhibits release of a proinflammatory cytokine from the cell, for example, using methods described herein.
  • a box biologically active fragments can be used in the methods described herein in which full length A box polypeptides are used, for example, inhibiting release of a proinflammatory cytokine from a cell, or treating a patient having a condition characterized by activation of an inflammatory cytokine cascade.
  • an "HMGB B box”, also referred to herein as a "B box” is a substantially pure, or substantially pure and isolated polypeptide, that has been separated from components that naturally accompany it, and consists of an amino acid sequence that is less than a full length HMGB polypeptide and has one or more ofthe following biological activities: increasing inflammation, increasing release of a proinflammatory cytokine from a cell, and or increasing the activity ofthe inflammatory cytokine cascade.
  • the HMGB B box polypeptide has one ofthe above biological activities.
  • the HMGB B box polypeptide has two ofthe above biological activities.
  • the HMGB B box polypeptide has all three ofthe above biological activities.
  • the HMGB B box has at least 25%, 30%, 40%, 50%, 60%, 70%, 80% or 90%, ofthe biological activity of a full length HMGB polypeptide.
  • the HMGB B box does not comprise an HMGB A box.
  • the HMGB B box is a polypeptide that is about 90%, 80%, 70%, 60%, 50%, 40%, 35%, 30%, 25%, or 20%, ofthe length of a full length HMGB 1 polypeptide.
  • the HMGB B box comprises or consists ofthe sequence of SEQ ID NO:5, SEQ ID NO:20 or SEQ ID NO:58, or the amino acid sequence in the corresponding region of an HMGB protein in a mammal, but is still less than the full length HMGB polypeptide.
  • An HMGB B box polypeptide is also a recombinantly produced polypeptide having the same amino acid sequence as an HMGB B box polypeptide described above.
  • the HMGB B box is a mammalian HMGB B box, for example, a human HMGBl B box.
  • An HMGB B box often has no more than about 85 amino acids and no fewer than about 4 amino acids.
  • polypeptides having B box sequences within them include, but are not limited to, the HMGB proteins and polypeptides described herein.
  • the B box sequences in such polypeptides can be determined and isolated using methods described herein, for example, by sequence comparisons to B boxes described herein and testing for biological activity, using methods described herein or other methods known in the art.
  • HMGB B box polypeptide sequences include the following sequences: FKDPNAPKRP PSAFFLFCSE YRPKIKGEHP GLSIGDNAKK LGEMW ⁇ TAA DDKQPYEKKA AKLKEKYEKD IAAY (human HMGB 1 ; SEQ ID NO: 51); KKDPNAPKRP PSAFFLFCSE HRPKIKSEHP GLSIGDTAKK LGEMWSEQSA KDKQPYEQKA AKLKEKYEKD IAAY (human HMGB2; SEQ ID NO: 52); FKDPNAPKRL PSAFFLFCSE YRPKIKGEHP GLSIGDNAKK LGEMW ⁇ TAA DDKQPYEKKA AKLKEKYEKD IAAY (HMG1L5 (formerly HMG1L10); SEQ ID NO: 53); FKDPNAPKRP PSAFFLFCSE YHPKIKGEHP GLSIGDNAKK LGEMW ⁇ TAA DDKQPGEKKA AKL
  • HMGB B box polypeptides ofthe invention also encompass sequence variants.
  • Variants include a substantially homologous polypeptide encoded by the same genetic locus in an organism, i.e., an allelic variant, as well as other variants.
  • Variants also encompass polypeptides derived from other genetic loci in an organism, but having substantial homology to a polypeptide encoded by an HMGB box nucleic acid molecule, and complements and portions thereof, or having substantial homology to a polypeptide encoded by a nucleic acid molecule comprising the nucleotide sequence of an HMGB B box nucleic acid molecule.
  • HMGB B box nucleic acid molecules are known in the art and can be derived from HMGB B box polypeptides as described herein.
  • Variants also include polypeptides substantially homologous or identical to these polypeptides but derived from another organism, i.e., an ortholog.
  • Variants also include polypeptides that are substantially homologous or identical to these polypeptides that are produced by chemical synthesis.
  • Variants also include polypeptides that are substantially homologous or identical to these polypeptides that are produced by recombinant methods.
  • a non-naturally occurring HMGB B box polypeptide has at least 60%, more preferably, at least 70%, 75%, 80%, 85%, or 90%, and most preferably at least 95%, sequence identity to the sequence of an HMGB B box as described herein, for example, the sequence of SEQ ID NO:5, SEQ ID NO:20, or SEQ ID NO:58, as determined using the BLAST program and parameters described herein.
  • the HMGB B box consists ofthe sequence of SEQ ID NO:5, SEQ ID NO:20, or SEQ ID NO:58, or the amino acid sequence in the corresponding region of an HMGB protein in a mammal, and has one or more ofthe biological activities of an HMGB B box, as detennined using methods described herein or other methods known in the art.
  • the present invention is directed to a polypeptide comprising an HMGB B box biologically active fragment that has B box biological activity, or a non-naturally occurring HMGB B box fragment
  • the present invention is directed to a polypeptide comprising a vertebrate HMGB B box or a fragment thereof that has B box biological activity, or a non-naturally occurring HMGB B box but not comprising a full length HMGB polypeptide.
  • a "B box fragment that has B box biological activity” or a "B box biologically active fragment” is meant a fragment of an HMGB B box that has the activity of an HMGB B box.
  • the B box fragment can induce release of a pro-inflammatory cytokine from a vertebrate cell or increase inflammation, or induce the inflammatory cytokine cascade.
  • a B box fragment is the fragment comprising the first 20 amino acids ofthe HMGBl B box (SEQ ID NO: 16 or SEQ ID NO:23), as described herein.
  • B box fragments can be generated using standard molecular biology techniques and assaying the function ofthe fragment by determining if the fragment, when administered to a cell, increases release of a proinflammatory cytokine from the cell, as compared to a suitable control, for example, using methods described herein or other methods known in the art.
  • HMGB polypeptides, HMGB A boxes, and HMGB B boxes include polypeptides that have sequence identity to the HMGB polypeptides, HMGB A boxes, and HMGB B boxes described herein.
  • two polypeptides are substantially homologous or identical when the amino acid sequences are at least about 60%, 70%, 75%, 80%, 85%, 90%, or 95% or more, homologous or identical.
  • the percent identity of two amino acid sequences (or two nucleic acid sequences) can be determined by aligning the sequences for optimal comparison purposes (e.g., gaps can be introduced in the sequence of a first sequence).
  • the length ofthe HMGB polypeptide, HMGB A box polypeptide, or HMGB B box polypeptide aligned for comparison purposes is at least 30%), preferably, at least 40%, more preferably, at least 60%, and even more preferably, at least 70%>, 80%>, 90%, or 100%, ofthe length ofthe reference sequence, for example, those sequence provided in FIGS. 12A-12E, FIGS. 14A-14P, and SEQ ID NOS: 18, 20, and 22.
  • the database searched is a non-redundant (NR) database
  • parameters for sequence comparison can be set at: no filters; Expect value of 10; Word Size of 3; the Matrix is BLOSUM62; and Gap Costs have an Existence of 11 and an Extension of 1.
  • the percent identity between two amino acid sequences can be accomplished using the GAP program in the GCG software package (Accelrys, San Diego, California) using either a Blossom 63 matrix or a PAM250 matrix, and a gap weight of 12, 10, 8, 6, or 4 and a length weight of 2, 3, or 4.
  • the percent identity between two nucleic acid sequences can be accomplished using the GAP program in the GCG software package (Accelrys, San Diego, California), using a gap weight of 50 and a length weight of 3.
  • cytokine is a soluble protein or peptide which is naturally produced by mammalian cells and which acts in vivo as a humoral regulator at micro- to picomolar concentrations. Cytokines can, either under normal or pathological conditions, modulate the functional activities of individual cells and tissues.
  • a proinflammatory cytokine is a cytokine that is capable of causing any ofthe following physiological reactions associated with inflammation: vasodilation, hyperemia, increased permeability of vessels with associated edema, accumulation of granulocytes and mononuclear phagocytes, or deposition of fibrin.
  • the proinflammatory cytokine can also cause apoptosis, such as in chronic heart failure, where TNF has been shown to stimulate cardiomyocyte apoptosis (Pulkki, Ann. Med. 29: 339-343, 1997; and Tsutsui et al, Immunol. Rev. 174:192-209, 2000).
  • proinflammatory cytokines are tumor necrosis factor (TNF), interleulcin (IL)-l , IL-l ⁇ , IL-6, IL-8, IL-18, interferon ⁇ , HMG-1, platelet-activating factor (PAF), and macrophage migration inhibitory factor (MIF).
  • Proinflammatory cytokines are to be distinguished from anti-inflammatory cytokines, such as IL-4, IL-10, and IL-13, which are not mediators of inflammation.
  • proinflammatory cytokines are produced in an inflammatory cytokine cascade, defined herein as an in vivo release of at least one proinflammatory cytokine in a mammal, wherein the cytokine release affects a physiological condition ofthe mammal.
  • an inflammatory cytokine cascade is inhibited in embodiments of the invention where proinflammatory cytokine release causes a deleterious physiological condition.
  • an agent that inhibits TNF biological activity is an agent that decreases one or more ofthe biological activities of TNF.
  • TNF biological activity include, but are not limited to, vasodilation, hyperemia, increased permeability of vessels with associated edema, accumulation of granulocytes and mononuclear phagocytes, and deposition of fibrin.
  • Agents that inhibit TNF biological activity include agents that inhibit (decrease) the interaction between TNF and a TNF receptor. Examples of such agents include antibodies or antigen binding fragments thereof that bind to TNF, antibodies or antigen binding fragments that bind a TNF receptor, and molecules that bind TNF or the TNF receptor and prevent
  • agents include, but are not limited to peptides, proteins, synthesized molecules, for example, synthetic organic molecules, naturally-occurring molecule, for example, naturally occurring organic molecules, nucleic acid molecules, and components thereof.
  • agents that inhibit TNF biological activity include infliximab (Remicade; Centocor, Inc.,
  • Inflammatory cytokine cascades contribute to deleterious characteristics, including inflammation and apoptosis, of numerous disorders. Included are disorders characterized by both localized and systemic reactions, including, without limitation, the disorders described herein (e.g., those conditions enumerated in the background section of this specification).
  • Particular disorders characterized by inflammatory cytokine cascades include, e.g., sepsis, allograft rejection, rheumatoid arthritis, asthma, lupus, adult respiratory distress syndrome, chronic obstructive pulmonary disease, psoriasis, pancreatitis, peritonitis, burns, myocardial ischemia, organic ischemia, reperfusion ischemia, Behcet's disease, graft versus host disease, Crohn's disease, ulcerative colitis, multiple sclerosis, and cachexia.
  • sepsis allograft rejection, rheumatoid arthritis, asthma, lupus, adult respiratory distress syndrome, chronic obstructive pulmonary disease, psoriasis, pancreatitis, peritonitis, burns, myocardial ischemia, organic ischemia, reperfusion ischemia, Behcet's disease, graft versus host disease, Crohn's disease, ulcerative co
  • the present invention is directed to a polypeptide composition comprising a vertebrate HMGB A box, or a biologically active fragment thereof, which can inhibit release of a piOinflammatory cytokine from a cell treated with HMG, or which can be used to treat a condition characterized by activation of an inflammatory cytokine cascade.
  • the invention is directed to compositions comprising an HMGB A box, or a biologically active fragment or variant thereof, in combination with one or more agents that inhibit TNF biological activity, for example, infliximab, etanercept, adalimumab, CDP870, CDP571, Lenercept, or Thalidomide.
  • agents that inhibit TNF biological activity for example, infliximab, etanercept, adalimumab, CDP870, CDP571, Lenercept, or Thalidomide.
  • Such compositions can be used to inhibit release of a proinflammatory cytokine from a vertebrate cell treated with HMG, and/or can be used to treat a condition characterized by activation of an inflammatory cytokine cascade.
  • the use ofthe terms “inhibit” or “decrease” encompasses at least a small but measurable reduction in proinflammatory cytokine release.
  • the release ofthe proinflammatory cytokine is inhibited by at least 20% over non-treated controls; in more preferred embodiments, the inhibition is at least 50%; in still more preferred embodiments, the inhibition is at least 70%, and in the most preferred embodiments, the inhibition is at least 80%. Inhibition can be assessed using methods described herein or other methods known in the art. Such reductions in proinflammatory cytokine release are capable of reducing the deleterious effects of an inflammatory cytokine cascade in in vivo embodiments.
  • HMGB A boxes e.g., vertebrate HMGB A boxes
  • an HMGB A box e.g., a vertebrate HMGB A box
  • an HMGB A box is within the scope ofthe invention.
  • the HMGB A box is a vertebrate HMGB A box (e.g., a mammalian HMGB A box, such as a human HMGB 1 A box provided herein as SEQ ID NO :4, SEQ ID NO:22, or SEQ ID NO:57). Also included in the present invention are fragments ofthe HMGBl A box having HMGB A box biological activity, as described herein.
  • a vertebrate HMGB A box e.g., a mammalian HMGB A box, such as a human HMGB 1 A box provided herein as SEQ ID NO :4, SEQ ID NO:22, or SEQ ID NO:57.
  • fragments ofthe HMGBl A box having HMGB A box biological activity as described herein.
  • non-naturally occurring HMGB A boxes can be created without undue experimentation, which would inhibit release of a proinflammatory cytokine from a vertebrate cell treated with a vertebrate HMGB.
  • These non-naturally occurring functional A boxes can be created by aligning amino acid sequences of HMGB A boxes from different sources, and making one or more substitutions in one ofthe sequences at amino acid positions where the A boxes differ. The substitutions are preferably made using the same amino acid residue that occurs in the compared A box. Alternatively, a conservative substitution is made from either ofthe residues.
  • Conservative amino acid substitutions refer to the interchangeability of residues having similar side chains.
  • Conservatively substituted amino acids can be grouped according to the chemical properties of their side chains. For example, one grouping of amino acids includes those amino acids have neutral and hydrophobic side chains (a, v, 1, i, p, w, f, and m); another grouping is those amino acids having neutral and polar side chains (g, s, t, y, c, n, and q); another grouping is those amino acids having basic side chains (k, r, and h); another grouping is those amino acids having acidic side chains (d and e); another grouping is those amino acids having aliphatic side chains (g, a, v, 1, and i); another grouping is those amino acids having aliphatic-hydroxyl side chains (s and t); another grouping is those amino acids having amine-containing side chains (n, q, k, r, and h); another grouping is those amino acids having aromatic side chains (f,
  • HMGB A box polypeptide While a conservative amino acid substitution would be expected to preserve the biological activity of an HMGB A box polypeptide, the following is one example of how non-naturally occurring A box polypeptides (variants) can be made by comparing the human HMGB 1 A box (SEQ ID NO :4) with residues 32 to 85 of SEQ ID NO:3 ofthe human HMGB2 A box (SEQ ID NO:17).
  • a non-naturally occurring HMGB A box can be created by, for example, by substituting the alanine (a) residue at the third position in the HMGBl A box with the serine (s) residue that occurs at the third position ofthe HMGB2 A box.
  • the skilled artisan would know that the substitution would provide a functional non- naturally occurring A box because the s residue functions at that position in the HMGB2 A box.
  • the third position ofthe HMGBl A box can be substituted with any amino acid that is conservative to alanine or serine, such as glycine (g), threonine (t), valine (v) or leucine (1).
  • g glycine
  • t threonine
  • v valine
  • leucine leucine
  • HMGB A boxes could be created without undue experimentation wliich would be expected to be functional, and the functionality of any particular non-naturally occurring HMGB A box could be predicted with adequate accuracy.
  • the functionality of any non-naturally occurring HMGB A box could be determined without undue experimentation by simply adding it to cells along with an HMGB polypeptide, and determining whether the A box inhibits release of a proinflammatory cytokine by the cells, using, for example, methods described herein.
  • the cell from which the A box or an A box biologically active fragment will inhibit the release of HMG-induced proinflammatory cytokines can be any cell that can be induced to produce a proinflammatory cytokine.
  • the cell is a mammalian cell, for example, an immune cell (e.g., a macrophage, a monocyte, or a neutrophil).
  • Polypeptides comprising an A box or A box biologically active fragment that can inhibit the production of any single proinflammatory cytokine, now known or later discovered, are within the scope ofthe present invention.
  • the antibodies can inhibit the production of TNF, IL- 1 ⁇ , and/or IL-6.
  • the antibodies can inhibit the production of any proinflammatory cytokines produced by the vertebrate cell.
  • the present invention is directed to a polypeptide composition
  • a polypeptide composition comprising a vertebrate HMGB B box, or a biologically active fragment thereof, which can increase release of a proinflammatory cytokine from a vertebrate cell treated with HMGB.
  • the use ofthe term "increase” encompasses at least a small but measurable rise in proinflammatory cytokine release.
  • the release ofthe proinflammatory cytokine is increased by at least 1.5-fold, at least 2-fold, at least 5-fold, or at least 10-fold, over non-treated controls.
  • Such increases in proinflammatory cytokine release are capable of increasing the effects of an inflammatory cytokine cascade in in vivo embodiments.
  • Such polypeptides can also be used to induce weight loss and/or treat obesity.
  • the B box comprises SEQ ID NO:5, SEQ ID NO: 20 or SEQ ID NO:58, which are the sequences (three different lengths) ofthe human HMGBl B box, or, comprises the B box sequences from the polypeptides shown in FIGS.
  • HMGB B box 14A-14P is a fragment of an HMGB B box that has B box biological activity.
  • a 20 amino acid sequence contained within SEQ ID NO: 20 contributes to the function ofthe B box.
  • This 20 amino acid B-box fragment has the following amino acid sequence: flcdpnapkrl psafflfcse (SEQ ID NO:23).
  • Another example of an HMGB B box biologically active fragment consists of amino acids 1-20 of SEQ ID NO: 5 (naplcrppsafflfcseyrpk; SEQ ID NO: 16).
  • Antibodies to HMGB and HMGB B Box Polypeptides The invention is also directed to a purified preparation of antibodies that bind to an HMGB polypeptide or a biologically active fragment thereof (anti-HMGB antibodies).
  • the anti-HMGB antibodies can be neutralizing antibodies (i.e., can inhibit a biological activity of an HMG polypeptide or a biologically active fragment thereof, for example, the release of a proinflammatory cytokine from a vertebrate cell induced by HMG).
  • the invention is also directed to a purified preparation of antibodies that specifically bind to a vertebrate high mobility group protein (HMG) B box or a biologically active fragment thereof, but do not selectively bind to non-B box epitopes of HMGB (anti-HMGB B box antibodies).
  • HMG high mobility group protein
  • the antibodies can also be neutralizing antibodies (i.e., they can inhibit a biological activity of a B box polypeptide or biologically active fragment thereof, for example, the release of a proinflammatory cytokine from a vertebrate cell induced by HMGB).
  • Such antibodies can be combined with one or more agents that inhibit TNF biological activity, for example, infliximab, etanercept, adalimumab, CDP870, CDP571, Lenercept, or Thalidomide.
  • antibody or “purified antibody” as used herein refers to immunoglobulm molecules and immunologically active portions of immunoglobulin molecules, i.e., molecules that contain an antigen binding site that selectively binds an antigen.
  • a molecule that selectively binds to a polypeptide ofthe invention is a molecule that binds to that polypeptide or a fragment thereof, but does not substantially bind other molecules in a sample, e.g., a biological sample that naturally contains the polypeptide.
  • the antibody is at least 60%, by weight, free from proteins and naturally occurring organic molecules with which it is naturally associated. More preferably, the antibody preparation is at least 75% or 90%, and most preferably, 99%, by weight, antibody.
  • immunologically active portions of immunoglobulin molecules include F(ab) and F(ab') 2 fragments that can be generated by treating the antibody with an enzyme such as pepsin.
  • the invention provides polyclonal and monoclonal antibodies that selectively bind to a HMGB B box polypeptide ofthe invention.
  • a monoclonal antibody composition thus typically displays a single binding affinity for a particular polypeptide ofthe invention with which it immunoreacts.
  • Polyclonal antibodies can be prepared, e.g., as described herein, by immunizing a suitable subject with a desired immunogen, e.g., an HMGB B box polypeptide ofthe invention or fragment thereof.
  • the antibody titer in the immunized subject can be monitored over time by standard techniques, such as with an enzyme linked immunosorbent assay (ELISA) using immobilized polypeptide.
  • ELISA enzyme linked immunosorbent assay
  • the antibody molecules directed against the polypeptide can be isolated from the mammal (e.g., from the blood) and further purified by well-known techniques, such as protein A chromatography to obtain the IgG fraction.
  • antibody-producing cells can be obtained from the subject and used to prepare monoclonal antibodies by standard techniques, such as the hybridoma technique originally described by Kohler and Milstein (Nature 256:495-497, 1975), the human B cell hybridoma technique (Kozbor et al., Immunol. Today 4:72, 1983), the EBV-hybridoma technique (Cole et al., Monoclonal Antibodies and Cancer Therapy, Alan R. Liss, Inc., pp. 77-96, 1985) or trioma techniques.
  • standard techniques such as the hybridoma technique originally described by Kohler and Milstein (Nature 256:495-497, 1975), the human B cell hybridoma technique (Kozbor et al., Immunol. Today 4:72, 1983), the EBV-hybridoma technique (Cole et al., Monoclonal Antibodies and Cancer Therapy, Alan R. Liss, Inc., pp. 77-96, 1985
  • hybridomas The technology for producing hybridomas is well known (see generally Current Protocols in Immunology, Coligan et al, (eds.) John Wiley & Sons, Inc., New York, NY, 1994). Briefly, an immortal cell line (typically a myeloma) is fused to lymphocytes (typically splenocytes) from a mammal immunized with an immunogen as described above, and the culture supernatants ofthe resulting hybridoma cells are screened to identify a hybridoma producing a monoclonal antibody that binds a particular polypeptide (e.g., a polypeptide ofthe invention).
  • lymphocytes typically splenocytes
  • a monoclonal antibody to an HMGB B box polypeptide ofthe invention can be identified and isolated by screening a recombinant combinatorial immunoglobulin library (e.g., an antibody phage display library) with the polypeptide to thereby isolate immunoglobulin library members that bind the polypeptide.
  • Kits for generating and screening phage display libraries are commercially available (e.g., the Pharmacia Recombinant Phage Antibody System, Catalog No. 27-9400-01; and the Stratagene SurfZAPTM Phage Display Kit, Catalog No. 240612).
  • recombinant antibodies such as chimeric and humanized monoclonal antibodies, comprising both human and non-human portions, which can be made using standard recombinant DNA techniques, are within the scope ofthe invention.
  • Such chimeric and humanized monoclonal antibodies can be produced by recombinant DNA techniques known in the art.
  • antibodies ofthe invention e.g., a monoclonal antibody
  • a polypeptide-specific antibody can facilitate the purification of natural polypeptide from cells and of recombinantly produced polypeptide expressed in host cells.
  • an antibody specific for an HMGB B box polypeptide ofthe invention can be used to detect the polypeptide (e.g., in a cellular lysate, cell supernatant, or tissue sample) in order to evaluate the abundance and pattern of expression ofthe polypeptide.
  • vertebrate HMGB polypeptides and HMGB B boxes show a high degree of sequence conservation, it is believed that vertebrate HMGB polypeptides or HMGB B boxes in general can induce release of a proinflammatory cytokine from a vertebrate cell. Therefore, antibodies against vertebrate HMGB polypeptides or HMGB B boxes are within the scope ofthe invention. In one embodiment, the antibodies are neutralizing antibodies.
  • the HMGB polypeptide is a mammalian HMG, as described herein, more preferably a mammalian HMGBl polypeptide, most preferably a human HMGB 1 polypeptide, provided herein as SEQ ID NO: 1.
  • Antibodies can also be directed against an HMGB polypeptide fragment that has HMGB polypeptide biological activity.
  • the HMGB B box is a mammalian HMGB B box, more preferably a mammalian HMGBl B box, most preferably a human HMGBl B box, provided herein as SEQ ID NO:5, SEQ ID NO:20, or SEQ ID NO:58.
  • Antibodies can also be directed against an HMGB B box fragment that has B box biological activity.
  • Antibodies generated against an HMGB immunogen or an HMGB B box immunogen can be obtained by administering an HMGB polypeptide, or fragment thereof, an HMGB B box or fragment thereof, or cells comprising the HMGB polypeptide, the HMGB B box, or fragments thereof, to an animal, preferably a nonhuman, using routine protocols.
  • the polypeptide such as an antigenically or immunologically equivalent derivative, is used as an antigen to immunize a mouse or other animal, such as a rat or chicken.
  • the immunogen may be associated, for example, by conjugation, with an immunogenic carrier protein, for example, bovine serum albumin (BSA) or keyhole limpet haemocyanin (KLH).
  • BSA bovine serum albumin
  • KLH keyhole limpet haemocyanin
  • a multiple antigenic peptide comprising multiple copies ofthe HMGB or HMGB B box or fragment, may be sufficiently antigenic to improve immunogenicity so as to obviate the need for a carrier.
  • Bispecific antibodies having two antigen binding domains where each is directed against a different HMGB or HMGB B box epitope, may also be produced by routine methods.
  • any technique known in the art that provides antibodies produced by continuous cell line cultures can be used. See, e.g., Kohler and Milstein, supra; and Cole et al, supra.
  • the antibody is preferably modified to make it less immunogenic in the individual.
  • the individual is human the antibody is preferably "humanized"; where the complementarity determining region(s) ofthe antibody is transplanted into a human antibody (for example, as described in Jones et al. (Nature 321:522-525, 1986); and Tempest et al. (Biotechnology 9:266-273, 1991)).
  • Phage display technology can also be utilized to select antibody genes with binding activities towards the polypeptide either from repertoires of PCR amplified v-genes of lymphocytes from humans screened for possessing anti-B box antibodies or from naive libraries (McCafferty et al., Nature 348:552-554, 1990; and Marks, et al., Biotechnology 10:779-783, 1992).
  • the affinity of these antibodies can also be improved by chain shuffling (Clackson et al., Nature 352: 624-628, 1991).
  • Anti-HMGB B box antibodies that can inhibit the production of any single proinflammatory cytokine, and/or inhibit the release of a proinflammatory cytokine from a cell, and/or inhibit a condition characterized by activation of an inflammatory cytokine cascade, are within the scope ofthe present invention.
  • the antibodies can inhibit the production of TNF, IL-1 ⁇ , and/or IL-6.
  • the antibodies can inhibit the production of any proinflammatory cytokines produced by the vertebrate cell.
  • the cell can be any cell that can be induced to produce a proinflammatory cytokine.
  • the cell is an immune cell, for example, macrophages, monocytes, or neutrophils.
  • Compositions Comprising One or More of an HMGB A box polypeptide, an Antibody to HMGB, an Antibody to an HMGB B box, and an Inhibitor of TNF Biological Activity
  • the present invention is directed to a composition
  • a composition comprising any ofthe above-described polypeptides (e.g., an HMGB A box polypeptide or biologically active fragment as described herein) in a pharmaceutically acceptable carrier.
  • suitable pharmaceutically acceptable carriers include those described herein.
  • the composition can inhibit a condition characterized by activation of an inflammatory cytokine cascade.
  • the condition can be one where the inflammatory cytokine cascade causes a systemic reaction, such as with endotoxic shock.
  • the condition can be mediated by a localized inflammatory cytokine cascade, as in rheumatoid arthritis.
  • Nonlimiting examples of conditions which can be usefully treated using the present invention include those conditions enumerated in the background section of this specification.
  • the condition to be treated is appendicitis, peptic, gastric or duodenal ulcers, peritonitis, pancreatitis, ulcerative, pseudomembranous, acute or ischemic colitis, hepatitis, Crohn's disease, asthma, allergy, anaphylactic shock, organ ischemia, reperfusion injury, organ necrosis, hay fever, sepsis, septicemia, endotoxic shock, cachexia, septic abortion, disseminated bacteremia, burns, Alzheimer's disease, coeliac disease, congestive heart failure, adult respiratory distress syndrome, cerebral infarction, cerebral embolism, spinal cord injury, paralysis, allograft rejection or graft- versus-host disease, hi another embodiment, the condition is endotoxic shock or allograft rejection.
  • the composition may advantageously also include an immunosuppressant that is used to inhibit allograft rejection, such as cyclosporin.
  • an immunosuppressant that is used to inhibit allograft rejection, such as cyclosporin.
  • the invention is directed to a composition comprising the antibody preparations described above (e.g., anti-HMGB B box antibodies or biologically active fragments thereof, as described herein), in a pharmaceutically acceptable carrier, hi these embodiments, the compositions can inhibit a condition characterized by the activation of an inflammatory cytokine cascade. Conditions that can be treated with these compositions have been previously enumerated.
  • the invention is directed to a composition comprising any ofthe above-described HMGB A box polypeptides, and/or an antibody or antigen binding fragment thereof that binds HMGB, and/or an antibody or antigen binding fragment thereof that binds an HMGB B box, and an agent that inhibits TNF biological activity (collectively termed "combination therapy compositions").
  • the combination therapy composition can inhibit a condition characterized by activation of an inflammatory cytokine cascade and/or inhibit release of a proinflammatory cytokine from a cell.
  • the condition can be one where the inflammatory cytokine cascade causes a systemic reaction, such as with endotoxic shock.
  • condition can be mediated by a localized inflammatory cytokine cascade, as in rheumatoid arthritis.
  • a localized inflammatory cytokine cascade as in rheumatoid arthritis.
  • Nonlimiting examples of conditions which can be usefully treated using the present invention include those conditions enumerated in the background section of this specification.
  • the condition to be treated is sepsis, allograft rejection, rheumatoid arthritis, asthma, lupus, adult respiratory distress syndrome, chronic obstructive pulmonary disease, psoriasis, pancreatitis, peritonitis, burns, myocardial ischemia, organic ischemia, reperfusion ischemia, Behcet's disease, graft versus host disease, Crohn's disease, ulcerative colitis, multiple sclerosis, and cachexia.
  • the combination therapy compositions are administered to a patient in need thereof in an amount sufficient to inhibit release of proinflammatory cytokine from a cell and/or to treat a condition characterized by activation of an inflammatory cytokine cascade.
  • release ofthe proinflammatory cytokine is inhibited by at least 10%, 20%, 25%, 50%, 75%, 80%, 90% or 95%, as assessed using methods described herein or other methods known in the art.
  • the carrier or excipient included with the polypeptide e.g., an HMGB A box polypeptide or biologically active fragment thereof), antibody (e.g., an anti-HMGB B box antibody or biologically active fragment thereof) or combination therapy composition (e.g., an HMGB A box polypeptide or biologically active fragment thereof and an agent that inhibits TNF biological activity, and/or an antibody or antigen binding fragment thereof that binds HMGB and an agent that inhibits TNF biological activity, and/or an antibody or antigen binding fragment thereof that binds an HMGB B box and an agent that inhibits TNF biological activity) is chosen based on the expected route of administration ofthe composition in therapeutic applications. The route of administration ofthe composition depends on the condition to be treated.
  • intravenous injection may be preferred for treatment of a systemic disorder such as endotoxic shock
  • oral administration may be preferred to treat a gastrointestinal disorder such as a gastric ulcer.
  • the route of administration and the dosage ofthe composition to be administered can be determined by the skilled artisan, without undue experimentation, in conjunction with standard dose-response studies. Relevant circumstances to be considered in making such determinations include the condition or conditions to be treated, the choice of composition to be administered, the age, weight, and response ofthe individual patient, and the severity ofthe patient's symptoms.
  • the antibody composition can be administered orally, parenterally, intranasally, vaginally, rectally, lingually, sublingually, bucally, intrabuccaly and transdermally to the patient.
  • compositions designed for oral, lingual, sublingual, buccal and intrabuccal administration can be made without undue experimentation by means well known in the art, for example, with an inert diluent or with an edible carrier.
  • the compositions may be enclosed in gelatin capsules or compressed into tablets.
  • compositions ofthe present invention may be incorporated with excipients and used in the form of tablets, troches, capsules, elixirs, suspensions, syrups, wafers, chewing gums and the like.
  • Tablets, pills, capsules, troches and the like may also contain binders, recipients, disintegrating agent, lubricants, sweetening agents, and flavoring agents.
  • binders include microcrystalline cellulose, gum tragacanth and gelatin.
  • excipients include starch and lactose.
  • disintegrating agents include alginic acid, corn starch and the like.
  • lubricants include magnesium stearate and potassium stearate.
  • An example of a glidant is colloidal silicon dioxide.
  • sweetening agents include sucrose, saccharin and the like.
  • flavoring agents include peppermint, methyl salicylate, orange flavoring and the like. Materials used in preparing these various compositions should be pharmaceutically pure and non-toxic in the amounts used.
  • compositions ofthe present invention can easily be administered parenterally such as, for example, by intravenous, intramuscular, intrathecal or subcutaneous injection.
  • Parenteral administration can be accomplished by incorporating the compositions ofthe present invention into a solution or suspension.
  • solutions or suspensions may also include sterile diluents such as water for injection, saline solution, fixed oils, polyethylene glycols, glycerine, propylene glycol and/or other synthetic solvents.
  • Parenteral formulations may also include antibacterial agents such as, for example, benzyl alcohol and/or methyl parabens, antioxidants such as, for example, ascorbic acid and/or sodium bisulfite and chelating agents such as EDTA.
  • Buffers such as acetates, citrates and/or phosphates, and agents for the adjustment of tonicity, such as sodium chloride and/or dextrose, may also be added.
  • the parenteral preparation can be enclosed in ampules, disposable syringes or multiple dose vials made of glass or plastic.
  • Rectal administration includes administering the pharmaceutical compositions into the rectum or large intestine. This can be accomplished using suppositories or enemas.
  • Suppository formulations can easily be made by methods known in the art. For example, suppository formulations can be prepared by heating glycerin to about 120°C, dissolving the polypeptide composition, antibody composition and/or combination therapy composition in the glycerin, mixing the heated glycerin after which purified water may be added, and pouring the hot mixture into a suppository mold.
  • Transdermal administration includes percutaneous absorption ofthe composition through the skin.
  • Transdermal formulations include patches, ointments, creams, gels, salves and the like.
  • the present invention includes nasally administering to a mammal (e.g., a human) a therapeutically effective amount ofthe composition.
  • nasally administering or nasal administration includes administering the composition to the mucous membranes ofthe nasal passage or nasal cavity ofthe patient.
  • pharmaceutical compositions for nasal administration of a composition include therapeutically effective amounts ofthe polypeptide, antibody and/or combination therapy agents, prepared by well-known methods to be administered, for example, as a nasal spray, nasal drop, suspension, gel, ointment, cream or powder. Administration ofthe composition may also take place using a nasal tampon or nasal sponge.
  • compositions can also include an antagonist of an early sepsis mediator.
  • an early sepsis mediator is a proinflammatory cytokine that is released from cells soon (i.e., within 30-60 min.) after induction of an inflammatoiy cytokine cascade (e.g., exposure to LPS).
  • these cytokines are TNF, IL-l , IL-l ⁇ , IL-6, PAF, and MIF.
  • early sepsis mediators include receptors for these cytokines (for example, tumor necrosis factor receptor type 1) and enzymes required for production of these cytokines, for example, interleukin-l ⁇ converting enzyme).
  • Antagonists of any early sepsis mediator can be useful for these embodiments by further inhibiting an inflammatory cytokine cascade.
  • Nonlimiting examples of antagonists of early sepsis mediators are antisense compounds that bind to the mRNA ofthe early sepsis mediator, preventing its expression (see, e.g., Ojwang et al. (Biochemistry 36:6033-6045, 1997); Pampfer et al. (Biol. Reprod. 52:1316-1326, 1995); U.S. Patent No. 6,228,642; Yahata et al. (Antisense Nucleic Acid Drug Dev. 6:55-61, 1996); and Taylor et al. (Antisense Nucleic Acid Drug Dev.
  • ribozymes that specifically cleave the mRNA ofthe early sepsis mediator (see, e.g., Leavitt et al. (Antisense Nucleic Acid Drug Dev. 10: 409-414, 2000); Hendrix et al. (Biochem. J. 314 (Pt. 2): 655-661, 1996)), and antibodies that bind to the early sepsis mediator and inhibit their action (see, e.g., Kam and Targan (Expert Opin. Pharmacother. 1: 615-622, 2000); Nagahira et al. (J. Immunol. Methods 222, 83-92, 1999); Lavine et al. (J. Cereb.
  • agents that can be administered with the compositions described herein include, e.g., VitaxinTM and other antibodies targeting v ⁇ 3 integrin (see, e.g., U.S. Patent No. 5,753,230, PCT Publication Nos. WO 00/78815 and WO 02/070007; the entire teachings of all of which are incorporated herein by reference) and anti-IL-9 antibodies (see, e.g., PCT Publication No. WO 97/08321; the entire teachings of which are incorporated herein by reference).
  • Additional agents that can be administered with the polypeptide compositions described herein include, e.g., B7 antagonists (e.g., CTLA4Ig, anti-CD80 antibodies, anti-CD86 antibodies), methotrexate, and/or CD40 antagonists (e.g., anti-CD40 ligand (CD40L)) (see, e.g., Saito et al., J. Immunol. 160(9):4225-31 (1998)).
  • the present invention is also directed to a method of inhibiting the release of a proinflammatory cytokine from a mammalian cell.
  • the method comprises treating the cell with any ofthe HMGB A box compositions, and/or any ofthe HMGB B box or HMGB B box biologically active fragment antibody compositions, and/or any ofthe combination therapy compositions discussed above. It is believed that this method would be useful for inhibiting the cytokine release from any mammalian cell that produces a proinflammatory cytokine.
  • the cell is a macrophage, because macrophage production of proinflammatory cytokines is associated with several important diseases.
  • the proinflammatory cytokine is TNF, IL-l ⁇ , IL-1 ⁇ , MIF and/or IL-6, because those proinflammatory cytokines are particularly important mediators of disease.
  • the methods of these embodiments are useful for in vitro applications, such as in studies for determining biological characteristics of proinflammatory cytokine production in cells.
  • the preferred embodiments are in vivo therapeutic applications, where the cells are in a patient suffering from, or at risk for, a condition characterized by activation of an inflammatory cytokine cascade.
  • the present invention is directed to a method of treating a condition in a patient characterized by activation of an inflammatory cytokine cascade.
  • the method comprises administering to the patient any ofthe HMGB A box compositions (including non-naturally occurring A box polypeptides and A box biologically active fragments), any ofthe HMGB B box or B box biologically active fragment antibody compositions (including non-naturally occurring B box polypeptides or biologically active fragments thereof), and/or any of the combination therapy compositions discussed above.
  • This method would be expected to be useful for any condition that is mediated by an inflammatory cytokine cascade, including any of those that have been previously enumerated.
  • preferred conditions include appendicitis, peptic, gastric or duodenal ulcers, peritonitis, pancreatitis, ulcerative, pseudomembranous, acute or ischemic colitis, hepatitis, Crohn's disease, asthma, allergy, anaphylactic shock, organ ischemia, reperfusion injury, organ necrosis, hay fever, sepsis, septicemia, endotoxic shock, cachexia, septic abortion, disseminated bacteremia, bums, Alzheimer's disease, cerebral infarction, cerebral embolism, spinal cord injury, paralysis, allograft rejection or graft- versus-host disease.
  • the condition is endotoxic shock or allograft rejection.
  • the composition may advantageously also include an immunosuppressant that is used to inhibit allograft rejection, such as cyclosporin.
  • These methods can also usefully include the administration of an antagonist of an early sepsis mediator, an anti- ⁇ v ⁇ 3 antibody, an anti JL-9 antibody, a B7 antagonist (e.g., CTLA4Ig, an anti-CD80 antibody, an anti-CD86 antibody), methotrexate, and/or a CD40 antagonist (e.g., anti-CD40 ligand (CD40L)).
  • a B7 antagonist e.g., CTLA4Ig, an anti-CD80 antibody, an anti-CD86 antibody
  • methotrexate e.g., methotrexate
  • CD40 antagonist e.g., anti-CD40 ligand (CD40L)
  • the B box polypeptides and biologically active fragments thereof described herein can be used to induce inflammatory cytokines in the appropriate isolated cells in vitro, or ex vivo, or as a treatment in vivo.
  • the polypeptide or fragment can be administered by providing a DNA or RNA vector encoding the B box or B box fragment, with the appropriate control sequences operably linked to the encoded B box or B box fragment, so that the B box or B box fragment is synthesized in the treated cell or patient.
  • the B box polypeptides or B box fragment polypeptides or vectors as a weight loss treatment. See WO 00/47104 (the entire teachings of which are incorporated herein by reference), demonstrating that treatment with HMGBl induces weight loss.
  • the present invention is directed to methods of stimulating the release of a proinflammatory cytokine from a cell.
  • the method comprises treating the cell with any ofthe B box polypeptides or biologically active B box fragment polypeptides, for example, polypeptides that comprise or consist of the sequence of SEQ ID NO:5, SEQ ID NO:20, SEQ ID NO:58, SEQ ID NO: 16, or SEQ ID NO:23, as described herein (including non-naturally occurring B box polypeptides and fragments).
  • This method is useful for in vitro applications, for example, for studying the effect of proinflammatory cytokine production on the biology ofthe producing cell. Since the HMGB B box has the activity ofthe HMGB protein, the B box would also be expected to induce weight loss. Therefore, in additional embodiments, the present invention is a method for effecting weight loss or treating obesity in a patient.
  • the method comprises administering to the patient an effective amount of any ofthe B box polypeptides or B box fragment polypeptides described herein (including non-naturally occurring B box polypeptides and fragments).
  • the B box polypeptide or B box fragment polypeptide is in a pharmaceutically acceptable carrier.
  • the present invention is also directed to a method of determining whether a compound (test compound) inhibits inflammation and/or an inflammatory response.
  • the method comprises combining the compound with (a) a cell that releases a proinflammatory cytokine when exposed to a vertebrate HMGB B box or a biologically active fragment thereof, and (b) the HMGB B box or a biologically active fragment thereof, and then determining whether the compound inhibits the release ofthe proinflammatory cytokine from the cell, as compared to a suitable control.
  • a compound that inhibits the release ofthe proinflammatory cytokine in this assay is a compound that can be used to treat inflammation and/or an inflammatory response.
  • the HMGB B box or biologically active HMGB B box fragment can be endogenous to the cell or can be introduced into the cell using standard recombinant molecular biology techniques. Any cell that releases a proinflammatory cytokine in response to exposure to a vertebrate HMGB B box or biologically active fragment thereof in the absence of a test compound would be expected to be useful for this invention. It is envisioned that the cell that is selected would be important in the etiology ofthe condition to be treated with the inhibitory compound that is being tested. For many conditions, it is expected that the preferred cell is a human macrophage.
  • any method for determining whether the compound inhibits the release ofthe proinflammatory cytokine from the cell would be useful for these embodiments. It is envisioned that the preferred methods are the direct measurement ofthe proinflammatory cytokine, for example, with any of a number of commercially available ELISA assays. However, in some embodiments, the measurement ofthe inflammatory effect of released cytokines may be preferable, particularly when there are several proinflammatory cytokines produced by the test cell. As previously discussed, for many important disorders, the predominant proinflammatory cytokines are TNF, IL-l ⁇ , IL-l ⁇ , MIF or IL-6; particularly TNF.
  • the present invention also features a method of determining whether a compound increases an inflammatory response and/or inflammation.
  • the method comprises combining the compound (test compound) with (a) a cell that releases a proinflammatory cytokine when exposed to a vertebrate HMGB A box or a biologically active fragment thereof, and (b) the HMGB A box or biologically active fragment, and then determining whether the compound increases the release ofthe proinflammatory cytoldne from the cell, as compared to a suitable control.
  • a compound that increases the release ofthe proinflammatory cytokine in this assay is a compound that can be used to increase an inflammatory response and/or inflammation.
  • the HMGB A box or HMGB A box biologically active fragment can be endogenous to the cell or can be introduced into the cell using standard recombinant molecular biology techniques.
  • any cell in which release of a proinflammatory cytokine is normally inhibited in response to exposure to a vertebrate HMGB A box or a biologically active fragment thereof in the absence of any test compound would be expected to be useful for this invention. It is envisioned that the cell that is selected would be important in the etiology ofthe condition to be treated with the inhibitory compound that is being tested. For many conditions, it is expected that the preferred cell is a human macrophage.
  • any method for determining whether the compound increases the release of the proinflammatory cytokine from the cell would be useful for these embodiments. It is envisioned that the preferred methods are the direct measurement ofthe proinflammatory cytokine, for example, with any of a number of commercially available ELISA assays. However, in some embodiments, the measurement ofthe inflammatory effect of released cytokines may be preferable, particularly when there are several proinflammatory cytokines produced by the test cell. As previously discussed, for many important disorders, the predominant proinflammatory cytokines are TNF, IL-l ⁇ , IL-l ⁇ , MIF or IL-6; particularly TNF.
  • HMGBl and Production of HMGBl Mutants The following methods were used to prepare clones and mutants of human HMGBl .
  • Recombinant full length human HMGBl (651 base pairs; GenBank Accession Number U51677) was cloned by PCR amplification from a human brain Quick-Clone cDNA preparation (Clontech, Palo Alto, CA) using the following primers; forward primer: 5' GATGGGCAAAGGAGATCCTAAG 3' (SEQ ID NO:6) and reverse primer: 5* GCGGCCGCTTATTCATCATCATCATCTTC 3' (SEQ ID NO:7).
  • Human HMGBl mutants were cloned and purified as follows.
  • HMGB 1 human Brain Quick-Clone cDNA preparation (Clontech, Palo Alto, CA).
  • the primers used were (forward and reverse, respectively):
  • Carboxy terminus mutant (557 bp): 5' GATGGGCAAAGGAGATCCTAAG 3' (SEQ ID NO:8) and 5' GCGGCCGC TCACTTGCTTTTTTCAGCCTTGAC 3' (SEQ ID NO:9).
  • Amino terminus+B box mutant (486 bp): 5' GAGCATAAGAAGAAGCACCCA 3' (SEQ ID NO: 10) and 5* GCGGCCGC TCACTTGCTTTTTTCAGCCTTGAC 3' (SEQ ID NO: 11).
  • B box mutant (233 bp): 5' AAGTTCAAGGATCCCAATGCAAAG 3' (SEQ ID NO: 12) and 5' GCGGCCGCTCAATATGCAGCTATATCCTTTTC 3' (SEQ ID NO:13).
  • Amino terminus+A box mutant (261 bp): 5' GATGGGCAAAGGAGATCCTAAG 3' (SEQ ID NO: 14) and 5' TCACTTTTTTGTCTCCCCTTTGGG 3' (SEQ ID NO: 15).
  • PCR products were subcloned into pCRII-TOPO vector EcoRI sites using the TA cloning method per manufacturer's instruction (Invitrogen, Carlsbad, CA). After amplification, the PCR product was digested with EcoRI and subcloned into an expression vector with a GST tag pGEX (Pharmacia); correct orientation and positive clones were confirmed by DNA sequencing on both strands. The recombinant plasmids were transformed into protease deficient E.
  • HMGB mutants generated as described above have the following amino acid sequences:
  • a Box mutant MGKGDPKKPTGKMSSYAFFNQTCREEHKKK HPDASV ⁇ FSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPP KGET (SEQ ID NO: 21), wherein the A box consists ofthe sequence PTGKMSSYAFFNQTCREEHKKKHPDASNNFSEFSKKCSERWKTMSAKEKGK FEDMAKADKARYEREMKTYIPPKGET (SEQ ID NO:22)
  • a polypeptide generated from a GST vector lacking HMGBl protein was included as a control (containing a GST tag only).
  • DNase I Life Technologies
  • carboxy terminus and B box mutants carboxy terminus and B box mutants
  • benzonase nuclease Novagen, Madison, WI
  • the protein eluates were passed over a polymyxin B column (Pierce, Rockford, IL) to remove any contaminating LPS, and dialyzed extensively against phosphate buffered saline to remove excess reduced glutathione. The preparations were then lyophilized and redissolved in sterile water before use. LPS levels were less than 60 pg/ ⁇ g protein for all ofthe mutants and 300 pg/ ⁇ g for wild type HMG-1, as measured by Limulus amebocyte lysate assay (Bio Whittaker Inc., Walkersville, MD). The integrity of protein was verified by SDS-PAGE. Recombinant rat HMGBl (Wang et al., Science 285: 248-251, 1999) was used in some experiments since it does not have degraded fragments as observed in purified human HMGBl .
  • Murine macrophage-like RAW 264.7 cells (American Type Culture Collection, Rockville, MD) were cultured in RPMI 1640 medium (Lifetime).
  • TNF release was measured by a standard murine fibroblast L929 (ATCC, American Type Culture Collection, Rockville, MD) cytotoxicity bioassay (Bianchi et al., Journal of Experimental Medicine 183:927-936, 1996) with the minimum detectable concentration of 30 pg/ml.
  • Recombinant mouse TNF was obtained from R&D system Inc., (Minneapolis, MN).
  • Murine fibroblast L929 cells were cultured in DMEM (Life Technologies, Grand Island, NY) supplemented with 10% fetal bovine serum (Gemini, Catabasas, CA), penicillin (50 units/ml) and streptomycin (50 ⁇ g/ml) (Life Technologies) in a humidified incubator with 5% CO 2 .
  • HMGBl B box Polyclonal antibodies against HMGBl B box were raised in rabbits (Cocalico Biologicals, Inc., Reamstown, PA) and assayed for titer by immunoblotting. IgG was purified from anti-HMGB 1 antiserum using Protein A agarose according to manufacturer's instructions (Pierce, Rockford, IL). Anti-HMGB 1 B box antibodies were affinity purified using cyanogen bromide activated Sepharose beads (Cocalico Biological, Inc.). Non-immune rabbit IgG was purchased from Sigma (St. Louis, MO). Antibodies detected full length HMGBl and B box in immunoassay, but did not cross react with TNF, IL-1 and IL-6.
  • HMGBl labeling of HMGBl with Na-' 25 I and cell surface binding
  • Purified HMGBl protein (10 ⁇ g) was radiolabeled with 0.2 mCi of carrier- free 125 I (NEN Life Science Products Inc., Boston, MA) using Iodo-beads (Pierce, Rockford, IL) according to the manufacturer's instructions.
  • 125 I-HMGB1 protein was separated from un-reacted 125 I by gel chromatography columns (P6 Micro Bio-Spin Chromatography Columns, Bio-Rad Laboratories, Hercules, CA) previously equilibrated with 300 mM sodium chloride, 17.5 mM sodium citrate, pH 7.0, and 0.1%) bovine serum albumin (BSA).
  • BSA bovine serum albumin
  • TNF knock out mice were obtained from Amgen (Thousand Oaks, CA) and were on a B6xl29 background. Age-matched wild-type B6xl29 mice were used as a control for the studies. Mice were bred in-house at the University of Florida specific pathogen-free transgenic mouse facility (Gainesville, FL) and were used at 6-8 weeks of age.
  • mice Male 6-8 week old Balb/c and C3H/HeJ mice were purchased from Harlen Sprague-Dawley (Indianapolis, IN) and were allowed to acclimate for 7 days before use in experiments. All animals were housed in the North Shore University Hospital Animal Facility under standard temperature, and a light and dark cycle.
  • Cecal ligation and puncture was performed as described previously (Fink and Heard, J. Surg. Res. 49:186-196, 1990; Wichmann et al, Crit. Care Med. 26:2078-2086, 1998; and Remick et al, Shock 4:89-95, 1995). Briefly, Balb/c mice were anesthetized with 75 mg/kg ketamine (Fort Dodge, Fort Dodge, Iowa) and 20 mg/kg of xylazine (Bohringer Ingelheim, St. Joseph, MO) intramuscularly. A midline incision was performed, and the cecum was isolated. A 6-0 prolene suture ligature was placed at a level 5.0 mm from the cecal tip away from the ileocecal valve.
  • the ligated cecal stump was then punctured once with a 22-gauge needle, without direct extrusion of stool.
  • the cecum was then placed back into its normal intra-abdominal position.
  • the abdomen was then closed with a running suture of 6-0 prolene in two layers, peritoneum and fascia separately to prevent leakage of fluid.
  • All animals were resuscitated with a normal saline solution administered sub- cutaneously at 20 ml/kg of body weight.
  • Each mouse received a subcutaneous injection of imipenem (0.5 mg/mouse) (Primaxin, Merck & Co., Inc., West Point, PA) 30 minutes after the surgery. Animals were then allowed to recuperate. Mortality was recorded for up to 1 week after the procedure; survivors were followed for 2 weeks to ensure no late mortalities had occurred.
  • mice were injected intraperitoneally with 20 mg D-galactosamine-HCL (Sigma)/mouse (in 200. ⁇ l PBS) and 0.1 or 1 mg of either HMBG1 B box or vector protein (in 200 ⁇ l PBS). Mortality was recorded daily for up to 72 hours after injection; survivors were followed for 2 weeks, and no later deaths from B box toxicity were observed.
  • Spleen bacteria were recovered as described previously (Villa et al., J. Endotoxin Res. 4:197-204, 1997). Spleens were removed using sterile technique and homogenized in 2 ml of PBS. After serial dilutions with PBS, the homogenate was plated as 0.15 ml aliquots on tryptic soy agar plates (Difco, Detroit, MI) and CFU were counted after overnight incubation at 37°C.
  • HMGBl has 2 folded DNA binding domains (A and B boxes) and a negatively-charged acidic carboxyl tail.
  • a and B boxes DNA binding domains
  • carboxyl tail a negatively-charged acidic carboxyl tail.
  • mutants of human HMGBl were made by polymerase chain reaction (PCR) using specific primers as described herein, and the mutant proteins were expressed using a glutathione S-transferase (GST) gene fusion system (Pharmacia Biotech, Piscataway, NJ) in accordance with the manufacturer's instructions. Briefly, DNA fragments, made by PCR methods, were fused to GST fusion vectors and amplified in E. coli. The expressed HMGBl protein and HMGBl mutants were then isolated using a GST affinity column.
  • GST glutathione S-transferase
  • RAW 264.7 cells were cultured in RPMI 1640 medium (Life Technologies, Grand Island NY) supplemented with 10% fetal bovine serum (Gemini, Catabasas, CA), penicillin and streptomycin (Life Technologies). Polymyxin (Sigma, St. Louis, MO) was added at 100 units/ml to suppress the activity of any contaminating LPS. Cells were incubated with 1 ⁇ g/ml of full length (wild-type) HMGBl and each HMGBl mutant protein in Opti- MEM I medium for 8 hours.
  • TNF released from the cells was measured by a standard murine fibroblast L929 (ATCC) cytotoxicity bioassay (Bianchi et al., supra) with the minimum detectable concentration of 30 pg/ml.
  • HMGBl and carboxy 1-truncated HMGBl significantly stimulated TNF release by monocyte cultures (murine macrophage-like RAW 264.7 cells).
  • the B box was a potent activator of monocyte TNF release. This stimulating effect ofthe B box was specific, because A box only weakly activated TNF release.
  • HMGBl B box varying amounts of HMGBl B box were evaluated for the effects on TNF, IL-1B, and IL-6 production in murine macrophage-like RAW 264.7 cells.
  • RAW 264.7 cells were stimulated with B box protein at 0-10 ⁇ g/ml, as indicated in FIGS. 2A-2C for 8 hours.
  • Conditioned media were harvested and measured for TNF, IL-l ⁇ and IL-6 levels. TNF levels were measured as described herein, and IL-l ⁇ and IL-6 levels were measured using the mouse IL-l ⁇ and IL-6 enzyme-linked immunosorbent assay (ELISA) kits (R&D System Inc., Minneapolis, MN) and N>5 for all experiments.
  • ELISA enzyme-linked immunosorbent assay
  • FIGS. 2A-2C The results ofthe studies are shown in FIGS. 2A-2C.
  • TNF release from RAW 264.7 cells increased with increased amounts of B box administered to the cells.
  • FIG. 2B addition of 1 ⁇ g/ml or 10 ⁇ g/ml of B box resulted in increased release of IL-l ⁇ from RAW 264.7 cells.
  • FIG. 2C IL-6 release from RAW 264.7 cells increased with increased amounts of B box administered to the cells. The kinetics of B box-induced TNF release were also examined.
  • TNF release and TNF mRNA expression were measured in RAW 264.7 cells induced by B box polypeptide or GST tag polypeptide only used as a control (vector) (10 ⁇ g/ml) for 0 to 48 hours.
  • RNAzol B RNAzol B method in accordance with the manufacturer's instructions (Tel-Test "B", Inc., Friendswood, TX). TNF (287 bp) was measured by RNase protection assay (Ambion, Austin, TX). Equal loading and the integrity of RNA was verified by ethidium bromide staining ofthe RNA sample on an agarose-formaldehyde gel. The results ofthe RNase protection assay are shown in FIG. 2D. As shown in FIG. 2D, B box activation of monocytes occurred at the level of gene transcription, because TNF mRNA was increased significantly in monocytes exposed to B box protein (FIG. 2B).
  • TNF mRNA expression was maximal at 4 hours and decreased at 8 and 24 hours.
  • the vector only control (GST tag) showed no effect on TNF mRNA expression.
  • a similar study was carried out measuring TNF protein released from RAW 264.7 cells 0, 4, 8, 24, 32 or 48 hours after administration of B box or vector only (GST tag), using the L929 cytotoxicity assay described herein. Compared to the control (medium only), B box treatment stimulated TNF protein expression (FIG. 2E) and vector alone (FIG. 2F) did not. Data are representative of three separate experiments. Together these data indicate that the HMGB 1 B box domain has cytokine activity and is responsible for the cytokine stimulating activity of full length HMGB 1.
  • HMGBl B box dose-dependently stimulated release of TNF, IL-l ⁇ and IL-6 from monocyte cultures (FIGS. 2A-2C), in agreement with the inflammatory activity of full length HMGBl (Andersson et al., J. Exp. Med. 192: 565-570, 2000).
  • these studies indicate that maximum TNF protein release occurred within 8 hours (FIG. 2E).
  • This delayed pattern of TNF release is similar to TNF release induced by HMGBl itself, and is significantly later than the kinetics of TNF induced by LPS (Andersson et al, supra).
  • Example 4 The First 20 Amino Acids ofthe HMGBl B Box Stimulate TNF Activity
  • the TNF-stimulating activity ofthe HMGBl B box was further mapped. This study was carried out as follows. Fragments ofthe B box were generated using synthetic peptide protection techniques, as described herein. Five HMGBl B box fragments (from SEQ ID NO:20), containing amino acids 1-20, 16-25, 30-49, 45-64, or 60-74 ofthe HMGBl B box were generated, as indicated in FIG. 3. RAW 264.7 cells were treated with B box (1 ⁇ g/ml) or a synthetic peptide fragment ofthe B box (10 ⁇ g/ml), as indicated in FIG.
  • TNF-stimulating activity was retained by a synthetic peptide corresponding to amino acids 1-20 ofthe HMGBl B box of SEQ ID NO:20 (flcdpnaplcrlpsafflfcse; SEQ ID NO :23).
  • the TNF stimulating activity of the 1 -20- mer was less potent than either the full length synthetic B box (1-74-mer), or full length HMGBl, but the stimulatory effects were specific because the synthetic 20- mers for amino acid fragments containing 16-25, 30-49, 45-64, or 60-74 ofthe HMGBl B box did not induce TNF release.
  • This B box fragment can be used in the same manner as a polypeptide encoding a full length B box polypeptide, for example, to stimulate release of a proinflammatory cytokine, or to treat a condition in a patient characterized by activation of an inflammatory cytokine cascade.
  • HMGBl A box only weakly induced TNF production, as shown in FIG. 1, the ability of HMGBl A box to act as an antagonist of HMGBl activity was evaluated. This study was carried out as follows. Sub-confluent RAW 264.7 cells in 24-well dishes were treated with HMGBl (1 ⁇ g/ml) and 0, 5, 10, or 25 ⁇ g/ml of A box for 16 hours in Opti-MEM I medium in the presence of polymyxin B (100 units/ml).
  • the TNF-stimulating activity (assayed using the L929 cytotoxicity assay described herein) in the sample receiving no A box was expressed as 100%, and the inhibition by A box was expressed as percent of HMGBl alone.
  • the results ofthe effect of A box on TNF release from RAW 264.7 cells is shown in FIG. 4A.
  • Antagonism of full length HMGBl activity by HMGBl was also determined by measuring TNF release from RAW 264.7 macrophage cultures stimulated by co-addition of A box with full length HMGBl.
  • RAW 264.7 macrophage cells ATCC were seeded into 24-well tissue culture plates and used at 90% confluence. The cells were treated with HMGBl, and/or A boxes as indicated for 16 hours in Optimum I medium (Life Technologies, Grand Island, NY) in the presence of polymyxin B (100 units/ml, Sigma, St. Louis, MO) and supematants were collected for TNF measurement (mouse ELISA kit from R&D System Inc, Minneapolis, MN).
  • FIG. 4B is a histogram ofthe effect of HMGBl (HMG-1), alone, A box alone, Vector (control) alone, HMGBl in combination with A box, and HMGBl in combination with vector. As shown in FIG. 4B, HMGBl A box significantly attenuated the TNF stimulating activity of full length HMGBl.
  • Example 7 HMGBl A Box Protein Inhibits HMGBl Cytokine Activity by Binding to It
  • HMGBl A box acts as an antagonist by displacing HMGBl binding
  • 125 I-labeled-HMGBl was added to macrophage cultures and binding was measured at 4°C after 2 hours. Binding assays in RAW 264.7 cells were performed as described herein. 125 I-HMGB1 binding was measured in RAW 264.7 cells plated in 24-well dishes for the times indicated in FIG. 5A. Specific binding shown equals total cell-associated 125 I-HMGB1 (CPM/well) minus cell associated CPM/well in the presence of 5,000 fold molar excess of unlabeled HMGBl.
  • FIG. 5 A is a graph ofthe binding of 125 I-HMGB1 over time. As shown in FIG. 5 A,
  • HMGBl exhibited saturable first order binding kinetics. The specificity of binding was assessed as described in Example 1.
  • FIG. 5B is a histogram ofthe cell surface binding of 125 I-HMGB1 in the absence of unlabeled HMGBl or HMGBl A box, or in the presence of 5,000 molar excess of unlabeled HMGBl or HMGBl A box, measured as a percent ofthe total CPM/well.
  • Total equals counts per minutes (CPMVwell of cell associated 125 I-HMGB1 in the absence of unlabeled HMGBl or A box for 2 hours at 4°C.
  • HMGBl or A box equals CPM/well of cell-associated 125 I-HMGB1 in the presence of 5,000 molar excess of unlabeled HMGBl or unlabeled A box. The data are expressed as the percent of total counts obtained in the absence of unlabeled HMGBl proteins (2,382,179 CPM/well).
  • Example 8 Inhibition of Full Length HMGBl and HMGBl B Box Cytokine Activity by Anti-B Box Polyclonal Antibodies.
  • HMGBl B box antibodies The ability of antibodies directed against the HMGBl B box to modulated the effect of full length or HMGB 1 B box was also assessed.
  • Affinity purified antibodies directed against the HMGBl B box (B box antibodies) were generated as described herein and using standard techniques.
  • To assay the effect ofthe antibodies on HMGBl -induced or HMGBl B box-induced TNF release from RAW 264.7 cells sub-confluent RAW 264.7 cells in 24-well dishes were treated with HMG-1 (1 ⁇ g/ml) or HMGB 1 B box (10 ⁇ g/ml) for 10 hours with or without anti-B box antibody (25 ⁇ g/ml or 100 ⁇ g/ml antigen affinity purified, Cocalico Biologicals, Inc., Reamstown, PA) or non-immune IgG (25 ⁇ g/ml or 100 ⁇ g/ml; Sigma) added.
  • FIG. 6 is a histogram of TNF released by RAW 264.7 cells administered nothing, 1 ⁇ g/ml of HMGB 1 , 1 ⁇ g/ml of HMGBl plus 25 ⁇ g/ml of anti-B box antibody, 1 ⁇ g/ml of HMGBl plus 25 ⁇ g/ml of IgG (control), 10 ⁇ g/ml of B-box, 10 ⁇ g/ml of B-box plus 100 ⁇ g/ml of anti-B box antibody or 10 ⁇ g/ml of B-box plus 100 ⁇ g/ml of IgG (control).
  • the amount of TNF released from the cells induced by HMGBl alone (without addition of B box antibodies) was set as 100%, and the data shown in FIG. 6 are the results of 3 independent experiments. As shown in FIG. 6, affinity purified antibodies directed against the HMGBl B box significantly inhibited TNF release induced by either full length HMGBl or the HMGBl B box. These results indicate that such an antibody can be used to modulate HMGBl function.
  • mice (20-25 grams, male, Harlan Sprague-Dawley, Indianapolis, IN) were intraperitoneally injected with D-gal (20 mg) (Sigma, St. Louis, Missouri) and B box (0.1 mg/ml/mouse or 1 mg/ml/mouse) or GST tag (vector; 0.1 mg/ml/mouse or 1 mg/ml/mouse), as indicated in Table 1. Survival of the mice was monitored up to 7 days to ensure no late death occurred. The results of this study are shown in Table 1. Table 1: Toxicity of HMGBl B box on D-galactosamine-sensitized Balb/c Mice
  • mice treated with comparable preparations ofthe purified GST vector protein devoid of B box were lethal to D- galactosamine-sensitized mice in a dose-dependent mamier. In all instances in which death occurred, it occurred within 12 hours. Lethality was not observed in mice treated with comparable preparations ofthe purified GST vector protein devoid of B box.
  • Example 10 Histology of D-galactosamine-sensitized Balb/c Mice or C3H/HeJ Mice Administered HMGBl B Box Protein
  • mice D-galactosamine-sensitized Balb/c mice.
  • Mice (3 per group) received D-gal (20 mg/mouse) plus B box or vector (1 mg/mouse) intraperitoneally for 7 hours and were then sacrificed by decapitation. Blood was collected, and organs (liver, heart, kidney and lung) were harvested and fixed in 10% formaldehyde. Tissue sections were prepared with hematoxylin and eosin staining for histological evaluation (Criterion Inc., Vancouver, Canada). The results of these studies are shown in FIGS.
  • FIG. 7A-7J which are scanned images of hematoxylin and eosin stained kidney sections (FIG. 7A), myocardium sections (FIG. 7C), lung sections (FIG. 7E), and liver sections (FIGS. 7G and 71) obtained from an untreated mouse and kidney sections (FIG. 7B), myocardium sections (FIG. 7D), lung sections (FIG. 7F), and liver sections (FIGS. 7H and 7J) obtained from mice treated with the HMGB 1 B box.
  • B box treatment caused no abnormality in kidneys (FIGS. 7A and 7B) and lungs (FIGS. 7E and 7F).
  • mice had some ischemic changes and loss of cross striation in myocardial fibers in the heart (FIGS. 7C and 7D as indicated by the arrow in FIG. 7D).
  • Liver showed most ofthe damage by the B box as illustrated by active hepatitis (FIGS. 7G-7J).
  • FIG. 7J hepatocyte dropouts are seen surrounded by accumulated polymorphonuclear leukocytes.
  • the arrows in FIG. 7J point to the sites of polymorphonuclear accumulation (dotted) or apoptotic hepatocytes (solid).
  • Administration of HMGBl B box in vivo also stimulated significantly increased serum levels of IL-6 (315+93 vs.20+7 pg/ml, B box vs. control, p ⁇ 0.05) and IL-l ⁇ (15+3 vs. 4+1 pg/ml, B box vs. control, p ⁇ 0.05).
  • TNF-KO TNF knock-out mice
  • wild-type controls B6xl29 strain sensitized with D- galactosamine (20 mg/mouse) and exposed to B box (1 mg/mouse, injected intraperitoneally).
  • the B box was highly lethal to the wild-type mice (6 dead out of nine exposed) but lethality was not observed in the TNF-KO mice treated with B box (0 dead out of 9 exposed, p ⁇ 0.05 v. wild type).
  • FIG. 8 shows the results of this study in a graph that illustrates the levels of HMGBl in mice 0 hours, 8 hours, 18 hours, 24 hours, 48 hours, and 72 hours after subjection to CLP.
  • serum HMGBl levels were not significantly increased for the first eight hours after cecal perforation, then increased significantly after 18 hours (FIG. 8).
  • Increased serum HMGBl remained at elevated plateau levels for at least 72 hours after CLP, a kinetic profile that is quite similar to the previously-described, delayed HMGB 1 kinetics in endotoxemia (Wang et al., supra). This temporal pattern of HMGBl release corresponded closely to the development of signs of sepsis in the mice.
  • mice were subjected to cecal perforation and treated by administration of A box beginning 24 hours after the onset of sepsis.
  • CLP was performed on male Balb/c mice as described herein. Animals were randomly grouped, with 15-25 mice per group.
  • the HMGBl A box (60 or 600 ⁇ g/mouse each time) or vector (GST tag, 600 ⁇ g/mouse) alone was administered intraperitoneally twice daily for 3 days beginning 24 hours after CLP. Survival was monitored twice daily for up to 2 weeks to ensure no late death occurred. The results of this study are illustrated in FIG.
  • the rescuing effects ofthe HMGBl A box in this sepsis model were A box dose-dependent; animals treated with 600 ⁇ g/mouse of A box were observed to be significantly more alert, active, and to resume feeding behavior as compared to either control animals treated with vector-derived preparations, or to animals treated with only 60 ⁇ g A box. The latter animals remained gravely ill, with depressed activity and feeding for several days, and most died.
  • FIG. 10 A is a graph ofthe survival of septic mice treated with either a control antibody or an anti- HMGB 1 antibody.
  • CFU the aerobic colony forming units
  • anti-HMGB 1 B box antibodies were evaluated for their ability to rescue LPS-induced septic mice.
  • Male Balb/c mice (20-25 gm, 26 per group) were treated with an LD75 dose of LPS (15 mg/kg) injected intraperitoneally (IP).
  • Anti-HMGB 1 B box or non-immune rabbit serum (0.3 ml per mouse each time, IP) was given at time 0, +12 hours and +24 hours after LPS administration. Survival of mice was evaluated over time. The results of this study are shown in FIG. 10B, which is a graph ofthe survival of septic mice administered anti-HMGB 1 B box antibodies or non-immune serum. As shown in FIG. 10B, anti-HMGB 1 B box antibodies improved survival ofthe septic mice.
  • Example 14 Inhibition of HMGBl Signaling Pathway Using an Anti-RAGE Antibody
  • HMGBl HMG-1; 1 ⁇ g/ml
  • LPS 0.1 ⁇ g/ml
  • HMGBl B box B Box; 1 ⁇ g/ml
  • anti-RAG ⁇ antibody 25 ⁇ g/ml
  • non-immune IgG 25 ⁇ g/ml
  • supematants were collected for TNF measurement using the L929 cytotoxicity assay described herein.
  • IgG purified polyclonal anti- RAG ⁇ antibody Catalog No.
  • FIG. 11 A is a histogram ofthe effects of HMGB 1, LPS, or HMGB 1 B box in the presence of anti-RAG ⁇ antibodies or non-immune IgG (control) on TNF release from RAW 264.7 cells.
  • anti-RAG ⁇ antibody significantly inhibited HMGBl B box-induced TNF release. This suppression was specific, because anti-RAG ⁇ did not significantly inhibit LPS-stimulated TNF release.
  • the maximum inhibitory effect of anti- RAGE decreased HMG-1 signaling by only 40%, suggesting that other signal transduction pathways may participate in HMGBl signaling.
  • HMGB 1 or HMGB 1 B box were transiently co-transfected with an expression plasmid encoding a murine MyD 88-dominant-negative (DN) mutant (corresponding to amino acids 146-296), or empty vector, plus a luciferase reporter plasmid under the control ofthe NF- ⁇ B -dependent ELAM promoter, as described by Means et al. (J. Immunol. 166:4074-4082, 2001).
  • DN MyD 88-dominant-negative
  • HMGBl full-length HMGBl (100 ng/ml), or purified HMGBl B box (10 ⁇ g/ml), for 5 hours.
  • Cells were then harvested and luciferase activity was measured, using standard methods. All transfections were performed in triplicate, repeated at least three times, and a single representative experiment is shown in FIG. 1 IB.
  • HMGBl stimulated luciferase activity in samples that were not co-transfected with the MyD 88 dominant negative, and the level of stimulation was decreased in samples that were co-transfected with the MyD 88 dominant negative. This effect was also observed in samples administered HMGB B box.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Engineering & Computer Science (AREA)
  • Immunology (AREA)
  • Heart & Thoracic Surgery (AREA)
  • Cardiology (AREA)
  • Pulmonology (AREA)
  • Communicable Diseases (AREA)
  • Oncology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Zoology (AREA)
  • Dermatology (AREA)
  • Rheumatology (AREA)
  • Biophysics (AREA)
  • Hematology (AREA)
  • Obesity (AREA)
  • Physical Education & Sports Medicine (AREA)
  • Child & Adolescent Psychology (AREA)
  • Pain & Pain Management (AREA)
  • Toxicology (AREA)
  • Neurosurgery (AREA)
  • Neurology (AREA)
  • Biochemistry (AREA)
  • Diabetes (AREA)
  • Genetics & Genomics (AREA)
  • Molecular Biology (AREA)
  • Biomedical Technology (AREA)
EP03789973A 2002-11-20 2003-11-20 Verwendung vonhmgb-fragmenten als entzündungshemmende mittel Withdrawn EP1569684A4 (de)

Applications Claiming Priority (5)

Application Number Priority Date Filing Date Title
US42784602P 2002-11-20 2002-11-20
US42784102P 2002-11-20 2002-11-20
US427841P 2002-11-20
US427846P 2002-11-20
PCT/US2003/037507 WO2004046345A2 (en) 2002-11-20 2003-11-20 Use of hmgb fragments as anti-inflammatory agents

Publications (2)

Publication Number Publication Date
EP1569684A2 true EP1569684A2 (de) 2005-09-07
EP1569684A4 EP1569684A4 (de) 2006-08-02

Family

ID=32329191

Family Applications (1)

Application Number Title Priority Date Filing Date
EP03789973A Withdrawn EP1569684A4 (de) 2002-11-20 2003-11-20 Verwendung vonhmgb-fragmenten als entzündungshemmende mittel

Country Status (6)

Country Link
EP (1) EP1569684A4 (de)
JP (1) JP2006510619A (de)
AU (1) AU2003294488B2 (de)
CA (1) CA2506328A1 (de)
NZ (1) NZ540067A (de)
WO (1) WO2004046345A2 (de)

Families Citing this family (35)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US6303321B1 (en) 1999-02-11 2001-10-16 North Shore-Long Island Jewish Research Institute Methods for diagnosing sepsis
US7304034B2 (en) 2001-05-15 2007-12-04 The Feinstein Institute For Medical Research Use of HMGB fragments as anti-inflammatory agents
US7696169B2 (en) 2003-06-06 2010-04-13 The Feinstein Institute For Medical Research Inhibitors of the interaction between HMGB polypeptides and toll-like receptor 2 as anti-inflammatory agents
WO2005025604A2 (en) * 2003-09-10 2005-03-24 The General Hospital Corporation Use of hmgb and hmgb fragments to decrease specific immune response
CA2882022A1 (en) 2003-09-11 2005-03-24 Walter Newman Monoclonal antibodies against hmgb1
PT1768677E (pt) * 2004-07-02 2008-10-06 Creabilis Therapeutics Spa Ácidos nucleicos para o tratamento de patologias relacionadas com hmgb1
EP1814576A2 (de) * 2004-07-20 2007-08-08 Critical Therapeutics, Inc. Kombinationstherapien von hmgb- und komplementinhibitoren gegen entzündungen
EP1797118A2 (de) * 2004-09-03 2007-06-20 Creabilis Therapeutics S.P.A. Protease resistente mutanten von humanem und nicht-humanem hmgb1 box-a protein und dessen therapeutische/diagnistische verwendung
WO2007001422A2 (en) * 2004-10-22 2007-01-04 Medimmune, Inc. High affinity antibodies against hmgb1 and methods of use thereof
WO2006138429A2 (en) * 2005-06-16 2006-12-28 The Feinstein Institute For Medical Research Antibodies against hmgb1 and fragments thereof
US20100040608A1 (en) * 2005-07-18 2010-02-18 Marie Wahren-Herlenius Use of HMGB1 antagonists for the treatment of inflammatory skin conditions
WO2007031100A1 (en) * 2005-09-14 2007-03-22 Ostini, Marco Active immunotherapy of life-threatening systemic inflammation
AU2006312847A1 (en) * 2005-11-09 2007-05-18 Pharmexa A/S Therapeutic vaccines targeting HMGB1
CA2663300C (en) * 2006-09-15 2014-10-07 Creabilis Therapeutics S.P.A. Polymer conjugates of box-a of hmgb1 and box-a variants of hmgb1
ES2520026T3 (es) 2006-09-18 2014-11-11 The Board Of Trustees Of The University Of Arkansas Composiciones y métodos para potenciar respuestas inmunitarias
US8470325B2 (en) 2007-02-15 2013-06-25 Kagoshima University Method of treating amykloidosis comprising administering an anti-HMGB-1 antibody
WO2009133943A1 (ja) 2008-04-30 2009-11-05 株式会社ジェノミックス 生体内機能的細胞の高効率採取法
CN102711777B (zh) 2009-10-28 2015-04-15 吉诺米克斯股份有限公司 利用骨髓间充质干细胞和/或多能干细胞的血中动员的组织再生促进剂
CN102811734B (zh) 2010-01-21 2016-02-10 阿肯色大学评议会 增强免疫应答的疫苗载体和方法
CN102971008B (zh) 2010-06-09 2015-11-25 阿肯色大学评议会 降低弯曲菌属感染的疫苗和方法
DK2703487T3 (en) 2011-04-26 2018-09-10 Genomix Co Ltd TIME TO INDUCTION Tissue Regeneration and its Use
EP2913059B1 (de) 2012-10-25 2018-04-11 Genomix Co., Ltd. Neuartiges verfahren zur behandlung von rückenmarksverletzungen mit hmgb1-fragmenten
RU2647467C2 (ru) 2012-10-25 2018-03-15 Дженомикс Ко., Лтд. Новый способ лечения инфаркта миокарда с применением фрагмента hmgb1
MX2015009547A (es) 2013-01-28 2015-11-25 Evec Inc Anticuerpo anti-hmgb1 humanizado o fragmento de union al antigeno del mismo.
US9603915B2 (en) 2013-02-14 2017-03-28 The Board of Trustees of the University of Akansas Compositions and methods of enhancing immune responses to Eimeria or limiting Eimeria infection
BR112015023024B1 (pt) 2013-03-15 2022-04-19 The Board Of Trustees Of The University Of Arkansas Vetor de vacina e composições farmacêuticas compreendendo o mesmo
KR102767638B1 (ko) 2016-05-03 2025-02-20 더 보드 오브 트러스티스 오브 더 유니버시티 오브 아칸소 면역자극 및 항원 폴리펩티드를 포함하는 효모 백신 벡터, 및 그를 이용하는 방법
BR112019014921A2 (pt) 2017-01-27 2020-03-31 StemRIM Inc. Agente terapêutico para miocardiopatia, infarto antigo do miocárdio e insuficiência cardíaca crônica
EP3595445B1 (de) 2017-03-15 2024-09-04 The Research Institute at Nationwide Children's Hospital Zusammensetzung und verfahren zur brechung bakterieller biofilme ohne begleitentzündung
US11298403B2 (en) 2017-12-01 2022-04-12 StemRIM Inc. Therapeutic agent for inflammatory bowel disease
EP3719117A4 (de) 2017-12-01 2021-11-03 Stemrim Inc. Ektoderme mesenchymale stammzellen und verfahren zur herstellung davon
US20210024594A1 (en) * 2018-02-08 2021-01-28 StemRIM Inc. Therapeutic Agent for Psoriasis
US12304933B2 (en) 2018-10-05 2025-05-20 StemRIM Inc. Disease treatment drug based on mesenchymal-stem-cell mobilization
EP3860718A4 (de) 2018-10-05 2022-08-31 Research Institute at Nationwide Children's Hospital Hmgb1-proteinderivate zur entfernung von biofilmen
CN111743890A (zh) * 2019-03-26 2020-10-09 深圳先进技术研究院 水绫霉素或其衍生物的用途

Family Cites Families (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US6303321B1 (en) * 1999-02-11 2001-10-16 North Shore-Long Island Jewish Research Institute Methods for diagnosing sepsis
CA2296792A1 (en) * 1999-02-26 2000-08-26 Genset S.A. Expressed sequence tags and encoded human proteins

Non-Patent Citations (5)

* Cited by examiner, † Cited by third party
Title
DAILEY LISA ET AL: "Coevolution of HMG domains and homeodomains and the generation of transcriptional regulation by Sox/POU complexes" JOURNAL OF CELLULAR PHYSIOLOGY, vol. 186, no. 3, March 2001 (2001-03), pages 315-328, XP002373261 ISSN: 0021-9541 *
DATABASE Geneseq [Online] 6 October 2000 (2000-10-06), "Human secreted protein, SEQ ID NO: 7904." XP002373264 retrieved from EBI accession no. GSN:AAG03823 Database accession no. AAG03823 & EP 1 033 401 A (SERONO GENETICS INSTITUTE S.A; GENSET) 6 September 2000 (2000-09-06) *
ROGALLA P ET AL: "Mapping and molecular characterization of five HMG1-related DNA sequences" CYTOGENETICS AND CELL GENETICS, vol. 83, no. 1-2, 1998, pages 124-129, XP009063822 ISSN: 0301-0171 *
See also references of WO2004046345A2 *
YANG HUAN ET AL: "Reversing established sepsis with antagonists of endogenous high-mobility group box 1." PROCEEDINGS OF THE NATIONAL ACADEMY OF SCIENCES OF THE UNITED STATES OF AMERICA, vol. 101, no. 1, 6 January 2004 (2004-01-06), pages 296-301, XP002373262 ISSN: 0027-8424 *

Also Published As

Publication number Publication date
JP2006510619A (ja) 2006-03-30
NZ540067A (en) 2007-05-31
WO2004046345A2 (en) 2004-06-03
CA2506328A1 (en) 2004-06-03
AU2003294488A1 (en) 2004-06-15
EP1569684A4 (de) 2006-08-02
AU2003294488B2 (en) 2007-05-24
WO2004046345A3 (en) 2004-12-02

Similar Documents

Publication Publication Date Title
AU2003294488B2 (en) Use of HMGB fragments as anti-inflammatory agents
US8501173B2 (en) Antibodies to high mobility group-1(HMGB1) B-box polypeptides
AU2002309829B2 (en) Use of HMG fragment as anti-inflammatory agents
US20080124320A1 (en) Use of HMGB fragments as anti-inflammatory agents
AU2002309829A1 (en) Use of HMG fragment as anti-inflammatory agents
JP2005512507A6 (ja) 抗炎症剤としてのhmgフラグメントの使用
US20060111287A1 (en) Acetylated protein
EA003675B1 (ru) Белки, связывающие интерлейкин-18, их получение и применение
WO2005026209A2 (en) Monoclonal antibodies against hmgb1
US20040156851A1 (en) HMGB1 combination therapies
JP2003532370A (ja) 新規なTh2特異的分子およびその使用方法
US5905146A (en) DNA binding protein S1-3
AU2007234583B2 (en) Use of HMG fragment as anti-inflammatory agents
EP2364998A1 (de) Antikörper gegen HMGB1 und Fragmente davon
AU2007205777A1 (en) Use of HMGB fragments as anti-inflammatory agents
KR20010085816A (ko) 면역 관련 질환 치료용 조성물 및 치료 방법

Legal Events

Date Code Title Description
PUAI Public reference made under article 153(3) epc to a published international application that has entered the european phase

Free format text: ORIGINAL CODE: 0009012

17P Request for examination filed

Effective date: 20050616

AK Designated contracting states

Kind code of ref document: A2

Designated state(s): AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HU IE IT LI LU MC NL PT RO SE SI SK TR

AX Request for extension of the european patent

Extension state: AL LT LV MK

DAX Request for extension of the european patent (deleted)
A4 Supplementary search report drawn up and despatched

Effective date: 20060630

RIN1 Information on inventor provided before grant (corrected)

Inventor name: O'KEEFE, THERESA, L.

Inventor name: NEWMAN, WALTER

17Q First examination report despatched

Effective date: 20080818

STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: THE APPLICATION IS DEEMED TO BE WITHDRAWN

18D Application deemed to be withdrawn

Effective date: 20081230