EP1220894A1 - Prpp-amidotransferase aus nicotiana tabacum - Google Patents
Prpp-amidotransferase aus nicotiana tabacumInfo
- Publication number
- EP1220894A1 EP1220894A1 EP00969449A EP00969449A EP1220894A1 EP 1220894 A1 EP1220894 A1 EP 1220894A1 EP 00969449 A EP00969449 A EP 00969449A EP 00969449 A EP00969449 A EP 00969449A EP 1220894 A1 EP1220894 A1 EP 1220894A1
- Authority
- EP
- European Patent Office
- Prior art keywords
- plant
- prpp amidotransferase
- seq
- plants
- activity
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Withdrawn
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/82—Vectors or expression systems specially adapted for eukaryotic hosts for plant cells, e.g. plant artificial chromosomes (PACs)
- C12N15/8241—Phenotypically and genetically modified plants via recombinant DNA technology
- C12N15/8242—Phenotypically and genetically modified plants via recombinant DNA technology with non-agronomic quality (output) traits, e.g. for industrial processing; Value added, non-agronomic traits
- C12N15/8243—Phenotypically and genetically modified plants via recombinant DNA technology with non-agronomic quality (output) traits, e.g. for industrial processing; Value added, non-agronomic traits involving biosynthetic or metabolic pathways, i.e. metabolic engineering, e.g. nicotine, caffeine
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/82—Vectors or expression systems specially adapted for eukaryotic hosts for plant cells, e.g. plant artificial chromosomes (PACs)
- C12N15/8241—Phenotypically and genetically modified plants via recombinant DNA technology
- C12N15/8242—Phenotypically and genetically modified plants via recombinant DNA technology with non-agronomic quality (output) traits, e.g. for industrial processing; Value added, non-agronomic traits
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/82—Vectors or expression systems specially adapted for eukaryotic hosts for plant cells, e.g. plant artificial chromosomes (PACs)
- C12N15/8241—Phenotypically and genetically modified plants via recombinant DNA technology
- C12N15/8261—Phenotypically and genetically modified plants via recombinant DNA technology with agronomic (input) traits, e.g. crop yield
- C12N15/8271—Phenotypically and genetically modified plants via recombinant DNA technology with agronomic (input) traits, e.g. crop yield for stress resistance, e.g. heavy metal resistance
- C12N15/8274—Phenotypically and genetically modified plants via recombinant DNA technology with agronomic (input) traits, e.g. crop yield for stress resistance, e.g. heavy metal resistance for herbicide resistance
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/10—Transferases (2.)
- C12N9/1048—Glycosyltransferases (2.4)
- C12N9/1077—Pentosyltransferases (2.4.2)
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2430/00—Assays, e.g. immunoassays or enzyme assays, involving synthetic organic compounds as analytes
- G01N2430/20—Herbicides, e.g. DDT
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2500/00—Screening for compounds of potential therapeutic value
Definitions
- the present invention relates to the identification of plant PRPP amidotransferase (phosphoribosyl pyrophosphate A idotransferase, E.C. 2.4.2.14) as a new target for herbicidal active compounds.
- the present invention further relates to DNA sequences coding for a polypeptide with PRPP amidotransferase activity.
- the invention relates to the use of a nucleic acid coding for a protein with PRPP amidotransferase activity of plant origin for the production of a test system for identifying inhibitors of PRPP amidotransferase with herbicidal activity and inhibitors of plant PRPP amidotransferase identified using this test system.
- the invention further relates to the use of the nucleic acid SEQ-ID No. 1 or SEQ-ID No. 3 coding for plant PRPP amidotransferase for the production of plants with increased resistance to inhibitors of PRPP amidotransferase, and for the production of plants with a modified purine nucleotide content.
- the invention relates to a method for eliminating undesirable plant growth, the plants to be removed being treated with a compound which is specifically PRPP amidotransferase, coded by a DNA sequence SEQ-ID No. 1 or a DNA sequence hybridizing with this DNA sequence, binds and inhibits their function.
- Plants are able to synthesize their cell components from carbon dioxide, water and inorganic salts.
- Nucleotides are synthesized de novo in plants. They are of particular importance as part of the nucleic acids. In a covalent bond, nucleotides activate carbohydrates for the biosynthesis of polysaccharides. They also activate head groups for the biosynthesis of lipids. Nucleotides are involved in almost all metabolic pathways. Nucleoside triphosphates, especially ATP, drive most of the cell's energy-intensive reactions. Adenine nucleotides can also be found as a component in essential factors such as coenzyme A, as well as nicotinamide and flavin coenzymes, which are involved in many cellular reactions.
- GTP guanosine 5 x triphosphate
- Nucleotides are also the starting metabolites for the biosynthesis of methylxanthines such as caffeine and theobromine in plant families of the Rubiaceae and Theaceae.
- CDNAs coding for PRPP amidotransferase enzymes could be isolated and characterized from various bacterial, animal and plant organisms.
- Plant PRPP amidotransferase cDNAs were isolated from Glycine max, Vigna aconitifolia and from Arabid ⁇ psis thaliana by complementation of E. coli purF mutants and by DNA hybridization techniques (Ito et al., Plant Molecular Biology 26 (1994), 529-533; Kim et al., The Plant Journal 7 (1995), 77-86). Sequence homologies indicate that the encoded enzymes, like PRPP amidotransferase from E. coli, contain 4Fe-4S clusters.
- the PRPP amidotransferase amino acid sequences from plants, which are elongated in comparison to E. coli at the N terminal, are similar to plastid signal sequences.
- PRPP amidotransferase isoenzymes there are several PRPP amidotransferase isoenzymes in plants that are differentially expressed.
- the RNA for AtATasel from Arabidopsis thaliana preferentially accumulates in the roots, while the AtATase2 transcripts are found more strongly in young leaves and flowers (Ito et al., Plant Molecular Biology 26 (1994), 529-533).
- a PRPP amidotransferase RNA accumulates mainly in root nodules and is induced in root tissues by L-glutamine (Kim et al., The Plant Journal 7 (1995), 77-86).
- ASA adenylosuccinate synthetase
- Inhibitors for enzymes in purine biosynthesis are also known for their pharmacological activity in animals and microorganisms: Folate analogs inhibit, among other things, the enzyme GAR transformylase and have an antiproliferative, anti-inflammatory and immunosuppressive effect.
- Mycophenolic acid (MPA) acts as an inhibitor of IMP dehydrogenase in the GMP synthesis pathway, antimicrobial, antivi- ral and immunosuppressive (Kitchin et al., Journal of the American Acade y of Dermatology 37 (1997), 445-449).
- Bacterial PRPP amidotransferase can be inhibited, for example, by glutamine antagonists such as azaserine, 6-diazo-5-oxo-L-norleucine (DON) or L-2-amino-4-oxo-5-chloropentanoic acid as well as by mercaptopurine and thioguanosine.
- glutamine antagonists such as azaserine, 6-diazo-5-oxo-L-norleucine (DON) or L-2-amino-4-oxo-5-chloropentanoic acid as well as by mercaptopurine and thioguanosine.
- Glutamine antagonists are not specific for PRPP amidotransferase and also act on other enzymes of purine biosynthesis, e.g. the formylglycine amide ribotide synthase. A proof of the effectiveness of glutamine antagonists on plant PRPP amidotransferase is still
- the object of the present invention was to demonstrate that PRPP amidotransferase is a suitable herbicidal target in plants, the isolation of a complete plant cDNA coding for the enzyme PRPP amidotransferase and its functional expression in bacterial or eukaryotic cells, and the production of an efficient and simple PRPP amidotransferase test system for performing inhibitor-enzyme binding studies.
- the object was achieved by isolating genes which code for the plant enzyme PRPP amidotransferase, the production of antisense constructs of PRPP amidotransferase, and the functional expression of PRPP amidotransferase in bacterial or eukaryotic cells.
- One object of the present invention relates to the isolation of full-length cDNAs coding for functional PRPP amidotransferase (E.C.2.4.2.14) from tobacco (Nicotiana tabacum).
- a first object of the present invention is a DNA sequence SEQ-ID NO. 1 or SEQ ID NO. 3 containing the coding region of a plant PRPP amidotransferase from tobacco, see Example 1.
- the invention further relates to DNA sequences which are derived from SEQ-ID NO. 1 or SEQ ID NO. 3 are derived or hybridize with one of these sequences and which code for a protein which has the biological activity of a PRPP amidotransferase.
- Nicotiana tabacum cv. Samsun NN which carry an antisense construct of PRPP amidotransferase, were characterized in more detail.
- the plants show in different ways Measurements of growth retardation and fading of the leaves.
- the transgenic lines as well as the descendants of the 1st and 2nd generation showed a reduced growth in soil.
- a reduced amount of PRPP amidotransferase RNA compared to the wild type could be detected in the Northern hybridization.
- a reduced amount of PRPP amidotransferase activity in the transgenic lines could be detected in comparison with wild type plants, see Example 7.
- PRPP amidotransferase for the first time as a suitable target protein for herbicidal active ingredients.
- the expression cassette containing a DNA sequence SEQ-ID No. 1 or SEQ ID NO. 3 are expressed, for example, in other bacteria, in yeasts, fungi, algae, plant cells, insect cells or mammalian cells, see Example 4.
- the PRPP amidotransferase protein expressed with the aid of the expression cassette according to the invention is particularly suitable for the detection of inhibitors specific for PRPP amidotransferase.
- the plant PRPP amidotransferase can be used, for example, in an enzyme test in which the activity of the PRPP amidotransferase is determined in the presence and absence of the active substance to be tested. A comparison of the two activity determinations can be used to make a qualitative and quantitative statement about the inhibitory behavior of the active substance to be tested, see Example 3.
- the invention further relates to a method for identifying substances having a herbicidal action which inhibit PRPP amidotransferase activity in plants, consisting of
- transgenic plants, plant tissues or plant cells which contain an additional DNA sequence coding for an enzyme with PRPP amidotransferase activity and are able to overexpress an enzymatically active PRPP amidotransferase;
- the suppression of the growth or survivability of the non-transformed plants, plant cells, plant tissues or plant parts without, however, strongly suppressing the growth or survivability of the transgenic plants, plant cells, plant tissues or plant parts shows that the substance from b) shows herbicidal activity and inhibits PRPP amidotransferase enzyme activity in plants.
- Another object of the invention is a method for the identification of inhibitors of plant PRPP amidotransferases, with potential herbicidal activity by cloning the gene of a plant PRPP amidotransferase, overexpression in a suitable expression cassette - for example in insect cells - which opens and opens the cells Cell extract is used directly or after enrichment or isolation of the enzyme PRPP amidotransferase in a test system for measuring the enzyme activity in the presence of low molecular weight chemical compounds.
- the invention further relates to compounds with herbicidal activity which can be identified using the test system described above.
- Another object of the invention is a method for eliminating undesirable plant growth, wherein the plants to be removed are treated with a compound which specifically binds to plant PRPP amidotransferase and inhibits their function.
- PRPP amidotransferase inhibitors with herbicidal activity can be used as defoliants, desiccants, haulm killers and in particular as weed killers. Weeds in the broadest sense are understood to mean all plants that grow up in places where they are undesirable. Whether the active ingredients found with the aid of the test system according to the invention act as total or selective herbicides depends, inter alia, on the amount used.
- PRPP amidotransferase inhibitors with herbicidal activity can be used, for example, against the following weeds:
- Echinochloa Setaria, Panicum, Digitaria, Phleum, Poa, Festuca, Eleusine, Brachiaria, Lolium, Bromus, Avena, Cyperus, Sorghum, Agropyron, Cynodon, Monochoria, Fimbristylis, Sagittaria, Eleo-charis, Scirpus, Paspalum, Sphenumum, Ischaemum Dactyloctenium, Agrostis, Alopecurus, Apera.
- the invention also relates to expression cassettes, the sequence of which codes for a PRPP amidotransferase from tobacco or its functional equivalent.
- the nucleic acid sequence can e.g. be a DNA or a cDNA sequence.
- an expression cassette according to the invention also contain regulatory nucleic acid sequences which control the expression of the coding sequence in the host cell.
- an expression cassette according to the invention comprises upstream, ie at the 5 'end of the coding sequence, a promoter and downstream, ie at the 3 'end, a polyadenylation signal and, if appropriate, further regulatory elements which are operatively linked to the intermediate coding sequence for the PRPP amidotransferase gene.
- An operational link is the sequential one
- An expression cassette according to the invention is produced by fusing a suitable promoter with a suitable PRPP amidotransferase DNA sequence and a polyadenylation signal according to common recombination and cloning techniques, as described, for example, in T. Maniatis, E.F. Fritsch and J. Sambrook, Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory, Cold Spring Harbor, NY (1989) and in T.J. Silhavy, M.L. Berman and L.W. Enquist, Experiments with Gene Fusions, Cold Spring Harbor Laboratory, Cold Spring Harbor, NY (1984) and in Ausubel, F.M. et al. , Current Protocols in Molecular Biology, Greene Publishing Assoc. and Wiley-Inter-science (1987).
- the invention also relates to functionally equivalent DNA sequences which code for a PRPP amidotransferase gene and which, based on the total length of the DNA sequence, have sequence homology with the DNA sequence SEQ-ID NO. 1 or SEQ ID NO. 3 have from 40 to 100%.
- Preferred objects of the invention are functionally equivalent DNA sequences which code for a PRPP amidotransferase gene and which, based on the total length of the DNA sequence, have sequence homology with the DNA sequence SEQ-ID NO. 1 or SEQ ID NO. 3 have from 60 to 100%.
- a particularly preferred object of the invention are functionally equivalent DNA sequences which code for a PRPP amidotransferase gene and which, based on the total length of the DNA sequence, have sequence homology with the DNA sequence SEQ-ID NO. 1 or SEQ-ID No. 3 have from 80 to 100%.
- Functionally equivalent sequences which code for a PRPP amidotransferase gene are, according to the invention, those sequences which, despite a different nucleotide sequence, still have the desired functions.
- Functional equivalents thus include naturally occurring variants of the sequences described here as well as artificial ones, for example by chemical synthesis Nucleotide sequences obtained which are adapted to the codon use of a plant.
- a functional equivalent is also understood to mean, in particular, natural or artificial mutations of an originally isolated sequence coding for a PRPP amidotransferase, which furthermore shows the desired function. Mutations include substitutions, additions, deletions, exchanges or insertions of one or more nucleotide residues.
- the present invention also encompasses those nucleotide sequences which are obtained by modifying this nucleotide sequence. The aim of such a modification can e.g. further narrowing down the coding sequence contained therein or e.g. also the insertion of further restriction enzyme interfaces.
- Functional equivalents are also those variants whose function is weakened or enhanced compared to the original gene or gene fragment.
- the expression cassette according to the invention can also be used to transform bacteria, cyanobacteria, yeasts, filamentous fungi and algae with the aim of producing sufficient quantities of the enzyme PRPP amidotransferase.
- Another object of the invention is a protein from tobacco characterized by the amino acid sequence SEQ-ID NO: 2 or SEQ-ID No. 4 or derivatives or parts of this protein with PRPP amidotransferase activity.
- the invention also relates to plant proteins with PRPP amidotransferase activity with an amino acid sequence homology to the tobacco PRPP amidotransferase with SEQ-ID NO: 2 or SEQ-ID NO. 4 of 20 - 100% identity.
- Vegetable proteins with PRPP amidotransferase activity with an amino acid sequence homology to the tobacco PRPP amidotransferases with the sequences SEQ-ID NO: 2 or SEQ-ID NO are preferred. 4 out of 50 - 100% identity.
- Plant proteins with PRPP amidotransferase activity with an amino acid sequence homology to the tobacco PRPP amidotransferases with the sequences SEQ-ID NO: 2 or SEQ-ID NO are particularly preferred. 4 of 80 - 100% identity.
- Another object of the invention was the overexpression of the PRPP amidotransferase gene in plants for the production of plants which are tolerant of inhibitors of PRPP amidotransferase.
- the effectiveness of the expression of the transgenically expressed PRPP amidotransferase gene can be determined, for example, in vitro by proliferation or by a germination test.
- a change in the type and level of expression of the PRPP amidotransferase gene and its effect on the resistance to inhibitors of PRPP amidotransferase on test plants can be tested in greenhouse experiments.
- the invention also relates to transgenic plants, transformed with an expression cassette according to the invention, containing the DNA sequence SEQ-ID No. 1 or SEQ-ID No. 3, which by additional expression of the DNA sequence SEQ-ID No. 1 or SEQ-ID No. 3 have become tolerant of inhibitors of PRPP amidotransferase, as well as transgenic cells, tissues, parts and propagation material of such plants.
- Transgenic crop plants such as e.g. Barley, wheat, rye, corn, soy, rice, cotton, sugar beet, canola, sunflower, flax, hemp, potato, tobacco, tomato, rapeseed, alfalfa, lettuce and the various tree, nut and wine species, as well as legumes ,
- a change in the nucleotide content in plants can be useful in various cases.
- Plant-based baby food products are added with nucleotides, for example, in order to achieve a nutritional composition that corresponds to breast milk.
- an optimized nucleotide content would be useful in the case of enteral feeding of patients.
- a reduced purine nucleotide content in nutritionally relevant plants is relevant for the dietary nutrition of patients with gout.
- Nucleotides also have a taste-forming and taste-enhancing effect, so that a changed nucleotide content affects the taste properties of plants.
- the invention therefore furthermore relates to plants which, after expression of the DNA sequence SEQ-ID No. 1 or SEQ-ID No. 3 have a modified purine nucleotide content in the plant.
- the content of the purine nucleotides IMP, AMP is preferred and / or GMP or their di- or trinucleotides ADP, ATP or GDP, GTP increased.
- a plant with a modified purine nucleotide content is, for example, expressed by expressing an additional DNA sequence SEQ-ID No. 1 or SEQ-ID No. 3 produced in the plant in sense or antisense orientation.
- Modified content of purine nucleotides means that both plants with an increased content of purine nucleotides in sense orientation and also plants with a reduced content in guanosine nucleotides with sense orientation (cosuppression) or antisense orientation can be produced.
- increasing the purine nucleotide content means, for example, the artificially acquired one
- Another object of the invention is the use of plant PRPP amidotransferase to change the concentrations of methylxanthines in plants.
- Sequences are particularly preferred which ensure targeting in the apoplasts, in plastids, the vacuole, the mitochondrium, the endoplasmic reticulum (ER) or, due to the lack of corresponding operative sequences, ensuring that they remain in the compartment of formation, the cytosol (Kermode, Crit. Rev. Plant Sci. 15, 4 (1996), 285-423).
- the plant expression cassette can be installed in the plant transformation vector pBinAR, see Example 5.
- any promoter which can control the expression of foreign genes in plants is suitable as promoters of the expression cassette according to the invention.
- a plant promoter or a plant virus-derived promoter is preferably used. The is particularly preferred
- CaMV 35S promoter from the cauliflower mosaic virus (Franck et al., Cell 21 (1980), 285-294). This promoter contains different recognition sequences for transcriptional effectors, all of which lead to permanent and constitutive expression of the introduced gene (Benfey et al., EMBO J. 8 (1989), 2195-2202).
- the expression cassette according to the invention can also contain a chemically inducible promoter, by means of which the expression of the exogenous PRPP amidotransferase gene in the plant can be controlled at a specific point in time.
- Such promoters as for example the PRPl promoter (Ward et al., Plant Mol Biol.
- promoters are particularly preferred which ensure expression in tissues or parts of plants in which the biosynthesis of purines or their precursors takes place. Promoters that ensure leaf-specific expression should be mentioned in particular.
- the promoter of the cytosolic FBPase from potato or the ST-LSI promoter from potato (Stockhaus et al., EMBO J., (1989) 8, 2445-245) are to be mentioned.
- the expression cassette according to the invention can therefore contain, for example, a seed-specific promoter (preferably the phaseolin promoter, the USP or LEB4 promoter), the LEB4 signal peptide, the gene to be expressed and an ER retention signal.
- a seed-specific promoter preferably the phaseolin promoter, the USP or LEB4 promoter
- the LEB4 signal peptide the gene to be expressed and an ER retention signal.
- the inserted nucleotide sequence coding for a PRPP amidotransferase can be produced synthetically or obtained naturally or contain a mixture of synthetic and natural DNA components.
- synthetic nucleotide sequences with codons are generated which are preferred by plants. These codons preferred by plants can be determined from codons with the highest protein frequency, which are expressed in most interesting plant species.
- various DNA fragments can be manipulated in order to obtain a nucleotide sequence which expediently reads in the correct direction and which is equipped with a correct reading frame.
- adapters or linkers can be attached to the fragments.
- artificial DNA sequences are suitable as long as, as described above, for example, they impart the desired property of increasing the level of purine nucleotides in the plant by overexpressing the PRPP amidotransferase gene in crop plants.
- Such artificial DNA sequences can be determined, for example, by back-translating proteins constructed using molecular modeling, which have PRPP amidotransferase activity, or by using viüro selection. Coding DNA sequences which are obtained by back-translating a polypeptide sequence according to the codon usage specific for the host plant are particularly suitable. The specific codon usage can easily be determined by a person skilled in plant genetic methods by computer evaluations of other known genes of the plant to be transformed.
- Sequences which code for fusion proteins are to be mentioned as further suitable equivalent nucleic acid sequences according to the invention, part of the fusion protein being a plant PRPP amidotransferase polypeptide or a functionally equivalent part thereof.
- the second part of the fusion protein can e.g. be another polypeptide with enzymatic activity or an antigenic polypeptide sequence that can be used to detect PRPP amidotransferase expression (e.g. myc-tag or his-tag).
- this is preferably a regulatory protein sequence, such as e.g. a signal or transit peptide that directs the PRPP amidotransferase protein to the desired site of action.
- the promoter and terminator regions according to the invention should expediently be provided in the transcription direction with a linker or polylinker which contains one or more restriction sites for the insertion of this sequence.
- the linker has 1 to 10, usually 1 to 8, preferably 2 to 6, restriction sites.
- the linker has a size of less than 100 bp, often less than 60 bp, but at least 5 bp within the regulatory ranges.
- the promoter according to the invention can be both native or homologous and foreign or heterologous to the host plant.
- the expression cassette according to the invention contains, in the 5 '-3' transcription direction, the promoter according to the invention, any sequence and a region for the transcriptional termination. Different termination areas are interchangeable.
- Preferred polyadenylation signals are plant polyadenylation signals, preferably those which essentially correspond to T-DNA polyadenylation signals from Agrobacterium tumefaciens, in particular gene 3 of T-DNA (octopine synthase) of the Ti plasmid pTiACH5 (Gielen et al., EMBO J. 3 (1984), 835) or functional equivalents.
- an expression cassette according to the invention is inserted as an insert into a recombinant vector whose vector DNA contains additional functional regulatory signals, for example sequences for replication or integration.
- additional functional regulatory signals for example sequences for replication or integration.
- Suitable vectors are described, inter alia, in "Methods in Plant Molecular Biology and Biotechnology” (CRC Press, Chapter 6/7, 71-119).
- transformation The transfer of foreign genes into the genome of a plant is called transformation.
- the methods described for the transformation and regeneration of plants from plant tissues or plant cells for transient or stable transformation are used. Suitable methods are the protoplast transformation by polyethylene glycol-induced DNA uptake, the biolistic approach with the gene cannon, the electroporation, the incubation of dry embryos in DNA-containing solution, the microinjection and the gene transfer mediated by Agrobacterium.
- the methods mentioned are described, for example, in B. Jenes et al., Techniques for Gene Transfer, in: Transgenic Plants, Vol. 1, Engineering and Utilization, edited by SD Kung and R. Wu, Academic Press (1993) 128-143 and in Potrykus Annu. Rev. Plant Physiol. Plant Molec. Biol.
- the construct to be expressed is preferably cloned into a vector which is suitable for transforming Agrobacterium tumefaciens, for example pBin19 (Bevan et al., Nucl. Acids Res. 12 (1984), 8711).
- Agrobacteria transformed with an expression cassette according to the invention can also be used in a known manner to transform plants, in particular crop plants, such as cereals, corn, soybeans, rice, cotton, sugar beet, canola, sunflower, flax, hemp, potato, tobacco, tomato, rapeseed, alfalfa , Lettuce and the various tree, nut and wine species as well as legumes are used, for example by bathing wounded leaves or leaf pieces in an agrobacterial suspension and then cultivating them in suitable media.
- crop plants such as cereals, corn, soybeans, rice, cotton, sugar beet, canola, sunflower, flax, hemp, potato, tobacco, tomato, rapeseed, alfalfa , Lettuce and the various tree, nut and wine species as well as legumes are used, for example by bathing wounded leaves or leaf pieces in an agrobacterial suspension and then cultivating them in suitable media.
- the biosythesis site of purines is generally the leaf tissue, so that leaf-specific expression of the PRPP amidotransferase gene makes sense.
- the purine biosynthesis need not be limited to the leaf tissue, but can also be tissue-specific in all other parts of the plant - for example in fatty seeds.
- constitutive expression of the exogenous PRPP amidotransferase gene is advantageous.
- inducible expression may also appear desirable.
- the expression cassettes according to the invention can be cloned into suitable vectors which enable their multiplication, for example in E. coli.
- suitable cloning vectors include pBR332, pUC series, M13mp series and pA-CYC184.
- Binary vectors which can replicate both in E. coli and in agrobacteria are particularly suitable.
- Another object of the invention relates to the use of an expression cassette according to the invention for the transformation of plants, plant cells, plant tissues or parts of plants.
- the aim of the use is preferably to increase the PRPP amidotransferase content in the plant.
- the expression can take place specifically in the leaves, in the seeds or in other parts of the plant.
- Such transgenic plants, their reproductive material and their plant cells, tissue or parts are a further object of the present invention.
- Cloning methods such as Restriction cleavages, agarose gel electrophoresis, purification of DNA fragments, transfer of nucleic acids to nitrocellulose and nylon membranes, linking of DNA fragments, transformation of Escherichia coli cells, cultivation of bacteria and sequence analysis of recombinant DNA were carried out as in Sambrook et al. (1989) (Cold Spring Harbor Laboratory Press: ISBN 0-87969-309-6).
- the sequencing of recombinant DNA molecules was carried out with a laser fluorescence DNA sequencer from ABI according to the method of Sanger (Sanger et al., Proc. Natl. Acad. Sci. USA 74 (1977), 5463-5467). Fragments resulting from a polymerase chain reaction were sequenced and checked to avoid polymerase errors in constructs to be expressed.
- RNA from plant tissues was, as in Logemann et al. (Anal. Biochem. 163 (1987), 21). For the analysis, 20 ⁇ g RNA were separated in a 1.5% agarose gel containing formaldehyde and transferred to nylon membranes (Hybond, Amersham). The detection of specific transcripts was carried out as described for Amasino (Anal. Biochem. 152 (1986), 304). The DNA fragments used as a probe were radioactively marked with a Random Pri ed DNA Labeling Kit (Röche, Mannheim) and hybridized according to standard methods (see Hybond user instructions, Amersham). Hyridization signals were visualized by autoradiography using X-OMAT AR films from Kodak.
- DNA-modifying enzymes and molecular biological kits were developed by the companies AGS (Heidelberg), Amersham (Braunschweig), Biometra (Göttingen), Röche (Mannheim), Genomed (Bad Oeynnhausen), New England Biolabs (Schwalbach / Taunus), Novagen (Madison, Wisconsin, USA), Perkin-Elmer (Weiterstadt), Pharmacia (Freiburg) Qiagen (Hilden) and Stratagene (Heidelberg). Unless otherwise stated, they were used according to the manufacturer's instructions.
- E. coli, XL-1 Blue The bacterial strains used below (E. coli, XL-1 Blue) were obtained from Stratagene.
- E. coli AT 2465 was obtained from the coli genetic stock center (Yale University, New Haven).
- the Agrobacterium strain used for plant transformation (Agrobacterium tumefaciens, C58C1 with the plasmid pGV2260 or pGV3850kan) was developed by Deblaere et al. (Nucl. Acids Res. 13 (1985), 4777).
- the agrobacterial strain LBA4404 (Clontech) or other suitable strains can be used.
- the vectors pUC19 (anish-Perron, Gene 33 (1985), 103-119) pBluescript SK- (Stratagene), pGEM-T (Promega), pZerO (Invitrogen), pBinl9 (Bevan et al., Nucl. Acids Res. 12 (1984), 8711-8720) and pBinAR (Höfgen and Willmitzer, Plant Science 66 (1990), 221-230).
- the reaction mixtures contained approx. 1 ng / ⁇ l template DNA, 0.5 UM of oligonucleotides 5 ( -cgc tct aga act agt gga tc-3 'and 5 * -tcg agg tcg acg gta tc-3', 200 ⁇ M deoxy nucleotides (Pharmacia), 50 mM KC1, 10 mM Tris-HCl (pH 8.3 at 25 ° C, 1.5 mM MgCl 2 ) and 0.02 U / ul Taq polymerase (Perkin Elmer).
- the amplification conditions were set as follows:
- Annealing temperature 50 ° C, 1 min
- the resulting fragment of 1.9 kb was used for a heterologous screening of a cDNA library from Nicotiana tabacum var. SR-1 (Stratagene). 3.0 x 10 5 lambda phages from the cDNA library were plated on agar plates with E. coli XLl-blue as a bacterial strain. The phage DNA was transferred to nitrocellulose filters (Gelman Sciences) using standard methods (Sambrook et al. (1989), Cold Spring Harbor Laboratory Press: ISBN 0-87969-309-6) and fixed on the filters.
- the PCR fragment described above was used as the hybridization probe and was radioactively labeled with the aid of the “Multiprime DNA labeling System” (Amersham Buchler) in the presence of ⁇ - 32 P-dCTP (specific activity 3000 Ci / mmol) according to the manufacturer's instructions.
- the membranes were hybridized after prehybridization at 60 ° C. in 3 ⁇ SSPE, 0.1% sodium dodecyl sulfate (w / v), 0.02% polyvinylpyrrolidone (w / v), 0.02% Ficoll 400 (w / v) and 50 mg / ml calf thymus DNA for approx. 12 hours.
- Ntpurl.l (clone 7.2) containing the DNA sequence SEQ-ID No. 1 and Ntpurl .2 (clone 9.2) containing the DNA sequence SEQ-ID No. 3 are identified which reading frames code with homology to AtATAsel from Arabidopsis thaliana.
- the amino acid sequences of Ntpurl.l (SEQ-ID No. 2 - length: 573 amino acids) and Ntpurl.2 (SEQ-ID No. 4 - length: 573 amino acids) are 97% identical, see Table 1.
- the homology at the amino acid level to AtATasel is 81% for Ntpurl.l and 85% for Ntpurl.2.
- the continuous reading frames begin with nucleotide base 49 (Ntpurl.l) or 25 (Ntpurl.2) and are translated into polypeptides with a length of 573 amino acids.
- Table 1 nucleotide base 49 (Ntpurl.l) or 25 (Ntpurl.2)
- NGSIFNTSSDTEWLHLIAISKARPFLLRIVEACEKIEGAYSMVFVTEDK 250 251 LVAVRDPHGFRPLVMGRRSNGAWFASETCALDLIEATYEREVNPGE W 300
- VDKDGVQSICLMPHPERKSCIFEHIYFALPNSWFGRSVYESRRAFGEIL 350 351 ATEAPVECDVGIAVPDSGIVAALGYAAKAGVPFQQGLIRSHYVGRTFIEP 400
- the vegetable proteins (Ntpurl.l, Ntpurl.2, AtATasel) show sequences of bacteria and PRPP amidotransferase
- Ntpurl-2 DV..LKSITG VGLVSDVFNE SKLDQL.
- PGD MAIGHVRYST AGSSMLKNVQ purl_hum SVPTFKSHKG MGLVNHVFTE DNLKKLYVSN LGIGHTRYAT TGKCELENCQ
- Ntpurl.2 was expressed in E. coli.
- a fragment of 1523 bp was amplified in a PCR with Pfu polymerase using the oligonucleotides Jle336: 5 '-ttttgctagcgactcgtattttgacg-3' and Jle337: 5 '-aaaagatctcaggttctaacttcat -3 ⁇ and Ntpurl .2-DNA as template.
- the generated DNA Fragment codes for an N-terminally shortened PRPP amidotransferase enzyme by 86 amino acids, which no longer contains the assumed transit peptide.
- This shortened form of the PRPP amidotransferase enzyme begins N-terminally with the amino acids MDSYFDDDD.
- An Nhel cleavage site and a BglII cut line were inserted by means of the oligonucleotides, via which the fragment generated was ligated into the expression vector pETlla (Novagen) cleaved with Nhel and BamHI.
- Test system for measuring the activity of plant PRPP amidotransferase activity
- PRPP phosphoribosyl pyrophosphate
- PRA phosphoribosylamine
- APAD 3-acetylpyridine adenine dinucleotide
- PRAT PRPP amidotransferase
- reaction mixture (see below) was incubated for up to 60 minutes at 37 ° C and the reaction was stopped by incubating at 95 ° C for 5 minutes.
- the detection of the glutamate formed was carried out in detection batch 20 (see below) by photometric measurement of the APADH increase at 363 nm after the addition of the glutamate dehydrogenase.
- test system is particularly suitable for measuring the PRPP amidotransferase activity from plant material and in expression extracts, for example from baculovirus-infected insect cells.
- the amplification conditions were set as follows:
- the PCR product was ligated into the Vector pFast-Bacl (GibcoBRL) cut with StuI. The correct orientation of the insert was ensured by control digestion with Kpnl.
- the transfer vector pFastBacNtpurl.2 obtained was used according to the manufacturer's instructions to generate recombinant baculoviruses using Sf21 insect cells (Invitrogen). Sf21 insect cells were infected with the recombinant baculovirus (BvNtpurl.2). The cells were harvested by centrifugation after 2-4 days. A protein of approx.
- a whole cell extract was produced by the pressure digestion method ("French Press") in extraction buffer (100 mM HEPES pH 8.0; 2.5 mM EDTA; 10% glycerol; 20 mM DTE; 0.2 mM PEFA block) and after desalting on a PDIO column (Pharmacia) for measuring the PRPP amidotransferase activity in the described assay (see example 3).
- the clone Ntpurl.l was cleaved with Smal and EcoRV and a 1482 bp fragment was isolated, which was converted into the vector with Smal cleaved pBinAR (Höfgen and Willmitzer, Plant Science 66 (1990), 221-230).
- the antisense or sense constructs obtained in this way were designated pBinAR-NtpurlA or pBinAR-Ntpurl, see Figure 1.
- the plasmids pBinAR-NtpurlA and pBinAR-Ntpurl were transformed in Agrobacterium tumefaciens C58Cl: pGV2260 (Deblaere et al., Nucl. Acids. Res. 13 (1984), 4777-4788).
- Agrobacterium tumefaciens C58Cl: pGV2260 To transform tobacco plants (Nicotiana tabacum cv. Samsun NN), a 1:50 dilution of an overnight culture of a positively transformed agrobacterial colony in Murashige-Skoog medium (Murashige and Skoog Physiol. Plant. 15 (1962), 473) with 2% sucrose (2MS -Medium) is used.
- Leaf disks of sterile plants were incubated in a Petri dish with a 1:50 agrobacterial dilution for 5-10 minutes. This was followed by a 2-day incubation in the dark at 25 ° C. on 2MS medium with 0.8% Bacto agar. The cultivation was continued after 2 days with 16 hours of light / 8 hours of darkness and on a weekly basis on MS medium with 500 mg / 1 claforan (cefotaxime sodium), 50 mg / 1 kamanycin, 1 mg / 1 benzylaminopurine (BAP ), 0.2 mg / 1 naphthylacetic acid and 1.6 g / 1 glucose. Growing shoots were transferred to MS medium with 2% sucrose, 250 mg / 1 Claforan and 0.8% Bacto agar.
- Regenerated shoots were obtained on 2MS medium with kanamycin and claforan, transferred to soil after rooting and after cultivation for two weeks in a climatic chamber in a 16 hour light / 8 hour dark rhythm at 60% humidity for PRPP amidotransferase expression and - Activity as well as changes in metabolite levels and phenotypic growth characteristics were examined.
- Altered nucleotide contents can e.g. according to the method of Stitt et al., FEBS Letters 145 (1982), 217-222.
- Transgenic plants that have been transformed with the construct with pBinAR-Ntpurl are characterized by different degrees of reduced growth and large-area bleaching of the leaves compared to untransformed control plants (Fig. 2).
- the RNA analysis by the Northern blot technique showed a reduced amount of Ntpurl.1-RNA in transgenic lines with the described phenotype (Fig. 3). This Effects were also observed in subsequent generations of the transgenic lines.
- the 5 PRPP amidotransferase activity in the transgenic lines was measured and compared with that in untransformed controls.
- approx. 30 g leaves of approx. 20 cm high plants were homogenized with 50 ml extraction buffer at + 4 ° C.
- the digestion extract was filtered through Miracloth (Calbiochem, Bad Soden) and centrifuged at 16000 rpm in the Sorval centrifuge.
- Fig. 4A shows the PRPP amidotransferase activity based on the pro-
- Fig. 4B shows the PRPP amidotransferase activity based on the fresh weight.
- PRPP amidotransferase 5 activity can be prepared from plant tissues, see example 7.
- a plant PRPP amidotransferase can be found in E. coli, insect cells or another suitable expression system can be expressed.
- known PRPP amidotransferase inhibitors - such as glutamine antagonists - were identified.
- Construct pBinAR-Ntpurl were transformed and their successor generation (lines 3.1, 3.2, 3.9., 25.1 and 38.8.), Leaf material (5 disks each with a diameter of 6 mm) were harvested and immediately frozen in liquid nitrogen. TCA extracts were then prepared using standard methods and used to determine the nucleotide contents.
- AMP is strong in the transgenic lines with the exception of line 38.8 in the green leaf area and less in yellow leaf areas compared to the wild type (WT) (see Fig. 5).
Landscapes
- Health & Medical Sciences (AREA)
- Genetics & Genomics (AREA)
- Life Sciences & Earth Sciences (AREA)
- Engineering & Computer Science (AREA)
- Chemical & Material Sciences (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Organic Chemistry (AREA)
- Biotechnology (AREA)
- Wood Science & Technology (AREA)
- Zoology (AREA)
- Molecular Biology (AREA)
- Biomedical Technology (AREA)
- General Engineering & Computer Science (AREA)
- General Health & Medical Sciences (AREA)
- Biochemistry (AREA)
- Microbiology (AREA)
- Plant Pathology (AREA)
- Cell Biology (AREA)
- Physics & Mathematics (AREA)
- Biophysics (AREA)
- Medicinal Chemistry (AREA)
- Nutrition Science (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Enzymes And Modification Thereof (AREA)
- Breeding Of Plants And Reproduction By Means Of Culturing (AREA)
- Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)
Abstract
Description
Claims
Applications Claiming Priority (3)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| DE1999149000 DE19949000A1 (de) | 1999-10-11 | 1999-10-11 | PRPP-Amidotransferase aus Pflanzen |
| DE19949000 | 1999-10-11 | ||
| PCT/EP2000/009839 WO2001027248A1 (de) | 1999-10-11 | 2000-10-07 | Prpp-amidotransferase aus nicotiana tabacum |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| EP1220894A1 true EP1220894A1 (de) | 2002-07-10 |
Family
ID=7925270
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| EP00969449A Withdrawn EP1220894A1 (de) | 1999-10-11 | 2000-10-07 | Prpp-amidotransferase aus nicotiana tabacum |
Country Status (5)
| Country | Link |
|---|---|
| EP (1) | EP1220894A1 (de) |
| AU (1) | AU7915900A (de) |
| CA (1) | CA2387159A1 (de) |
| DE (1) | DE19949000A1 (de) |
| WO (1) | WO2001027248A1 (de) |
Family Cites Families (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5780253A (en) * | 1995-05-04 | 1998-07-14 | Sandoz Ltd. | Screening method for detection of herbicides |
| EP1015602A1 (de) * | 1997-02-03 | 2000-07-05 | Yale University | Glutrna gln amidotransferase- eine neue essentielle komponente der translation |
-
1999
- 1999-10-11 DE DE1999149000 patent/DE19949000A1/de not_active Withdrawn
-
2000
- 2000-10-07 AU AU79159/00A patent/AU7915900A/en not_active Abandoned
- 2000-10-07 EP EP00969449A patent/EP1220894A1/de not_active Withdrawn
- 2000-10-07 WO PCT/EP2000/009839 patent/WO2001027248A1/de not_active Ceased
- 2000-10-07 CA CA002387159A patent/CA2387159A1/en not_active Abandoned
Non-Patent Citations (1)
| Title |
|---|
| See references of WO0127248A1 * |
Also Published As
| Publication number | Publication date |
|---|---|
| WO2001027248A1 (de) | 2001-04-19 |
| CA2387159A1 (en) | 2001-04-19 |
| AU7915900A (en) | 2001-04-23 |
| WO2001027248A8 (de) | 2001-08-09 |
| DE19949000A1 (de) | 2001-04-12 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| WO2001014569A2 (de) | Erhöhung des polysaccharidgehaltes in pflanzen | |
| EP1212439B1 (de) | Pflanzen mit verändertem aminosäuregehalt und verfahren zu deren herstellung | |
| EP1222293A2 (de) | Gmp-synthetase aus pflanzen | |
| EP1135510A2 (de) | Dna-sequenz, kodierend einen glutamat/malat-translokator, plasmide, bakterien, hefen und pflanzen, enthaltend diesen transporter | |
| EP1220894A1 (de) | Prpp-amidotransferase aus nicotiana tabacum | |
| EP1259623B1 (de) | Aspartat-carbamyltransferase als herbizides target | |
| EP1070120A1 (de) | Amp-deaminase | |
| EP1210437B1 (de) | Dihydroorotase aus pflanzen | |
| EP1294925A2 (de) | Phosphoribosyl-pyrophosphat synthetase 1 als herbizides target | |
| EP1224292A2 (de) | Formylglycinamidinribotid-synthase aus pflanzen | |
| WO2004058956A1 (de) | Malat dehydrogenase als target für herbizide | |
| EP1307561B1 (de) | Nucleinsäuren, mit deren hilfe pflanzen mit verändertem metabolit-gehalt erzeugt werden können | |
| WO1998010074A2 (de) | Adenylosuccinat synthetase | |
| EP1315808A2 (de) | Dehydroquinat dehydratase/shikimat dehydrogenase als herbizides target | |
| DE10104721B4 (de) | Verfahren zur Erhöhung des Gehalts von Schwefelverbindungen in Pflanzen | |
| EP1527168B1 (de) | Saccharose-6-phosphat phosphatase als target für herbizide | |
| DE19632121C2 (de) | Transgene Pflanzenzellen und Pflanzen mit veränderter Acetyl-CoA-Bildung | |
| EP1685249A2 (de) | Der glycin decarboxylase komplex als herbizides target | |
| DE10050233A1 (de) | Verfahren zur genetischen Modifizierung einer Pflanze | |
| DE102004012481A1 (de) | UMP-Synthase (Orotat Phosphoribosyltransferase und Orotidin 5'-Phosphate Decarboxylase) als herbizides Target |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| PUAI | Public reference made under article 153(3) epc to a published international application that has entered the european phase |
Free format text: ORIGINAL CODE: 0009012 |
|
| 17P | Request for examination filed |
Effective date: 20020326 |
|
| AK | Designated contracting states |
Kind code of ref document: A1 Designated state(s): AT BE CH CY DE DK ES FI FR GB GR IE IT LI LU MC NL PT SE |
|
| AX | Request for extension of the european patent |
Free format text: AL;LT;LV;MK;RO;SI |
|
| RIN1 | Information on inventor provided before grant (corrected) |
Inventor name: EHRHARDT, THOMAS Inventor name: LERCHL, JENS Inventor name: SONNEWALD, UWE Inventor name: BOLDT, RALF |
|
| RIN1 | Information on inventor provided before grant (corrected) |
Inventor name: EHRHARDT, THOMAS Inventor name: BOLDT, RALF Inventor name: LERCHL, JENS Inventor name: SONNEWALD, UWE |
|
| STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: THE APPLICATION HAS BEEN WITHDRAWN |
|
| 18W | Application withdrawn |
Effective date: 20031007 |