EP1165700A1 - Sol-gel-überzug für einschichtige oder mehrschichtige lackierungen - Google Patents
Sol-gel-überzug für einschichtige oder mehrschichtige lackierungenInfo
- Publication number
- EP1165700A1 EP1165700A1 EP00914111A EP00914111A EP1165700A1 EP 1165700 A1 EP1165700 A1 EP 1165700A1 EP 00914111 A EP00914111 A EP 00914111A EP 00914111 A EP00914111 A EP 00914111A EP 1165700 A1 EP1165700 A1 EP 1165700A1
- Authority
- EP
- European Patent Office
- Prior art keywords
- sol
- groups
- gel
- coating material
- layer
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Withdrawn
Links
- 238000000576 coating method Methods 0.000 title claims abstract description 158
- 239000011248 coating agent Substances 0.000 title claims abstract description 109
- 239000010410 layer Substances 0.000 title claims description 52
- 239000002356 single layer Substances 0.000 title claims description 20
- 239000002966 varnish Substances 0.000 title abstract description 6
- 239000000463 material Substances 0.000 claims abstract description 68
- BLRPTPMANUNPDV-UHFFFAOYSA-N Silane Chemical compound [SiH4] BLRPTPMANUNPDV-UHFFFAOYSA-N 0.000 claims abstract description 32
- 229920001577 copolymer Polymers 0.000 claims abstract description 29
- 239000000654 additive Substances 0.000 claims abstract description 22
- 238000009833 condensation Methods 0.000 claims abstract description 18
- 230000005494 condensation Effects 0.000 claims abstract description 17
- 230000000996 additive effect Effects 0.000 claims abstract description 15
- 230000007062 hydrolysis Effects 0.000 claims abstract description 15
- 238000006460 hydrolysis reaction Methods 0.000 claims abstract description 15
- 125000002887 hydroxy group Chemical group [H]O* 0.000 claims abstract description 14
- 229910000077 silane Inorganic materials 0.000 claims abstract description 14
- 150000001875 compounds Chemical class 0.000 claims abstract description 13
- 125000003700 epoxy group Chemical group 0.000 claims abstract description 13
- 125000003277 amino group Chemical group 0.000 claims abstract description 6
- 125000004122 cyclic group Chemical group 0.000 claims abstract description 5
- 150000001990 dicarboxylic acid derivatives Chemical class 0.000 claims abstract 2
- 239000000178 monomer Substances 0.000 claims description 57
- -1 methoxy, ethoxy, n-propoxy, i- Propoxy, n-butoxy, sec-butoxy, beta-methoxy-ethoxy, acetoxy, propionyloxy Chemical group 0.000 claims description 39
- 239000004922 lacquer Substances 0.000 claims description 32
- 238000000034 method Methods 0.000 claims description 24
- 125000004432 carbon atom Chemical group C* 0.000 claims description 23
- 239000002253 acid Substances 0.000 claims description 22
- 238000004519 manufacturing process Methods 0.000 claims description 20
- 238000010422 painting Methods 0.000 claims description 19
- 239000007787 solid Substances 0.000 claims description 19
- 239000000758 substrate Substances 0.000 claims description 19
- CERQOIWHTDAKMF-UHFFFAOYSA-N Methacrylic acid Chemical compound CC(=C)C(O)=O CERQOIWHTDAKMF-UHFFFAOYSA-N 0.000 claims description 16
- 239000000843 powder Substances 0.000 claims description 14
- 230000008569 process Effects 0.000 claims description 11
- 230000000694 effects Effects 0.000 claims description 9
- 150000002736 metal compounds Chemical class 0.000 claims description 7
- 230000003678 scratch resistant effect Effects 0.000 claims description 7
- 239000007795 chemical reaction product Substances 0.000 claims description 6
- 229910052782 aluminium Inorganic materials 0.000 claims description 5
- XAGFODPZIPBFFR-UHFFFAOYSA-N aluminium Chemical group [Al] XAGFODPZIPBFFR-UHFFFAOYSA-N 0.000 claims description 5
- 125000000524 functional group Chemical group 0.000 claims description 5
- IQPQWNKOIGAROB-UHFFFAOYSA-N isocyanate group Chemical group [N-]=C=O IQPQWNKOIGAROB-UHFFFAOYSA-N 0.000 claims description 5
- 125000000217 alkyl group Chemical group 0.000 claims description 4
- 238000007334 copolymerization reaction Methods 0.000 claims description 4
- 125000001495 ethyl group Chemical group [H]C([H])([H])C([H])([H])* 0.000 claims description 4
- 125000002496 methyl group Chemical group [H]C([H])([H])* 0.000 claims description 4
- RTAQQCXQSZGOHL-UHFFFAOYSA-N Titanium Chemical group [Ti] RTAQQCXQSZGOHL-UHFFFAOYSA-N 0.000 claims description 3
- QCWXUUIWCKQGHC-UHFFFAOYSA-N Zirconium Chemical group [Zr] QCWXUUIWCKQGHC-UHFFFAOYSA-N 0.000 claims description 3
- 125000003545 alkoxy group Chemical group 0.000 claims description 3
- 125000003118 aryl group Chemical group 0.000 claims description 3
- 125000001436 propyl group Chemical group [H]C([*])([H])C([H])([H])C([H])([H])[H] 0.000 claims description 3
- 230000005855 radiation Effects 0.000 claims description 3
- 239000010936 titanium Chemical group 0.000 claims description 3
- 229910052719 titanium Inorganic materials 0.000 claims description 3
- 229910052726 zirconium Chemical group 0.000 claims description 3
- 125000006017 1-propenyl group Chemical group 0.000 claims description 2
- 125000003903 2-propenyl group Chemical group [H]C([*])([H])C([H])=C([H])[H] 0.000 claims description 2
- 125000001494 2-propynyl group Chemical group [H]C#CC([H])([H])* 0.000 claims description 2
- 125000002777 acetyl group Chemical group [H]C([H])([H])C(*)=O 0.000 claims description 2
- 125000004423 acyloxy group Chemical group 0.000 claims description 2
- 125000003342 alkenyl group Chemical group 0.000 claims description 2
- 125000004448 alkyl carbonyl group Chemical group 0.000 claims description 2
- 125000000304 alkynyl group Chemical group 0.000 claims description 2
- 150000001450 anions Chemical group 0.000 claims description 2
- 125000004369 butenyl group Chemical group C(=CCC)* 0.000 claims description 2
- 125000004435 hydrogen atom Chemical group [H]* 0.000 claims description 2
- 125000001624 naphthyl group Chemical group 0.000 claims description 2
- 125000001997 phenyl group Chemical group [H]C1=C([H])C([H])=C(*)C([H])=C1[H] 0.000 claims description 2
- 230000008439 repair process Effects 0.000 claims description 2
- 125000003396 thiol group Chemical group [H]S* 0.000 claims description 2
- 239000006223 plastic coating Substances 0.000 claims 1
- 239000000499 gel Substances 0.000 description 78
- 238000012360 testing method Methods 0.000 description 36
- 239000000243 solution Substances 0.000 description 30
- 239000003973 paint Substances 0.000 description 26
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 16
- 239000011230 binding agent Substances 0.000 description 12
- 239000000203 mixture Substances 0.000 description 12
- 239000002585 base Substances 0.000 description 11
- 238000002360 preparation method Methods 0.000 description 11
- 239000003999 initiator Substances 0.000 description 10
- 150000004756 silanes Chemical class 0.000 description 10
- 239000002904 solvent Substances 0.000 description 10
- QTBSBXVTEAMEQO-UHFFFAOYSA-N Acetic acid Chemical compound CC(O)=O QTBSBXVTEAMEQO-UHFFFAOYSA-N 0.000 description 9
- VYPSYNLAJGMNEJ-UHFFFAOYSA-N Silicium dioxide Chemical compound O=[Si]=O VYPSYNLAJGMNEJ-UHFFFAOYSA-N 0.000 description 9
- 239000003795 chemical substances by application Substances 0.000 description 9
- 239000000470 constituent Substances 0.000 description 9
- 239000003431 cross linking reagent Substances 0.000 description 9
- VZCYOOQTPOCHFL-UHFFFAOYSA-N trans-butenedioic acid Natural products OC(=O)C=CC(O)=O VZCYOOQTPOCHFL-UHFFFAOYSA-N 0.000 description 9
- SMZOUWXMTYCWNB-UHFFFAOYSA-N 2-(2-methoxy-5-methylphenyl)ethanamine Chemical compound COC1=CC=C(C)C=C1CCN SMZOUWXMTYCWNB-UHFFFAOYSA-N 0.000 description 8
- ZWEHNKRNPOVVGH-UHFFFAOYSA-N 2-Butanone Chemical compound CCC(C)=O ZWEHNKRNPOVVGH-UHFFFAOYSA-N 0.000 description 8
- NIXOWILDQLNWCW-UHFFFAOYSA-M Acrylate Chemical compound [O-]C(=O)C=C NIXOWILDQLNWCW-UHFFFAOYSA-M 0.000 description 8
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 8
- 239000011541 reaction mixture Substances 0.000 description 8
- 239000004576 sand Substances 0.000 description 8
- 239000000126 substance Substances 0.000 description 8
- 125000000391 vinyl group Chemical group [H]C([*])=C([H])[H] 0.000 description 8
- NIXOWILDQLNWCW-UHFFFAOYSA-N 2-Propenoic acid Natural products OC(=O)C=C NIXOWILDQLNWCW-UHFFFAOYSA-N 0.000 description 7
- ZNQVEEAIQZEUHB-UHFFFAOYSA-N 2-ethoxyethanol Chemical compound CCOCCO ZNQVEEAIQZEUHB-UHFFFAOYSA-N 0.000 description 7
- VZCYOOQTPOCHFL-OWOJBTEDSA-N Fumaric acid Chemical compound OC(=O)\C=C\C(O)=O VZCYOOQTPOCHFL-OWOJBTEDSA-N 0.000 description 7
- UHKJHMOIRYZSTH-UHFFFAOYSA-N ethyl 2-ethoxypropanoate Chemical compound CCOC(C)C(=O)OCC UHKJHMOIRYZSTH-UHFFFAOYSA-N 0.000 description 7
- 239000000945 filler Substances 0.000 description 7
- 238000006116 polymerization reaction Methods 0.000 description 7
- 229920005989 resin Polymers 0.000 description 7
- 239000011347 resin Substances 0.000 description 7
- OKKJLVBELUTLKV-UHFFFAOYSA-N Methanol Chemical compound OC OKKJLVBELUTLKV-UHFFFAOYSA-N 0.000 description 6
- PPBRXRYQALVLMV-UHFFFAOYSA-N Styrene Chemical compound C=CC1=CC=CC=C1 PPBRXRYQALVLMV-UHFFFAOYSA-N 0.000 description 6
- QAOWNCQODCNURD-UHFFFAOYSA-N Sulfuric acid Chemical compound OS(O)(=O)=O QAOWNCQODCNURD-UHFFFAOYSA-N 0.000 description 6
- 150000007513 acids Chemical class 0.000 description 6
- 239000003849 aromatic solvent Substances 0.000 description 6
- BDAGIHXWWSANSR-UHFFFAOYSA-N methanoic acid Natural products OC=O BDAGIHXWWSANSR-UHFFFAOYSA-N 0.000 description 6
- 238000002156 mixing Methods 0.000 description 6
- 229910052757 nitrogen Inorganic materials 0.000 description 6
- 229920003023 plastic Polymers 0.000 description 6
- 239000004033 plastic Substances 0.000 description 6
- 239000005056 polyisocyanate Substances 0.000 description 6
- 229920001228 polyisocyanate Polymers 0.000 description 6
- LYCAIKOWRPUZTN-UHFFFAOYSA-N Ethylene glycol Chemical compound OCCO LYCAIKOWRPUZTN-UHFFFAOYSA-N 0.000 description 5
- 150000001336 alkenes Chemical class 0.000 description 5
- 229920003180 amino resin Polymers 0.000 description 5
- 238000006243 chemical reaction Methods 0.000 description 5
- 150000002148 esters Chemical class 0.000 description 5
- 239000004744 fabric Substances 0.000 description 5
- 125000002768 hydroxyalkyl group Chemical group 0.000 description 5
- VZCYOOQTPOCHFL-UPHRSURJSA-N maleic acid Chemical compound OC(=O)\C=C/C(O)=O VZCYOOQTPOCHFL-UPHRSURJSA-N 0.000 description 5
- 229910052751 metal Inorganic materials 0.000 description 5
- 239000002184 metal Substances 0.000 description 5
- 230000004048 modification Effects 0.000 description 5
- 238000012986 modification Methods 0.000 description 5
- KWYUFKZDYYNOTN-UHFFFAOYSA-M potassium hydroxide Inorganic materials [OH-].[K+] KWYUFKZDYYNOTN-UHFFFAOYSA-M 0.000 description 5
- 239000000047 product Substances 0.000 description 5
- 238000003756 stirring Methods 0.000 description 5
- 239000004575 stone Substances 0.000 description 5
- 229920001567 vinyl ester resin Polymers 0.000 description 5
- 229920002554 vinyl polymer Polymers 0.000 description 5
- WYTZZXDRDKSJID-UHFFFAOYSA-N (3-aminopropyl)triethoxysilane Chemical compound CCO[Si](OCC)(OCC)CCCN WYTZZXDRDKSJID-UHFFFAOYSA-N 0.000 description 4
- POAOYUHQDCAZBD-UHFFFAOYSA-N 2-butoxyethanol Chemical compound CCCCOCCO POAOYUHQDCAZBD-UHFFFAOYSA-N 0.000 description 4
- LZDXRPVSAKWYDH-UHFFFAOYSA-N 2-ethyl-2-(prop-2-enoxymethyl)propane-1,3-diol Chemical compound CCC(CO)(CO)COCC=C LZDXRPVSAKWYDH-UHFFFAOYSA-N 0.000 description 4
- WROUWQQRXUBECT-UHFFFAOYSA-N 2-ethylacrylic acid Chemical compound CCC(=C)C(O)=O WROUWQQRXUBECT-UHFFFAOYSA-N 0.000 description 4
- CCTFMNIEFHGTDU-UHFFFAOYSA-N 3-methoxypropyl acetate Chemical compound COCCCOC(C)=O CCTFMNIEFHGTDU-UHFFFAOYSA-N 0.000 description 4
- 239000004925 Acrylic resin Substances 0.000 description 4
- QGZKDVFQNNGYKY-UHFFFAOYSA-N Ammonia Chemical compound N QGZKDVFQNNGYKY-UHFFFAOYSA-N 0.000 description 4
- VEXZGXHMUGYJMC-UHFFFAOYSA-N Hydrochloric acid Chemical compound Cl VEXZGXHMUGYJMC-UHFFFAOYSA-N 0.000 description 4
- LRHPLDYGYMQRHN-UHFFFAOYSA-N N-Butanol Chemical compound CCCCO LRHPLDYGYMQRHN-UHFFFAOYSA-N 0.000 description 4
- OFOBLEOULBTSOW-UHFFFAOYSA-N Propanedioic acid Natural products OC(=O)CC(O)=O OFOBLEOULBTSOW-UHFFFAOYSA-N 0.000 description 4
- 150000001252 acrylic acid derivatives Chemical class 0.000 description 4
- 239000003054 catalyst Substances 0.000 description 4
- LDHQCZJRKDOVOX-NSCUHMNNSA-N crotonic acid Chemical compound C\C=C\C(O)=O LDHQCZJRKDOVOX-NSCUHMNNSA-N 0.000 description 4
- 239000012530 fluid Substances 0.000 description 4
- 239000011976 maleic acid Substances 0.000 description 4
- LVHBHZANLOWSRM-UHFFFAOYSA-N methylenebutanedioic acid Natural products OC(=O)CC(=C)C(O)=O LVHBHZANLOWSRM-UHFFFAOYSA-N 0.000 description 4
- 230000003287 optical effect Effects 0.000 description 4
- 239000003960 organic solvent Substances 0.000 description 4
- 229920000058 polyacrylate Polymers 0.000 description 4
- 239000004848 polyfunctional curative Substances 0.000 description 4
- 239000003505 polymerization initiator Substances 0.000 description 4
- 229920005862 polyol Polymers 0.000 description 4
- 150000003077 polyols Chemical class 0.000 description 4
- BPSIOYPQMFLKFR-UHFFFAOYSA-N trimethoxy-[3-(oxiran-2-ylmethoxy)propyl]silane Chemical compound CO[Si](OC)(OC)CCCOCC1CO1 BPSIOYPQMFLKFR-UHFFFAOYSA-N 0.000 description 4
- JAHNSTQSQJOJLO-UHFFFAOYSA-N 2-(3-fluorophenyl)-1h-imidazole Chemical compound FC1=CC=CC(C=2NC=CN=2)=C1 JAHNSTQSQJOJLO-UHFFFAOYSA-N 0.000 description 3
- OSWFIVFLDKOXQC-UHFFFAOYSA-N 4-(3-methoxyphenyl)aniline Chemical compound COC1=CC=CC(C=2C=CC(N)=CC=2)=C1 OSWFIVFLDKOXQC-UHFFFAOYSA-N 0.000 description 3
- KXDHJXZQYSOELW-UHFFFAOYSA-M Carbamate Chemical compound NC([O-])=O KXDHJXZQYSOELW-UHFFFAOYSA-M 0.000 description 3
- DNIAPMSPPWPWGF-UHFFFAOYSA-N Propylene glycol Chemical compound CC(O)CO DNIAPMSPPWPWGF-UHFFFAOYSA-N 0.000 description 3
- 229910008051 Si-OH Inorganic materials 0.000 description 3
- 229910006358 Si—OH Inorganic materials 0.000 description 3
- BOTDANWDWHJENH-UHFFFAOYSA-N Tetraethyl orthosilicate Chemical compound CCO[Si](OCC)(OCC)OCC BOTDANWDWHJENH-UHFFFAOYSA-N 0.000 description 3
- ZMANZCXQSJIPKH-UHFFFAOYSA-N Triethylamine Chemical compound CCN(CC)CC ZMANZCXQSJIPKH-UHFFFAOYSA-N 0.000 description 3
- 150000001298 alcohols Chemical class 0.000 description 3
- 229910052799 carbon Inorganic materials 0.000 description 3
- 150000001735 carboxylic acids Chemical class 0.000 description 3
- 238000004132 cross linking Methods 0.000 description 3
- MTHSVFCYNBDYFN-UHFFFAOYSA-N diethylene glycol Chemical compound OCCOCCO MTHSVFCYNBDYFN-UHFFFAOYSA-N 0.000 description 3
- KPUWHANPEXNPJT-UHFFFAOYSA-N disiloxane Chemical class [SiH3]O[SiH3] KPUWHANPEXNPJT-UHFFFAOYSA-N 0.000 description 3
- 239000003995 emulsifying agent Substances 0.000 description 3
- 235000019253 formic acid Nutrition 0.000 description 3
- 239000001530 fumaric acid Substances 0.000 description 3
- 239000011521 glass Substances 0.000 description 3
- 239000007788 liquid Substances 0.000 description 3
- FPYJFEHAWHCUMM-UHFFFAOYSA-N maleic anhydride Chemical compound O=C1OC(=O)C=C1 FPYJFEHAWHCUMM-UHFFFAOYSA-N 0.000 description 3
- 150000002763 monocarboxylic acids Chemical class 0.000 description 3
- VLKZOEOYAKHREP-UHFFFAOYSA-N n-Hexane Chemical compound CCCCCC VLKZOEOYAKHREP-UHFFFAOYSA-N 0.000 description 3
- 229920000620 organic polymer Polymers 0.000 description 3
- 239000002245 particle Substances 0.000 description 3
- 150000003254 radicals Chemical class 0.000 description 3
- 239000002002 slurry Substances 0.000 description 3
- LFQCEHFDDXELDD-UHFFFAOYSA-N tetramethyl orthosilicate Chemical compound CO[Si](OC)(OC)OC LFQCEHFDDXELDD-UHFFFAOYSA-N 0.000 description 3
- LDHQCZJRKDOVOX-UHFFFAOYSA-N trans-crotonic acid Natural products CC=CC(O)=O LDHQCZJRKDOVOX-UHFFFAOYSA-N 0.000 description 3
- LIKMAJRDDDTEIG-UHFFFAOYSA-N 1-hexene Chemical compound CCCCC=C LIKMAJRDDDTEIG-UHFFFAOYSA-N 0.000 description 2
- OZAIFHULBGXAKX-UHFFFAOYSA-N 2-(2-cyanopropan-2-yldiazenyl)-2-methylpropanenitrile Chemical compound N#CC(C)(C)N=NC(C)(C)C#N OZAIFHULBGXAKX-UHFFFAOYSA-N 0.000 description 2
- HIXDQWDOVZUNNA-UHFFFAOYSA-N 2-(3,4-dimethoxyphenyl)-5-hydroxy-7-methoxychromen-4-one Chemical compound C=1C(OC)=CC(O)=C(C(C=2)=O)C=1OC=2C1=CC=C(OC)C(OC)=C1 HIXDQWDOVZUNNA-UHFFFAOYSA-N 0.000 description 2
- OMIGHNLMNHATMP-UHFFFAOYSA-N 2-hydroxyethyl prop-2-enoate Chemical compound OCCOC(=O)C=C OMIGHNLMNHATMP-UHFFFAOYSA-N 0.000 description 2
- CSCPPACGZOOCGX-UHFFFAOYSA-N Acetone Chemical compound CC(C)=O CSCPPACGZOOCGX-UHFFFAOYSA-N 0.000 description 2
- IJGRMHOSHXDMSA-UHFFFAOYSA-N Atomic nitrogen Chemical compound N#N IJGRMHOSHXDMSA-UHFFFAOYSA-N 0.000 description 2
- KAKZBPTYRLMSJV-UHFFFAOYSA-N Butadiene Chemical compound C=CC=C KAKZBPTYRLMSJV-UHFFFAOYSA-N 0.000 description 2
- SOGAXMICEFXMKE-UHFFFAOYSA-N Butylmethacrylate Chemical compound CCCCOC(=O)C(C)=C SOGAXMICEFXMKE-UHFFFAOYSA-N 0.000 description 2
- UGFAIRIUMAVXCW-UHFFFAOYSA-N Carbon monoxide Chemical compound [O+]#[C-] UGFAIRIUMAVXCW-UHFFFAOYSA-N 0.000 description 2
- XTHFKEDIFFGKHM-UHFFFAOYSA-N Dimethoxyethane Chemical compound COCCOC XTHFKEDIFFGKHM-UHFFFAOYSA-N 0.000 description 2
- RRHGJUQNOFWUDK-UHFFFAOYSA-N Isoprene Chemical compound CC(=C)C=C RRHGJUQNOFWUDK-UHFFFAOYSA-N 0.000 description 2
- KFZMGEQAYNKOFK-UHFFFAOYSA-N Isopropanol Chemical compound CC(C)O KFZMGEQAYNKOFK-UHFFFAOYSA-N 0.000 description 2
- CERQOIWHTDAKMF-UHFFFAOYSA-M Methacrylate Chemical compound CC(=C)C([O-])=O CERQOIWHTDAKMF-UHFFFAOYSA-M 0.000 description 2
- 108010019160 Pancreatin Proteins 0.000 description 2
- NBIIXXVUZAFLBC-UHFFFAOYSA-N Phosphoric acid Chemical compound OP(O)(O)=O NBIIXXVUZAFLBC-UHFFFAOYSA-N 0.000 description 2
- 229910000831 Steel Inorganic materials 0.000 description 2
- DKGAVHZHDRPRBM-UHFFFAOYSA-N Tert-Butanol Chemical compound CC(C)(C)O DKGAVHZHDRPRBM-UHFFFAOYSA-N 0.000 description 2
- XXROGKLTLUQVRX-UHFFFAOYSA-N allyl alcohol Chemical compound OCC=C XXROGKLTLUQVRX-UHFFFAOYSA-N 0.000 description 2
- 150000001412 amines Chemical class 0.000 description 2
- 229910021529 ammonia Inorganic materials 0.000 description 2
- 150000008064 anhydrides Chemical class 0.000 description 2
- 230000008901 benefit Effects 0.000 description 2
- BTANRVKWQNVYAZ-UHFFFAOYSA-N butan-2-ol Chemical compound CCC(C)O BTANRVKWQNVYAZ-UHFFFAOYSA-N 0.000 description 2
- 229910002091 carbon monoxide Inorganic materials 0.000 description 2
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 description 2
- 239000000919 ceramic Substances 0.000 description 2
- 239000008199 coating composition Substances 0.000 description 2
- 239000011247 coating layer Substances 0.000 description 2
- CGGMCNLKDXNMLH-UHFFFAOYSA-N ctk4f7189 Chemical compound C1C2CCC1C1C2CC(CO)C1CO CGGMCNLKDXNMLH-UHFFFAOYSA-N 0.000 description 2
- HGCIXCUEYOPUTN-UHFFFAOYSA-N cyclohexene Chemical compound C1CCC=CC1 HGCIXCUEYOPUTN-UHFFFAOYSA-N 0.000 description 2
- ZSWFCLXCOIISFI-UHFFFAOYSA-N cyclopentadiene Chemical compound C1C=CC=C1 ZSWFCLXCOIISFI-UHFFFAOYSA-N 0.000 description 2
- LPIQUOYDBNQMRZ-UHFFFAOYSA-N cyclopentene Chemical compound C1CC=CC1 LPIQUOYDBNQMRZ-UHFFFAOYSA-N 0.000 description 2
- 230000003247 decreasing effect Effects 0.000 description 2
- FJKIXWOMBXYWOQ-UHFFFAOYSA-N ethenoxyethane Chemical compound CCOC=C FJKIXWOMBXYWOQ-UHFFFAOYSA-N 0.000 description 2
- RTZKZFJDLAIYFH-UHFFFAOYSA-N ether Substances CCOCC RTZKZFJDLAIYFH-UHFFFAOYSA-N 0.000 description 2
- 230000009477 glass transition Effects 0.000 description 2
- 125000003055 glycidyl group Chemical group C(C1CO1)* 0.000 description 2
- WGCNASOHLSPBMP-UHFFFAOYSA-N hydroxyacetaldehyde Natural products OCC=O WGCNASOHLSPBMP-UHFFFAOYSA-N 0.000 description 2
- 238000009863 impact test Methods 0.000 description 2
- 239000004611 light stabiliser Substances 0.000 description 2
- VUZPPFZMUPKLLV-UHFFFAOYSA-N methane;hydrate Chemical compound C.O VUZPPFZMUPKLLV-UHFFFAOYSA-N 0.000 description 2
- 239000002114 nanocomposite Substances 0.000 description 2
- 239000002105 nanoparticle Substances 0.000 description 2
- 239000003791 organic solvent mixture Substances 0.000 description 2
- 229940055695 pancreatin Drugs 0.000 description 2
- WXZMFSXDPGVJKK-UHFFFAOYSA-N pentaerythritol Chemical compound OCC(CO)(CO)CO WXZMFSXDPGVJKK-UHFFFAOYSA-N 0.000 description 2
- YWAKXRMUMFPDSH-UHFFFAOYSA-N pentene Chemical compound CCCC=C YWAKXRMUMFPDSH-UHFFFAOYSA-N 0.000 description 2
- 238000005191 phase separation Methods 0.000 description 2
- 150000002989 phenols Chemical class 0.000 description 2
- XNGIFLGASWRNHJ-UHFFFAOYSA-N phthalic acid Chemical compound OC(=O)C1=CC=CC=C1C(O)=O XNGIFLGASWRNHJ-UHFFFAOYSA-N 0.000 description 2
- 229920000642 polymer Polymers 0.000 description 2
- 229920001296 polysiloxane Polymers 0.000 description 2
- BDERNNFJNOPAEC-UHFFFAOYSA-N propan-1-ol Chemical compound CCCO BDERNNFJNOPAEC-UHFFFAOYSA-N 0.000 description 2
- 150000004760 silicates Chemical class 0.000 description 2
- RMAQACBXLXPBSY-UHFFFAOYSA-N silicic acid Chemical class O[Si](O)(O)O RMAQACBXLXPBSY-UHFFFAOYSA-N 0.000 description 2
- 229910052710 silicon Inorganic materials 0.000 description 2
- 239000010703 silicon Substances 0.000 description 2
- HEMHJVSKTPXQMS-UHFFFAOYSA-M sodium hydroxide Inorganic materials [OH-].[Na+] HEMHJVSKTPXQMS-UHFFFAOYSA-M 0.000 description 2
- 239000007858 starting material Substances 0.000 description 2
- 239000010959 steel Substances 0.000 description 2
- KDYFGRWQOYBRFD-UHFFFAOYSA-N succinic acid Chemical compound OC(=O)CCC(O)=O KDYFGRWQOYBRFD-UHFFFAOYSA-N 0.000 description 2
- 150000003460 sulfonic acids Chemical class 0.000 description 2
- 125000000999 tert-butyl group Chemical group [H]C([H])([H])C(*)(C([H])([H])[H])C([H])([H])[H] 0.000 description 2
- RXMRGBVLCSYIBO-UHFFFAOYSA-M tetramethylazanium;iodide Chemical compound [I-].C[N+](C)(C)C RXMRGBVLCSYIBO-UHFFFAOYSA-M 0.000 description 2
- CPUDPFPXCZDNGI-UHFFFAOYSA-N triethoxy(methyl)silane Chemical compound CCO[Si](C)(OCC)OCC CPUDPFPXCZDNGI-UHFFFAOYSA-N 0.000 description 2
- AVWRKZWQTYIKIY-UHFFFAOYSA-N urea-1-carboxylic acid Chemical group NC(=O)NC(O)=O AVWRKZWQTYIKIY-UHFFFAOYSA-N 0.000 description 2
- DTGKSKDOIYIVQL-WEDXCCLWSA-N (+)-borneol Chemical group C1C[C@@]2(C)[C@@H](O)C[C@@H]1C2(C)C DTGKSKDOIYIVQL-WEDXCCLWSA-N 0.000 description 1
- PUPZLCDOIYMWBV-UHFFFAOYSA-N (+/-)-1,3-Butanediol Chemical compound CC(O)CCO PUPZLCDOIYMWBV-UHFFFAOYSA-N 0.000 description 1
- JHPBZFOKBAGZBL-UHFFFAOYSA-N (3-hydroxy-2,2,4-trimethylpentyl) 2-methylprop-2-enoate Chemical compound CC(C)C(O)C(C)(C)COC(=O)C(C)=C JHPBZFOKBAGZBL-UHFFFAOYSA-N 0.000 description 1
- DNIAPMSPPWPWGF-GSVOUGTGSA-N (R)-(-)-Propylene glycol Chemical compound C[C@@H](O)CO DNIAPMSPPWPWGF-GSVOUGTGSA-N 0.000 description 1
- BQCIDUSAKPWEOX-UHFFFAOYSA-N 1,1-Difluoroethene Chemical compound FC(F)=C BQCIDUSAKPWEOX-UHFFFAOYSA-N 0.000 description 1
- LGXVIGDEPROXKC-UHFFFAOYSA-N 1,1-dichloroethene Chemical compound ClC(Cl)=C LGXVIGDEPROXKC-UHFFFAOYSA-N 0.000 description 1
- OZCMOJQQLBXBKI-UHFFFAOYSA-N 1-ethenoxy-2-methylpropane Chemical compound CC(C)COC=C OZCMOJQQLBXBKI-UHFFFAOYSA-N 0.000 description 1
- UZKWTJUDCOPSNM-UHFFFAOYSA-N 1-ethenoxybutane Chemical compound CCCCOC=C UZKWTJUDCOPSNM-UHFFFAOYSA-N 0.000 description 1
- OVGRCEFMXPHEBL-UHFFFAOYSA-N 1-ethenoxypropane Chemical compound CCCOC=C OVGRCEFMXPHEBL-UHFFFAOYSA-N 0.000 description 1
- JRZJOMJEPLMPRA-UHFFFAOYSA-N 1-nonene Chemical compound CCCCCCCC=C JRZJOMJEPLMPRA-UHFFFAOYSA-N 0.000 description 1
- ZKEUVTROUPQVTM-UHFFFAOYSA-N 1-pentylperoxypentane Chemical compound CCCCCOOCCCCC ZKEUVTROUPQVTM-UHFFFAOYSA-N 0.000 description 1
- HECLRDQVFMWTQS-RGOKHQFPSA-N 1755-01-7 Chemical compound C1[C@H]2[C@@H]3CC=C[C@@H]3[C@@H]1C=C2 HECLRDQVFMWTQS-RGOKHQFPSA-N 0.000 description 1
- FXNDIJDIPNCZQJ-UHFFFAOYSA-N 2,4,4-trimethylpent-1-ene Chemical group CC(=C)CC(C)(C)C FXNDIJDIPNCZQJ-UHFFFAOYSA-N 0.000 description 1
- WFSMVVDJSNMRAR-UHFFFAOYSA-N 2-[2-(2-ethoxyethoxy)ethoxy]ethanol Chemical compound CCOCCOCCOCCO WFSMVVDJSNMRAR-UHFFFAOYSA-N 0.000 description 1
- GNUGVECARVKIPH-UHFFFAOYSA-N 2-ethenoxypropane Chemical compound CC(C)OC=C GNUGVECARVKIPH-UHFFFAOYSA-N 0.000 description 1
- 229940093475 2-ethoxyethanol Drugs 0.000 description 1
- KTCIQOVSDDBEIG-UHFFFAOYSA-N 2-ethyl-2-methylheptanoic acid Chemical compound CCCCCC(C)(CC)C(O)=O KTCIQOVSDDBEIG-UHFFFAOYSA-N 0.000 description 1
- IPNCJMYEZCKXIL-UHFFFAOYSA-N 2-hydroxybutan-2-yl prop-2-enoate Chemical compound CCC(C)(O)OC(=O)C=C IPNCJMYEZCKXIL-UHFFFAOYSA-N 0.000 description 1
- 125000000954 2-hydroxyethyl group Chemical group [H]C([*])([H])C([H])([H])O[H] 0.000 description 1
- PYSRRFNXTXNWCD-UHFFFAOYSA-N 3-(2-phenylethenyl)furan-2,5-dione Chemical compound O=C1OC(=O)C(C=CC=2C=CC=CC=2)=C1 PYSRRFNXTXNWCD-UHFFFAOYSA-N 0.000 description 1
- QOXOZONBQWIKDA-UHFFFAOYSA-N 3-hydroxypropyl Chemical group [CH2]CCO QOXOZONBQWIKDA-UHFFFAOYSA-N 0.000 description 1
- OFNISBHGPNMTMS-UHFFFAOYSA-N 3-methylideneoxolane-2,5-dione Chemical compound C=C1CC(=O)OC1=O OFNISBHGPNMTMS-UHFFFAOYSA-N 0.000 description 1
- ATVJXMYDOSMEPO-UHFFFAOYSA-N 3-prop-2-enoxyprop-1-ene Chemical compound C=CCOCC=C ATVJXMYDOSMEPO-UHFFFAOYSA-N 0.000 description 1
- GBSGXZBOFKJGMG-UHFFFAOYSA-N 3-propan-2-yloxypropan-1-ol Chemical compound CC(C)OCCCO GBSGXZBOFKJGMG-UHFFFAOYSA-N 0.000 description 1
- NDWUBGAGUCISDV-UHFFFAOYSA-N 4-hydroxybutyl prop-2-enoate Chemical compound OCCCCOC(=O)C=C NDWUBGAGUCISDV-UHFFFAOYSA-N 0.000 description 1
- IZSHZLKNFQAAKX-UHFFFAOYSA-N 5-cyclopenta-2,4-dien-1-ylcyclopenta-1,3-diene Chemical group C1=CC=CC1C1C=CC=C1 IZSHZLKNFQAAKX-UHFFFAOYSA-N 0.000 description 1
- OAOABCKPVCUNKO-UHFFFAOYSA-N 8-methyl Nonanoic acid Chemical compound CC(C)CCCCCCC(O)=O OAOABCKPVCUNKO-UHFFFAOYSA-N 0.000 description 1
- QTBSBXVTEAMEQO-UHFFFAOYSA-M Acetate Chemical compound CC([O-])=O QTBSBXVTEAMEQO-UHFFFAOYSA-M 0.000 description 1
- HRPVXLWXLXDGHG-UHFFFAOYSA-N Acrylamide Chemical compound NC(=O)C=C HRPVXLWXLXDGHG-UHFFFAOYSA-N 0.000 description 1
- NLHHRLWOUZZQLW-UHFFFAOYSA-N Acrylonitrile Chemical compound C=CC#N NLHHRLWOUZZQLW-UHFFFAOYSA-N 0.000 description 1
- 229910018072 Al 2 O 3 Inorganic materials 0.000 description 1
- 239000004342 Benzoyl peroxide Substances 0.000 description 1
- OMPJBNCRMGITSC-UHFFFAOYSA-N Benzoylperoxide Chemical compound C=1C=CC=CC=1C(=O)OOC(=O)C1=CC=CC=C1 OMPJBNCRMGITSC-UHFFFAOYSA-N 0.000 description 1
- 241001012508 Carpiodes cyprinus Species 0.000 description 1
- BRLQWZUYTZBJKN-UHFFFAOYSA-N Epichlorohydrin Chemical compound ClCC1CO1 BRLQWZUYTZBJKN-UHFFFAOYSA-N 0.000 description 1
- 239000004593 Epoxy Substances 0.000 description 1
- 235000009161 Espostoa lanata Nutrition 0.000 description 1
- 240000001624 Espostoa lanata Species 0.000 description 1
- YCKRFDGAMUMZLT-UHFFFAOYSA-N Fluorine atom Chemical compound [F] YCKRFDGAMUMZLT-UHFFFAOYSA-N 0.000 description 1
- DGAQECJNVWCQMB-PUAWFVPOSA-M Ilexoside XXIX Chemical compound C[C@@H]1CC[C@@]2(CC[C@@]3(C(=CC[C@H]4[C@]3(CC[C@@H]5[C@@]4(CC[C@@H](C5(C)C)OS(=O)(=O)[O-])C)C)[C@@H]2[C@]1(C)O)C)C(=O)O[C@H]6[C@@H]([C@H]([C@@H]([C@H](O6)CO)O)O)O.[Na+] DGAQECJNVWCQMB-PUAWFVPOSA-M 0.000 description 1
- VVQNEPGJFQJSBK-UHFFFAOYSA-N Methyl methacrylate Chemical compound COC(=O)C(C)=C VVQNEPGJFQJSBK-UHFFFAOYSA-N 0.000 description 1
- GYCMBHHDWRMZGG-UHFFFAOYSA-N Methylacrylonitrile Chemical compound CC(=C)C#N GYCMBHHDWRMZGG-UHFFFAOYSA-N 0.000 description 1
- WHNWPMSKXPGLAX-UHFFFAOYSA-N N-Vinyl-2-pyrrolidone Chemical compound C=CN1CCCC1=O WHNWPMSKXPGLAX-UHFFFAOYSA-N 0.000 description 1
- 239000004677 Nylon Substances 0.000 description 1
- BPQQTUXANYXVAA-UHFFFAOYSA-N Orthosilicate Chemical compound [O-][Si]([O-])([O-])[O-] BPQQTUXANYXVAA-UHFFFAOYSA-N 0.000 description 1
- ALQSHHUCVQOPAS-UHFFFAOYSA-N Pentane-1,5-diol Chemical compound OCCCCCO ALQSHHUCVQOPAS-UHFFFAOYSA-N 0.000 description 1
- 108010081873 Persil Proteins 0.000 description 1
- 229920002845 Poly(methacrylic acid) Polymers 0.000 description 1
- 239000004721 Polyphenylene oxide Substances 0.000 description 1
- 239000004372 Polyvinyl alcohol Substances 0.000 description 1
- ZLMJMSJWJFRBEC-UHFFFAOYSA-N Potassium Chemical compound [K] ZLMJMSJWJFRBEC-UHFFFAOYSA-N 0.000 description 1
- QQONPFPTGQHPMA-UHFFFAOYSA-N Propene Chemical compound CC=C QQONPFPTGQHPMA-UHFFFAOYSA-N 0.000 description 1
- 229920002125 Sokalan® Polymers 0.000 description 1
- 229920000147 Styrene maleic anhydride Polymers 0.000 description 1
- 229910010413 TiO 2 Inorganic materials 0.000 description 1
- ZJCCRDAZUWHFQH-UHFFFAOYSA-N Trimethylolpropane Chemical compound CCC(CO)(CO)CO ZJCCRDAZUWHFQH-UHFFFAOYSA-N 0.000 description 1
- 239000007983 Tris buffer Substances 0.000 description 1
- XTXRWKRVRITETP-UHFFFAOYSA-N Vinyl acetate Chemical compound CC(=O)OC=C XTXRWKRVRITETP-UHFFFAOYSA-N 0.000 description 1
- BZHJMEDXRYGGRV-UHFFFAOYSA-N Vinyl chloride Chemical compound ClC=C BZHJMEDXRYGGRV-UHFFFAOYSA-N 0.000 description 1
- QYKIQEUNHZKYBP-UHFFFAOYSA-N Vinyl ether Chemical class C=COC=C QYKIQEUNHZKYBP-UHFFFAOYSA-N 0.000 description 1
- YIMQCDZDWXUDCA-UHFFFAOYSA-N [4-(hydroxymethyl)cyclohexyl]methanol Chemical compound OCC1CCC(CO)CC1 YIMQCDZDWXUDCA-UHFFFAOYSA-N 0.000 description 1
- LBKOBSXMPMKAKL-UHFFFAOYSA-N [Li].[F].[Na].[Mg] Chemical compound [Li].[F].[Na].[Mg] LBKOBSXMPMKAKL-UHFFFAOYSA-N 0.000 description 1
- 238000005299 abrasion Methods 0.000 description 1
- 239000006096 absorbing agent Substances 0.000 description 1
- 125000003668 acetyloxy group Chemical group [H]C([H])([H])C(=O)O[*] 0.000 description 1
- 230000002378 acidificating effect Effects 0.000 description 1
- 229920006243 acrylic copolymer Polymers 0.000 description 1
- 125000002015 acyclic group Chemical group 0.000 description 1
- 239000002318 adhesion promoter Substances 0.000 description 1
- 239000000853 adhesive Substances 0.000 description 1
- 230000001070 adhesive effect Effects 0.000 description 1
- 239000003463 adsorbent Substances 0.000 description 1
- 230000002411 adverse Effects 0.000 description 1
- 239000003513 alkali Substances 0.000 description 1
- 229910001854 alkali hydroxide Inorganic materials 0.000 description 1
- 150000001447 alkali salts Chemical class 0.000 description 1
- 229910001860 alkaline earth metal hydroxide Inorganic materials 0.000 description 1
- 125000004466 alkoxycarbonylamino group Chemical group 0.000 description 1
- 150000003973 alkyl amines Chemical class 0.000 description 1
- 125000002947 alkylene group Chemical group 0.000 description 1
- XYLMUPLGERFSHI-UHFFFAOYSA-N alpha-Methylstyrene Chemical compound CC(=C)C1=CC=CC=C1 XYLMUPLGERFSHI-UHFFFAOYSA-N 0.000 description 1
- HSFWRNGVRCDJHI-UHFFFAOYSA-N alpha-acetylene Natural products C#C HSFWRNGVRCDJHI-UHFFFAOYSA-N 0.000 description 1
- 229910000147 aluminium phosphate Inorganic materials 0.000 description 1
- SNAAJJQQZSMGQD-UHFFFAOYSA-N aluminum magnesium Chemical compound [Mg].[Al] SNAAJJQQZSMGQD-UHFFFAOYSA-N 0.000 description 1
- QDHUQRBYCVAWEN-UHFFFAOYSA-N amino prop-2-enoate Chemical class NOC(=O)C=C QDHUQRBYCVAWEN-UHFFFAOYSA-N 0.000 description 1
- 150000003863 ammonium salts Chemical class 0.000 description 1
- 125000000129 anionic group Chemical group 0.000 description 1
- 238000007743 anodising Methods 0.000 description 1
- 239000012736 aqueous medium Substances 0.000 description 1
- 150000001491 aromatic compounds Chemical class 0.000 description 1
- 239000012298 atmosphere Substances 0.000 description 1
- XOZUGNYVDXMRKW-AATRIKPKSA-N azodicarbonamide Chemical compound NC(=O)\N=N\C(N)=O XOZUGNYVDXMRKW-AATRIKPKSA-N 0.000 description 1
- 235000019400 benzoyl peroxide Nutrition 0.000 description 1
- 230000001680 brushing effect Effects 0.000 description 1
- 125000000484 butyl group Chemical group [H]C([*])([H])C([H])([H])C([H])([H])C([H])([H])[H] 0.000 description 1
- AXCZMVOFGPJBDE-UHFFFAOYSA-L calcium dihydroxide Chemical compound [OH-].[OH-].[Ca+2] AXCZMVOFGPJBDE-UHFFFAOYSA-L 0.000 description 1
- 239000000920 calcium hydroxide Substances 0.000 description 1
- 229910001861 calcium hydroxide Inorganic materials 0.000 description 1
- 150000001732 carboxylic acid derivatives Chemical class 0.000 description 1
- 150000001733 carboxylic acid esters Chemical class 0.000 description 1
- 229940072282 cardura Drugs 0.000 description 1
- 239000001913 cellulose Substances 0.000 description 1
- 229920002678 cellulose Polymers 0.000 description 1
- 230000008859 change Effects 0.000 description 1
- 238000004040 coloring Methods 0.000 description 1
- 238000009500 colour coating Methods 0.000 description 1
- 238000010276 construction Methods 0.000 description 1
- 238000001816 cooling Methods 0.000 description 1
- 239000006184 cosolvent Substances 0.000 description 1
- 125000000753 cycloalkyl group Chemical group 0.000 description 1
- 125000000113 cyclohexyl group Chemical group [H]C1([H])C([H])([H])C([H])([H])C([H])(*)C([H])([H])C1([H])[H] 0.000 description 1
- 230000001419 dependent effect Effects 0.000 description 1
- 238000001514 detection method Methods 0.000 description 1
- 239000003599 detergent Substances 0.000 description 1
- GUJOJGAPFQRJSV-UHFFFAOYSA-N dialuminum;dioxosilane;oxygen(2-);hydrate Chemical compound O.[O-2].[O-2].[O-2].[Al+3].[Al+3].O=[Si]=O.O=[Si]=O.O=[Si]=O.O=[Si]=O GUJOJGAPFQRJSV-UHFFFAOYSA-N 0.000 description 1
- 150000001991 dicarboxylic acids Chemical class 0.000 description 1
- 239000003085 diluting agent Substances 0.000 description 1
- 238000003618 dip coating Methods 0.000 description 1
- 238000007598 dipping method Methods 0.000 description 1
- SZXQTJUDPRGNJN-UHFFFAOYSA-N dipropylene glycol Chemical compound OCCCOCCCO SZXQTJUDPRGNJN-UHFFFAOYSA-N 0.000 description 1
- 238000004821 distillation Methods 0.000 description 1
- 239000012153 distilled water Substances 0.000 description 1
- RUZYUOTYCVRMRZ-UHFFFAOYSA-N doxazosin Chemical compound C1OC2=CC=CC=C2OC1C(=O)N(CC1)CCN1C1=NC(N)=C(C=C(C(OC)=C2)OC)C2=N1 RUZYUOTYCVRMRZ-UHFFFAOYSA-N 0.000 description 1
- 238000001035 drying Methods 0.000 description 1
- 238000009713 electroplating Methods 0.000 description 1
- 238000005516 engineering process Methods 0.000 description 1
- VGIYPVFBQRUBDD-UHFFFAOYSA-N ethenoxycyclohexane Chemical compound C=COC1CCCCC1 VGIYPVFBQRUBDD-UHFFFAOYSA-N 0.000 description 1
- YCUBDDIKWLELPD-UHFFFAOYSA-N ethenyl 2,2-dimethylpropanoate Chemical compound CC(C)(C)C(=O)OC=C YCUBDDIKWLELPD-UHFFFAOYSA-N 0.000 description 1
- MEGHWIAOTJPCHQ-UHFFFAOYSA-N ethenyl butanoate Chemical compound CCCC(=O)OC=C MEGHWIAOTJPCHQ-UHFFFAOYSA-N 0.000 description 1
- UIWXSTHGICQLQT-UHFFFAOYSA-N ethenyl propanoate Chemical compound CCC(=O)OC=C UIWXSTHGICQLQT-UHFFFAOYSA-N 0.000 description 1
- 125000005677 ethinylene group Chemical group [*:2]C#C[*:1] 0.000 description 1
- UHESRSKEBRADOO-UHFFFAOYSA-N ethyl carbamate;prop-2-enoic acid Chemical class OC(=O)C=C.CCOC(N)=O UHESRSKEBRADOO-UHFFFAOYSA-N 0.000 description 1
- 230000002349 favourable effect Effects 0.000 description 1
- 239000003063 flame retardant Substances 0.000 description 1
- 239000011737 fluorine Substances 0.000 description 1
- 229910052731 fluorine Inorganic materials 0.000 description 1
- XUCNUKMRBVNAPB-UHFFFAOYSA-N fluoroethene Chemical compound FC=C XUCNUKMRBVNAPB-UHFFFAOYSA-N 0.000 description 1
- 238000009472 formulation Methods 0.000 description 1
- ZZUFCTLCJUWOSV-UHFFFAOYSA-N furosemide Chemical compound C1=C(Cl)C(S(=O)(=O)N)=CC(C(O)=O)=C1NCC1=CC=CO1 ZZUFCTLCJUWOSV-UHFFFAOYSA-N 0.000 description 1
- 239000007789 gas Substances 0.000 description 1
- 238000010438 heat treatment Methods 0.000 description 1
- 125000004051 hexyl group Chemical group [H]C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])* 0.000 description 1
- 229930195733 hydrocarbon Natural products 0.000 description 1
- 150000002430 hydrocarbons Chemical class 0.000 description 1
- XLYOFNOQVPJJNP-UHFFFAOYSA-M hydroxide Chemical compound [OH-] XLYOFNOQVPJJNP-UHFFFAOYSA-M 0.000 description 1
- 238000010348 incorporation Methods 0.000 description 1
- 239000003112 inhibitor Substances 0.000 description 1
- 150000007529 inorganic bases Chemical class 0.000 description 1
- JEIPFZHSYJVQDO-UHFFFAOYSA-N iron(III) oxide Inorganic materials O=[Fe]O[Fe]=O JEIPFZHSYJVQDO-UHFFFAOYSA-N 0.000 description 1
- ZXEKIIBDNHEJCQ-UHFFFAOYSA-N isobutanol Chemical compound CC(C)CO ZXEKIIBDNHEJCQ-UHFFFAOYSA-N 0.000 description 1
- 239000012948 isocyanate Substances 0.000 description 1
- 150000002513 isocyanates Chemical class 0.000 description 1
- 150000002576 ketones Chemical class 0.000 description 1
- PBOSTUDLECTMNL-UHFFFAOYSA-N lauryl acrylate Chemical compound CCCCCCCCCCCCOC(=O)C=C PBOSTUDLECTMNL-UHFFFAOYSA-N 0.000 description 1
- NEMFQSKAPLGFIP-UHFFFAOYSA-N magnesiosodium Chemical compound [Na].[Mg] NEMFQSKAPLGFIP-UHFFFAOYSA-N 0.000 description 1
- 239000000391 magnesium silicate Substances 0.000 description 1
- 239000002609 medium Substances 0.000 description 1
- 150000002734 metacrylic acid derivatives Chemical class 0.000 description 1
- 229910044991 metal oxide Inorganic materials 0.000 description 1
- 150000004706 metal oxides Chemical class 0.000 description 1
- 125000005397 methacrylic acid ester group Chemical group 0.000 description 1
- GBMDVOWEEQVZKZ-UHFFFAOYSA-N methanol;hydrate Chemical compound O.OC GBMDVOWEEQVZKZ-UHFFFAOYSA-N 0.000 description 1
- BFXIKLCIZHOAAZ-UHFFFAOYSA-N methyltrimethoxysilane Chemical compound CO[Si](C)(OC)OC BFXIKLCIZHOAAZ-UHFFFAOYSA-N 0.000 description 1
- 239000011859 microparticle Substances 0.000 description 1
- 239000002480 mineral oil Substances 0.000 description 1
- 235000010446 mineral oil Nutrition 0.000 description 1
- 150000007522 mineralic acids Chemical class 0.000 description 1
- 239000002808 molecular sieve Substances 0.000 description 1
- 150000002762 monocarboxylic acid derivatives Chemical class 0.000 description 1
- 229910052901 montmorillonite Inorganic materials 0.000 description 1
- 125000004108 n-butyl group Chemical group [H]C([H])([H])C([H])([H])C([H])([H])C([H])([H])* 0.000 description 1
- 150000002825 nitriles Chemical class 0.000 description 1
- JFNLZVQOOSMTJK-KNVOCYPGSA-N norbornene Chemical compound C1[C@@H]2CC[C@H]1C=C2 JFNLZVQOOSMTJK-KNVOCYPGSA-N 0.000 description 1
- 229920001778 nylon Polymers 0.000 description 1
- 150000007524 organic acids Chemical class 0.000 description 1
- 150000007530 organic bases Chemical class 0.000 description 1
- FIWHJQPAGLNURC-UHFFFAOYSA-N oxiran-2-ylmethyl 7,7-dimethyloctanoate Chemical compound CC(C)(C)CCCCCC(=O)OCC1CO1 FIWHJQPAGLNURC-UHFFFAOYSA-N 0.000 description 1
- 238000007591 painting process Methods 0.000 description 1
- RGSFGYAAUTVSQA-UHFFFAOYSA-N pentamethylene Natural products C1CCCC1 RGSFGYAAUTVSQA-UHFFFAOYSA-N 0.000 description 1
- 150000002978 peroxides Chemical class 0.000 description 1
- 150000003009 phosphonic acids Chemical class 0.000 description 1
- 150000003014 phosphoric acid esters Chemical class 0.000 description 1
- 229920000728 polyester Polymers 0.000 description 1
- 229920000570 polyether Polymers 0.000 description 1
- 230000000379 polymerizing effect Effects 0.000 description 1
- 239000004814 polyurethane Substances 0.000 description 1
- 229920002635 polyurethane Polymers 0.000 description 1
- 229920002451 polyvinyl alcohol Polymers 0.000 description 1
- 229920000036 polyvinylpyrrolidone Polymers 0.000 description 1
- 239000001267 polyvinylpyrrolidone Substances 0.000 description 1
- 235000013855 polyvinylpyrrolidone Nutrition 0.000 description 1
- QCTJRYGLPAFRMS-UHFFFAOYSA-N prop-2-enoic acid;1,3,5-triazine-2,4,6-triamine Chemical class OC(=O)C=C.NC1=NC(N)=NC(N)=N1 QCTJRYGLPAFRMS-UHFFFAOYSA-N 0.000 description 1
- MOVRCMBPGBESLI-UHFFFAOYSA-N prop-2-enoyloxysilicon Chemical compound [Si]OC(=O)C=C MOVRCMBPGBESLI-UHFFFAOYSA-N 0.000 description 1
- HJWLCRVIBGQPNF-UHFFFAOYSA-N prop-2-enylbenzene Chemical compound C=CCC1=CC=CC=C1 HJWLCRVIBGQPNF-UHFFFAOYSA-N 0.000 description 1
- 150000003856 quaternary ammonium compounds Chemical class 0.000 description 1
- 239000012429 reaction media Substances 0.000 description 1
- 238000010992 reflux Methods 0.000 description 1
- 230000008929 regeneration Effects 0.000 description 1
- 238000011069 regeneration method Methods 0.000 description 1
- 238000005096 rolling process Methods 0.000 description 1
- 125000005920 sec-butoxy group Chemical group 0.000 description 1
- 125000002914 sec-butyl group Chemical group [H]C([H])([H])C([H])([H])C([H])(*)C([H])([H])[H] 0.000 description 1
- 239000000741 silica gel Substances 0.000 description 1
- 229910002027 silica gel Inorganic materials 0.000 description 1
- 150000003377 silicon compounds Chemical class 0.000 description 1
- 229910052709 silver Inorganic materials 0.000 description 1
- 239000004332 silver Substances 0.000 description 1
- URGAHOPLAPQHLN-UHFFFAOYSA-N sodium aluminosilicate Chemical compound [Na+].[Al+3].[O-][Si]([O-])=O.[O-][Si]([O-])=O URGAHOPLAPQHLN-UHFFFAOYSA-N 0.000 description 1
- 238000003980 solgel method Methods 0.000 description 1
- 238000005507 spraying Methods 0.000 description 1
- 230000000087 stabilizing effect Effects 0.000 description 1
- 125000004079 stearyl group Chemical group [H]C([*])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])[H] 0.000 description 1
- 238000003860 storage Methods 0.000 description 1
- 125000001424 substituent group Chemical group 0.000 description 1
- 239000001384 succinic acid Substances 0.000 description 1
- 238000004381 surface treatment Methods 0.000 description 1
- 229920001059 synthetic polymer Polymers 0.000 description 1
- 239000008399 tap water Substances 0.000 description 1
- 235000020679 tap water Nutrition 0.000 description 1
- 238000010345 tape casting Methods 0.000 description 1
- GJBRNHKUVLOCEB-UHFFFAOYSA-N tert-butyl benzenecarboperoxoate Chemical compound CC(C)(C)OOC(=O)C1=CC=CC=C1 GJBRNHKUVLOCEB-UHFFFAOYSA-N 0.000 description 1
- 238000010998 test method Methods 0.000 description 1
- 150000005621 tetraalkylammonium salts Chemical class 0.000 description 1
- 230000008646 thermal stress Effects 0.000 description 1
- 238000012546 transfer Methods 0.000 description 1
- WOZZOSDBXABUFO-UHFFFAOYSA-N tri(butan-2-yloxy)alumane Chemical compound [Al+3].CCC(C)[O-].CCC(C)[O-].CCC(C)[O-] WOZZOSDBXABUFO-UHFFFAOYSA-N 0.000 description 1
- 150000003918 triazines Chemical class 0.000 description 1
- YAQCYZLLBMLGOB-UHFFFAOYSA-N tricyclo[5.2.1.02,6]dec-3-ylmethanol Chemical compound C1CC2C3C(CO)CCC3C1C2 YAQCYZLLBMLGOB-UHFFFAOYSA-N 0.000 description 1
- 229920006305 unsaturated polyester Polymers 0.000 description 1
- 150000003673 urethanes Chemical class 0.000 description 1
- 230000000007 visual effect Effects 0.000 description 1
- 238000005406 washing Methods 0.000 description 1
- 239000004924 water-based lacquer Substances 0.000 description 1
- 239000000080 wetting agent Substances 0.000 description 1
- 239000002023 wood Substances 0.000 description 1
- PAPBSGBWRJIAAV-UHFFFAOYSA-N ε-Caprolactone Chemical compound O=C1CCCCCO1 PAPBSGBWRJIAAV-UHFFFAOYSA-N 0.000 description 1
Classifications
-
- B—PERFORMING OPERATIONS; TRANSPORTING
- B05—SPRAYING OR ATOMISING IN GENERAL; APPLYING FLUENT MATERIALS TO SURFACES, IN GENERAL
- B05D—PROCESSES FOR APPLYING FLUENT MATERIALS TO SURFACES, IN GENERAL
- B05D7/00—Processes, other than flocking, specially adapted for applying liquids or other fluent materials to particular surfaces or for applying particular liquids or other fluent materials
- B05D7/50—Multilayers
- B05D7/52—Two layers
- B05D7/53—Base coat plus clear coat type
- B05D7/536—Base coat plus clear coat type each layer being cured, at least partially, separately
-
- B—PERFORMING OPERATIONS; TRANSPORTING
- B05—SPRAYING OR ATOMISING IN GENERAL; APPLYING FLUENT MATERIALS TO SURFACES, IN GENERAL
- B05D—PROCESSES FOR APPLYING FLUENT MATERIALS TO SURFACES, IN GENERAL
- B05D7/00—Processes, other than flocking, specially adapted for applying liquids or other fluent materials to particular surfaces or for applying particular liquids or other fluent materials
- B05D7/50—Multilayers
- B05D7/56—Three layers or more
- B05D7/57—Three layers or more the last layer being a clear coat
- B05D7/576—Three layers or more the last layer being a clear coat each layer being cured, at least partially, separately
-
- C—CHEMISTRY; METALLURGY
- C09—DYES; PAINTS; POLISHES; NATURAL RESINS; ADHESIVES; COMPOSITIONS NOT OTHERWISE PROVIDED FOR; APPLICATIONS OF MATERIALS NOT OTHERWISE PROVIDED FOR
- C09D—COATING COMPOSITIONS, e.g. PAINTS, VARNISHES OR LACQUERS; FILLING PASTES; CHEMICAL PAINT OR INK REMOVERS; INKS; CORRECTING FLUIDS; WOODSTAINS; PASTES OR SOLIDS FOR COLOURING OR PRINTING; USE OF MATERIALS THEREFOR
- C09D133/00—Coating compositions based on homopolymers or copolymers of compounds having one or more unsaturated aliphatic radicals, each having only one carbon-to-carbon double bond, and at least one being terminated by only one carboxyl radical, or of salts, anhydrides, esters, amides, imides, or nitriles thereof; Coating compositions based on derivatives of such polymers
- C09D133/04—Homopolymers or copolymers of esters
- C09D133/06—Homopolymers or copolymers of esters of esters containing only carbon, hydrogen and oxygen, the oxygen atom being present only as part of the carboxyl radical
- C09D133/062—Copolymers with monomers not covered by C09D133/06
- C09D133/066—Copolymers with monomers not covered by C09D133/06 containing -OH groups
-
- C—CHEMISTRY; METALLURGY
- C09—DYES; PAINTS; POLISHES; NATURAL RESINS; ADHESIVES; COMPOSITIONS NOT OTHERWISE PROVIDED FOR; APPLICATIONS OF MATERIALS NOT OTHERWISE PROVIDED FOR
- C09D—COATING COMPOSITIONS, e.g. PAINTS, VARNISHES OR LACQUERS; FILLING PASTES; CHEMICAL PAINT OR INK REMOVERS; INKS; CORRECTING FLUIDS; WOODSTAINS; PASTES OR SOLIDS FOR COLOURING OR PRINTING; USE OF MATERIALS THEREFOR
- C09D183/00—Coating compositions based on macromolecular compounds obtained by reactions forming in the main chain of the macromolecule a linkage containing silicon, with or without sulfur, nitrogen, oxygen, or carbon only; Coating compositions based on derivatives of such polymers
- C09D183/04—Polysiloxanes
-
- C—CHEMISTRY; METALLURGY
- C09—DYES; PAINTS; POLISHES; NATURAL RESINS; ADHESIVES; COMPOSITIONS NOT OTHERWISE PROVIDED FOR; APPLICATIONS OF MATERIALS NOT OTHERWISE PROVIDED FOR
- C09D—COATING COMPOSITIONS, e.g. PAINTS, VARNISHES OR LACQUERS; FILLING PASTES; CHEMICAL PAINT OR INK REMOVERS; INKS; CORRECTING FLUIDS; WOODSTAINS; PASTES OR SOLIDS FOR COLOURING OR PRINTING; USE OF MATERIALS THEREFOR
- C09D183/00—Coating compositions based on macromolecular compounds obtained by reactions forming in the main chain of the macromolecule a linkage containing silicon, with or without sulfur, nitrogen, oxygen, or carbon only; Coating compositions based on derivatives of such polymers
- C09D183/14—Coating compositions based on macromolecular compounds obtained by reactions forming in the main chain of the macromolecule a linkage containing silicon, with or without sulfur, nitrogen, oxygen, or carbon only; Coating compositions based on derivatives of such polymers in which at least two but not all the silicon atoms are connected by linkages other than oxygen atoms
-
- C—CHEMISTRY; METALLURGY
- C08—ORGANIC MACROMOLECULAR COMPOUNDS; THEIR PREPARATION OR CHEMICAL WORKING-UP; COMPOSITIONS BASED THEREON
- C08L—COMPOSITIONS OF MACROMOLECULAR COMPOUNDS
- C08L83/00—Compositions of macromolecular compounds obtained by reactions forming in the main chain of the macromolecule a linkage containing silicon with or without sulfur, nitrogen, oxygen or carbon only; Compositions of derivatives of such polymers
- C08L83/14—Compositions of macromolecular compounds obtained by reactions forming in the main chain of the macromolecule a linkage containing silicon with or without sulfur, nitrogen, oxygen or carbon only; Compositions of derivatives of such polymers in which at least two but not all the silicon atoms are connected by linkages other than oxygen atoms
Definitions
- the present invention relates to a new sol-gel coating material for the production of sol-gel coatings on single-layer or multi-layer coatings.
- the present invention relates to a new method for producing painted substrates, in particular painted automobile bodies, in which the substrates are first provided with a multi-layer coating, after which a sol-gel coating material is applied and cured.
- two-component (2K) or multicomponent (3K, 4K) clearcoats contain, as essential constituents, binders, with functional groups which can react with isocyanate groups, and polyisocyanates with free isocyanate groups as crosslinking agents. The two essential components are stored separately until they are used.
- Both aqueous and conventional two-component (2K) or multi-component (3K, 4K) clearcoats are known.
- An example of an aqueous system can be found in German patent DE-A-44 21 823.
- These clear coats provide weather-resistant coatings, which, however, are often not sufficiently scratch-resistant under heavy use. Scratches are, however, already visually disturbing if the clear lacquer surface is only deformed without material being removed in the process.
- Both one-component (1K) and two-component (2K) undercoat lacquers are used.
- the one-component (IC) undercoat materials contain self- or externally crosslinking binders and, for example, aminoplast resins or blocked polyisocyanates as crosslinking agents.
- the two-component (2K) uni topcoats contain binders with functional groups that can react with isocyanate groups and polyisocyanates with free isocyanate groups as crosslinking agents. Paints of this type are also used as car refinish paints.
- As with the two-component (2K) clearcoats their two essential components are stored separately from each other until they are used. Solid-color top coats have a scratch resistance, which sometimes does not meet the particularly heavy loads to which commercial vehicles are often exposed.
- sol-gel clearcoats based on siloxane-containing paint formulation oranges have recently been developed, which are obtained by hydrolysis and condensation of silane compounds.
- lacquers which are used as coating agents for coatings on plastics, are described, for example, in German patent specifications DE-A-43 03 570, 34 07 087, 40 11 045, 40 25 215, 38 28 098, 40 20 316 or 41 22743 .
- Sol-gel clear coats give plastic substrates such as B. glasses or motorcycle helmet visors have a very good scratch resistance. This scratch resistance is not achieved by the well-known OEM (Original Equipment Manufacturing) clearcoats, which are usually used for the initial painting of vehicles. The automotive industry is now required to transfer this improved scratch resistance to the clearcoat layers and solid-color lacquer layers used in the painting of automobiles.
- OEM Olinal Equipment Manufacturing
- sol-gel clear coats are too expensive.
- the economically more favorable use of the sol-gel clearcoats as an additional coating layer over the previously used clearcoat or solid-color topcoats results in adhesion problems between these painting poles and the sol-gel coating, which occur in particular after stone chipping and when exposed to condensation.
- the object of the present invention is to provide a new sol-gel coating material which allows the advantageous properties of the sol-gel coatings with the advantageous properties of the known single-layer or multi-layer coatings, in particular the single- or multi-layer effect and / or to combine color-imparting painting orifices for automotive OEM painting without causing problems of liability.
- the new sol-gel coating material has been found to contain
- AI Acrylate copolymer (AI), obtainable by copolymerization of at least the following monomers:
- variable R has the following meaning:
- R hydrolyzable groups, hydroxyl groups and non-hydrolyzable groups, with the proviso that at least one, preferably at least two, hydrolyzable group (s) is or are present;
- coating material according to the invention.
- a one-coat paint system based on a one-component (LC) clear coat, two-component (2K) or multi-component (3K, 4K) clear coat, powder clear coat or UV-curable clear coat,
- process according to the invention the new processes for the production of sol-gel coatings are referred to collectively as "process according to the invention”.
- sol-gel coatings according to the invention were found which can be produced from the coating materials according to the invention and are referred to below as “sol-gel coatings according to the invention”.
- substrates which have at least one sol-gel coating according to the invention and are referred to below as “substrates according to the invention”.
- the object underlying the invention could be achieved with the aid of the coating material according to the invention and the method according to the invention.
- the coating material of the invention adheres to the painting rods without problems, without it falling in the event of stone chipping or after exposure to condensation, i.e. H. a ten-day exposure of the layers in an atmosphere of 40 ° C and 100% relative humidity, comes off or cracks.
- the optical properties of the painting rods provided with the sol-gel coatings according to the invention also meet all requirements.
- the coating material according to the invention is a siloxane-containing coating formulation which can be prepared by reacting hydrolyzable silicon compounds with water or water-releasing agents and which contains organic constituents to improve certain properties.
- a general description of such systems can be found, for example, in the article by Bruce M. Novak, "Hybrid Nanocomposite Materials-Between Inorganic Glasses and Organic Polymers", in Advanced Materials, 1993, 5, No. 6, pp. 422-433, or in the lecture by R. Kasemann, H. Schmidt, 15th International Conference, International Center for Coatings Technology, Paper 7, "Coatings for mechanical and chemical protection based on organic-inorganic sol-gel nanocomposites ", 1993.
- R can be an alkyl group such as methyl or ethyl.
- Tetramethylorthosilicate (TMOS) or tetraethylorthosilicate (TEOS) are often used. Acids, bases or fluoride ions are used to catalyze the reactions.
- the sol-gel coating according to the invention is produced by targeted hydrolysis and condensation of silicic acid esters and metal alcoholates. It gains special properties through the incorporation of organically modified silicic acid derivatives into the silicate network. They allow the construction of an organic polymer network in addition to the inorganic grand framework, if organic radicals, preferably those with olefinically unsaturated groups and / or epoxy groups, can be used.
- the modification takes place according to the invention in that a finished organic polymer is present during the hydrolysis and condensation of the starting products or in the sol.
- the coating material of the invention consists of the three essential components (A), (B) and (C).
- Component (A) is an acrylate copolymer solution which is preferably free from aromatic solvents.
- the term “free from aromatic solvents” or “free from aromatics” here and below means that the content of aromatic solvents or aromatic compounds in a solution is ⁇ 1% by weight, preferably ⁇ 0.5% by weight. % and particularly preferably ⁇ 0.2% by weight and in particular lies below the gas chromatographic detection limit.
- the acrylate copolymer solution (A) to be used according to the invention contains at least one acrylate copolymer (AI), which is obtained by copolymerizing the monomers (al), (a2) and (a3) mentioned below and, if appropriate, further monomers (a4), (a5) and or (a6 ) is prepared, wherein (al), (a2) and (a3) and optionally (a4), (a5) and (a6) are selected in type and amount such that the acrylate copolymer (Al) has the desired OH number, acid number and has the desired molecular weight.
- AI acrylate copolymer
- the acrylate copolymers (Al) preferably have a hydroxyl number of 40 to 240, particularly preferably 60 to 210 and in particular 100 to 200, an acid number of 5 to 100, particularly preferably 10 to 60 and in particular 20 to 40, Glass transition temperatures from -35 to + 85 ° C and number average molecular weights Mn from 1,500 to 300,000.
- Monomers (a2) which can be copolymerized with (al), (a2), (a3), (a4), (a5) and (a6) and are different from (a5) are ethylenically unsaturated monomers which carry at least one hydroxyl group per molecule and are essentially free of acid groups, such as hydroxyalkyl esters of acrylic acid, methacrylic acid or another alpha, beta-ethylenically unsaturated Carboxylic acids which are derived from an alkylene glycol which is esterified with the acid or can be obtained by reacting the acid with an alkylene oxide, in particular hydroxyalkyl esters of acrylic acid, methacrylic acid, ethacrylic acid, crotonic acid, maleic acid, fumaric acid or itaconic acid, in which the hydroxyalkyl group up to Contains 20 carbon atoms, such as 2-hydroxyethyl, 2-hydroxypropyl, 3-hydroxypropyl, 3-hydroxybutyl, 4-hydroxybutyl acrylate, me
- the proportion of trimethylolpropane monoallyl ether is usually 2 to 10% by weight, based on the total weight of the monomers (a1) to (a6) used to prepare the polyacrylate resin. In addition, however, it is also possible to add 2 to 10% by weight, based on the total weight of the monomers used to prepare the polyacrylate resin, of trimethylolpropane monoallyl ether to the finished polyacrylate resin.
- the olefinically unsaturated polyols such as, in particular, trimethylolpropane monoallyl ether, can be used as the sole monomers containing hydroxyl groups, but particularly in proportion in combination with other monomers mentioned containing hydroxyl groups.
- each can be at least one acid group, preferably one
- Carboxyl group, per molecule, with (al), (a2), (a4), (a5) and (a6) copolymerizable, ethylenically unsaturated monomer or a mixture of such monomers can be used.
- Acrylic acid and / or methacrylic acid are particularly preferably used as component (a3).
- other ethylenically unsaturated carboxylic acids with up to 6 carbon atoms in the molecule can also be used. Examples of such acids are ethacrylic acid, crotonic acid, maleic acid, fumaric acid and itaconic acid.
- ethylenically unsaturated sulfonic or phosphonic acids or their partial esters can be used as component (a3).
- a3 is maleic acid mono (meth) acryloyloxyethyl ester, succinic acid mono (meth) acryloyloxyethyl ester and phthalic acid mono (meth) acryloyloxyethyl ester.
- One or more vinyl esters of monocarboxylic acids having 5 to 18 carbon atoms in the molecule and branched in the alpha position can be used as monomers (a4).
- the branched monocarboxylic acids can be obtained by reacting formic acid or carbon monoxide and water with olefins in the presence of a liquid, strongly acidic catalyst; the olefins can be cracked products of paraffinic hydrocarbons, such as mineral oil fractions, and can contain both branched and straight-chain acyclic and / or cycloaliphatic olefins.
- olefins When such olefins are reacted with formic acid or with carbon monoxide and water, a mixture of carboxylic acids is formed in which the carboxyl groups are predominantly located on a quaternary carbon atom.
- Other olefinic starting materials are, for example, propylene trimer, propylene tetramer and diisobutylene.
- the vinyl esters can also be prepared from the acids in a manner known per se, for example by letting the acid react with acetylene. Because of the good availability, vinyl esters of saturated aliphatic monocarboxylic acids having 9 to 11 carbon atoms which are branched on the alpha carbon atom are particularly preferably used.
- the monomer (a5) used is the reaction product of acrylic acid and / or methacrylic acid with the glycidyl ester of a monocarboxylic acid having 5 to 18 carbon atoms per molecule and branched in the alpha position.
- Glycidyl esters of strongly branched monocarboxylic acids are available under the trade name "Cardura”.
- the reaction of acrylic or methacrylic acid with the glycidyl ester of a carboxylic acid with a tertiary alpha carbon atom can be carried out before, during or after the polymerization reaction.
- the reaction product of acrylic and / or methacrylic acid with the glycidyl ester of versatic acid is preferably used as component (a5). This glycidyl ester is commercially available under the name "Cardura E10".
- monomers (a6) all of which can be copolymerized with (al), (a2), (a3), (a4) and (a5), differ from (al), (a2), (a3) and (a4) and are essentially free of acid groups ethylenically unsaturated monomers or mixtures of such monomers can be used.
- component (a6) is essentially free of acid groups ethylenically unsaturated monomers or mixtures of such monomers.
- Olefins such as ethylene, propylene, but-1-ene, pent-1-ene, hex-1-ene, cyclohexene, cyclopentene, norbornene, butadiene, isoprene, cyclopentadiene and / or dicyclopentadiene;
- (Meth) acrylic acid amides such as (meth) acrylic acid amide, N-methyl, N, N-dimethyl, N-ethyl, N, N-diethyl, N-propyl, N, N-dipropyl, N-butyl, N, N-dibutyl, N-cyclohexyl and / or N, N-cyclohexyl-methyl- (meth) acrylic acid amide;
- Monomers containing epoxy groups such as the glycidyl ester of acrylic acid, methacrylic acid, ethacrylic acid, crotonic acid, maleic acid, fumaric acid and / or itaconic acid; vinyl aromatic hydrocarbons, such as styrene, alpha-alkylstyrenes, in particular alpha-methylstyrene, and / or vinyltoluene;
- Nitriles such as acrylonitrile and / or methacrylonitrile
- Vinyl compounds such as vinyl chloride, vinyl fluoride, vinylidene dichloride, vinylidene difluoride; N-vinyl pyrrolidone; Vinyl ethers such as ethyl vinyl ether, n-propyl vinyl ether, isopropyl vinyl ether, n-butyl vinyl ether,
- Polysiloxane macromonomers which have a number average molecular weight Mn from 1,000 to 40,000, preferably from 2,000 to 20,000, particularly preferably 2,500 to 10,000 and in particular 3,000 to 7,000 and im
- Patent application WO 92/22615 on page 12, line 18 to page 18, line 10, or acryloxysilane-containing vinyl monomers which can be prepared by reacting hydroxy-functional silanes with epichlorohydrin and then reacting the reaction product with methacrylic acid and / or hydroxyalkyl esters of ( Meth) acrylic acid;
- Vinyl aromatic hydrocarbons in particular styrene, are preferably used.
- the type and amount of components (a1) to (a6) is selected so that the polyacrylate resin (AI) has the desired OH number, acid number and glass transition temperature.
- Acrylate resins used with particular preference are obtained by polymerizing
- component (a2) 10 to 50% by weight, preferably 15 to 40% by weight, of component (a2),
- component (a3) 1 to 15% by weight, preferably 1 to 8% by weight, of component (a3),
- component (a6) 5 to 30% by weight, preferably 10 to 20% by weight, of component (a6),
- the acrylate copolymers (AI) used according to the invention are prepared in an organic solvent or solvent mixture which is preferably free from aromatic solvents and in the presence of at least one polymerization initiator.
- the polymerization initiators which are customary for the preparation of acrylate copolymers are used as polymerization initiators.
- Suitable polymerization initiators are free radical initiators, such as, for example, tert-butyl peroxyethyl hexanoate, benzoyl peroxide, di-tert. Amyl peroxide, azobisisobutyronitrile and tert-butyl perbenzoate called.
- the initiators are preferably used in an amount of 1 to 25% by weight, particularly preferably 2 to 10% by weight, based on the total weight of the monomers.
- the polymerization is advantageously carried out at a temperature of 80 to 200 ° C., preferably 110 to 180 ° C.
- Ethoxyethyl propionate and isopropoxypropanol are preferably used as solvents.
- the acrylate copolymer (AI) is preferably produced by a two-stage process, since the resulting coating materials according to the invention thus have better processability.
- Acrylate copolymers (AI) which can be obtained by
- (a6) is or are added and further polymerized.
- the monomers (a4) and / or (a5) are only partially added to the initial charge together with at least part of the solvent and the rest of these monomers are added, as described above.
- at least 20% by weight of the solvent and about 10% by weight of the monomers (a4) and (a5) and, if appropriate, parts of the monomers (al) and (a6) are preferably introduced.
- the second stage can immediately follow the first. However, the second stage can only be started after a certain time, for example after 10 minutes to 10 hours.
- the amount and rate of addition of the initiator is preferably chosen so that an acrylate copolymer (Al) having a number average molecular weight Mn of 1000 to 30,000 daltons is obtained. It is preferred that the initiator feed be started some time, generally about 1 to 15 minutes, before the monomers feed. Also preferred is a method in which the initiator addition begins at the same time as the monomer addition and is terminated about half an hour after the monomer addition is complete. The initiator is preferably added in a constant amount per unit of time. After the addition of the initiator has ended, the reaction mixture is continued for as long (as a rule 1.5 Hours) kept at the polymerization temperature until essentially all of the monomers used had been completely reacted.
- Al acrylate copolymer
- Substantially completely converted is intended to mean that preferably 100% by weight of the monomers used have been reacted, but it is also possible that a low residual monomer content of at most up to about 0.5% by weight, based on the Weight of the reaction mixture can remain unreacted.
- the monomers for the preparation of the acrylate copolymers (AI) are preferably polymerized in the case of a polymerization solid which is not too high, preferably at a polymerization solids content of 80 to 50% by weight, based on the monomers, and the solvents are then partially removed by distillation, so that the acrylate copolymer solutions formed (A) have a solids content of preferably 100 to 60% by weight.
- the solids content of the acrylate copolymer solutions (A) is adjusted to at least 60% by weight, more preferably less than 40% by weight and in particular less than 30% by weight with at least one preferably aromatic-free solvent.
- Suitable solvents are ethoxyethyl propionate and butyl glycol.
- the preparation of the acrylate copolymers (AI) to be used according to the invention has no special features in terms of method, but takes place with the aid of the methods of continuous or discontinuous copolymerization which are customary and known in the plastics field, under normal pressure or overpressure in stirred tanks, autoclaves, tubular reactors or Taylor reactors.
- suitable copolymerization processes are described in the patents DE-A-197 09 465, DE-C-197 09 476, DE-A-28 48 906, DE-A-195 24 182, EP-A-0 554783, WO 95/27742 or WO 82/02387.
- Taylor reactors which are used to convert substances under the conditions of the Taylor flow are known. They essentially consist of two coaxial, concentrically arranged cylinders, the outer of which is fixed and the inner of which rotates. The volume formed by the gap between the cylinders serves as the reaction space. With increasing angular velocity C ⁇ ; of the inner cylinder occur a number of different flow forms, which are characterized by a dimensionless characteristic number, the so-called Taylor number Ta.
- the Taylor number is also dependent on the kinematic viscosity v of the fluid in the gap and on the geometric parameters, the outer radius of the inner cylinder, the inner radius of the outer cylinder r a and the gap width d, the difference between the two radii , according to the following formula:
- Ta (Oi Ti dv "1 (d / r i ) 1 2 (D
- the laminar Couette flow a simple shear flow, forms. If the speed of rotation of the inner cylinder is further increased, opposite rotating (counter-rotating) vortices with axes along the circumferential direction occur alternately above a critical value. These so-called Taylor vortices are rotationally symmetrical and have a diameter that is approximately as large as the gap width. Two adjacent vertebrae form a pair of vertebrae or a vertebral cell. This behavior is based on the fact that when the inner cylinder rotates with the outer cylinder at rest, the fluid particles near the inner cylinder are subjected to a stronger centrifugal force than those which are further away from the inner cylinder.
- each pair of vortices travels through the gap, with only a small mass exchange occurring between adjacent pairs of vortices.
- the mixing within such vortex pairs is very high, whereas the axial mixing beyond the pair boundaries is only very low.
- a pair of vortices can therefore be regarded as a well-mixed stirred kettle.
- the flow system thus behaves like an ideal flow tube in that the vortex pairs move through the gap with a constant dwell time like ideal stirred tanks.
- Taylor reactors with an outer reactor wall and a concentrically or eccentrically arranged rotor located therein, a reactor bottom and a reactor cover, which together define the annular-shaped reactor volume, at least one device for metering in starting materials and a device for the product outlet are advantageous, the reactor wall and / or the rotor is or are geometrically designed such that the conditions for the Taylor flow are met over substantially the entire length of the reactor in the reactor volume, ie the annular gap widens in the direction of flow.
- the proportion of constituent (A) in the coating material according to the invention can vary very widely and depends in particular on what flexibility the sol-gel coating according to the invention produced therefrom should have.
- the share is capped; so it must not be chosen so high that there is a phase separation in the coating material according to the invention or the hardness and scratch resistance of the sol-gel coating decrease too much.
- the person skilled in the art can therefore determine the optimum proportion in each case on the basis of his specialist knowledge, if necessary with the aid of simple preliminary tests.
- the other essential constituent of the coating material of the invention is the base lacquer (B). It is also preferably free of aromatic solvents.
- the hydrolyzable silane (B1) is a compound of the general formula I
- radicals R can be the same or different and are selected from hydrolyzable groups, hydroxyl groups and non-hydrolyzable groups.
- the non-hydrolyzable groups R in the general formula I are preferably selected from alkyl groups, in particular with 1 to 4 carbon atoms, such as, for example, methyl, ethyl, propyl and butyl groups; Alkenyl groups, in particular with 2 to 4 carbon atoms, such as vinyl, 1-propenyl, 2-propenyl and butenyl groups; Alkynyl groups, in particular with 2 to 4 carbon atoms, such as acetylenyl and propargyl groups; and aryl groups, in particular with 6 to 10 carbon atoms, such as phenyl and naphthyl grapppen. Alkyl groups are preferably used as non-hydrolyzable groups R.
- hydrolyzable groups R in formula I mentioned above are hydrogen atoms; Alkoxy groups, in particular with 1 to 20 carbon atoms, such as e.g. Methoxy, ethoxy, n-propoxy, i-propoxy, n-butoxy, tert-butoxy and sec-butoxy groups; alkoxy-substituted alkoxy groups, e.g. beta methoxy ethoxy groups; Acyloxy groups, in particular with 1 to 4 carbon atoms, e.g. Acetoxy and propionyloxy groups; and alkylcarbonyl groups such as e.g. Acetyl groups.
- Particularly preferred hydrolyzable groups R are those which have no substituent and give aromatics-free hydrolysis products with a low molecular weight, e.g. lower alcohols, such as methanol, ethanol, propanol, n-butanol, i-butanol, sec-butanol and tert-butanol.
- lower alcohols such as methanol, ethanol, propanol, n-butanol, i-butanol, sec-butanol and tert-butanol.
- At least one group R of formula I must be a hydrolyzable group.
- Silanes (B1) with two, preferably and four, in particular three, hydrolyzable groups R are particularly preferred.
- the non-hydrolyzable groups R of the silanes (B1) can contain at least one functional group.
- These functional groups can be, for example, epoxy groups, amino groups, olefinically unsaturated groups such as vinyl or (meth) acrylic groups, mercapto groups,
- hydrolyzable silanes (B1) to be used according to the invention are methyltriethoxysilane, methyltrimethoxysilane, tetramethylorthosilicate, tetraethylorthosilicate, 3-
- All or part of the silanes (B1) can be used in the form of precondensates, i.e. Compounds that are formed by partial hydrolysis of the silanes (B1), either alone or in a mixture with other hydrolyzable compounds.
- the silanes (B1) are precondensed with water in the desired mixing ratio.
- the amount of water is metered in so that local over-concentrations are avoided. This is achieved, for example, by adding the amount of water to the reaction mixture with the aid of moisture-laden adsorbents, for example silica gel or molecular sieves, water-containing organic solvents, for example 80% ethanol, or salt hydrates, for example CaCl 2 x 6H 2 O.
- Pre-condensation is preferably carried out in the presence of hydrolysis - And condensation catalyst, however, in the absence of an organic solvent.
- the hydrolysis and condensation of the hydrolyzable silanes (B1) is carried out in the presence of a preferably aromatic-free organic solvent, such as an aliphatic alcohol, such as methanol, ethanol, propanol, isopropanol or butanol, an ether such as dimethoxyethane, an ester such as dimethylglycol acetate or Methoxypropylacetate and / or 2-ethoxyethanol (ethyl glycol) or a ketone such as acetone or methyl ethyl ketone.
- a preferably aromatic-free organic solvent such as an aliphatic alcohol, such as methanol, ethanol, propanol, isopropanol or butanol, an ether such as dimethoxyethane, an ester such as dimethylglycol acetate or Methoxypropylacetate and / or 2-ethoxyethanol (ethyl glycol) or a ketone such as acetone or methyl
- metal compounds and / or metal oxides can also be present as nanoparticles in the hydrolysis and condensation. These nanoparticles are ⁇ 50 nm. For example, they can be Al 2 O 3 , ZrO and / or TiO 2 .
- Suitable metal compounds are hydrolyzable metal compounds (B2) of the general formula II
- variable M stands for aluminum, titanium or zirconium, but in particular aluminum. Accordingly, the index n stands for 3 or 4.
- variable R has the same meaning as given above for the general formula I. It is advantageous here if in the case of aluminum at least two, in particular three, and in the case of titanium or zirconium, three, in particular four, hydrolyzable groups are present.
- alkoxy groups described above are particularly advantageous and are therefore used with preference.
- Sec-butyloxy groups are very particularly preferably used.
- An example of a hydrolyzable metal compound (B2) which is used with very particular preference is accordingly aluminum tris-sec-butoxide.
- the molar ratio of metal M to silicon can be varied widely and depends primarily on the scratch resistance and hardness to be adjusted in the sol-gel coatings according to the invention. In general, the replacement of part of the silicon by aluminum in particular can increase the scratch resistance of the sol-gel coatings according to the invention.
- the molar ratio M: Si can be 1:10 to 1: 1.5, preferably 1: 6 to 1: 3.
- Proton- or hydroxyl-ion-releasing compounds and amines are suitable as hydrolysis and condensation catalysts.
- Specific examples are organic or inorganic acids, such as hydrochloric acid, sulfuric acid,
- Phosphoric acid formic acid or acetic acid as well as organic or inorganic bases such as ammonia, alkali or alkaline earth metal hydroxides, e.g.
- amines soluble in the reaction medium e.g. lower alkylamines or alkanolamines.
- reaction medium e.g. lower alkylamines or alkanolamines.
- Acids and bases especially hydrochloric acid, acetic acid, ammonia or
- Triethylamine particularly preferred.
- the precondensation is carried out so far that the resulting base lacquer (B) still has a liquid consistency. It preferably has a solids content of less than 80% by weight, particularly preferably less than 60% by weight and in particular less than 40% by weight.
- the proportion of component (B) in the coating material according to the invention can also vary very widely and depends primarily on the scratch resistance and hardness of the sol-gel coating according to the invention produced therefrom.
- the share is capped; it should not be chosen so high that phase separation occurs in the coating material according to the invention and / or that the sol-gel coatings according to the invention thus produced become too hard and brittle.
- the person skilled in the art can therefore determine the optimum proportion in each case on the basis of his specialist knowledge, if necessary with the aid of simple preliminary tests.
- the third essential component of the coating material of the invention is the additive solution (C).
- a suitable compound (cl) is glycidyl (meth) acrylate.
- component (c2) contains as component (c2) at least one silane (B1) with at least one non-hydrolyzable group R which has at least one epoxy group.
- component (c2) is 3-glycidyloxypropyltrimethoxysilane.
- An example of a suitable silane (B1) is 3-aminopropyltriethoxysilane.
- suitable dicarboxylic anhydrides are maleic anhydride and itaconic anhydride.
- Components (cl), (c2) and (c3) are contained in the additive solution in a weight ratio of (1 to 10): (1 to 30): 1, in particular (2 to 6): (10 to 20): 1 .
- the solids content of the additive solution (C) is preferably below 80% by weight, preferably below 60% by weight and in particular below 50
- the proportion of additive solution (C) in the coating material of the invention can also vary widely.
- the person skilled in the art can determine the optimum proportion in each case on the basis of his specialist knowledge, if necessary with the aid of simple preliminary tests.
- Particularly advantageous coating materials according to the invention contain, based on their total amount, 5 to 20, preferably 10 to 15 and in particular 11 to 14% by weight of the acrylate copolymer solution (A), 40 to 85, preferably 45 to 80 and in particular 50 to 75% by weight.
- the coating material of the invention may further contain at least one hardener (D).
- suitable hardeners (D) are quaternary ammonium compounds such as tetraalkylammonium salts, in particular tetramethylammonium iodide.
- the hardener (D) can preferably be contained in the coating material according to the invention in an amount of 0.001 to 1% by weight.
- the coating material of the invention can furthermore contain relatively large amounts of preferably non-aromatic solvents as component (E). This is particularly the case when particularly thin sol-gel Coatings are to be made.
- suitable solvents (E) are the abovementioned lower alcohols, in particular ethanol, or glycol ethers such as ethyl glycol or butyl glycol.
- the coating material of the invention can contain customary and known paint additives (F). Suitable are all paint additives (F) which do not adversely affect the property profile of the sol-gel coatings according to the invention, in particular their optical properties (appearance) and scratch resistance, but rather vary and improve them in an advantageous manner.
- UV absorbers such as UV absorbers
- Emulsifiers especially non-ionic emulsifiers such as alkoxylated
- Alkanols and polyols, phenols and alkylphenols or anionic emulsifiers such as alkali salts or ammonium salts of alkane carboxylic acids, alkanesulfonic acids, and sulfonic acids of alkoxylated alkanols and polyols, phenols and alkylphenols;
- Wetting agents such as siloxanes, fluorine-containing compounds
- film-forming aids such as cellulose derivatives
- rheology-controlling additives such as those known from the patent specifications WO 94/22968, EP-A-0 276 501, EP-A-0 249 201 or WO 97/12945; crosslinked polymeric microparticles, such as are disclosed, for example, in EP-A-0 008 127; inorganic layered silicates such as aluminum-magnesium silicates, sodium-magnesium and
- Montmorillonite type Silicas such as aerosils; or synthetic polymers with ionic and / or associative groups such as
- Ethylene-maleic anhydride copolymers and their derivatives or hydrophobically modified ethoxylated urethanes or polyacrylates are examples of Ethylene-maleic anhydride copolymers and their derivatives or hydrophobically modified ethoxylated urethanes or polyacrylates.
- the coating material of the invention has a solids content of up to 80, preferably up to 60, particularly preferably up to 40 and in particular up to 20% by weight. If particularly thin sol-gel coatings according to the invention are to be produced, ie coatings with a thickness of ⁇ 5 ⁇ m, it is advisable to choose a solids content of less than 20% by weight.
- the production of the coating material according to the invention has no special features, but is carried out in a customary and known manner by mixing its essential constituents (A), (B) and (C) and, if appropriate, (D), (E) and / or (F) in the customary manner and known mixing units such as dissolvers.
- the components can be mixed with one another in any way. For example, they can be poured into the mixing unit at once and mixed together. According to the invention, however, it is advantageous to present the base lacquer (B) in order to then add the remaining constituents one after the other. It has proven useful here to add the acrylate copolymer solution (A) before the additive solution (C).
- a solvent (E) is used, it is advantageously added after the addition of the acrylate copolymer solution (A) and before the addition of the additive solution (C). If paint additives (F) are used, they are advantageously added after the addition of the acrylate copolymer solution (A).
- the hardener (D) is advantageously added last.
- the coating materials of the invention are outstandingly suitable for the production of the sol-gel coatings according to the invention, in particular sol-gel clearcoats.
- every conceivable substrate can be coated with them.
- Examples include substrates made of metal, plastic, glass, wood or ceramic. These substrates can be provided with a primer. In the case of plastic, it can be a so-called hydro grandier rank. in the In the case of metal, the substrate can also have been subjected to a surface treatment, for example an electroplating line or a phosphating line or anodizing line. Furthermore, an electro dip coating and a filler may be present on the metal substrate as a grandiose rank.
- the application of the coating materials according to the invention has no special features in terms of method, but rather the customary application methods, such as spraying, knife coating, brushing, pouring, dipping or rolling, can be used.
- the coating materials according to the invention are cured, which results in the sol-gel coatings according to the invention. If necessary, pre-drying can also be carried out before curing. The usual and known methods and devices such as forced air ovens can also be used for this.
- the coating materials of the invention can also be cured with medium IR radiation. This makes it possible to coat only parts of substrates or single-layer or multi-layer painting rods in a targeted manner at damaged or particularly exposed locations and to provide them with a scratch-resistant finish, without the other parts being affected by thermal stress. This makes the advantageous use of the coating materials according to the invention possible in automotive refinishing. Since the amount of coating material according to the invention can also be kept to a minimum, its use is also particularly economical.
- the coating materials of the invention can be applied directly to the above-mentioned ungrounded or primed substrates in order to then form a scratch-resistant sol-gel coating according to the invention after curing.
- substrates as they are usually used for the manufacture of vehicles, other components and devices, such as radiators or containers, or furniture is made scratch-resistant.
- the coating materials according to the invention are suitable for the coating of single-layer or multi-layer lacquering coats, in particular single-layer or multi-layer effect and / or color-imparting lacquer coats such as are customary in the fields of automotive OEM coats, automotive refinish coats, industrial lacquer coats, including container coatings, plastic lacquer coats and furniture lacquer coats and are known.
- single-layer paint coats of this type are the solid-color top coats described at the outset, known from automotive primer coats and car refinish coats, in particular those based on the two-component (2K) single-coat lacquers, or clear, transparent lacquer coats based on the clear coats described below, in particular the one-component (LC).
- multi-layer paint coats are the paint coats, which have an effect and / or color-imparting base coat layer, in particular one based on a water-based paint, and a clear coat layer, in particular based on a one-component (IC) clear coat, two-component (2K) or
- Multi-component (3K, 4K) clearcoat, powder clearcoat, powder slurry clearcoat or UV-curable clearcoat, especially a two-component (2K) - or Multi-component (3K, 4K) clear varnish, are included and are produced in the context of the automotive painting process using the wet-on-wet process or in the context of car repair painting.
- the coating materials of the invention are particularly outstandingly suitable, in particular, for coating multi-layer coating oranges of this type.
- Multi-component (3K, 4K) clearcoats for the production of single-layer or multi-layer coatings, there is the further significant advantage that not only the coating materials of the invention are suitable for the production of the sol-gel coatings, but also conventional sol-gel clearcoats if the said lacquers are partially cured after their application and before the sol-gel clear lacquers are applied. After that, the said lacquers are fully cured together with the sol-gel clear lacquers.
- This procedure according to the invention results in a particularly good adhesion between the layers of paint and the sol-gel coatings. Particularly excellent results are obtained if the coating materials of the invention are used in the process according to the invention.
- Suitable one-component (IC), two-component (2K) or multicomponent (3K, 4K) clearcoats are known, for example, from the patents DE-A-42 04 518, US-A-5, 474,811, US-A-5,356,669, US -A-5,605,965, WO 94/10211, WO 94/10212, WO 94/10213, EP-A-0 594 068, EP-A-0 594 071, EP-A-0 594 142, EP-A-0 604 992, WO 94/22969, EP-A-0 596 460 or WO 92/22615.
- One-component (IC) clearcoats are known to contain binders and crosslinking agents containing hydroxyl groups, such as blocked polyisocyanates, tris (alkoxycarbonylamino) triazines and / or aminoplast resins.
- binders and crosslinking agents containing hydroxyl groups such as blocked polyisocyanates, tris (alkoxycarbonylamino) triazines and / or aminoplast resins.
- they contain, as binders, polymers with pendant carbamate and or allophanate groups and optionally carbamate and or allophanate-modified aminoplast resins as crosslinking agents.
- Two-component (2K) or multicomponent (3K, 4K) clearcoats contain, as is known, essential constituents of hydroxyl group-containing binders and polyisocyanates as crosslinking agents, which are stored separately until they are used.
- powder clearcoats are known, for example, from German patent specification DE-A-42 22 194 or the product information from BASF Lacke + Wegner AG, "Powder coatings", 1990.
- Powder clear lacquers are known to contain binders containing epoxy groups and polycarboxylic acids as crosslinking agents.
- Powder slurry clearcoats are known to contain powder clearcoats dispersed in an aqueous medium.
- UV-curable clearcoats are known, for example, from the patents EP-A-0 540 884, EP-A-0 568 967 or US-A-4,675,234.
- oligomeric and / or polymeric compounds curable with actinic light and / or electron radiation preferably radiation-curable binders, in particular based on ethylenically unsaturated prepolymers and / or ethylenically unsaturated oligomers, optionally one or more reactive diluents and optionally one or more photoinitiators.
- radiation-curable binders are (meth) acrylic-functional ones
- multilayer clear lacquer layers can also be used, such as a clear lacquer layer based on hydroxyl groups
- Binders and blocked polyisocyanates and aminoplasts as crosslinking agents lie directly on the waterborne basecoat and over which contains a further clear lacquer layer based on binders containing carbamate and / or allophanate groups and aminoplasts as crosslinking agents.
- sol-gel coatings according to the invention which are preferably produced from the coating materials according to the invention by the process according to the invention, are notable for excellent scratch resistance with very good adhesion, even after exposure to condensation water. The appearance is also very good.
- the method according to the invention is therefore particularly suitable for painting vehicle bodies, in particular automobile bodies, with multi-layer paint bars, for industrial paint shops, including container coatings, and for furniture paint shops.
- 39 parts of ethoxyethyl propionate were placed in a suitable stirred kettle with reflux condenser and stirring and heated to 130.degree.
- a first monomer feed vessel 9.598 parts of butyl methacrylate, 7.708 parts of methyl methacrylate, 8.003 parts of styrene, 4.253 parts of methacrylic ester 13.0 (methacrylic acid ester with a long alkyl radical in the ester part) and 9.096 parts of hydroxyethyl acrylate were premixed.
- a second monomer feed vessel 3.810 parts of hydroxyethyl acrylate, 1.831 parts of acrylic acid and 0.916 parts of ethoxyethyl propionate were introduced.
- the solution of the acrylate copolymer with butyl glycol was adjusted to a solids content of 20% by weight, and the solution for organic modification 2 resulted.
- the adduct itself was prepared by reacting 220 parts of 3-aminopropyltriethoxysilane and 100 parts of maleic anhydride.
- the sol-gel clearcoat 4a was obtained by adding 14.77 to 61.2 parts of the base coat 4 (46.9% by weight in ethyl glycol) with stirring Parts of the organic modification solution 2, 20.8 parts
- the sol-gel clearcoat 4b was obtained by adding 11.77 parts of the organic modification solution 2, 14.89 parts to 71.3 parts of the base coat 4 (40.3% by weight in ethyl glycol) with stirring Methoxypropylacetate, 0.47 parts BYK® 301 and 1.57 parts of additive solution 3 were added.
- the resulting sol-gel clearcoat 4b was used for the production of a sol-gel coating on a multilayer coating with a clearcoat layer based on a commercially available two-component (2K) clearcoat (example 2).
- sol-gel clear lacquer 4a was applied.
- the solid-color topcoat and the sol-gel clearcoat were then cured together at 90 ° C. for 4 hours.
- the result was a coating with a solid-color lacquer layer with a thickness of 45 ⁇ m and the sol-gel coating according to the invention with a thickness of 8 ⁇ m.
- the paint was free of cracks and made a very good overall optical impression.
- a commercially available filler from BASF Coatings AG was first applied and baked onto a steel pistol coated with a commercially available electrocoat (cathodic dip coat with a layer thickness of 18 - 22 ⁇ m). The result was a filler layer with a layer thickness of 35 to 40 ⁇ m.
- a green metallic water-based paint (Ecostar R jungle green from BASF Coatings AG) was then applied in the same way to the filler and predried at 80 ° C. for 10 minutes. After the panels had been cooled, a layer of a commercially available two-component (2K) clearcoat (FF95-0111 from BASF) was applied Coatings AG) applied and pre-dried for 10 min at 80 ° C and partially cured.
- sol-gel clearcoat 4b was applied in accordance with the preparation example.
- the water-based lacquer layer, the clear lacquer layer and the sol-gel clear lacquer layer were then cured together at 150 ° C. for 30 minutes.
- the result was a multilayer coating with a basecoat layer with a thickness of 15 ⁇ m, a clear lacquer layer with a thickness of 44 ⁇ m and the sol-gel coating according to the invention with a thickness of 8 ⁇ m.
- the paint shop was free of cracks and made a very good overall visual impression.
- Table 1 gives an overview of the tests carried out and the results obtained.
- test panels were stored at room temperature for at least 2 weeks after application of the paints before the test was carried out.
- the paint surface was damaged with a sieve fabric that was loaded with a mass.
- the screen fabric and the varnish surface were wetted liberally with a detergent solution.
- the test panel was moved back and forth under the screen fabric in a lifting motion by means of a motor drive.
- test specimen was eraser covered with nylon sieve cloth (No. 11, 31 ⁇ m mesh size, Tg 50 ° C.) (4.5 x 2.0 cm, wide side perpendicular to the scratch direction).
- the coating weight is 2000 g.
- the scratch resistance was determined after the sand test.
- the paint surfaces were loaded with sand (20g quartz-silver sand 1.5-2.0 mm).
- the sand was placed in a beaker (floor cut off flat), which was firmly attached to the test panel.
- the same test panels as described above in the brush test were used.
- the table with the cup and the sand was shaken by means of a motor drive. The movement The loose sand caused damage to the paint surface (100 double strokes in 20 s).
- the test area was cleaned of abrasion, carefully wiped under a cold water jet and then dried with compressed air. The gloss was measured according to DIN 67530 before and after damage.
- the scratch resistance was determined in Example 1 by Amtec. As a result of the load, the gloss decreased from the initial value 68 by only 5 gloss units, which further underpins the high scratch resistance of the sol-gel coating according to the invention.
- Test panels of Examples 1 and 2 define the damage caused by sulfuric acid
- test substances were spaced one segment width apart (setting the Gradients applied to 30 - 75 ° C [1 ° C per heating segment]).
- the test panels were loaded on a gradient oven (eg type: 2615 from BYK-Gardner) for 30 minutes. The temperature at which the first visible change occurred was determined.
- the Erichsen depth according to DIN EN ISO 1520: 1995-04 was 0.5 mm (example 1) or 0.4 mm (example 2).
Landscapes
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Engineering & Computer Science (AREA)
- Wood Science & Technology (AREA)
- Materials Engineering (AREA)
- Organic Chemistry (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Application Of Or Painting With Fluid Materials (AREA)
- Paints Or Removers (AREA)
Abstract
Sol-Gel-Beschichtungsstoff, enthaltend: (A) eine Acrylatcopolymerisatlösung, enthaltend mindestens ein Acrylatcopolymerisat (A1); (B) einen Stammlack, herstellbar durch Hydrolyse und Kondensation mindestens eines hydrolysierbaren Silans (B1) der allgemeinen Formel (I) SiR4, worin die Variable R die folgende Bedeutung hat: R = hydrolysierbare Gruppen, Hydroxygruppen und nicht hydrolysierbare Gruppen, mit der Massgabe, dass mindestens eine, vorzugsweise mindestens zwei, hydrolysierbare Gruppe(n) vorhanden ist oder sind; und (C) eine Additivlösung, enthaltend c1) mindestens eine mindestens eine Epoxidgruppe enthaltende ethylenisch ungesättigte Verbindung, c2) mindestens ein Silan (B1) mit mindestens einer nicht hydrolysierbaren Gruppe R, welche mindestens eine Epoxidgruppe aufweist, und c3) mindestens ein Addukt mindestens eines Silans (B1) mit mindestens einer nicht hydrolysierbaren Gruppe R, welche mindestens eine Aminogruppe aufweist, und mindestens einem cyclischen ethylenisch ungesättigten Dicarbonsäureanhydrid; und seine Verwendung zur Herstellung kratzfester Sol-Gel-Überzüge.
Description
Sol-Gel-Überzug für einschichtige oder mehrschichtige Lackierungen
Die vorliegende Erfindung betrifft einen neuen Sol-Gel-Beschichtungsstoff zur Herstellung von Sol-Gel-Überzügen auf einschichtigen oder mehrschichtigen Lackierungen. Insbesondere betrifft die vorliegende Erfindung ein neues Verfahren zur Herstellung von lackierten Substraten, insbesondere von lackierten Automobilkarosserien, bei dem die Substrate zunächst mit einer Mehrschichtlackierung versehen werden, wonach hierauf ein Sol-Gel- Beschichtungsstoff aufgetragen und ausgehärtet wird.
Automobilkarosserien werden größtenteils mit einem mehrschichtigen effekt- und/oder farbgebenden Lackaufbau versehen. Als letzte Überzugsschicht werden häufig Klarlacke aufgetragen. Hierfür kommen die üblichen und bekannten Zweikomponenten(2K)- oder Mehrkomponenten(3K, 4K)-Klarlacke in Betracht.
Zweikomponenten(2K)- oder Mehrkomponenten(3K, 4K)-Klarlacke enthalten bekanntermaßen als wesentliche Bestandteile Bindemittel, mit funktionellen Gruppen, welche mit Isocyanatgrappen reagieren können, und Polyisocyanate mit freien Isocyanatgrappen als Vernetzungsmittel. Die beiden wesentlichen Bestandteile werden bis zu ihrer Verwendung getrennt gelagert. Es sind sowohl wäßrige als auch konventionelle Zweikomponenten(2K)- oder Mehrkomponenten(3K, 4K)-Klarlacke bekannt. Ein Beispiel für ein wäßriges System geht aus der deutschen Patentschrift DE-A-44 21 823 hervor. Diese Klarlacke liefern witterungsbeständige Beschichtungen, welche indes bei starker Beanspruchung oftmals nicht genügend kratzfest sind. Kratzer sind indes schon optisch störend, wenn die Klarlackoberfläche lediglich verformt wird, ohne daß hierbei Material abgetragen wird.
Die Automobilkarosserien, insbesondere für Nutzfahrzeuge, können indes auch einschichtige effekt- und/oder farbgebende Lackierungen aufweisen, welche auch
als Unidecklacke bezeichnet werden. Es werden sowohl Einkomponenten(lK)- als auch Zweikomponenten (2K)-Unidecklacke angewandt. Bekanntermaßen enthalten die Einkomponenten(lK)-Unidecklacke selbst- oder fremdvernetzende Bindemittel und beispielsweise Aminoplastharze oder blockierte Polyisocyanate als Vernetzungsmittel. Die Zweikomponenten(2K)-Unidecklacke enthalten Bindemittel mit funktionellen Gruppen, die mit Isocyanatgrappen reagieren können, und Polyisocyanate mit freien Isocyanatgrappen als Vernetzungsmittel. Lacke dieser Art werden auch als Autoreparaturlacke verwendet. Wie bei den Zweikomponenten(2K)-Klarlacken werden ihre beiden wesentlichen Komponenten bis zur Verwendung getrennt voneinander gelagert. Unidecklacke weisen eine Kratzfestigkeit auf, welche manchmal der besonders starken Beanspruchung, denen Nutzfahrzeuge oft ausgesetzt sind, nicht genügt.
In neuerer Zeit wurden sogenannte Sol-Gel-Klarlacke auf Basis von siloxanhaltigen Lackformulierangen entwickelt, die durch Hydrolyse und Kondensation von Silanverbindungen erhalten werden. Diese Lacke, die als Überzugsmittel für Beschichtungen von Kunststoffen verwendet werden, werden beispielsweise in den deutschen Patentschriften DE-A-43 03 570, 34 07 087, 40 11 045, 40 25 215, 38 28 098, 40 20 316 oder 41 22743 beschrieben.
Sol-Gel-Klarlacke verleihen Kunststoff-Substraten wie z. B. Brillengläsern oder Motorradhelm- Visieren eine sehr gute Kratzfestigkeit. Diese Kratzfestigkeit wird von den bekannten OEM (Original Equipment Manufacturing)-Klarlacken, die üblicherweise bei der Erstlackierung von Fahrzeugen verwendet werden, nicht erreicht. Seitens der Automobilindustrie wird nun die Anforderung gestellt, diese verbesserte Kratzfestigkeit auch auf die bei der Lackierang von Automobilen verwendeten Klarlackschichten und Unidecklackschichten zu übertragen.
Der Ersatz der üblicherweise in der Automobillackierang eingesetzten OEM- Klarlacke durch Sol-Gel-Klarlacke ist indes nicht ohne weiteres möglich, weil sie
hierfür z. B. zu spröde sind oder weil bei dem Versuch, sie an die OEM- Anforderungen anzupassen, häufig nur schlechte optische Eigenschaften (Appearance) erzielt werden. Vor allem sind die Sol-Gel-Klarlacke zu teuer. Der ökonomisch günstigere Einsatz der Sol-Gel-Klarlacke als zusätzliche Überzugsschicht über die bisher verwendeten Klarlack- oder Unidecklackschichten ergibt Haftungsprobleme zwischen diesen Lackierangen und dem Sol-Gel-Überzug, die insbesondere nach Steinschlag und bei Belastung durch Schwitzwasser auftreten.
Aufgabe der vorliegenden Erfindung ist es, einen neuen Sol-Gel- Beschichtungsstoff bereitzustellen, welcher es gestattet die vorteilhaften Eigenschaften der Sol-Gel-Überzüge mit den vorteilhaften Eigenschaften der bekannten einschichtigen oder mehrschichtigen Lackierungen, insbesondere der ein- oder mehrschichtigen effekt- und/oder farbgebenden Lackierangen für die Automobilerstlackierang, zu kombinieren, ohne daß es dabei zu Problemen der Haftung kommt.
Demgemäß wurde der neue Sol-Gel-Beschichtungsstoff gefunden, enthaltend
(A) eine Acrylatcopolymerisatlösung, enthaltend mindestens ein
Acrylatcopolymerisat (AI), herstellbar durch Copolymerisation mindestens der folgenden Monomeren:
al) mindestens einen im wesentlichen säuregrappenfreien (Meth)acrylsäureester,
a2) mindestens ein ethylenisch ungesättigtes Monomer, das mindestens eine Hydroxylgruppe pro Molekül trägt und im wesentlichen säuregrappenfrei ist, und
a3) mindestens ein mindestens eine Säuregrappe, die in die entsprechende Säureaniongrappe überführbar ist, pro Molekül tragendes ethylenisch ungesättigtes Monomer;
(B) einen Stammlack, herstellbar durch Hydrolyse und Kondensation mindestens eines hydrolysierbaren Silans (Bl) der allgemeinen Formel I
SiR, (D,
worin die Variable R die folgende Bedeutung hat:
R = hydrolysierbare Gruppen, Hydroxygruppen und nicht hydrolysierbare Gruppen, mit der Maßgabe, daß mindestens eine, vorzugsweise mindestens zwei, hydrolysierbare Gruppe(n) vorhanden ist oder sind;
und
(C) eine Additivlösung, enthaltend
cl) mindestens eine mindestens eine Epoxidgrappe enthaltende ethylenisch ungesättigte Verbindung,
c2) mindestens ein Silan (Bl) mit mindestens einer nicht hydrolysierbaren Gruppe R, welche mindestens eine Epoxidgrappe aufweist, und
c3) mindestens ein Addukt mindestens eines Silans (Bl) mit mindestens einer nicht hydrolysierbaren Gruppe R, welche
mindestens eine Aminograppe aufweist, und mindestens einem cyclischen ethylenisch ungesättigten Dicarbonsäureanhydrid.
Im folgenden wird der neue Sol-Gel-Beschichtungsstoff als „erfmdungsgemäßer Beschichtungsstoff' bezeichnet.
Außerdem wurde das neue Verfahren zur Herstellung von Sol-Gel-Überzügen durch Applikation und Aushärten von Sol-Gel-Beschichtungsstoffen auf ungrandierten oder grundierten Substraten oder ungrandierten oder grundierten Substraten, welche mit einer einschichtigen oder mehrschichtige Lackierung versehen sind, gefunden, bei dem man den erfmdungsgemäßen Beschichtungsstoff verwendet und/oder bei dem man vor der Applikation eines Sol-Gel-Beschichtungsstoffs
(il) eine einschichtige Lackierang auf Basis eines Einkomponenten(lK)- Klarlacks, Zweikomponenten(2K)- oder Mehrkomponenten(3K, 4K)- Klarlacks, Pulverklarlacks oder UV-härtbaren Klarlacks,
(i2) eine mehrschichtige effekt- und/oder farbgebende Lackierung mit einer obersten Schicht auf Basis eines Einkomponenten(lK)-Klarlacks,
Zweikomponenten(2K)- oder Mehrkomponenten(3K, 4K)-Klarlacks, Pulverklarlacks oder UV-härtbaren Klarlacks oder
(i3) eine einschichtige effekt- und/oder farbgebende Lackierang auf Basis eines Unidecklacks
appliziert und teilweise aushärtet.
In folgenden werden die neuen Verfahren zur Herstellung von Sol-Gel-Überzügen der Kürze halber zusammenfassend als „erfindungsgemäßes Verfahren" bezeichnet.
Des weiteren wurden neue Sol-Gel-Überzüge gefunden, welche aus dem erfindungsgemäßen Beschichtungsstoffen herstellbar sind und im folgenden als „erfindungsgemäße Sol-Gel-Überzüge" bezeichnet werden.
Nicht zuletzt wurden neue Substrate gefunden, welche mindestens einen erfindungsgemäßen Sol-Gel-Überzug aufweisen und im folgenden als „erfindungsgemäße Substrate" bezeichnet werden.
Im Hinblick auf den Stand der Technik war es überraschend und für den Fachmann nicht vorhersehbar, daß die der Erfindung zugrundeliegende Aufgabe mit Hilfe des erfmdungsgemäßen Beschichtungsstoffs und des erfindungsgemäßen Verfahrens gelöst werden konnte. Insbesondere war es überraschend, daß der erfindungsgemäße Beschichtungsstoff ohne Probleme auf den Lackierangen haftet, ohne daß es bei Steinschlag oder nach der Belastung im Schwitzwasser, d. h. eine zehntägige Belastung der Schichten in einer Atmosphäre von 40 °C und 100% relativer Luftfeuchtigkeit, zu Ablösungen oder Rissen kommt. Auch die optischen Eigenschaften der mit den erfmdungsgemäßen Sol-Gel-Überzügen versehenen Lackierangen genügen allen Ansprüchen.
Bei dem erfmdungsgemäßen Beschichtungsstoff handelt es sich um eine siloxanhaltige Lackformulierang, die durch Umsetzung von hydrolysierbaren Siliciumverbindungen mit Wasser oder Wasser abspaltenden Mitteln hergestellt werden kann und die zur Verbesserung bestimmter Eigenschaften organische Bestandteile enthält. Eine allgemeine Beschreibung von solchen Systemen findet sich beispielsweise in dem Artikel von Bruce M. Novak, „Hybrid Nanocomposite Materials-Between Inorganic Glasses and Organic Polymers", in Advanced
Materials, 1993, 5, Nr.6, S. 422-433, oder in dem Vortrag von R. Kasemann, H. Schmidt, 15. International Conference, International Centre for Coatings Technology, Paper 7, „Coatings for mechanical and chemical protection based on organic-inorganic Sol-Gel Nanocomposites", 1993.
Die Basisreaktionen finden in einem Sol-Gel-Prozeß statt, bei dem Tetraorthosilikate gegebenenfalls in Gegenwart eines Co-Lösemittels hydrolisiert und kondensiert werden:
Hydrolyse:
Si(OR)4 + H2O → (RO)3Si-OH + ROH
Kondensation:
-Si-OH + HO-Si- → -Si-O-Si- + H2O -Si-OH + RO-Si- → -Si-O-Si- + ROH
wobei R eine Alkylgruppe, wie Methyl oder Ethyl sein kann. Häufig werden Tetramethylorthosilikat (TMOS) oder Tetraethylorthosilikat (TEOS) eingesetzt. Zur Katalyse der Reaktionen werden Säuren, Basen oder Fluoridionen eingesetzt.
Bei dem erfindungsgemäßen Beschichtungsstoff handelt es sich demnach um siloxanhaltige Strukturen, die mit organischen Bestandteilen modifiziert sind (Ormocer® = Organically Modified Ceramic).
Der erfindungsgemäße Sol-Gel-Überzug wird durch gezielte Hydrolyse und Kondensation von Kieselsäureestern und von Metallakoholaten hergestellt. Spezielle Eigenschaften erhält er durch den Einbau organisch modifizierter Kieselsäurederivate in das silicatische Netzwerk. Sie erlauben den Aufbau eines organischen Polymernetzwerks zusätzlich zum anorganischen Grandgerüst, wenn
organische Reste, vorzugsweise solche mit olefinisch ungesättigten Gruppen und/oder Epoxidgruppen, eingesetzt werden.
Die Modifizierung erfolgt erfindungsgemäß dadurch, daß während der Hydrolyse und Kondensation der Ausgangsprodukte oder im Sol ein fertiges organisches Polymer anwesend ist.
Der erfindungsgemäße Beschichtungsstoff besteht aus den drei wesentlichen Komponenten (A), (B) und (C).
Bei der Komponente (A) handelt es sich um eine Acrylatcopolymerisatlösung, welche vorzugsweise frei von aromatischen Lösemitteln ist.
Im Rahmen der vorliegenden Erfindung bedeutet der Begriff „frei von aromatischen Lösemitteln" oder „aromatenfrei" hier und im folgenden, daß der Gehalt an aromatischen Lösemitteln oder aromatischen Verbindungen in einer Lösung <1 Gew.-%, vorzugsweise <0,5 Gew.-% und besonders bevorzugt <0,2 Gew.-% beträgt und insbesondere unterhalb der gaschromatographischen Nachweisgrenze Hegt.
Die erfmdungsgemäß zu verwendende Acrylatcopolymerisatlösung (A) enthält mindestens ein Acrylatcopolymerisat (AI), welches durch die Copolymerisation der nachstehend genannten Monomeren (al), (a2) und (a3) sowie gegebenenfalls weiterer Monomerer (a4), (a5) und oder (a6) hergestellt wird, wobei (al), (a2) und (a3) sowie gegebenenfalls (a4), (a5) und (a6) in Art und Menge so ausgewählt werden, daß das Acrylatcopolymerisat(Al) die gewünschte OH-Zahl, Säurezahl und das gewünschte Molekulargewicht aufweist. Vorzugsweise weisen die Acrylatcopolymerisate (AI) eine Hydroxylzahl von 40 bis 240, besonders bevorzugt 60 bis 210 und insbesondere 100 bis 200, eine Säurezahl von 5 bis 100, besonders bevorzugt 10 bis 60 und insbesondere 20 bis 40,
Glasübergangstemperaturen von -35 bis +85°C und zahlenmittlere Molekulargewichte Mn von 1.500 bis 300.000 auf.
Zur Herstellung der erfindungsgemäß eingesetzten Polyacrylatharze kann als Monomer (al) jeder mit (a2), (a3), (a4), (a5) und (a6) copolymerisierbare (Meth)Acrylsäurealkyl- oder -cycloalkylester mit bis zu 20 Kohlenstoffatomen im Alkylrest, insbesondere Methyl-, Ethyl-, Propyl-, n-Butyl-, sec.-Butyl-, tert.- Butyl-, Hexyl-, Ethylhexyl-, Stearyl- und Laurylacrylat oder -methacrylat; cycloaliphatische (Meth)acrylsäureester, insbesondere Cyclohexyl-, Isobornyl-, Dicyclopentadienyl-, Octahydro-4,7-methano-lH-inden-methanol- oder tert.- Butylcyclohexyl(meth)acrylat; (Meth)Acrylsäureoxaalkylester oder oxacycloalkylester wie Ethyltriglykol(meth)acrylat und
Methoxyoligoglykol(meth)acrylat mit einem Molekulargewicht Mn von vorzugsweise 550; oder andere ethoxylierte und/oder propoxylierte hydroxylgruppenfreie (Meth)acrylsäurederivate; verwendet werden. Diese können in untergeordneten Mengen höherfunktionelle (Meth)Acrylsäurealkyl- oder - cycloalkylester wie Ethylengylkol-, Propylenglykol-, Diethylenglykol-, Dipropylenglykol-, Butylenglykol-, Pentan-l,5-diol-, Hexan- 1,6-diol-, Octahydro-4,7-methano-lH-inden-dimethanol- oder Cyclohexan-IJ-, -1,3- oder - l,4-diol-di(meth)acrylat; Trimethylolpropan-di- oder -tri(meth)acrylat; oder Pentaerythrit-di-, -tri- oder -tetra(meth)acrylat; enthalten. Im Rahmen der vorliegenden Erfindung sind hierbei unter untergeordneten Mengen an höherfunktionellen Monomeren solche Mengen zu verstehen, welche nicht zur Vernetzung oder Gelierung der Polyacrylatharze führen.
Als Monomere (a2) können mit (al), (a2), (a3), (a4), (a5) und (a6) copolymerisierbare und von (a5) verschiedene, ethylenisch ungesättigte Monomere, die mindestens eine Hydroxylgruppe pro Molekül tragen und im wesentlichen säuregrappenfrei sind, wie Hydroxyalkylester der Acrylsäure, Methacrylsäure oder einer anderen alpha,beta-ethylenisch ungesättigten
Carbonsäure, welche sich von einem Alkylenglykol ableiten, der mit der Säure verestert ist, oder durch Umsetzung der Säure mit einem Alkylenoxid erhältlich sind, insbesondere Hydroxyalkylester der Acrylsäure, Methacrylsäure, Ethacrylsäure, Crotonsäure, Maleinsäure, Fumarsäure oder Itaconsäure, in denen die Hydroxyalkylgrappe bis zu 20 Kohlenstoffatome enthält, wie 2-Hydroxyethyl- , 2-Hydroxypropyl-, 3-Hydroxypropyl-, 3-Hydroxybutyl-, 4-Hydroxybutylacrylat, -methacrylat, -ethacrylat, -crotonat, -maleinat, -fumarat oder -itaconat; 1,4- Bis(hydroxymethyl)cyclohexan-, Octahydro-4,7 -methano- 1 H-inden-dimethanol- oder Methylpropandiolmonoacrylat, -monomethacrylat, -monoethacrylat, - monocrotonat, -monomaleinat, -monofumarat oder -monoitaconat; oder Umsetzungsprodukte aus cyclischen Estern, wie z.B. epsilon-Caprolacton und diesen Hydroxyalkylestern; oder olefmisch ungesättigte Alkohole wie Allylalkohol oder Polyole wie Trimethylolpropanmono- oder diallylether oder Pentaerythritmono-, -di- oder -triallylether; verwendet werden. Hinsichtlich dieser höherfunktionellen Monomeren (a2) gilt das für die höherfunktionellen Monomeren (al) Gesagte sinngemäß. Der Anteil an Trimethylolpro- panmonoallylether beträgt üblicherweise 2 bis 10 Gew.-%, bezogen auf das Gesamtgewicht der zur Herstellung des Polyacrylatharzes eingesetzten Monomeren (al) bis (a6). Daneben ist es aber auch möglich, 2 bis 10 Gew.-%, bezogen auf das Gesamtgewicht der zur Herstellung des Polyacrylatharzes eingesetzten Monomeren, Trimethylolpropanmonoallylether zum fertigen Polyacrylatharz zuzusetzen. Die olefmisch ungesättigten Polyole, wie insbesondere Trimethylolpropanmonoallylether, können als alleinige hydroxylgruppenhaltige Monomere, insbesondere aber anteilsmäßig in Kombination mit anderen der genannten hydroxylgrappenhaltigen Monomeren, eingesetzt werden.
Als Monomer (a3) kann jedes mindestens eine Säuregrappe, vorzugsweise eine
Carboxylgrappe, pro Molekül tragende, mit (al), (a2), (a4), (a5) und (a6) copolymerisierbare, ethylenisch ungesättigte Monomer oder ein Gemisch aus
solchen Monomeren verwendet werden. Als Komponente (a3) werden besonders bevorzugt Acrylsäure und/oder Methacrylsäure eingesetzt. Es können aber auch andere ethylenisch ungesättigte Carbonsäuren mit bis zu 6 C-Atomen im Molekül verwendet werden. Beispiele für solche Säuren sind Ethacrylsäure, Crotonsäure, Maleinsäure, Fumarsäure und Itaconsäure. Weiterhin können ethylenisch ungesättigte Sulfon- oder Phosphonsäuren, bzw. deren Teilester, als Komponente (a3) verwendet werden. Als Komponente (a3) kommen desweiteren Maleinsäuremono(meth)acryloyloxyethylester, Bernsteinsäuremo- no(meth)acryloyloxyethylester und Phthalsäuremono(meth)acryloyloxyethylester in Betracht.
Als Monomere (a4) können ein oder mehrere Vinylester von in alpha-Stellung verzweigten Monocarbonsäuren mit 5 bis 18 C-Atomen im Molekül eingesetzt werden. Die verzweigten Monocarbonsäuren können erhalten werden durch Um- Setzung von Ameisensäure oder Kohlenmonoxid und Wasser mit Olefinen in Anwesenheit eines flüssigen, stark sauren Katalysators; die Olefine können Crack-Produkte von paraffinischen Kohlenwasserstoffen, wie Mineralölfraktionen, sein und können sowohl verzweigte wie geradkettige acyclische und/oder cycloaliphatische Olefine enthalten. Bei der Umsetzung solcher Olefine mit Ameisensäure bzw. mit Kohlenmonoxid und Wasser entsteht ein Gemisch aus Carbonsäuren, bei denen die Carboxylgruppen vorwiegend an einem quaternären Kohlenstoffatom sitzen. Andere olefmische Ausgangsstoffe sind z.B. Propylentrimer, Propylentetramer und Diisobutylen. Die Vinylester können aber auch auf an sich bekannte Weise aus den Säuren hergestellt werden, z.B. indem man die Säure mit Acetylen reagieren läßt. Besonders bevorzugt werden - wegen der guten Verfügbarkeit - Vinylester von gesättigten aliphatischen Monocarbonsäuren mit 9 bis 11 C-Atomen, die am alpha-C-Atom verzweigt sind, eingesetzt.
Als Monomer (a5) wird das Umsetzungsprodukt aus Acrylsäure und/oder Methacrylsäure mit dem Glycidylester einer in alpha-Stellung verzweigten Monocarbonsäure mit 5 bis 18 C-Atomen je Molekül eingesetzt. Glycidylester stark verzweigter Monocarbonsäuren sind unter dem Handelsnamen "Cardura" erhältlich. Die Umsetzung der Acryl- oder Methacrylsäure mit dem Glycidylester einer Carbonsäure mit einem tertiären alpha-Kohlenstoffatom kann vorher, während oder nach der Polymerisationsreaktion erfolgen. Bevorzugt wird als Komponente (a5) das Umsetzungsprodukt von Acryl- und/oder Methacrylsäure mit dem Glycidylester der Versatiesäure eingesetzt. Dieser Glycidylester ist unter dem Namen "Cardura E10" im Handel erhältlich.
Als Monomere (a6) können alle mit (al), (a2), (a3), (a4) und (a5) copolymerisierbaren, von (al), (a2), (a3) und (a4) verschiedenen, im wesentlichen säuregruppenfreien ethylenisch ungesättigten Monomere oder Gemische aus solchen Monomeren verwendet werden. Als Komponente (a6) kommen
Olefine wie Ethylen, Propylen, But-l-en, Pent-1-en, Hex-l-en, Cyclohexen, Cyclopenten, Norbonen, Butadien, Isopren, Cylopentadien und/oder Dicyclopentadien;
(Meth)Acrylsäureamide wie (Meth)Acrylsäureamid, N-Methyl -, N,N- Dimethyl-, N-Ethyl-, N,N-Diethyl-, N-Propyl-, N,N-Dipropyl, N-Butyl-, N,N-Dibutyl-, N-Cyclohexyl- und/oder N,N-Cyclohexyl-methyl- (meth)acrylsäureamid;
Epoxidgrappen enthaltende Monomere wie der Glycidylester der Acrylsäure, Methacrylsäure, Ethacrylsäure, Crotonsäure, Maleinsäure, Fumarsäure und/oder Itaconsäure;
vinylaromatische Kohlenwasserstoffe, wie Styrol, alpha-Alkylstyrole, insbesondere alpha-Methylstyrol, und/oder Vinyltoluol;
Nitrile wie Acrylnitril und/oder Methacrylnitril;
Vinylverbindungen wie Vinylchlorid, Vinylfluorid, Vinylidendichlorid, Vinylidendifluorid; N-Vinylpyrrolidon; Vinylether wie Ethylvinylether, n-Propylvinylether, Isopropylvinylether, n-Butylvinylether,
Isobutylvinylether und/oder Vinylcyclohexylether; Vinylester wie Vinylacetat, Vinylpropionat, Vinylbutyrat, Vinylpivalat und/oder der
Vinylester der 2-Methyl-2-ethylheptansäure; und/oder
Polysiloxanmakromonomere, die ein zahlenmittleres Molekulargewicht Mn von 1.000 bis 40.000, bevorzugt von 2.000 bis 20.000, besonders bevorzugt 2.500 bis 10.000 und insbesondere 3.000 bis 7.000 und im
Mittel 0,5 bis 2,5, bevorzugt 0,5 bis 1,5, ethylenisch ungesättigte Doppelbindungen pro Molekül aufweisen, wie sie in der DE-A-38 07 571 auf den Seiten 5 bis 7, der DE-A 37 06 095 in den Spalten 3 bis 7, der EP-B-0 358 153 auf den Seiten 3 bis 6, in der US A 4,754,014 in den Spalten 5 bis 9, in der DE-A 44 21 823 oder in der der internationalen
Patentanmeldung WO 92/22615 auf Seite 12, Zeile 18, bis Seite 18, Zeile 10, beschrieben sind, oder Acryloxysilan-enthaltende Vinylmonomere, herstellbar durch Umsetzung hydroxyfunktioneller Silane mit Epichlorhy- drin und anschließender Umsetzung des Reaktionsproduktes mit Methacrylsäure und/oder Hydroxyalkylestern der (Meth)acrylsäure;
in Betracht.
Vorzugsweise werden vinylaromatische Kohlenwasserstoffe, insbesondere Styrol, eingesetzt.
Die Art und Menge der Komponenten (al) bis (a6) wird so ausgewählt, daß das Polyacrylatharz (AI) die gewünschte OH-Zahl, Säurezahl und Glasübergangstemperatur aufweist. Besonders bevorzugt eingesetzte Acrylatharze werden erhalten durch Polymerisation von
(al) 20 bis 60 Gew.-%, bevorzugt 30 bis 50 Gew.-%, der Komponente (al),
(a2) 10 bis 50 Gew.-%, bevorzugt 15 bis 40 Gew.-%, der Komponente (a2),
(a3) 1 bis 15 Gew.-%, bevorzugt 1 bis 8 Gew.-%, der Komponente (a3),
(a4) 0 bis 25 Gew.-% der Komponente (a4),
(a5) 0 bis 25 Gew.-% der Komponente (a5) und
(a6) 5 bis 30 Gew.-%, bevorzugt 10 bis 20 Gew.-%, der Komponente (a6),
wobei die Summe der Gewichtsanteile der Komponenten (al) bis (a6) jeweils 100 Gew.-% beträgt.
Die Herstellung der erfindungsgemäß eingesetzten Acrylatcopolymerisate (AI) erfolgt in einem organischen Lösemittel oder Lösemittelgemisch, welches vorzugsweise frei ist von aromatischen Lösungsmitteln, und in Gegenwart mindestens eines Polymerisationsinitiators. Als Polymerisationsinitiatoren werden die für die Herstellung von Acrylatcopolymerisaten üblichen Polymerisationsinitiatoren eingesetzt.
Beispiele geeigneter Polymerisationsinitiatoren sind freie Radikale bildende Initiatoren, wie z.B. tert.-Butylperoxyethylhexanoat, Benzoylperoxid, Di-tert.-
Amylperoxid, Azobisisobutyronitril und tert.-Butylperbenzoat genannt. Die Initiatoren werden bevorzugt in einer Menge von 1 bis 25 Gew.-%, besonders bevorzugt von 2 bis 10 Gew.-%, bezogen auf das Gesamtgewicht der Monomeren, eingesetzt.
Die Polymerisation wird zweckmäßigerweise bei einer Temperatur von 80 bis 200 °C, vorzugsweise 110 bis 180 °C, durchgeführt.
Bevorzugt werden als Lösemittel Ethoxyethylpropionat und Isopropoxypropanol eingesetzt.
Bevorzugt wird das Acrylatcopolymerisat (AI) nach einem Zweistufenverfahren hergestellt, da so die resultierenden erfindungsgemäßen Beschichtungsstoff e eine bessere Verarbeitbarkeit aufweisen. Bevorzugt werden daher Acrylatcopolymerisate (AI) eingesetzt, die erhältlich sind, indem
1. ein Gemisch aus den Monomeren (al) und (a2) sowie gegebenenfalls (a4), (a5) und/oder (a6) oder ein Gemisch aus Teilen der Monomeren (al) und (a2) sowie gegebenenfalls (a4), (a5) und/oder (a6) in einem organischen Lösemittel polymerisiert wird und
2. nachdem mindestens 60 Gew.-% des aus (al) und (a2) sowie gegebenenfalls (a4) (a5) und/oder (a6) bestehenden Gemisches zugegeben worden sind, das Monomer (a3) und der gegebenenfalls vorhandene Rest der Monomeren (al) und (a2) sowie gegebenenfalls (a4), (a5) und/oder
(a6) zugegeben wird oder werden und weiter polymerisiert wird.
Daneben ist es aber auch möglich, die Monomeren (a4) und/oder (a5) zusammen mit zumindest einem Teil des Lösemittels vorzulegen und die restlichen Monomeren zuzudosieren. Außerdem können auch die Monomeren (a4) und/oder
(a5) nur teilweise zusammen mit zumindest einem Teil des Lösemittels in die Vorlage gegeben werden und der Rest dieser Monomeren, wie oben beschrieben, zugegeben werden. Bevorzugt werden beispielsweise mindestens 20 Gew.-% des Lösemittels und ca. 10 Gew.-% der Monomeren (a4) und (a5) sowie gegebenenfalls Teilen der Monomeren (al) und (a6) vorgelegt.
Bevorzugt ist außerdem die Herstellung der erfindungsgemäß eingesetzten Acrylatpolymerisate (AI) durch ein Zweistufenverfahren, bei dem die erste Stufe 1 bis 8 Stunden, vorzugsweise 1,5 bis 4 Stunden, dauert und die Zugabe der Mischung aus (a3) und dem gegebenenfalls vorhandenen Rest der Monomeren (al) und (a2) sowie gegebenenfalls (a4), (a5) und (a6) innerhalb von 20 bis 120 Minuten, vorzugsweise innerhalb von 30 bis 90 Minuten, erfolgt. Nach Beendigung der Zugabe der Mischung aus (a3) und dem gegebenenfalls vorhandenen Rest der Monomeren (al) und (a2) sowie gegebenenfalls (a4), (a5) und (a6) wird so lange weiter polymerisiert, bis alle eingesetzten Monomeren im wesentlichen vollständig umgesetzt worden sind. Hierbei kann sich die zweite Stufe unmittelbar der ersten anschließen. Indes kann mit der zweiten Stufe erst nach einer gewissen Zeit, beispeilsweise nach 10 min bis 10 Stunden, begonnen werden.
Die Menge und Zugabegeschwindigkeit des Initiators wird vorzugsweise so gewählt, daß ein Acrylatcopolymerisat (AI) mit einem zahlenmittleren Molekulargewicht Mn von 1000 bis 30.000 Dalton erhalten wird. Es ist bevorzugt, daß mit dem Initiatorzulauf einige Zeit, im allgemeinen ca. 1 bis 15 Minuten, vor dem Zulauf der Monomeren begonnen wird. Ferner ist ein Verfahren bevorzugt, bei dem die Initiatorzugabe zum gleichen Zeitpunkt wie die Zugabe der Monomeren begonnen und etwa eine halbe Stunde nachdem die Zugabe der Monomeren beendet worden ist, beendet wird. Der Initiator wird vorzugsweise in konstanter Menge pro Zeiteinheit zugegeben. Nach Beendigung der Initiatorzugabe wird das Reaktionsgemisch noch so lange (in der Regel 1,5
Stunden) auf Polymerisationstemperatur gehalten, bis alle eingesetzten Monomere im wesentlichen vollständig umgesetzt worden sind. "Im wesentlichen vollständig umgesetzt" soll bedeuten, daß vorzugsweise 100 Gew.-% der eingesetzten Monomere umgesetzt worden sind, daß es aber auch möglich ist, daß ein geringer Restmonomerengehalt von höchstens bis zu etwa 0,5 Gew.-%, bezogen auf das Gewicht der Reaktionsmischung, unumgesetzt zurückbleiben kann.
Bevorzugt werden die Monomeren zur Herstellung der Acrylatcopolymerisate (AI) bei einem nicht allzu hohen Polymerisationsfestkörper, bevorzugt bei einem Polymerisationsfestkörper von 80 bis 50 Gew.-%, bezogen auf die Monomeren, polymerisiert und anschließend die Lösemittel teilweise destillativ entfernt, so daß die entstehenden Acrylatcopolymerisatlösungen (A) einen Festkörpergehalt von bevorzugt 100 bis 60 Gew.-% aufweisen.
Für die Verwendung in dem erfindungsgemäßen Beschichtungsstoff wird der Festkörpergehalt der Acrylatcopolymerisatlösungen (A) mit mindestens einem vorzugsweise aromatenfreien Lösemittel vorzugsweise auf unter 60 Gew.-%, besonders bevorzugt unter 40 Gew.-% und insbesondere unter 30 Gew.-% eingestellt.
Beispiel geeigneter Lösemittel sind Ethoxyethylpropionat und Butylglykol.
Die Herstellung der erfindungsgemäß zu verwendenden Acrylatcopolymerisate (AI) weist keine methodischen Besonderheiten auf, sondern erfolgt mit Hilfe der auf dem Kunststoffgebiet üblichen und bekannten Methoden der kontinuierlichen oder diskontinuierlichen Copolymerisation unter Normaldruck oder Überdruck in Rührkesseln, Autoklaven, Rohrreaktoren oder Taylorreaktoren.
Beispiele geeigneter Copolymerisationsverfahren werden in den Patentschriften DE-A-197 09 465, DE-C-197 09 476, DE-A-28 48 906, DE-A-195 24 182, EP- A-0 554783, WO 95/27742 oder WO 82/02387 beschrieben.
Erfindungsgemäß sind Taylorreaktoren vorteilhaft.
Taylorreaktoren, die der Umwandlung von Stoffen unter den Bedingungen der Taylorströmung dienen, sind bekannt. Sie bestehen in wesentlichen aus zwei koaxialen konzentrisch angeordneten Zylindern, von denen der äußere feststehend ist und der innere rotiert. Als Reaktionsraum dient das Volumen, das durch den Spalt der Zylinder gebildet wird. Mit zunehmender Winkelgeschwindigkeit CÖ; des Innenzylinders treten einer Reihe unterschiedlicher Strömungsformen auf, die durch eine dimensionslose Kennzahl, die sogenannte Taylor-Zahl Ta, charakterisiert sind. Die Taylor-Zahl ist zusätzlich zur Winkelgeschwindigkeit des Rührers auch noch abhängig von der kinematischen Viskosität v des Fluids im Spalt und von den geometrischen Parametern, dem äußeren Radius des Innenzylinders , dem inneren Radius des Außenzylinders ra und der Spaltbreite d, der Differenz beider Radien, gemäß der folgenden Formel:
Ta = (Oi Ti d v"1(d/ ri)1 2 (D
Bei niedriger Winkelgeschwindigkeit bildet sich die laminare Couette-Strömung, eine einfache Scherströmung, aus. Wird die Rotationsgeschwindigkeit des Innenzylinders weiter erhöht, treten oberhalb eines kritischen Werts abwechselnd entgegengesetzt rotierende (kontrarotierende) Wirbel mit Achsen längs der Umfangsrichtung auf. Diese sogenannten Taylor-Wirbel sind rotationssymmetrisch und haben einen Durchmesser, der annähernd so groß ist wie die Spaltbreite. Zwei benachbarte Wirbel bilden ein Wirbelpaar oder eine Wirbelzelle.
Dieses Verhalten beruht darauf, daß bei der Rotation des Innenzylinders mit ruhendem Außenzylinder die Fluidpartikel nahe des Innenzylinders einer stärkeren Zentrifugalkraft ausgesetzt sind als diejenigen, die weiter vom inneren Zylinder entfernt sind. Dieser Unterschied der wirkenden Zentrifugalkräfte drängt die Fluidpartikel vom Innen- zum Außenzylinder. Der Zentrifugalkraft wirkt die Viskositätskraft entgegen, da bei der Bewegung der Fluidpartikel die Reibung überwunden werden muß. Nimmt die Rotationsgeschwindigkeit zu, dann nimmt auch die Zentrifugalkraft zu. Die Taylor-Wirbel entstehen, wenn die Zentrifugalkraft größer als die stabilisierende Viskositätskraft wird.
Bei der Taylor-Strömung mit einem geringen axialen Strom wandert jedes Wirbelpaar durch den Spalt, wobei nur ein geringer Stoffaustausch zwischen benachbarten Wirbelpaaren auftritt. Die Vermischung innerhalb solcher Wirbelpaare ist sehr hoch, wogegen die axiale Vermischung über die Paargrenzen hinaus nur sehr gering ist. Ein Wirbelpaar kann daher als gut durchmischter Rührkessel betrachtet werden. Das Strömungsystem verhält sich somit wie ein ideales Strömungsrohr, indem die Wirbelpaare mit konstanter Verweilzeit wie ideale Rührkessel durch den Spalt wandern.
Erfmdungsgemäß von Vorteil sind hierbei Taylorreaktoren mit einer äußeren Reaktorwand und einem hierin befindlichen konzentrisch oder exzentrisch angeordneten Rotor, einem Reaktorboden und einem Reaktordeckel, welche zusammen das ringspaltförmige Reaktorvolumen definieren, mindestens einer Vorrichtung zur Zudosierang von Edukten sowie einer Vorrichtung für den Produktablauf, wobei die Reaktorwand und/oder der Rotor geometrisch derart gestaltet ist oder sind, daß auf im wesentlichen der gesamten Reaktorlänge im Reaktorvolumen die Bedingungen für die Taylorströmung erfüllt sind, d.h., daß sich der Ringspalt in Durchflußrichtung verbreitert.
Der Anteil des Bestandteils (A) an dem erfindungsgemäßen Beschichtungsstoff kann sehr breit variieren und richtet sich vor allem danach, was für eine Flexibilität der hieraus hergestellte erfindungsgemäße Sol-Gel-Überzug aufweisen soll. Der Anteil ist nach oben begrenzt; so darf er nicht so hoch gewählt werden, daß es in dem erfmdungsgemäßen Beschichtungsstoff zu einer Phasentrennung kommt oder die Härte und die Kratzfesigkeit des Sol-Gel-Überzugs zu stark abnimmt. Der Fachmann kann daher den jeweils optimalen Anteil aufgrund seines Fachwissens gegebenenfalls unter Zuhilfenahme einfacher Vorversuche bestimmen.
Der weitere wesentliche Bestandteil des erfindungsgemäßen Beschichtungsstoffs ist der Stammlack (B). Auch er ist vorzugsweise frei von aromatischen Lösemitteln.
Er wird hergestellt durch kontrollierte Hydrolyse und Kondensation mindestens eines organisch modifizierten hydrolysierbaren Silans (Bl). Erfindungsgemäß ist es von Vorteil, mindestens zwei Silane (Bl) zu verwenden.
Bei dem hydrolysierbaren Silan (Bl) handelt es sich um Verbindungen der allgemeinen Formel I
SiRt (D,
worin die Reste R gleich oder verschieden sein können und aus hydrolysierbaren Gruppen, Hydroxygruppen und nicht hydrolysierbaren Gruppen ausgewählt sind.
Die nicht hydrolysierbaren Gruppen R in der allgemeinen Formel I werden vorzugsweise ausgewählt aus Alkylgruppen, insbesondere mit 1 bis 4 C-Atomen, wie z.B. Methyl-, Ethyl-, Propyl- und Butylgruppen; Alkenylgrappen, insbesondere mit 2 bis 4 C-Atomen, wie z.B. Vinyl-, 1-Propenyl-, 2-Propenyl-
und Butenylgruppen; Alkinylgrappen, insbesondere mit 2 bis 4 C-Atomen wie Acetylenyl- und Propargylgrappen; und Arylgruppen, insbesondere mit 6 bis 10 C-Atomen, wie z.B. Phenyl- und Naphthylgrapppen. Als nicht hydrolysierbare Gruppen R werden bevorzugt Alkylgruppen eingesetzt.
Beispiele für hydrolysierbare Gruppen R in der vorstehend genannten Formel I sind Wasserstoffatome; Alkoxygrappen, insbesondere mit 1 bis 20 C-Atomen, wie z.B. Methoxy-, Ethoxy-, n-Propoxy-, i-Propoxy, n-Butoxy-, tert.-Butoxy- und sec.-Butoxygruppen; alkoxysubstituierte Alkoxygrappen, wie z.B. beta-Methoxy- ethoxygrappen; Acyloxygrappen, insbesondere mit 1 bis 4 C-Atomen wie z.B. Acetoxy- und Propionyloxygruppen; und Alkylcarbonylgrappen wie z.B. Acetylgruppen.
Besonders bevorzugte hydrolysierbare Gruppen R sind solche, die keinen Substituenten tragen und zu aromatenfreien Hydrolyseprodukten mit niedrigem Molekulargewicht, wie z.B. niederen Alkoholen, wie Methanol, Ethanol, Propanol, n-Butanol, i-Butanol, sec.-Butanol und tert.-Butanol führen.
Wenigstens eine Gruppe R der Formel I muß eine hydrolysierbare Gruppe sein. Silane (Bl) mit zwei, vorzugsweise und vier insbesondere drei hydrolysierbaren Gruppen R sind besonders bevorzugt.
Die nicht hydrolysierbaren Gruppen R der Silane (Bl) können mindestens eine funktionelle Gruppe enthalten. Bei diesen funktioneilen Gruppen kann es sich beispielsweise um Epoxidgrappen, Aminograppen, olefmisch ungesättigte Gruppen wie Vinyl- oder (Meth)acrylgruppen, Mercaptograppen,
Isocyanatgrapppen und/oder deren Umsetzungsprodukte mit weiteren reaktiven Verbindungen handeln.
Beispiele für gut geeignete erfindungsgemäß zu verwendende hydrolysierbare Silane (Bl) sind Methyltriethoxysilan, Methyltrimethoxysilan, Tetramethylorthosilikat, Tetraethylorthosilikat, 3-
Glycidyloxypropyltrimethoxysilan oder 3-Aminopropyltriethoxysilan.
Die Silane (Bl) können ganz oder teilweise in Form von Vorkondensaten eingesetzt werden, d.h. Verbindungen, die durch teilweise Hydrolyse der Silane (Bl), entweder allein oder im Gemisch mit anderen hydrolysierbaren Verbindungen entstanden sind.
Zur Hydrolyse und Kondensation werden die Silane (Bl) im gewünschten Mischungsverhältnis mit Wasser vorkondensiert. Die Wassermenge wird so zudosiert, daß lokale Überkonzentrationen vermieden werden. Dies gelingt z.B. durch Eintragen der Wassermenge in das Reaktionsgemisch mit Hilfe von feuchtigkeitsbeladenen Adsorbentien, z.B. Kieselgel oder Molekularsieben, wasserhaltigen organischen Lösungsmitteln, z.B. 80%igem Ethanol, oder Salzhydraten, z.B. CaCl2 x 6H2O. Vorzugsweise erfolgt die Vorkondensation in Gegenwart eines Hydrolyse- und Kondensationskatalysators jedoch in Abwesenheit eines organischen Lösungsmittels.
In einer weiteren Variante wird die Hydrolyse und Kondensation der hydrolysierbaren Silane (Bl) in der Gegenwart eines vorzugsweise aromatenfreien organischen Lösemittels, wie ein aliphatischer Alkohol, wie Methanol, Ethanol, Propanol, Isopropanol oder Butanol, ein Ether wie Dimethoxiethan, ein Ester wie Dimethylglycolacetat oder Methoxypropylacetat und/oder 2-Ethoxyethanol (Ethylglykol) oder ein Keton wie Aceton oder Methylethylketon, durchgeführt.
Gegebenenfalls können bei der Hydrolyse und Kondensation auch Metallverbindungen und/oder Metalloxide als Nanopartikel anwesend sein.
Diese Nanopartikel sind < 50 nm. Es kann sich beispielsweise um Al2O3, ZrO und/oder TiO2 handeln.
Beispiele geeigneter Metallverbindungen sind hydrolysierbare Metallverbindungen (B2) der allgemeinen Formel II
MRn (II).
In der allgemeinen Formel II steht die Variable M für Aluminium, Titan oder Zirkonium, insbesondere aber Aluminium. Dementsprechend steht der Index n für 3 oder 4.
In der allgemeinen Formel II hat die Variable R die gleiche Bedeutung wie vorstehend bei der allgemeinen Formel I angegeben. Es ist hierbei von Vorteil, wenn im Falle von Aluminium mindestens zwei, insbesondere drei, und im Falle von Titan oder Zirkonium drei, insbesondere vier, hydrolysierbare Gruppen vorhanden sind.
Hierbei sind die vorstehend beschriebenen Alkoxygrappen besonders vorteilhaft und werden deshalb bevorzugt verwendet. Ganz besonders bevorzugt werden sec.-Butyloxygruppen verwendet. Ein Beispiel für eine ganz besonders bevorzugt verwendete hydrolysierbare Metallverbindung (B2) ist demnach Aluminium-tri- sec.-butylat.
Das molare Verhältnis von Metall M zu Silizium kann breit variiert werden und richtet sich vor allem danach, welche Kratzfestigkeit und Härte in den erfindungsgemäßen Sol-Gel-Überzügen eingestellt werden soll. Im allgemeinen kann durch den Ersatz eines Teils des Siliziums durch insbesondere Aluminium die Kratzfestigkeit der erfindungsgemäßen Sol-Gel-Überzüge erhöht werden.
Insbesondere kann das molare Verhältnis M : Si bei 1 : 10 bis 1 : 1,5, vorzugsweise 1 : 6 bis 1 : 3, liegen.
Als Hydrolyse- und Kondensationskatalysatoren eignen sich protonen- oder hydroxylionenabspaltende Verbindungen und Amine. Spezielle Beispiele sind organisch oder anorganische Säuren, wie Salzsäure, Schwefelsäure,
Phosphorsäure, Ameisensäure oder Essigsäure sowie organische oder anorganische Basen wie Ammoniak, Alkali- oder ErdalJkalimetallhydroxide, z.B.
Natrium, Kalium- oder Calciumhydroxid, und im Reaktionsmedium lösliche Amine, z.B. niedere Alkylamine oder Alkanolamine. Hierbei sind flüchtige
Säuren und Basen, insbesondere Salzsäure, Essigsäure, Ammoniak oder
Triethylamin besonders bevorzugt.
Die Vorkondensation wird so weit geführt, daß der resultierende Stammlack (B) noch flüssige Konsistenz hat. Vorzugsweise weist er einen Festkörpergehalt von weniger als 80 Gew.-%, besonders bevorzugt weniger als 60 Gew.-% und insbesondere weniger als 40 Gew.-% auf.
Auch der Anteil des Bestandteils (B) an dem erfindungsgemäßen Beschichtungsstoff kann sehr breit variieren und richtet sich vor allem danach, was für eine Kratzfestigkeit und Härte der hieraus hergestellte erfindungsgemäße Sol-Gel-Überzug aufweisen soll. Der Anteil ist nach oben begrenzt; so darf er nicht so hoch gewählt werden, daß es in dem erfindungsgemäßen Beschichtungsstoff zu einer Phasentrennung kommt und/oder daß die hiermit hergestellten erfindungsgemäßen Sol-Gel-Überzüge zu hart und spröde werden. Der Fachmann kann daher den jeweils optimalen Anteil aufgrund seines Fachwissens gegebenenfalls unter Zuhilfenahme einfacher Vorversuche bestimmen.
Der dritte wesentliche Bestandteil des erfindungsgemäßen Beschichtungsstoffs ist die Additivlösung (C).
Sie enthält mindestens eine ethylenisch ungesättigte Verbindung (cl), welche mindestens eine Epoxidgrappe aufweist. Ein Beispiel einer geeigneten Verbindung (cl) ist Glycidyl(meth)acrylat.
Des weiteren enthält sie als Komponente (c2) mindestens ein Silan (Bl) mit mindestens einer nicht hydrolysierbaren Gruppe R, welche mindestens eine Epoxidgrappe aufweist. Ein Beispiel einer geeigneten Verbindung (c2) ist 3- Glycidyloxypropyltrimethoxysilan.
Nicht zuletzt enthält sie mindestens ein Addukt (c3) mindestens eines Silans (Bl) mit mindestens einer nicht hydrolysierbaren Gruppe R, welche mindestens eine Aminograppe aufweist, und mindestens einem cyclischen ethylenisch ungesättigten Dicarbonsäureanhydrid. Ein Beispiel für ein geeignetes Silan (Bl) ist 3-Aminopropyltriethoxysilan. Beispiele für geeignete Dicarbonsäureanhydride sind Malemsäureanhydrid und Itaconsäureanhydrid.
In der Additivlösung sind die Komponenten (cl), (c2) und (c3) in einem Gewichtsverhältnis von (1 bis 10) : (1 bis 30) : 1, insbesondere (2 bis 6) : (10 bis 20) : 1 enthalten. Vorzugsweise liegt der Festkörpergehalt der Additivlösung (C) unter 80 Gew.-%, vorzugsweise unter 60 Gew.-% und insbesondere unter 50
Gew.-%.
Auch der Anteil der Additivlösung (C) an dem erfindungsgemäßen Beschichtungsstoff kann breit variieren. Der Fachmann kann den jeweils optimalen Anteil aufgrund seines Fachwissens gegebenenfalls unter Zuhilfenahme einfacher Vorversuche bestimmen.
Besonders vorteilhafte erfindungsgemäße Beschichtungsstoffe enthalten, jeweils bezogen auf ihre Gesamtmenge, 5 bis 20, vorzugsweise 10 bis 15 und insbesondere 11 bis 14 Gew.-% der Acrylatcopolymerisatlösung (A), 40 bis 85, vorzugsweise 45 bis 80 und insbesondere 50 bis 75 Gew.-% des Stammlacks (B) sowie 0,5 bis 3, vorzugsweise 1 bis 2 und insbesondere 1,2 bis 1,7 Gew.-% der Additivlösung (C).
Hierbei ist es erfindungsgemäß von ganz besonderem Vorteil, wenn die Festkörpergehalte der erfindungswesentlichen Bestandteile (A), (B) und (C) derart gewählt werden, daß sie in einem Gewichtsverhältnis von (A) : (B) : (C) von
I bis 10 : 30 bis 60 : 1
- vorzugsweise 2 bis 8 : 35 bis 55 : 1 und
insbesondere 2,5 bis 6 : 40 bis 50 : 1
zueinander stehen.
Der erfindungsgemäße Beschichtungsstoff kann des weiteren mindestens einen Härter (D) enthalten. Beispiele geeigneter Härter (D) sind quaternäre Ammoniumverbindungen wie Tetraalkylammoniumsalze, insbesondere Tetramethylammoniumiodid. Vorzugsweise kann der Härter (D) in dem erfindungsgemäßen Beschichtungsstoff in einer Menge von 0,001 bis 1 Gew.-% enthalten sein.
Der erfindungsgemäße Beschichtungsstoff kann des weiteren größere Mengen an vorzugsweise nicht aromatischen Lösemitteln als Bestandteil (E) enthalten. Dies ist insbesondere dann der Fall, wenn besonders dünne erfindungsgemäße Sol-Gel-
Überzüge hergestellt werden sollen. Beispiele geeigneter Lösemittel (E) sind die vorstehend genannten niederen Alkohole, insbesondere Ethanol, oder Glykolether wie Ethylglykol oder Butylglykol.
Außerdem kann der erfindungsgemäße Beschichtungsstoff übliche und bekannte Lackadditive (F) enthalten. Geeignet sind alle Lackadditive (F), welche das Eigenschaftsprofil der erfindungsgemäßen Sol-Gel-Überzüge, insbesondere deren optische Eigenschaften (Appearance) und Kratzfestigkeit, nicht nachteilig beeinflussen, sondern in vorteilhafter Weise variieren und verbessern.
Beispiele geeigneter Lackadditive (F) sind
Lichtschutzmittel wie UV-Absorber;
- Radikallanger;
Katalysatoren für die Vernetzung;
Slipadditive;
Polymerisationsinhibitoren;
Entschäumer;
- Emulgatoren, insbesondere nicht ionische Emulgatoren wie alkoxylierte
Alkanole und Polyole, Phenole und Alkylphenole oder anionische Emulgatoren wie Alkalisalze oder Ammoniumsalze von Alkancarbon- säuren, Alkansulfonsäuren, und Sulfonsäuren von alkoxylierten Alkanolen und Polyolen, Phenolen und Alkylphenole;
Netzmittel wie Siloxane, fluorhaltige Verbindungen,
Carbonsäurehalbester, Phosphorsäureester, Polyacrylsäuren und deren Copolymere oder Polurethane;
- Haftvermittler;
Verlaufmittel;
filmbildende Hilfsmittel wie Cellulose-Derivate;
Flammschutzmittel oder
rheologiesteuernde Additive wie die aus den Patentschriften WO 94/22968, EP-A-0 276 501, EP-A-0 249 201 oder WO 97/12945 bekannten; vernetzte polymere Mikroteilchen, wie sie beispielsweise in der EP-A-0 008 127 offenbart sind; anorganische Schichtsilikate wie Aluminium-Magnesium-Silikate, Natrium-Magnesium- und
Natrium-Magnesium-Fluor-Lithium-Schichtsilikate des
Montmorillonit-Typs; Kieselsäuren wie Aerosile; oder synthetische Polymere mit ionischen und/oder assoziativ wirkenden Gruppen wie
Polyvinylalkohol, Poly(meth)acrylamid, Poly(meth)acrylsäure,
Polyvinylpyrrolidon, Styrol-Maleinsäureanhydrid- oder
Ethylen-Maleinsäureanhydrid-Copolymere und ihre Derivate oder hydrophob modifizierte ethoxylierte Urethane oder Polyacrylate.
Weitere Beispiele geeigneter Additive (E) werden in dem Lehrbuch „Lackadditive" von Johan Bieleman, Wiley-VCH, Weinheim, New York, 1998, beschrieben.
Der erfindungsgemäße Beschichtungsstoff weist einen Festkörpergehalt von bis zu 80, vorzugsweise bis zu 60, besonders bevorzugt bis zu 40 und insbesondere bis zu 20 Gew.-% auf. Sollen besonders dünne erfmdungsgemäße Sol-Gel- Überzüge, d.h. Überzüge einer Stärke < 5 μm hergestellt werden, empfiehlt es sich, einen Festkörpergehalt von weniger als 20 Gew.-% zu wählen.
Die Herstellung des erfmdungsgemäßen Beschichtungsstoffs weist keine Besonderheiten auf, sondern erfolgt in üblicher und bekannter Weise durch Vermischen seiner wesentlichen Bestandteile (A), (B) und (C) sowie gegebenenfalls (D), (E) und/oder (F) in üblichen und bekannten Mischaggregaten wie Dissolvern. Die Bestandteile können hierbei in beliebiger Weise miteinander vermischt werden. Beispielsweise können sie auf einmal in das Mischaggregat eingefüllt und miteinander vermischt werden. Erfindungsgemäß ist es indes von Vorteil, den Stammlack (B) vorzulegen, um dann die übrigen Bestandteile nacheinander einzelnen zuzugeben. Hierbei hat es sich bewährt, die Acrylatcopolymerisatlösung (A) vor der Additivlösung (C) zuzusetzen. Wird ein Lösemittel (E) verwendet, wird es vorteilhafterweise nach der Zugabe der Acrylatcopolymerisatlösung (A) und vor der Zugabe der Additivlösung (C) zugesetzt. Werden Lackadditive (F) verwendet, werden sie vorteilhafterweise nach der Zugabe der Acrylatcopolymerisatlösung (A) zugesetzt. Der Härter (D) wird vorteilhafterweise zuletzt zugegeben.
Die erfindungsgemäßen Beschichtungsstoffe sind hervorragend für die Herstellung der erfmdungsgemäßen Sol-Gel-Überzüge, insbesondere Sol-Gel- Klarlacke, geeignet.
Erfindungsgemäß kann mit ihnen jedes denkbare Substrat beschichtet werden.
Beispielhaft seien Substrate aus Metall, Kunststoff, Glas, Holz oder Keramik genannt. Diese Substrate können mit einer Grundierung versehen sein. Im Falle von Kunststoff kann es sich um eine sogenannte Hydro-Grandierang handeln. Im
Falle von Metall kann das Substrat auch einer Oberflächenbehandlung, beispielsweise einer Galvanisierang oder einer Phosphatierang oder Eloxierang, unterzogen worden sein. Des weiteren kann auf dem Metallsubstrat ein Elektrotauchlack und ein Füller als Grandierang vorhanden sein.
Die Applikation der erfindungsgemäßen Beschichtungsstoffe weist keine methodischen Besonderheiten auf, sondern es können die üblichen Applikationsmethoden wie Spritzen, Rakeln, Streichen, Gießen, Tauchen oder Walzen angewandt werden.
Nach ihrer Applikation werden die erfindungsggemäßen Beschichtungsstoffe gehärtet, wodurch die erfindungsgemäßen Sol-Gel-Überzüge resultieren. Vor der Härtung kann gegebenenfalls noch eine Vortrocknung erfolgen. Auch hierfür können die üblichen und bekannten Verfahren und Vorrichtungen wie Umluftöfen angewandt werden. Die erfindungsgemäßen Beschichtungsstoffe können auch mit mittlerer IR-Strahlung gehärtet werden. Hierdurch wird es möglich, nur Teile von Substraten oder ein- oder mehrschichtigen Lackierangen an beschädigten oder an besonders exponierten Stellen gezielt zu beschichten und kratzfest auszurüsten, ohne daß dabei die übrigen Teile durch thermische Belastung in Mitleidenschaft gezogen werden. Dies macht die vorteilhafte Verwendung der erfindungsgemäßen Beschichtungsstoffe in der Autoreparaturlackierang möglich. Da hierbei außerdem die Menge des erfindungsgemäßen Beschichtungsstoffs auf ein Minimum beschränkt werden kann, ist seine Verwendung auch besonders wirtschaftlich.
Die erfindungsgemäßen Beschichtungsstoffe können direkt auf die vorstehend genannten ungrandierten oder grundierten Substrate appliziert werden, um hierauf nach dem Aushärten einen kratzfesten erfindungsgemäßen Sol-Gel- Überzug zu bilden. In dieser Weise können Substrate, wie sie üblicherweise für
die Herstellung von Fahrzeugen, von sonstigen Bauteilen und Gerätschaften, wie Radiatoren oder Container, oder von Möbeln kratzfest ausgerüstet werden.
Die besonderen Vorteile der erfindungsgemäßen Beschichtungsstoffe treten indes besonders offen zutage, wenn sie für die Beschichtung von einschichtigen oder mehrschichtigen Lackierangen mit den erfindungsgemäßen Sol-Gel-Überzügen verwendet werden.
Demgemäß eignen sich die erfindungsgemäßen Beschichtungsstoffe für die Beschichtung einschichtiger oder mehrschichtiger Lackierangen, insbesondere einschichtiger oder mehrschichtiger effekt- und/oder farbgebende Lackierangen wie sie auf den Gebieten der Automobilerstlackierang, der Autoreparaturlackierang, der industriellen Lackierang, inklusive Container Coatings, der Kunststofflackierang und der Möbellackierang üblich und bekannt sind.
Beispiele einschichtiger Lackierangen dieser Art sind die eingangs beschriebenen, von der Automobilerstlackierang und Autoreparaturlackierang her bekannten Unidecklacke, insbesondere die auf Basis der Zweikomponenten(2K)- Unidecklacke, oder klare, transparente Lackierangen auf Basis der nachstehend beschriebenen Klarlacke, insbesondere der Einkomponenten(lK)-Klarlacke, der Zweikomponenten(2K)- oder Mehrkomponenten(3K, 4K)-Klarlacke, der Pulverklarlacke und der UV-härtbaren Klarlacke.
Beispiele für mehrschichtige Lackierangen sind die Lackierangen, welche eine effekt-und/oder f arbgebenden Basislackschicht, insbesondere eine auf Basis eines Wasserbasislacks, und eine Klarlackschicht, insbesondere auf Basis eines Einkomponenten(lK)-Klarlacks, Zweikomponenten(2K)- oder
Mehrkomponenten(3K, 4K)-Klarlacks, Pulverklarlacks, Pulverslurryklarlacks oder UV-härtbaren Klarlacks, insbesondere eines Zweikomponenten(2K)- oder
Mehrkomponenten(3K, 4K)-Klarlacks, enthalten und im Rahmen der Automobilerstlackierang nach dem Naß-in-naß-Verfahren oder im Rahmen der Autoreparaturlackierang erzeugt werden.
Die erfindungsgemäßen Beschichtungsstoffe sind insbesondere für Beschichtung von mehrschichtigen Lackierangen dieser Art besonders hervorragend geeignet.
Beispiele geeigneter Wasserbasislacke sowie der entsprechenden mehrschichtigen Lackierangen sind aus den Patentschriften EP-A-0 089 497, EP-A-0 256 540, EP- A-0 260447, EP-A-0 297 576, WO 96/12747, EP-A-0 523 610, EP-A-0 228 003, EP-A-0 397 806, EP-A-0 574 417, EP-A-0 531 510, EP-A-0 581 211, EP-A-0 708 788, EP-A-0 593 454, DE-A-43 28 092, EP-A-0 299 148, EP-A-0 394 737, EP-A-0 590 484, EP-A-0 234 362, EP-A-0 234 361, EP-A-0 543 817, WO 95/14721, EP-A-0 521 928, EP-A-0 522 420, EP-A-0 522 419, EP-A-0 649 865, EP-A-0 536 712, EP-A-0 596 460, EP-A-0 596 461, EP-A-0 584 818, EP-A- 0 669 356, EP-A-0 634 431, EP-A-0 678 536, EP-A-0 354 261, EP-A-0 424 705, WO 97/49745, WO 97/49747 oder EP-A-0401 565 bekannt.
Bei der Verwendung von Zweikomponenten(2K)-Unidecklacken oder von Einkomponenten(lK)-Klarlacken, Zweikomponenten(2K)- oder
Mehrkomponenten(3K, 4K)-Klarlacken, Pulverklarlacken und UV-härtbaren Klarlacken, insbesondere von Zweikomponenten(2K)- oder
Mehrkomponenten(3K, 4K)-Klarlacken, zur Herstellung von einschichtigen oder mehrschichtigen Lackierungen ergibt sich der weitere wesentliche Vorteil, daß nicht nur die erfindungsgemäßen Beschichtungsstoffe für die Herstellung der Sol- Gel-Überzüge in Betracht kommen, sondern auch herkömmliche Sol-Gel- Klarlacke, wenn die besagten Lacke nach ihrer Applikation und vor dem Auftragen der Sol-Gel-Klarlacke teilweise ausgehärtet werden. Hiernach werden die besagten Lacke gemeinsam mit den Sol-Gel-Klarlacken vollständig ausgehärtet. Durch diese erfindungsgemäße Vorgehensweise resultiert eine
besonders gute Haftung zwischen den Lackschichten und den Sol-Gel-Überzügen. Besonders hervorragende Ergebnisse werden erhalten, wenn bei dem erfindungsgemäßen Verfahren die erfindungsgemäßen Beschichtungsstoffe verwendet werden.
Beispiele geeigneter Einkomponenten(lK)-, Zweikomponenten(2K)- oder Mehrkomponenten(3K, 4K)-Klarlacke sind beispielsweise aus den Patentschriften DE-A-42 04 518, US-A-5 ,474,811, US-A-5,356,669, US-A-5,605,965, WO 94/10211, WO 94/10212, WO 94/10213, EP-A-0 594 068, EP-A-0 594 071, EP- A-0 594 142, EP-A-0 604 992, WO 94/22969, EP-A-0 596 460 oder WO 92/22615 bekannt.
Einkomponenten(lK)-Klarlacke enthalten bekanntermaßen hydroxylgrappenhaltige Bindemittel und Vernetzungsmittel wie blockierte Polyisocyanate, Tris(alkoxycarbonylamino)triazine und/oder Aminoplastharze. In einer weiteren Variante enthalten sie als Bindemittel Polymere mit seitenständigen Carbamat- und oder Allophanatgrappen und gegebenenfalls carbamat- und oder allophanatmodifizerten Aminoplastharzen als Vernetzungsmittel .
Zweikomponenten(2K)- oder Mehrkomponenten(3K, 4K)-Klarlacke enthalten als wesentliche Bestandteile bekanntermaßen hydroxylgrappenhaltige Bindemittel und Polyisocyanate als Vernetzungsmittel, welche bis zu ihrer Verwendung getrennt gelagert werden.
Beispiele geeigneter Pulverklarlacke sind beispielsweise aus der deutschen Patentschrift DE-A-42 22 194 oder der Produkt-Information der Firma BASF Lacke + Farben AG, „Pulverlacke", 1990 bekannt.
Pulverklarlacke enthalten als wesentliche Bestandteile bekanntermaßen epoxidgrappenhaltige Bindemittel und Polycarbonsäuren als Vernetzungsmittel.
Beispiele geeigneter Pulverslurry-Klarlacke sind beispielsweise aus der US- Patentschrift US-A-4,268,542 und den deutschen Patentanmeldungen DE-A-195 18 392.4 und DE-A-196 13 547 bekannt oder werden in der nicht vorveröffentlichten deutschen Patentanmeldung DE-A-198 14471.7 beschrieben.
Pulverslurry-Klarlacke enthalten bekanntermaßen Pulverklarlacke in einem wäßrigen Medium dispergiert.
UV-härtbare Klarlacke gehen beispielsweise aus den Patentschriften EP-A-0 540 884, EP-A- 0 568 967 oder US-A-4,675,234 hervor.
Sie enthalten bekanntermaßen mit aktinischem Licht und/oder Elektronenstrahlung härtbare niedermolekulare, oligomere und/oder polymere Verbindungen, vorzugsweise strahlenhärtbare Bindemittel, insbesondere auf Basis ethylenisch ungesättigter Präpolymerer und/oder ethylenisch ungesättigter Oligomerer, gegebenenfalls einen oder mehrere Reaktivverdünner sowie gegebenenfalls einen oder mehrere Photoinitiatoren. Beispiele geeigneter strahlenhärtbarer Bindemittel sind (meth)acrylfunktionelle
(Meth)Acrylcopolymere, Polyetheracrylate, Polyesteracrylate, ungesättigte Polyester, Epoxyacrylate, Urethanacrylate, Aminoacrylate, Melaminacrylate, Silikonacrylate und die entsprechenden Methacrylate. Bevorzugt werden Bindemittel eingesetzt, die frei von aromatischen Siraktoreinheiten sind.
Es können indes auch mehrschichtige Klarlackschichten angewandt werden wie etwa eine Klarlackschicht auf der Basis von hydroxylgruppenhaltigen
Bindemitteln und blockierten Polyisocyanaten und Aminoplasten als Vernetzungsmittel, die der Wasserbasislackschicht unmittelbar aufliegt und über
der sich eine weitere Klarlackschicht auf der Basis von carbamat- und/oder allophanatgrappenhaltigen Bindemitteln und Aminoplasten als Vernetzungsmittel befindet.
Die erfmdungsgemäßen Sol-Gel-Überzüge, welche aus den erfindungsgemäßen Beschichtungsstoff en vorzugsweise nach dem erfindungsgemäßen Verfahren hergestellt werden, zeichnen sich durch eine hervorragende Kratzfestigkeit bei sehr guter Haftung, auch nach der Belastung mit Schwitzwasser, aus. Auch die Appearance ist sehr gut. Das erfindungsgemäße Verfahren eignet sich daher insbesondere für die Lackierang von Fahrzeugkarosserien, insbesondere von Automobilkarosserien, mit Mehrschichtlackierangen, für die industrielle Lackierang, inklusive Container Coatings, und für die Möbellackierang.
Beispiele
Herstellbeispiel
Die Herstellung des erfindungsgemäßen Sol-Gel-KIarlacks
1. Die Herstellung eines Stammlacks
In einem geeigneten Reaktionsgefäß wurden unter Stickstoff 30 Teile vollentsalztes Wasser, 40 Teile Ethylglykol, 5 Teile Essigsäure (100 %ig), 66,5 Teile Methyltriethoxisilan und 4,1 Teile 3-Glycidyloxypropyl-trimethoxysilan vorgelegt und unter Rühren auf 60 °C erhitzt. Nach weiteren 3 Stunden bei 60 °C wurde die Reaktionsmischung unter Rühren auf 90 °C erhitzt und während 2 Stunden bei dieser Temperatur gehalten. Danach wurden 70 Teile der Reaktionsmischung azeotrop bei 85 °C abdestilliert. Nach dem Abkühlen auf Zimmertemperatur wurden der Reaktionsmischung 5 Teile Methoxypropylacetat
und 0J Teile BYK® 301 (Verlaufsmittel der Firma BYK) zugesetzt. Es resultierte der Stammlack 1 mit einem theoretischen Festkörpergehalt von 37 Gew.-% und einem experimentell ermittelten Festkörpergehalt von 46,9 Gew.-% (1 Stunde/130 °C). Für die Herstellung des Sol-Gel-Klarlacks 4b wurde der Festkörper auf 40,3 Gew.-% eingestellt.
2. Die Herstellung eines Acrylatcopolymerisats zur Modifikation des Sol-Gel-Klarlacks (Lösung zur organischen Modifikation 2)
In einem geeigneten Rührkessel mit Rückflußkühler und Rühren wurden 39 Teile Ethoxyethylpropionat vorgelegt und auf 130 °C erhitzt. In einem ersten Monomerzulaufgefaß wurden 9,598 Teile Butylmethacrylat, 7,708 Teile Methylmethacrylat, 8,003 Teile Styrol, 4,253 Teile Methacrylester 13.0 (Methacrylsäureester mit einem langen Alkylrest im Esterteil) und 9,096 Teile Hydroxyethylacrylat vorgemischt. In einem zweiten Monomerzulaufgefaß wurden 3,810 Teile Hydroxyethylacrylat, 1,831 Teile Acrylsäure und 0,916 Teile Ethoxyethylpropionat vorgelegt. In einen Initiatorzulauf gefäß wurden 3,692 Teile Peroxid TBPEH (tert.-Butylperethylhexanoat) und 6,025 Teile Ethoxyethylpropionat vorgelegt. Der Inhalt des ersten Monomerzulaufgefäßes wurde während vier Stonden gleichmäßig in den Reaktor dosiert. Nach zwei Stunden und 30 Minuten nach dem Beginn des ersten Monomerzulaufs wurde mit dem zweiten Monomerzulauf begonnen. Zu diesem Zweck wurde der Inhalt des zweiten Monomerzulaufgefäßes während einer Stunde und 30 Minuten gleichmäßig in den Reaktor dosiert. Der Inhalt des Initiatorzulaufgefäßes wurde während vier Stonden und 30 Minuten gleichmäßig in den Reaktor dosiert, wobei mit dem Initiatorzulauf fünf Minuten vor dem ersten Monomerzulauf begonnen wurde. Nach Beendigung der Zuläufe wurde die resultierende Reaktionsmischung während zwei Stunden bei 130 °C polymerisiert bis eine Originalviskosität von 2,2 dPas, ein Festkörpergehalt von 50 Gew.-% (15 Minuten/180 °C) und eine Säurezahlen von 30 mg KOH/g erreicht waren. Hiernach wurde das
Ethoxyethylpropionat im Vakuum bei 100 °C abdestilliert, bis ein Festkörpergehalt von 81 Gew.-% (15 Minuten/180 °C) erreicht war. Die resultierende Reaktionsmischung wurde auf 80 °C abgekühlt und mit Butylglykol und Ethoxyethylpropionat (Gewichtsverhältnis 5 : 1) auf einen Festkörpergehalt von 75 Gew.-% eingestellt.
Für die Herstellung des erfindungsgemäßen Sol-Gel-Klarlacks wurde die Lösung des Acrylatcopolymerisats mit Butylglykol auf einen Festkörpergehalt von 20 Gew.-% eingestellt, und es resultierte die Lösung zur organischen Modifikation 2.
Die Herstellung einer Additivlösung
15 Teile Ethylglykol, 2 Teile Methacrylsäure-2,3-epoxypropylester (Glycidylmethacrylat), 7,5 Teile 3-Glycidyloxypropyltrimethoxysilan, 0,5 Teile eines Addukts aus Maleinsäureanhydrid und 3-Aminopropyltriethoxysilan sowie 0J Teile Azodicarbonsäurediamid (GenitronR AZDN - M) wurden unter Rühren während sechs Stunden bei 100 °C miteinander vermischt. Es resultierte die Additivlösung 3 mit einem experimentell ermittelten Festkörpergehalt von 40 Gew.-% (15 Minuten/180 °C).
Das Addukt selbst wurde hergestellt, indem man 220 Teile 3- Aminopropyltriethoxysilan und 100 Teile Maleinsäureanhydrid miteinander umsetzte.
Die Herstellung des erfindungsgemäßen Sol-Gel-Klarlacke 4a und 4b
4.1 Der Sol-Gel-Klarlack 4a
Der Sol-Gel-Klarlack 4a wurde erhalten, indem man zu 61,2 Teilen des Stammlacks 4 (46,9 Gew.- %ig in Ethylglykol) unter Rühren nacheinander 14,77
Teile der Lösung zur organischen Modifikation 2, 20,8 Teile
Methoxypropylacetat, 0,014 Teile BYK® 301, 1,57 Teile der Additivlösung 3, 0,8 Teile Tinuvin® 384 und 0,6 Teile Tinuvin® 123 (Lichtschutzmittel der Firma Ciba-Geigy) miteinander vermischte. Zu der resultierenden Mischung wurden 7,0 Teile Tetramethylammoniumiodid-Lösung (3 %ig in Methanol Wasser 1 : 1) hinzugegeben. Der resultierende Sol-Gel-Klarlack 4a wurde während 30 Minuten bei Raumtemperator gerührt. Er wies einen Festkörpergehalt von 32 Gew.-% auf (15 Minuten/180 °C). Der Sol-Gel-Klarlack 4a wurde für die Herstellung eines Sol-Gel-Überzugs auf einer einschichtigen Lackierang auf Basis eines Zweikomponenten(2K)-Unidecklacks verwendet (Beispiel 1).
4. 2 Der Sol-Gel-Klarlack 4b
Der Sol-Gel-Klarlack 4b wurde erhalten, indem man zu 71,3 Teilen des Stammlacks 4 (40,3 Gew.-%ig in Ethylglykol) unter Rühren nacheinander 11,77 Teile der Lösung zur organischen Modifikation 2, 14,89 Teile Methoxypropylacetat, 0,47 Teile BYK® 301 und 1,57 Teile der Additivlösung 3 hinzugab. Der resultierende Sol-Gel-Klarlack 4b wurde für die Herstellung eines Sol-Gel-Überzugs auf einer mehrschichtigen Lackierung mit einer Klarlackschicht auf Basis eines handelsüblichen Zweikomponenten(2K)- Klarlacks verwendet (Beispiel 2).
Beispiel 1
Die Herstellung eines erfmdungsgemäßen Sol-Gel-Überzugs auf einer einschichtigen Lackierung
Auf mit einem handelsüblichen Elektrotauchlack kathodisch beschichteten Stahltafeln (Elektrotauchlackierang mit einer Schichtdicke von 18 - 22 μm) wur-
den mit einer Becherpistole zunächst ein handelsüblicher Füller von BASF Coatings AG appliziert und eingebrannt. Es resultierte eine Füllerschicht mit einer Schichtdicke von 35 bis 40 μm. Auf die Füllerschicht wurde ein handelsüblicher Zweikomponenten (2 K)-Unidecklack (AK66-1110 Ral 9005 Schwarz der Firma BASF Coatings AG) aufgetragen und während 15 Minuten bei 50 °C vorgetrocknet und teilweise gehärtet.
Nach dem Abkühlen der Tafeln wurde der Sol-Gel-Klarlack 4a aufgetragen. Hiernach wurden die Unidecklackschicht und die Sol-Gel-Klarlack-Schicht gemeinsam während 4 Stonden bei 90 °C ausgehärtet.
Es resultierte eine Lackierung mit einer Unidecklackschicht einer Stärke von 45 μm und dem erfindungsgemäßen Sol-Gel-Überzug einer Stärke von 8 μm. Die Lackierung war frei von Rissen und machte einen sehr guten optischen Gesamteindrack.
Beispiel 2
Die Herstellung eines erfindungsgemäßen Sol-Gel-Überzugs auf einer mehrschichtigen Lackierung
Auf mit einem handelsüblichen Elektrotauchlack kathodisch beschichteten Stahltafeln (Elektrotauchlackierang mit einer Schichtdicke von 18 - 22 μm) wurden mit einer Becherpistole zunächst ein handelsüblicher Füller von BASF Coatings AG appliziert und eingebrannt. Es resultierte eine Füllerschicht mit einer Schichtdicke von 35 bis 40 μm. Anschließend wurde auf den Füller in gleicher Weise ein grüner Metallic-Wasserbasislack (EcostarR Dschungelgrün der Firma BASF Coatings AG) appliziert und während 10 min bei 80 °C vorgetrocknet. Nach dem Kühlen der Tafeln wurde eine Schicht aus einem handelsüblichen Zweikomponenten(2K)-Klarlack (FF95-0111 der Firma BASF
Coatings AG) aufgetragen und während 10 min bei 80 °C vorgetrocknet und teilweise ausgehärtet.
Nach dem Abkühlen der beschichteten Tafeln wurde der erfindungsgemäße Sol- Gel-Klarlack 4b gemäß dem Herstellbeispiel appliziert. Die Wasserbasislackschicht, die Klarlackschicht und die Sol-Gel-Klarlack-Schicht wurden anschließend gemeinsam während 30 Minuten bei 150 °C ausgehärtet.
Es resultierte eine mehrschichtige Lackierung mit einer Basislackschicht einer Stärke von 15 μm, einer Klarlackschicht einer Stärke von 44 μm und dem erfindungsgemäßen Sol-Gel-Überzug einer Stärke von 8 μm. Die Lackierang war frei von Rissen und machte einen sehr guten optischen Gesamteindrack.
Beispiel 3
Die Prüfung der Eigenschaften der erfindungsgemäßen Sol-Gel-Überzüge der Beispiele 1 und 2
3.1 Haftung des Sol-Gel-Überzugs
Die Tabelle 1 gibt einen Überblick über die durchgeführten Tests und die hierbei erhaltenen Ergebnisse.
Tabelle 1:
Haftfestigkeit der erfmdungsgemäßen Sol-Gel-Überzüge
Testmethoden Beispiel
1 2
Kratzprobe nach DBL 7399 [Note 0 bis 5] 0 0
Kratzprobe nach 240 Stonden Schwitzwasser- Konstantklima (SKK) [Note 0 bis 5] 0 0
Gitterschnitt nach DIN 53151 (2 mm) [Note 0 bis 5] 0 0
Gitterschnitt nach 240 Stunden SKK und 24 Stunden Regeneration 0 0
[Note 0 bis 5]: 0 = bester Wert; 5 = schlechtester Wert
Die Ergebnisse der Tabelle 1 belegen die hervorragende Haftung der erfindungsgemäßen Sol-Gel-Überzüge auf den jeweiligen Lackierangen.
3.2 Die Kratzfestigkeit des Sol-Gel-Überzugs
3.2.1 Nach dem Bürstentest
Für diesen Test wurden die Prüftafeln wurden nach Applikation der Lacke mindestens 2 Wochen bei Raumtemperatur gelagert, bevor die Prüfung durchgeführt wurde.
Die Kratzfestigkeit des Sol-Gel-Überzugs auf den Prüftafeln wurde mit Hilfe des in Fig. 2 auf Seite 28 des Artikels von P. Betz und A. Bartelt, Progress in Organic Coatings, 22 (1993), Seiten 27 - 37, beschriebenen BASF-Bürstentests, der
allerdings bezüglich des verwendeten Gewichts (2000 g statt der dort genannten 280 g) abgewandelt wurde, folgendermaßen beurteilt:
Bei dem Test wurde qie Lackoberfläche mit einem Siebgewebe, welches mit einer Masse belastet wurde, geschädigt. Das Siebgewebe und die Lackoberfläche wurden mit einer Waschmittel-Lösung reichlich benetzt. Die Prüftafel wurde mittels eines Motorantriebs in Hubbewegungen unter dem Siebgewebe vor- und zurückgeschoben.
Der Prüfkörper war mit Nylon-Siebgewebe (Nr. 11, 31 μm Maschenweite, Tg 50 °C) bespanntes Radiergummi (4,5 x 2,0 cm, breite Seite senkrecht zur Kratzrichtong). Das Auflagegewicht betragt 2000 g.
Vor jeder Prüfung wurde das Siebgewebe erneuert, dabei war die Laufrichtung der Gewebemaschen parallel zur Kratzrichtong. Mit einer Pipette wurde ca. 1 ml einer frisch aufgerührten 0,25%igen Persil-Lösung vor dem Radiergummi aufgebracht. Die Umdrehungszahl des Motors wurde so eingestellt, daß in einer Zeit von 80 s 80 Doppelhübe ausgeführt wurden. Nach der Prüfung wurde die verbleibende Waschflüssigkeit mit kaltem Leitungswasser abgespült und die Prüftafel mit Druckluft trockengeblasen. Hierbei zeigte es sich, daß die erfindungsgemäßen Sol-Gel-Überzüge überhaupt nicht zerkratzt waren.
3.2.2 Nach dem Sandtest
Zusätzlich wurde die Kratzfestigkeit nach dem Sandtest bestimmt. Hierzu wurden die Lackoberflächen mit Sand belastet (20g Quarz-Silbersand 1,5-2,0 mm). Der Sand wurde in einen Becher (Boden plan abgeschnitten) gegeben, der fest auf der Prüftafel befestigt wurde. Es wurden die gleichen Prüftafeln wie oben im Bürstentest beschrieben verwendet. Mittels eines Motorantriebes wurde die Tafel mit dem Becher und dem Sand in Schüttelbewegungen versetzt. Die Bewegung
des losen Sandes verursachte dabei die Beschädigung der Lackoberfläche (100 Doppelhübe in 20 s). Nach der Sandbelastung wurde die Prüffläche vom Abrieb gereinigt, unter einem kalten Wasserstrahl vorsichtig abgewischt und anschließend mit Druckluft getrocknet. Gemessen wurde der Glanz nach DIN 67530 vor und nach Beschädigung.
Hierbei zeigte es sich, daß durch die Belastung der Glanz
bei Beispiel 1 nur um 9 Glanzeinheiten und
bei Beispiel 2 nur um 13 Glanzeinheiten abnahm,
was ein weiterer Beleg für die außerordentlich hohe Kratzfestigkeit des erfindungsgemäßen Sol-Gel-Überzugs ist.
3.3.3 Nach Amtec
Die Kratzfestigkeit wurde bei Beispiel 1 noch nach Amtec bestimmt. Hierbei nahm durch die Belastung der Glanz vom Ausgangswert 68 nur um 5 Glanzeinheiten ab, was die hohe Kratzfestigkeit des erfindungsgemäßen Sol-Gel- Überzugs weiter untermauert.
3.4 Chemikalienbeständigkeit
3.4.1 Chemikalienbeständigkeit nach dem MB-Gradientenofen-Test
Bei dem dem Fachmann gutbekannten MB-Gradientenofen-Test wurden die
Prüftafeln der Beispiele 1 und 2 definiert der Schädigung durch Schwefelsäure,
Wasser, Pankreatin und Baumharz ausgesetzt. Hierzu wurden die Probesubstanzen im Abstand von je einer Segmentbreite (Einstellung des
Gradienten auf 30 - 75°C [1°C pro Heizsegment]) aufgetragen. Nach einer Lagerung von 72 Stonden im Normklima 23 °C wurden die Prüftafeln auf einem Gradientenofen (z.B. Typ: 2615 Fa. BYK-Gardner) während 30 min belastet. Ermittelt wurde die Temperatur, bei der die erste sichtbare Veränderung auftrat.
Die Versuchsergebnisse finden sich in der Tabelle 2.
Tabelle 2: Chemikalienbeständigkeit nach dem MB-Gradientenofen-Test
Prüf Substanz Beispiel 1 Beispiel2
1. Markierung 1. Markierung bei °C bei °C
Schwefelsäure 1%-ig 61 55
Wasser dest. > 75 > 75
Pankreatin < 50 < 50
Baumharz > 75 > 75
Die Ergebnisse des MB-Gradientenofen-Tests untermauern die hohe Chemikalienbeständigkeit des erfmdungsgemäßen Sol-Gel-Überzugs.
3.4.2 Nach dem MEK-Test
Die Lösemittelbeständigkeit der erfindungsgemäßen Sol-Gel-Überzüge der Beispiele 1 und 2 wurden gemäß der Vorschrift des dem Fachmann gut bekannten MEK-Tests getestet. Selbst nach 200 Doppelhüben mit mit Methylethylketon getränkten Wattebäuschen waren keine Schädigungen zu sehen.
3.5 Steinschlagtest
Der der Fachwelt bekannte VDA Steinschlagtest unter Multi-Stoßbelastong (2 x 500 Gramm/2 bar) lieferte bei beiden Beispielen 1 und 2 einen Kennwert von 3 und einen Rostgrad von 2. Demnach erwies sich der erfindungsgemäße Sol-Gel- Überzug zusammen mit der einschichtigen (Beispiel 1) und der mehrschichtigen Lackierang (Beispiel 2) als ausreichend stabil gegenüber Steinschlag.
3.6 Erichsentiefung
Die Erichsentiefung nach DIN EN ISO 1520: 1995-04 lag bei 0,5 mm (Beispiel 1) bzw. bei 0,4 mm (Beispiel 2).
Claims
1. Sol-Gel-Beschichtungsstoff, enthaltend
(A) eine Acrylatcopolymerisatlösung, enthaltend mindestens ein
Acrylatcopolymerisat (AI), herstellbar durch Copolymerisation von mindestens den folgenden Monomeren:
al) mindestens einen im wesentlichen säuregrappenfreien (Meth)acrylsäureester,
a2) mindestens ein ethylenisch ungesättigtes Monomer, das mindestens eine Hydroxylgruppe pro Molekül trägt und im wesentlichen säuregrappenfrei ist, und
a3) mindestens ein mindestens eine Säuregrappe, die in die entsprechende Säureaniongruppe überführbar ist, pro Molekül tragendes ethylenisch ungesättigtes Monomer;
(B) einen Stammlack, herstellbar durch Hydrolyse und Kondensation mindestens eines hydrolysierbaren Silans (Bl) der allgemeinen Formel I
SiR, (I),
worin die Variable R die folgende Bedeutung hat:
R = hydrolysierbare Gruppen, Hydroxygruppen und nicht hydrolysierbare Gruppen, mit der Maßgabe, daß mindestens eine, vorzugsweise mindestens zwei, hydrolysierbare Grappe(n) vorhanden ist oder sind;
und
(C) eine Additivlösung, enthaltend
cl) mindestens eine mindestens eine Epoxidgrappe enthaltende ethylenisch ungesättigte Verbindung,
c2) mindestens ein Silan (Bl) mit mindestens einer nicht hydrolysierbaren Gruppe R, welche mindestens eine Epoxidgrappe aufweist, und
c3) mindestens ein Addukt mindestens eines Silans (Bl) mit mindestens einer nicht hydrolysierbaren Gruppe R, welche mindestens eine Aminograppe aufweist, und mindestens einem cyclischen ethylenisch ungesättigten Dicarbonsäureanhydrid.
2. Der Sol-Gel-Beschichtungsstoff nach Ansprach 1, dadurch gekennzeichnet, daß er, jeweils bezogen auf seine Gesamtmenge, 5 bis 20, vorzugsweise 10 bis 15 und insbesondere 11 bis 14 Gew.-% der Acrylatcopolymerisatlösung (A), 40 bis 85, vorzugsweise 45 bis 80 und insbesondere 50 bis 75 Gew.- des Stammlacks (B) sowie 0,5 bis 3, vorzugsweise 1 bis 2 und insbesondere 1,2 bis 1,7 Gew.-% der Additivlösung (C) enthält.
. Der Sol-Gel-Beschichtongsstoff nach Anspruch 1 oder 2, dadurch gekennzeichnet, daß die Festkörpergehalte der Bestandteile (A), (B) und (C) in einem Gewichtsverhältnis von (A) : (B) : (C) von
1 bis 10 : 30 bis 60 : 1
vorzugsweise 2 bis 8 : 35 bis 55 : 1 und
insbesondere 2,5 bis 6 : 40 bis 50 : 1
zueinander stehen.
4. Der Sol-Gel-Beschichtungsstoff nach einem der Ansprüche 1 bis 3, dadurch gekennzeichnet, daß der Stammlack (B) mindestens eine hydrolysierbare Metallverbindung der allgemeinen Formel II
MRn (IT),
worin die Variablen und der Index die folgende Bedeutung haben:
M = Aluminium, Titan oder Zirkonium,
R = hydrolysierbare Gruppen, Hydroxygruppen und nicht hydrolysierbare Gruppen, mit der Maßgabe, daß mindestens eine, vorzugsweise mindestens zwei, hydrolysierbare Gruppe(n) vorhanden ist oder sind, und
n 3 oder 4; enthält.
5. Der Sol-Gel-Beschichtungsstoff nach einem der Ansprüche 1 bis 4, dadurch gekennzeichnet, daß
die nicht hydrolysierbaren Grappen R Alkylgruppen, insbesondere mit 1 bis 4 C-Atomen; Alkenylgruppen, insbesondere mit 2 bis 4 C-Atomen; Alkinylgrappen, insbesondere mit 2 bis 4 C-Atomen; und/oder Arylgrappen, insbesondere mit 6 bis 10 C-Atomen; und
die hydrolysierbaren Grappen R Wasserstoffatome, Alkoxygrappen, insbesondere mit 1 bis 20 C-Atomen; alkoxysubstituierte Alkoxygrappen mit 3 bis 20 C-Atomen; Acyloxygrappen, insbesondere mit 1 bis 4 C-Atomen; Alkylcarbonylgruppen, insbesondere mit 2 bis 6 C-Atomen; sind.
6. Der Sol-Gel-Beschichtongsstoff nach Anspruch 5, dadurch gekennzeichnet, daß
- die hydrolysierbaren Grappen R Methoxy-, Ethoxy-, n-Propoxy-, i-
Propoxy, n-Butoxy-, sec-Butoxy-, beta-Methoxy-ethoxy-, Acetoxy- , Propionyloxy und/oder Acetylgrappen und die
die nicht hydrolysierbaren Grappen R Methyl-, Ethyl-, Propyl-, Butyl- Vinyl-, 1-Propenyl-, 2-Propenyl-, Butenyl-, Acetylenyl-,
Propargyl-, Phenyl- und/oder und Naphthylgrappen sind.
7. Der Sol-Gel-Beschichtungsstoff nach einem der Ansprüche 1 bis 6, dadurch gekennzeichnet, daß die nicht hydrolysierbaren Gruppen R mindestens eine funktionelle Gruppe, insbesondere mindestens eine Epoxidgruppe, Aminograppe, olefmisch ungesättigte Gruppe, Mercaptograppe, und/oder Isocyanatgrapppe und/oder deren Umsetzungsprodukte mit weiteren reaktiven Verbindungen, enthalten.
8. Der Sol-Gel-Beschichtongsstoff nach einem der Ansprüche 1 bis 7, dadurch gekennzeichnet, daß es sich um einen Sol-Gel-Klarlack handelt.
9. Die Verwendung des Sol-Gel-Beschichtongsstoffs gemäß einem der Ansprüche 1 bis 8 zur Herstellung kratzfester Sol-Gel-Überzüge, insbesondere für einschichtige oder mehrschichtige Lackierangen.
10. Die Verwendung des Sol-Gel-Beschichtongsstoffs nach Ansprach 9, dadurch gekennzeichnet, daß es sich um ausgehärtete einschichtige oder mehrschichtige Lackierangen handelt.
11. Die Verwendung des Sol-Gel-Beschichtongsstoffs nach Anspruch 9 oder 10, dadurch gekennzeichnet, daß es sich bei den Lackierangen um Automobilerstlackierangen, Autoreparaturlackierangen, industrielle Lackierangen, inklusive Container Coatings, Kunststofflackierangen und Möbellackierungen handelt.
12. Verfahren zur Herstellung kratzfester Sol-Gel-Überzüge durch Applikation und Aushärten von Sol-Gel-Beschichtungsstoffen auf ungrandierten oder grundierten Substraten oder ungrandierten oder grundierten Substraten, welche mit einer einschichtigen oder mehrschichtigen Lackierang versehen sind, dadurch gekennzeichnet, daß man hierbei einen Sol-Gel- Beschichtongsstoff gemäß einem der Ansprüche 1 bis 8 verwendet.
13. Verfahren zur Herstellung kratzfester Sol-Gel-Überzüge durch Applikation und Aushärten von Sol-Gel-Beschichtungsstoffen auf ungrandierten oder grandierten Substraten, welche mit einer einschichtigen oder mehrschichtigen Lackierang versehen sind, dadurch gekennzeichnet, daß man vor der Applikation des Sol-Gel-Beschichtongsstoffs
(il) eine einschichtige Lackierang auf Basis eines
Einkomponenten(lK)-Klarlacks, Zweikomponenten(2K)- oder Mehrkomponenten(3K, 4K)-Klarlacks, Pulverklarlacks oder UV- härtbaren Klarlacks,
(i2) eine mehrschichtige effekt- und/oder farbgebende Lackierang mit einer obersten Schicht auf Basis eines Einkomponenten(lK)- Klarlacks, Zweikomponenten(2K)- oder Mehrkomponenten(3K, 4K)-Klarlacks, Pulverklarlacks oder UV-härtbaren Klarlacks, insbesondere eines Einkomponenten(lK)-Klarlacks, Zweikomponenten(2K)- oder Mehrkomponenten(3K, 4K)-
Klarlacks, oder
(i3) eine einschichtige effekt- und/oder farbgebende Lackierang auf Basis eines Zweikomponenten(2K)-Unidecklacks
appliziert und teilweise aushärtet.
14. Das Verfahren nach Ansprach 13, dadurch gekennzeichnet, daß man hierbei einen Sol-Gel-Beschichtungsstoff gemäß einem der Ansprüche 1 bis 8 verwendet.
15. Das Verfahren nach einem der Ansprüche 12 bis 14, dadurch gekennzeichnet, daß man den applizierten Sol-Gel-Beschichtungsstoff durch Bestrahlen mit mittlerer IR-Strahlung aushärtet.
16. Das Verfahren nach einem der Ansprüche 12 bis 15, dadurch gekennzeichnet, daß daß es sich bei den Lackierangen um Automobilerstlackierangen, Autoreparatorlackierangen, industrielle Lackierangen, inklusive Container Coatings, und Möbellackierangen handelt.
17. Sol-Gel-Überzüge, herstellbar aus einem Sol-Gel-Beschichtungsstoff gemäß einem der Ansprüche 1 bis 8 und/oder nach dem Verfahren gemäß einem der Ansprüche 12 bis 16.
18. Substrate, enthaltend mindestens einen Sol-Gel-Überzug gemäß Anspruch 17.
Applications Claiming Priority (3)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| DE19909894A DE19909894A1 (de) | 1999-03-06 | 1999-03-06 | Sol-Gel-Überzug für einschichtige oder mehrschichtige Lackierungen |
| DE19909894 | 1999-03-06 | ||
| PCT/EP2000/001932 WO2000053683A1 (de) | 1999-03-06 | 2000-03-06 | Sol-gel-überzug für einschichtige oder mehrschichtige lackierungen |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| EP1165700A1 true EP1165700A1 (de) | 2002-01-02 |
Family
ID=7899935
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| EP00914111A Withdrawn EP1165700A1 (de) | 1999-03-06 | 2000-03-06 | Sol-gel-überzug für einschichtige oder mehrschichtige lackierungen |
Country Status (6)
| Country | Link |
|---|---|
| US (1) | US6872765B1 (de) |
| EP (1) | EP1165700A1 (de) |
| JP (1) | JP2002538281A (de) |
| AU (1) | AU3554100A (de) |
| DE (1) | DE19909894A1 (de) |
| WO (1) | WO2000053683A1 (de) |
Families Citing this family (32)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| DE10017652C2 (de) * | 2000-04-08 | 2002-02-14 | Basf Coatings Ag | Verwendung eines Substrates als Bunttonvorlage |
| DE10063519A1 (de) * | 2000-12-20 | 2002-07-04 | Nano X Gmbh | Lösungsmittelarme Sol-Gel-Systeme |
| DE10152853A1 (de) * | 2001-10-25 | 2003-05-15 | Ntc Nano Tech Coatings Gmbh | Mischung und Verfahren zur Herstellung von vernetzten Massen auf der Grundlage von modifizierten Polysiloxanen sowie damit hergestellte Überzüge und Formkörper |
| DE10158437A1 (de) * | 2001-11-29 | 2003-06-12 | Nano X Gmbh | Beschichtung zur dauerhaften Hydrophilierung von Oberflächen und deren Verwendung |
| DE10353507A1 (de) * | 2003-11-17 | 2005-06-30 | Basf Coatings Ag | Hydrolysate und/oder Kondensate von Epoxid- und Silangruppen enthaltenden Oligomeren und Polymeren, Verfahren zu ihrer Herstellung und ihre Verwendung |
| US20080214711A1 (en) * | 2005-04-28 | 2008-09-04 | Ppg Industries Ohio, Inc. | Hard coats with a cationic acrylic polymer |
| US20060247348A1 (en) * | 2005-04-28 | 2006-11-02 | Shan Cheng | Hard coats with a cationic acrylic polymer |
| US7455886B2 (en) * | 2005-08-22 | 2008-11-25 | Eastman Kodak Company | Nanocomposite materials and an in-situ method of making such materials |
| US20070178316A1 (en) * | 2006-01-30 | 2007-08-02 | Guardian Industries Corp. | First surface mirror with sol-gel applied protective coating for use in solar collector or the like |
| US20070291384A1 (en) * | 2006-06-14 | 2007-12-20 | Guardian Industries Corp. | Method of making reflector for solar collector or the like, and corresponding product, including reflective coating designed for improved adherence to laminating layer |
| US7871664B2 (en) * | 2006-03-23 | 2011-01-18 | Guardian Industries Corp. | Parabolic trough or dish reflector for use in concentrating solar power apparatus and method of making same |
| US20070221313A1 (en) * | 2006-03-23 | 2007-09-27 | Centre Luxembourgeois De Recherches Pour Le Verre Et La Ceramique S.A. (C.R.V.C.) | Method of making reflector for solar collector or the like and corresponding product |
| US20070223121A1 (en) * | 2006-03-23 | 2007-09-27 | Centre Luxembourgeois De Recherches Pour Le Verre Et La Ceramique S.A. (C.R.V.C.) | Method of making reflector for solar collector or the like and corresponding product |
| US8814372B2 (en) | 2006-03-23 | 2014-08-26 | Guardian Industries Corp. | Stiffening members for reflectors used in concentrating solar power apparatus, and method of making same |
| US9095878B2 (en) | 2006-08-02 | 2015-08-04 | Ford Motor Company | Coating compositions and methods of applying the same |
| FI20070497A0 (fi) * | 2007-06-20 | 2007-06-20 | Valtion Teknillinen | Pinnoite ja menetelmä pinnoitteen valmistamiseksi |
| US7803343B2 (en) * | 2007-06-27 | 2010-09-28 | J.M. Huber Corporation | Silica gel manufacturing method and gels made thereby |
| US7553416B2 (en) * | 2007-06-27 | 2009-06-30 | J.M. Huber Corporation | Caustic silica gel manufacturing method and gels made thereby |
| US8596468B2 (en) * | 2007-06-27 | 2013-12-03 | J.M. Huber Corporation | Composite caustic silica gel manufacturing method and gels made thereby |
| US7884176B2 (en) * | 2007-10-05 | 2011-02-08 | Chung Shan Institute Of Science And Technology, Armaments Bureau, M.N.D. | Epoxy/modified silicon dioxide corrosion resistant nanocomposite material and preparation method thereof |
| US20100229853A1 (en) * | 2009-01-13 | 2010-09-16 | Vandal Robert A | Mounting brackets for mirrors, and associated methods |
| JP2011072895A (ja) * | 2009-09-30 | 2011-04-14 | Basf Coatings Japan Ltd | 耐すり傷性塗膜の部分補修方法 |
| US8952119B2 (en) | 2010-11-18 | 2015-02-10 | Aspen Aerogels, Inc. | Organically modified hybrid aerogels |
| WO2013171582A1 (en) * | 2012-05-16 | 2013-11-21 | Université De Haute-Alsace | Radiation curable composition, and method for preparing a hybrid sol-gel layer on a surface of a substrate using said composition |
| CN105408429B (zh) * | 2013-05-28 | 2018-10-19 | 巴斯夫涂料有限公司 | 在固化前用水性溶胶-凝胶组合物后处理浸渍漆涂层的浸渍漆涂布导电基材的方法 |
| EP3033396B1 (de) * | 2013-08-12 | 2017-11-29 | BASF Coatings GmbH | Beschichtungszusammensetzung zur tauchlack-beschichtung elektrisch leitfähiger substrate enthaltend eine sol-gel-zusammensetzung |
| US20160244882A1 (en) * | 2013-09-30 | 2016-08-25 | Basf Coatings Gmbh | Method for autophoretic coating of metallic substrates with aftertreatment of the coating with an aqueous sol-gel composition |
| MX390670B (es) * | 2013-11-18 | 2025-03-20 | Basf Coatings Gmbh | Metodo de dos etapas para el recubrimiento por inmersion de sustratos electricamente conductores utilizando una composicion que contiene bi(iii). |
| JP6140764B2 (ja) * | 2014-05-21 | 2017-05-31 | 旭化成株式会社 | 水系コーティング剤組成物、塗膜、及び塗装製品 |
| CN104946060A (zh) * | 2015-07-24 | 2015-09-30 | 深圳市粤辉煌自动化设备有限公司 | 一种新型丙烯酸电泳涂料及其制备方法 |
| CN108624264B (zh) * | 2017-03-24 | 2021-07-13 | 三星电子株式会社 | 粘附用组合物,包括其的堆叠结构和电子装置 |
| GB2635891A (en) | 2023-09-29 | 2025-06-04 | Iqs Group A S | Optical security element |
Family Cites Families (115)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| GB1284755A (en) | 1968-09-30 | 1972-08-09 | Celanese Coatings Co | Process for coating surfaces and compositions for use therein |
| US3953644A (en) | 1974-12-20 | 1976-04-27 | Ford Motor Company | Powa--method for coating and product |
| JPS534048A (en) | 1975-12-26 | 1978-01-14 | Dainippon Toryo Co Ltd | Method of forming multi-layer coating film |
| NZ186925A (en) | 1977-04-25 | 1979-12-11 | Ici Ltd | Top-coating based on a basecoat and top-coat compositions not requiring an intermediate baking operation |
| GB2012191B (en) | 1977-09-29 | 1982-03-03 | Kodak Ltd | Coating process utilising cellulose esters such as cellulose acetate butyrate |
| US4246382A (en) | 1977-11-11 | 1981-01-20 | Asahi Kasei Kogyo Kabushiki Kaisha | Solvent resistent acrylic resin and process for producing the same |
| DE2835451C2 (de) | 1978-08-12 | 1985-10-24 | Saarbergwerke AG, 6600 Saarbrücken | Verfahren zum Verfestigen von Kohle und/oder Gestein im Bergbau |
| GB2073609B (en) | 1980-04-14 | 1984-05-02 | Ici Ltd | Coating process |
| US4675234A (en) | 1980-10-01 | 1987-06-23 | Tarkett Ab | Radiation cured coating and process therefor |
| DE3278283D1 (en) | 1981-01-09 | 1988-05-05 | Johnson & Son Inc S C | Process for continuous bulk copolymerization of vinyl monomers and product thereof |
| DE3126549A1 (de) | 1981-07-04 | 1983-01-20 | Bollig & Kemper, 5000 Köln | Verfahren zur herstellung von stabilen waessrigen dispersionen und deren verwendung als bindemittel zur herstellung von lacken, insbesondere zweischicht-metalleffektlacksystemen |
| DE3210051A1 (de) | 1982-03-19 | 1983-09-29 | Basf Farben + Fasern Ag, 2000 Hamburg | Wasserverduennbares ueberzugsmittel zur herstellung der basisschicht eines mehrschichtueberzuges |
| DE3333072A1 (de) | 1983-09-14 | 1985-03-21 | Basf Farben + Fasern Ag, 2000 Hamburg | Ueberzugsmasse, verfahren zur herstellung von ueberzuegen und beschichtetes substrat |
| DE3407087C2 (de) | 1984-02-27 | 1994-07-07 | Fraunhofer-Gesellschaft zur Förderung der angewandten Forschung e.V., 8000 München | Verfahren und Lack zur Herstellung von kratzfesten Beschichtungen |
| US4719132A (en) | 1984-09-21 | 1988-01-12 | Ppg Industries, Inc. | Process for the preparation of multi-layered coatings and coated articles derived therefrom |
| AT381499B (de) | 1985-02-27 | 1986-10-27 | Vianova Kunstharz Ag | Wasserverduennbare ueberzugsmittel, verfahren zur herstellung und ihre verwendung fuer basisschichtenbei zweischicht-decklackierung |
| DE3545618A1 (de) | 1985-12-21 | 1987-06-25 | Basf Lacke & Farben | Wasserverduennbares ueberzugsmittel zur herstellung der basisschicht eines mehrschichtueberzuges |
| US4754014A (en) | 1986-01-06 | 1988-06-28 | E. I. Du Pont De Nemours And Company | Polysiloxane graft copolymers, flexible coating compositions comprising same and branched polysiloxane macromers for preparing same |
| FR2603590B1 (fr) | 1986-02-25 | 1991-05-24 | Kansai Paint Co Ltd | Procede de preparation d'une resine contenant un polysiloxane |
| DE3606512A1 (de) | 1986-02-28 | 1987-09-03 | Basf Lacke & Farben | Dispersionen von vernetzten polymermikroteilchen in waessrigen medien, verfahren zur herstellung dieser dispersionen und beschichtungszusammensetzungen, die diese dispersionen enthalten |
| DE3606513C2 (de) | 1986-02-28 | 1998-05-07 | Basf Coatings Ag | Dispersionen von vernetzten Polymermikroteilchen in wäßrigen Medien und Verfahren zur Herstellung dieser Dispersionen |
| EP0249201A3 (de) | 1986-06-10 | 1989-07-19 | Union Carbide Corporation | Ablaufbeständige und hohen Feststoff enthaltende cycloalifatische Epoxydharzbeschichtungsmasse, die Polymere mit niedrigem Molekulargewicht und hohem Tg als ablaufwiderstandsfähiges Additiv enthalten |
| DE3628124A1 (de) | 1986-08-19 | 1988-03-03 | Herberts Gmbh | Waessriges ueberzugsmittel, verfahren zu seiner herstellung und dessen verwendung |
| DE3628125A1 (de) | 1986-08-19 | 1988-03-03 | Herberts Gmbh | Waessriges ueberzugsmittel, verfahren zu seiner herstellung und dessen verwendung |
| EP0320552A1 (de) | 1987-12-18 | 1989-06-21 | E.I. Du Pont De Nemours And Company | Verfahren zur Verbesserung des Aussehens eines mehrschichtigen Überzugs |
| NO170944C (no) | 1987-01-24 | 1992-12-30 | Akzo Nv | Fortykkede, vandige preparater, samt anvendelse av slike |
| JPS63221123A (ja) | 1987-03-09 | 1988-09-14 | Kansai Paint Co Ltd | 低温硬化性樹脂組成物 |
| US4791168A (en) | 1987-04-15 | 1988-12-13 | Basf Corporation, Inmont Division | Polyurethane resins in water-dilutable basecoats having low flash and quick-drying characteristics |
| DE3814853A1 (de) | 1987-05-02 | 1988-11-10 | Kansai Paint Co Ltd | Beschichtungsverfahren |
| DE3722005A1 (de) | 1987-07-03 | 1989-01-12 | Herberts Gmbh | Verfahren zur herstellung eines mehrschichtueberzuges und hierfuer geeignetes waessriges ueberzugsmittel |
| US4794147A (en) | 1987-07-24 | 1988-12-27 | Basf Corporation, Inmont Division | Novel non-ionic polyurethane resins having polyether backbones in water-dilutable basecoats |
| DE3825278A1 (de) | 1988-07-26 | 1990-02-01 | Basf Lacke & Farben | Verfahren zur herstellung von mehrschichtigen, schuetzenden und/oder dekorativen ueberzuegen auf substratoberflaechen |
| DE3828098A1 (de) | 1988-08-18 | 1990-03-08 | Fraunhofer Ges Forschung | Verfahren und zusammensetzung zur herstellung von kratzfesten materialien |
| JP2668083B2 (ja) | 1988-09-05 | 1997-10-27 | 関西ペイント株式会社 | 自動車用塗料組成物 |
| DE3835968A1 (de) | 1988-10-21 | 1990-06-21 | Fraunhofer Ges Forschung | Verfahren zur herstellung von materialien mit einem strukturierten ueberzug |
| DE3836815A1 (de) | 1988-10-28 | 1990-07-26 | Hofmann Klaus Dipl Chem | Verfahren und zusammensetzung zur herstellung von kratzfesten materialien, insbesondere beschichtungen mit verbesserter elastizitaet und haftung |
| DE3903804C2 (de) | 1989-02-09 | 2001-12-13 | Bollig & Kemper | Wäßrige Lackdispersionen und deren Verwendung |
| US4978708A (en) | 1989-04-25 | 1990-12-18 | Basf Corporation | Aqueous-based coating compositions comprising anionic polyurethane principal resin and anionic acrylic grind resin |
| NZ233481A (en) | 1989-05-30 | 1992-04-28 | Ppg Industries Inc | Water-based coating compositions having reduced organic solvent content comprising an aqueous dispersion of hydrophobic polymer microparticles |
| US5169719A (en) | 1989-10-06 | 1992-12-08 | Basf Corporation | Nonionically and partially anionically stabilized water-dispersible polyurethane/acrylic graft copolymers |
| DE4000748A1 (de) | 1990-01-12 | 1991-07-18 | Hoechst Ag | Waessrige ueberzugsmasse, deren herstellung und verwendung |
| DE4006832A1 (de) | 1990-03-05 | 1991-09-12 | Basf Lacke & Farben | Verfahren zur herstellung einer mehrschichtigen lackierung und waessriger lack |
| US5601880A (en) | 1990-03-28 | 1997-02-11 | Basf Lacke & Farben, Ag | Process for the production of a multicoat finish and aqueous basecoat suitable for this process |
| DE4009858C2 (de) | 1990-03-28 | 1998-02-05 | Basf Lacke & Farben | Wäßriger pigmentierter Basislack enthaltend als Bindemittel ein wasserverdünnbares Polyacrylatharz und Verwendung eines solchen Basislacks |
| DE4010176A1 (de) | 1990-03-30 | 1991-10-02 | Basf Lacke & Farben | Verfahren zur herstellung einer mehrschichtigen lackierung und waessriger lack |
| DE4011044A1 (de) | 1990-04-05 | 1991-10-10 | Fraunhofer Ges Forschung | Silane, verfahren zu ihrer herstellung und ihre verwendung zur herstellung von polymerisaten und polykondensaten |
| DE4011045A1 (de) | 1990-04-05 | 1991-10-10 | Fraunhofer Ges Forschung | Verfahren zum beschichten von kunststoffsubstraten und lack zur verwendung in diesem verfahren |
| DE4020316B4 (de) | 1990-06-26 | 2004-07-08 | Fraunhofer-Gesellschaft zur Förderung der angewandten Forschung e.V. | Verfahren zur Herstellung eines Lacks und dessen Verwendung |
| DE4025215C2 (de) | 1990-08-09 | 1994-03-10 | Fraunhofer Ges Forschung | Verfahren zur Herstellung eines Lacks und seine Verwendung zum Beschichten von Substraten mit einem alkalistabilen und abriebbeständigen Überzug |
| DE4107136A1 (de) | 1991-03-06 | 1992-09-10 | Basf Lacke & Farben | Verfahren zur herstellung einer mehrschichtigen, schuetzenden und/oder dekorativen lackierung |
| US5236995A (en) | 1991-03-26 | 1993-08-17 | Basf Corporation | Post-extended anionic polyurethane dispersion |
| DE4119857A1 (de) | 1991-06-17 | 1992-12-24 | Basf Lacke & Farben | Ueberzugsmittel auf der basis von carboxylgruppenhaltigen polymeren und epoxidharzen |
| DE4122265A1 (de) | 1991-07-05 | 1993-01-07 | Hoechst Ag | Polyurethan-dispersionen |
| DE4122266A1 (de) | 1991-07-05 | 1993-01-07 | Hoechst Ag | Polyurethan-dispersionen |
| DE4122743C1 (de) | 1991-07-10 | 1992-11-26 | Fraunhofer-Gesellschaft Zur Foerderung Der Angewandten Forschung Ev, 8000 Muenchen, De | |
| DE4123860A1 (de) | 1991-07-18 | 1993-01-21 | Herberts Gmbh | Waessriges ueberzugsmittel und dessen verwendung |
| US5385988A (en) | 1991-09-24 | 1995-01-31 | Mitsubishi Rayon Co., Ltd. | Composite composition having high transparency and process for producing same |
| DE4133704A1 (de) | 1991-10-11 | 1993-04-15 | Herberts Gmbh | Katalysatorfreies einkomponenten-ueberzugsmittel und dessen verwendung zur herstellung von saeurebestaendigen lackierungen |
| DE4133290A1 (de) | 1991-10-08 | 1993-04-15 | Herberts Gmbh | Verfahren zur herstellung von mehrschichtlackierungen unter verwendung von radikalisch und/oder kationisch polymerisierbaren klarlacken |
| CA2088129A1 (en) | 1992-02-06 | 1993-08-07 | Fritz Erdmann Kempter | Continuous polymerization of vinyl monomers |
| DE4204518A1 (de) | 1992-02-15 | 1993-08-19 | Basf Lacke & Farben | Verfahren zur herstellung einer zweischichtigen lackierung und fuer dieses verfahren geeignete nicht-waessrige lacke |
| US5221329A (en) | 1992-04-20 | 1993-06-22 | The Boeing Company | Water repellent composition |
| DE4215070A1 (de) | 1992-05-07 | 1993-11-11 | Herberts Gmbh | Verfahren zur Herstellung von Mehrschichtlackierungen |
| US5262362A (en) | 1992-06-22 | 1993-11-16 | The United States Of America As Represented By The Secretary Of The Navy | Coatings for SiO2 optical fibers |
| DE4222194A1 (de) | 1992-07-07 | 1994-01-13 | Basf Lacke & Farben | Verfahren zur Herstellung einer zweischichtigen Lackierung und für dieses Verfahren geeignete Pulverlacke |
| DE4224617A1 (de) | 1992-07-25 | 1994-01-27 | Herberts Gmbh | Wäßriges Überzugsmittel, Verfahren zu dessen Herstellung und dessen Verwendung bei Verfahren zur Mehrschichtlackierung |
| DE4228510A1 (de) | 1992-08-27 | 1994-03-03 | Herberts Gmbh | Wäßrige Polyurethanharzdispersion, Verfahren zu deren Herstellung und deren Verwendung in wäßrigen Überzugsmitteln |
| US5412016A (en) | 1992-09-28 | 1995-05-02 | E. I. Du Pont De Nemours And Company | Process for making polymeric inorganic-organic compositions |
| US5326815A (en) | 1992-09-29 | 1994-07-05 | Basf Corporation | Polyurethane coating composition derived from polyester polyol containing long-chain aliphatic polyol |
| US5356669A (en) | 1992-10-23 | 1994-10-18 | Basf Corporation | Composite color-plus-clear coating utilizing carbamate-functional polymer composition in the clearcoat |
| US5300328A (en) | 1992-10-23 | 1994-04-05 | Basf Corporation | Partially-defunctionalized aminoplast curing for polymer compositions |
| ZA937635B (en) | 1992-10-23 | 1994-05-05 | Basf Corp | Curable carbamate-functional polymer composition |
| US5605965A (en) | 1992-10-23 | 1997-02-25 | Basf Corporation | High gloss and/or high DOI coating utilizing carbamate-functional polymer composition |
| TW242644B (de) | 1992-10-30 | 1995-03-11 | Ppg Industries Inc | |
| US6103816A (en) | 1992-10-30 | 2000-08-15 | Ppg Industries Ohio, Inc. | Aqueous aminoplast curable film-forming compositions providing films having resistance to acid etching |
| JP2672031B2 (ja) | 1992-10-30 | 1997-11-05 | ピーピージー インダストリーズ,インコーポレイテッド | 耐酸エッチング性を有する塗膜を与えるアミノプラスト硬化可能な塗膜形成組成物 |
| DE4237492A1 (de) | 1992-11-06 | 1994-05-11 | Herberts Gmbh | Wäßrige Bindemittelzusammensetzung, diese enthaltende Überzugsmittel und deren Verwendung |
| DE4237490A1 (de) | 1992-11-06 | 1994-05-11 | Herberts Gmbh | Überzugsmittel und dessen Verwendung zur Herstellung von säurebeständigen Lackierungen |
| DE4303570C2 (de) | 1993-02-08 | 1997-03-20 | Fraunhofer Ges Forschung | Verfahren zur Herstellung von funktionellen Beschichtungen, beschichtete Substrate und Beschichtungsmaterial |
| DE4310414A1 (de) | 1993-03-31 | 1994-10-06 | Basf Lacke & Farben | Verfahren zur Herstellung einer zweischichtigen Decklackierung auf einer Substratoberfläche |
| DE4310413A1 (de) | 1993-03-31 | 1994-10-06 | Basf Lacke & Farben | Nichtwäßriger Lack und Verfahren zur Herstellung einer zweischichtigen Decklackierung |
| DE4320969A1 (de) | 1993-06-24 | 1995-01-05 | Basf Lacke & Farben | Verfahren zur Herstellung von Polyurethanharzen und deren Verwendung sowie die Verwendung von Ethoxyethylpropionat zur Herstellung von Polyurethanharzen |
| CA2127761C (en) | 1993-07-16 | 2005-10-18 | Armin Gobel | An aqueous dispersion of polyurethane resins, a method of manufacturing them, coating agents containing them and use thereof |
| DE4336206A1 (de) | 1993-10-23 | 1995-04-27 | Hoechst Ag | Wäßrige selbstvernetzende Polyurethan-Vinyl-Hybrid-Dispersionen |
| DE4339870A1 (de) | 1993-11-23 | 1995-05-24 | Basf Lacke & Farben | Verfahren zur Herstellung einer zweischichtigen Lackierung und wäßrige Lacke |
| DE4406547A1 (de) | 1994-02-28 | 1995-08-31 | Herberts Gmbh | Wäßrige Polyurethanharzdispersion, deren Herstellung und hierzu geeignete Polyurethanmakromere, und ihre Verwendung in wäßrigen Überzugsmitteln |
| US5447998A (en) | 1994-04-08 | 1995-09-05 | E. I. Du Pont De Nemours And Company | Clear coat resins by continuous polymerization |
| DE4413737A1 (de) | 1994-04-21 | 1995-10-26 | Herberts Gmbh | Wäßrige Dispersion auf der Basis von Polymer/Polyurethan-Harzen, Verfahren zu deren Herstellung, Überzugsmittel und deren Verwendung |
| DE4416857C1 (de) | 1994-05-13 | 1995-06-29 | Fraunhofer Ges Forschung | Hydrolysierbare und polymerisierbare Silane, Verfahren zu deren Herstellung sowie deren Verwendung |
| DE4421823A1 (de) | 1994-06-22 | 1996-01-04 | Basf Lacke & Farben | Aus mindestens 3 Komponenten bestehendes Beschichtungsmittel, Verfahren zu seiner Herstellung sowie seine Verwendung |
| DE4437535A1 (de) | 1994-10-20 | 1996-04-25 | Basf Lacke & Farben | Polyurethanmodifziertes Polyacrylat |
| US5670257A (en) | 1994-11-15 | 1997-09-23 | Nippon Shokubai Co., Ltd. | Organic-inorganic composite particles and production process therefor |
| ZA962618B (en) | 1995-04-10 | 1996-10-11 | Basf Lacke & Farben | Aqueous dispersion of transparent powder lacquers |
| US5654691A (en) | 1995-05-12 | 1997-08-05 | Wang; Randall | Auxiliary backup device of burglary alarm system |
| CA2220465A1 (en) | 1995-05-19 | 1996-11-28 | Basf Lacke + Farben Aktiengesellschaft | Aqueous powder coating dispersion |
| DE19524182A1 (de) | 1995-07-03 | 1997-01-09 | Basf Ag | Verfahren und Vorrichtung zur kontinuierlichen Herstellung von Polymeren |
| WO1997012945A1 (en) | 1995-10-06 | 1997-04-10 | Cabot Corporation | Aqueous thixotropes for waterborne systems |
| US5690569A (en) | 1996-03-13 | 1997-11-25 | Borg-Warner Automotive, Inc. | Single piece reinforced chain guide |
| US5965213A (en) | 1996-04-04 | 1999-10-12 | Basf Coatings Ag | Aqueous dispersions of a transparent powder coating |
| US5739194A (en) | 1996-06-24 | 1998-04-14 | Ppg Industries, Inc. | Humidity resistant aqueous urethane/acrylic resins and coating compositions |
| US5728769A (en) | 1996-06-24 | 1998-03-17 | Ppg Industries, Inc. | Aqueous urethane resins and coating compositins having enhanced humidity resistance |
| US5853809A (en) | 1996-09-30 | 1998-12-29 | Basf Corporation | Scratch resistant clearcoats containing suface reactive microparticles and method therefore |
| US5789085A (en) * | 1996-11-04 | 1998-08-04 | Blohowiak; Kay Y. | Paint adhesion |
| US5973068A (en) | 1996-11-07 | 1999-10-26 | Shin-Etsu Chemical Co., Ltd. | Silicone resin-containing emulsion composition, method for making same, and article having a cured film of same |
| DE19709465C2 (de) | 1997-03-07 | 2001-07-12 | Basf Coatings Ag | Beschichtungsmittel, Verfahren zur Herstellung von Mehrschichtlackierungen und Verwendung der Beschichtungsmittel hierfür |
| DE19715426A1 (de) | 1997-04-14 | 1998-10-15 | Bayer Ag | Blockierte Isocyanatgruppen aufweisende kolloidale Metalloxide |
| US5989687A (en) | 1997-12-09 | 1999-11-23 | Ppg Industries Ohio, Inc. | Inkjet printing media comprising the polymerization reaction product of the hydrolyzate of an aluminum alkoxide and an organoalkoxysilane |
| JP2003527449A (ja) | 1998-04-01 | 2003-09-16 | ビーエーエスエフ コーティングス アクチェンゲゼルシャフト | 非イオン的に安定化された粉末クリヤラッカー分散液 |
| DE19912661A1 (de) | 1998-04-01 | 1999-11-18 | Basf Coatings Ag | Nicht-ionisch stabilisierte Pulverlack-Dispersion |
| DE19816136A1 (de) | 1998-04-09 | 1999-10-14 | Inst Neue Mat Gemein Gmbh | Nanostrukturierte Formkörper und Schichten und deren Herstellung über stabile wasserlösliche Vorstufen |
| DE19843581C2 (de) * | 1998-09-23 | 2002-11-14 | Basf Coatings Ag | Verfahren zur Herstellung lackierter Substrate sowie entsprechend lackierte Substrate und deren Verwendung |
| DE19856000A1 (de) | 1998-12-04 | 2000-06-15 | Bayer Ag | Hybridlack-Zubereitung |
| DE19910876C2 (de) | 1999-03-11 | 2003-07-17 | Fraunhofer Ges Forschung | Verfahren zur Herstellung einer bewitterungsbeständigen Beschichtung |
| DE19940857A1 (de) | 1999-08-27 | 2001-03-01 | Basf Coatings Ag | Sol-Gel-Überzug für einschichtige oder mehrschichtige Lackierungen |
| DE10245729A1 (de) | 2002-10-01 | 2004-04-15 | Bayer Ag | Beschichtungszusammensetzung und Verfahren zu deren Herstellung |
-
1999
- 1999-03-06 DE DE19909894A patent/DE19909894A1/de not_active Withdrawn
-
2000
- 2000-03-06 JP JP2000603314A patent/JP2002538281A/ja active Pending
- 2000-03-06 US US09/914,937 patent/US6872765B1/en not_active Expired - Fee Related
- 2000-03-06 WO PCT/EP2000/001932 patent/WO2000053683A1/de not_active Ceased
- 2000-03-06 AU AU35541/00A patent/AU3554100A/en not_active Abandoned
- 2000-03-06 EP EP00914111A patent/EP1165700A1/de not_active Withdrawn
Non-Patent Citations (1)
| Title |
|---|
| See references of WO0053683A1 * |
Also Published As
| Publication number | Publication date |
|---|---|
| WO2000053683A1 (de) | 2000-09-14 |
| JP2002538281A (ja) | 2002-11-12 |
| DE19909894A1 (de) | 2000-09-07 |
| AU3554100A (en) | 2000-09-28 |
| US6872765B1 (en) | 2005-03-29 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| EP1165700A1 (de) | Sol-gel-überzug für einschichtige oder mehrschichtige lackierungen | |
| EP1208171B1 (de) | Sol-gel-überzug | |
| EP1115504B1 (de) | Kratzfester sol-gel-überzug für pulverslurry-klarlacke | |
| EP1208170B1 (de) | Sol-gel-überzug | |
| EP1135424A1 (de) | Aus mindestens drei komponenten bestehendes beschichtungsmittel, verfahren zu seiner herstellung sowie seine verwendung | |
| WO2000044839A1 (de) | Aus mindestens vier komponenten bestehendes beschichtungsmittel, verfahren zu seiner herstellung sowie seine verwendung | |
| WO2000044834A1 (de) | Wässriger beschichtungsstoff und modulsystem zu seiner herstellung | |
| WO2000032667A1 (de) | Aus mindestens drei komponenten bestehendes beschichtungsmittel, verfahren zu seiner herstellung sowie seine verwendung | |
| EP1165646A1 (de) | Aus mindestens drei komponenten bestehender beschichtungsstoff, verfahren zu seiner herstellung sowie seine verwendung | |
| EP1187885B1 (de) | Mit nanopartikeln modifizierte bindemittel für überzugsmittel und deren verwendung | |
| WO2000032665A1 (de) | Aus mindestens drei komponenten bestehendes beschichtungsmittel, verfahren zu seiner herstellung sowie seine verwendung | |
| EP1163299A2 (de) | Sol-gel-überzug für einschichtige oder mehrschichtige lackierungen | |
| DE19908627C2 (de) | Überzugsmittel und deren Verwendung bei der Mehrschichtlackierung | |
| EP1163303B1 (de) | Die verwendung von tricyclodecandimethanol zur herstellung von mehrschichtlackierungen | |
| WO2002064659A1 (de) | Wässriger mehrkomponentenbeschichtungsstoff, verfahren zu seiner herstellung und seine verwendung | |
| EP1155062A1 (de) | Beschichtungsmittel und verfahren zu dessen herstellung | |
| EP1554323A1 (de) | Phosphonsäuremodifizierte mikrogeldispersion | |
| EP1189996A1 (de) | Vergilbungsarme wässrige pulverklarlack-dispersionen und ihre verwendung | |
| WO2005014678A1 (de) | Phosphonsäuremodifizierte mikrogeldispersion | |
| DE10004750A1 (de) | Die Verwendung von Tricyclodecandimethanol zur Herstellung von Mehrschichtlackierungen | |
| DE10247847A1 (de) | Phosphonsäuremodifizierte Mikrogeldispersion |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| PUAI | Public reference made under article 153(3) epc to a published international application that has entered the european phase |
Free format text: ORIGINAL CODE: 0009012 |
|
| 17P | Request for examination filed |
Effective date: 20010726 |
|
| AK | Designated contracting states |
Kind code of ref document: A1 Designated state(s): AT BE CH CY DE DK ES FI FR GB GR IE IT LI LU MC NL PT SE |
|
| 17Q | First examination report despatched |
Effective date: 20030919 |
|
| GRAP | Despatch of communication of intention to grant a patent |
Free format text: ORIGINAL CODE: EPIDOSNIGR1 |
|
| STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: THE APPLICATION IS DEEMED TO BE WITHDRAWN |
|
| 18D | Application deemed to be withdrawn |
Effective date: 20040414 |