EP0861325A1 - Verfahren zur herstellung von peptiden über streptavidin-fusionsproteine - Google Patents

Verfahren zur herstellung von peptiden über streptavidin-fusionsproteine

Info

Publication number
EP0861325A1
EP0861325A1 EP96938115A EP96938115A EP0861325A1 EP 0861325 A1 EP0861325 A1 EP 0861325A1 EP 96938115 A EP96938115 A EP 96938115A EP 96938115 A EP96938115 A EP 96938115A EP 0861325 A1 EP0861325 A1 EP 0861325A1
Authority
EP
European Patent Office
Prior art keywords
peptide
fusion protein
pth
seq
streptavidin
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Withdrawn
Application number
EP96938115A
Other languages
English (en)
French (fr)
Inventor
Erhard Kopetzki
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Roche Diagnostics GmbH
Original Assignee
Roche Diagnostics GmbH
Boehringer Mannheim GmbH
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Roche Diagnostics GmbH, Boehringer Mannheim GmbH filed Critical Roche Diagnostics GmbH
Publication of EP0861325A1 publication Critical patent/EP0861325A1/de
Withdrawn legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/575Hormones
    • C07K14/58Atrial natriuretic factor complex; Atriopeptin; Atrial natriuretic peptide [ANP]; Cardionatrin; Cardiodilatin
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/195Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
    • C07K14/36Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria from Actinomyces; from Streptomyces (G)
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/575Hormones
    • C07K14/635Parathyroid hormone, i.e. parathormone; Parathyroid hormone-related peptides
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/11DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
    • C12N15/62DNA sequences coding for fusion proteins
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/20Fusion polypeptide containing a tag with affinity for a non-protein ligand
    • C07K2319/22Fusion polypeptide containing a tag with affinity for a non-protein ligand containing a Strep-tag
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/50Fusion polypeptide containing protease site
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/70Fusion polypeptide containing domain for protein-protein interaction
    • C07K2319/74Fusion polypeptide containing domain for protein-protein interaction containing a fusion for binding to a cell surface receptor
    • C07K2319/75Fusion polypeptide containing domain for protein-protein interaction containing a fusion for binding to a cell surface receptor containing a fusion for activation of a cell surface receptor, e.g. thrombopoeitin, NPY and other peptide hormones

Definitions

  • the invention relates to a process for the recombinant production of peptides by expression of fusion proteins with streptavidin and subsequent enzymatic cleavage of the fusion protein
  • Peptides are usually understood to mean substances which consist of up to about 100 amino acids.
  • the production of such peptides is either chemical (Kent, SBH et al (1988) (I), Hodson, JH, (1993) (2) or recombinant ( Kopetzki, E et al (1994) (3) Winnacker, E -L (1987) (4), Harris, TJR (1983) (5))
  • peptides can be used for the recombinant production of peptides.
  • direct expression in the cytoplasm of microorganisms or cell lines can take place.However, this requires a minimum polypeptide length of approx. 80 to 100 amino acids. Smaller peptides are not stable and are broken down by proteolysis As a rule, an additional N-terminal methionine and the yields are very low
  • the object of the present invention is to provide a method by means of which peptides can be made available via streptavidin fusion proteins in high yield and purity with complete separation from the streptavidin portion
  • the object is achieved according to the invention by a process for the recombinant production of a peptide by expression of a DNA in microorganisms, preferably prokaryotes, which codes for a fusion protein of streptavidin and the peptide mentioned, streptavidin and peptide via a peptide sequence which can be cleaved by an endoproteinase, isolation of the insoluble, inactive fusion protein, solubilization of the inactive fusion protein with a denaturing agent, dilution of the denaturing agent at a pH value between 8.5 and 11 until the fusion protein can be cleaved by an endoproteinase, cleavage of the fusion protein, Lower the pH until the cleaved streptavidin and uncleaved fusion protein precipitate and purify the desired peptide from the supernatant
  • streptavidin fusion proteins can be expressed very well in prokaryotes and can be isolated in the form of insoluble inactive proteins (inclusion bodies). Streptavidin fusion proteins solubilized in denaturing agents can be diluted so far at pH values above 8.5 that they can be digested with an endoproteinase without precessing
  • the fusion protein does not have to be renatured to the active protein.
  • the released streptavidin and possibly not cleaved streptavidin fusion protein can be separated from the desired peptide by precipitation at pH values below 6
  • the method according to the invention is suitable for producing a large number of short-chain peptides.
  • the method is suitable for the production of natriuretic peptides and parathyroid hormone peptides.
  • Natriuretic peptides are peptides with natriuretic activity, which are formed in the cardiac ventricle, the adrenal gland and the brain from a precursor polypeptide (prohormone) and have a ring of 17 amino acids as structural element, which is separated by a disulfide bridge between two Cysteine residues is formed.
  • Precursor polypeptides are e.g. B. the "atriaT natriuretic peptide (ANP 1-126) or cardiodilatin (CCD 1-126) and the" brain "natriuretic peptides of the B and C type.
  • Preferred NP peptides are derived from the" human ⁇ atrial -natriuretic peptide "(h ⁇ ANP).
  • the C-terminal h ⁇ ANP fragments of amino acids 95-126, 99-126 and 102-126 are particularly preferred.
  • Urodilatin (CDD 95-126) is a natriuretic peptide which can be obtained from human urine (Forssmann, K. et al. (1988) (23).
  • the peptide has a length of 32 amino acids and forms a ring from 17 amino acids through the formation of a disulfide bridge between two cysteine residues and belongs to the cardiodilatin / "atriar -natriuretic peptide (CDD / ANP) family.
  • ⁇ -ANP 99-126
  • Urodilatin (CCD 95 - 126) is probably created in vivo by cleavage of this propeptide between amino acids 94 and 95.
  • the approximately 3.5 kDa urodilatin peptide differs from ⁇ -ANP (99 - 126) -Peptide through a 4-amino acid extension at the N-terminus
  • the amino acid sequence and the structure of urodilatin are described, for example, in Drummer, C. et al. (1993) (24)
  • Urodilatin binds to the membrane-bound ANP receptors A and B. and activates an intracellular guanylate cycla coupled to the receptor This causes the formation of the "second messenger" cGMP, which mediates the diuretic and natriuretic effects in the kidney and the relaxing effect on the smooth vascular muscles. (Heim, J.M. (1989) (25)).
  • Urodilatin is thus a preferred therapeutic agent for the prophylaxis and therapy of acute kidney failure, e.g. B. in patients after heart or liver transplants.
  • B. kidney failure
  • Urodilatin is thus a preferred therapeutic agent for the prophylaxis and therapy of acute kidney failure, e.g. B. in patients after heart or liver transplants.
  • parathyroid hormone parathyroid hormone
  • the method according to the invention for producing parathyroid hormone (PTH) and its fragments can also be used advantageously.
  • the DNA and amino acid sequence of PTH is described, for example, in Rokkones, E. et al. (1994) (16).
  • the human parathyroid gene codes for a pre-pro-PTH protein of 115 amino acids. After splitting off the signal sequence and the prosegement, the matured PTH hormone has 84 amino acids (PTH 1 - 84). It has been shown that PTH, which is produced recombinantly in E. coli and S. cerevisiae, is unstable and degrades rapidly.
  • the production of PTH fusion proteins is described by Forsberg, G. et al. (1991) (17).
  • a nucleic acid is produced which codes for a fusion protein from mature PTH (1-84) and a 15 kD IgG binding protein.
  • a cleavage site for thrombin or subtilisin is inserted between the two protein parts.
  • This fusion protein is also unstable and is already degraded to a considerable extent when expressed in E. coli.
  • the degradation of PTH (1-84) could not be prevented even by secretion of the mature PTH (1-84) hormone into the periplasm of E.coli using the protein A signal sequence.
  • the half-life of PTH (1 - 84) in E. coli is only a few minutes.
  • the fusion proteins can be cleaved enzymatically with a specifically cleaving proteinase (restriction proteinase).
  • the proteinase is selected taking into account the amino acid sequence of the peptide to be produced. Care should be taken to ensure that the recognition / cleavage sequence of the restriction proteinase does not occur in the desired peptide and preferably not in the carrier portion (streptavidin portion) of the fusion protein, ie it should only occur once in the cleavage region (linker region).
  • cleaving endoproteinases z. B.
  • enterokinase factor Xa, thrombin, subtilisin BPN variants / ubiquitin protein peptidase, renin, collagenase, trypsin, chymotrypsin, endoproteinase Lys-C, Kallekrein (Carter, P., (12)), TEV proteinase (Parks, TD et al ., Anal. Biochem. 216 (1994) 413-417) (36), IgA proteinase (Pohlner, J. et al., Nature 325 (1987) 458-462) (37), Kex2p proteinase (EP-A 0467 839) (38) or S. aureus V8 proteinase.
  • Endoproteinase LysC which specifically cleaves proteins and peptides at the C-terminal end of lysine, is preferably used.
  • Such an enzyme is known, for example, from fungi or bacteria (DE 30 34 045 C2).
  • Endoproteinase LysC is particularly well suited for the production of peptides that do not contain a lysine residue, such as. B. Urodilatin.
  • a peptide sequence which can be cleaved by an endoproteinase is a short-chain peptide sequence which preferably consists of 5-15 amino acids and which contains a cleavage site for the desired endoproteinase at the C-terminal.
  • This N-terminal linker preferably contains, in addition to the desired endoproteinase recognition sequence, a combination of several amino acids, selected from the amino acids Gly, Thr, Ser, Ala, Pro, Asp, Glu, Arg and Lys.
  • a linker is particularly preferably used in which 2-8 of these additional amino acids are the negatively charged amino acids Asp and / or Glu.
  • Streptavidin for example, as described in EP-B 0 198 015 (7) and EP-A 0 612 325 (8), can be used as streptavidin.
  • Other streptavidin derivatives or fragments as described for example by Sano, T. et al., (9), are also suitable.
  • a streptavidin which is truncated (shortened) at the N-terminus and / or C-terminus is preferably used. This prevents aggregation and proteolysis (Sano, T. et al., (9)).
  • a streptavidin is preferably used which begins with amino acids 10-20 and ends with amino acids 130-140 (numbering analogously: Argarana, C.E. et al. (1986) (33)).
  • a streptavidin of amino acids 16-133 or 13-139 is particularly preferably used.
  • the fusion proteins are produced by expressing a DNA (nucleic acid sequence) which codes for the fusion protein in microorganisms, preferably in prokaryotes.
  • a DNA nucleic acid sequence
  • the expression vector used should not contain any elements which mediate secretion of the protein into the medium.
  • a DNA suitable for expression can preferably be produced synthetically. Such methods are known to the person skilled in the art common and described, for example, in Beattie, KL and Fowler, RF (1991) (34), EP-B 0 424 990 (35), Itakura, K et al (1977) (20).
  • the nucleic acid sequence of the proteins according to the invention can be appropriately modified Such modifications are, for example
  • Fusion proteins can be found both in prokaryotes and in other cells, for example in eukaryotic host cells such as yeasts (for example Saccharomyces, Pichia, Hansenula and Kluyveromyces) and fungi such as Aspergillis and Trichoderma in the form of insoluble protein aggregates, so-called "inclusion bodies" (IBs ), Inclusion bodies occur when the rate of synthesis of the protein in the cell is greater than the rate of folding to the active native protein. In this case, the protein aggregates in the cell, preferably in the cytoplasm. There the protein becomes denatured, compressed and insoluble Form deposited in the cell. As a result, the cell experiences as little interference as possible with its other cell functions
  • Suitable prokaryotic host organisms are, for example, Escherichia, Streptomyces or Bacillus.
  • the microorganisms preferably prokaryotes, are transformed in the usual way with the vector which contains the DNA coding for the fusion protein, and then fermented in the usual manner.
  • the insoluble, inactive protein (IBs) is isolated from the cells in a conventional manner, for example by centrifugation (pellet fraction). Protein aggregates can be obtained by washing the pellet with z.
  • B. detergent-containing buffers are further enriched.
  • the IBs are treated with a denaturing agent, e.g. Guanidine hydrochloride, urea or a urea derivative (see, for example, US Pat. No. 5,453,363) is solubilized and transferred to a suitable non-denaturing buffer (pH> 8.5) by dilution or dialysis.
  • a denaturing agent e.g. Guanidine hydrochloride, urea or a urea derivative (see, for example, US Pat. No. 5,453,363) is solubilized and transferred to a suitable non-denaturing buffer (pH> 8.5) by dilution or dialysis.
  • the dilution is carried out in such a way that the remaining denaturing agent does not significantly affect the enzymatic hydrolysis of the fusion protein.
  • the dilution is preferably carried out in a pulsed manner, for example by dropping the IB solubilizate in buffer (pH> 8.5) which contains no denaturing agent.
  • Such a pulse-like dilution enables a practically simultaneous removal of the effect of the denaturing agent and separation of the molecules to be solubilized. This largely avoids an undesired intermolecular interaction (aggregation) of the molecules to be solubilized.
  • the fusion proteins produced by the process according to the invention are not broken down in the host cells and can be completely cleaved enzymatically without any significant cleavage taking place in the peptide portion itself (for example PTH or urodilatin).
  • the method according to the invention is particularly suitable for the production of urodilatin, parathyroid hormone and their fragments.
  • the urodilatin fragments of amino acids 95-126, 99-126 or 102-126 and the parathyroid fragment of amino acids 1-37 are particularly preferably produced.
  • Example 1 shows the DNA segments A and B obtained according to Example 1.
  • the expression vector for the core-SA-URO (95-126) fusion gene with endoproteinase LysC cleavage site is based on the expression vector pSAM-CORE for core streptavidin.
  • the preparation and description of the plasmid pSAM-CORE is described in WO 93/09144 (11).
  • the unique Nhel restriction site located at the 3 'end in front of the stop codon of the core-SA gene was used to construct core-SA fusion proteins.
  • GGCCGCATGGACCGTATCGGTGCTCAGTCCGGACTGGGTTGCAACTCCTTCCGTT ACTAATGA SEQ ID NO: 5
  • DNA segment B (FIG. 1) "aged” (reaction buffer: 12.5 mmol / l Tris-HCl, pH 7.0 and 12.5 mmol / l MgCl2; oligonucleotide concentration: 1 pmol / 60 ⁇ l in each case ) and the hybridization products A and B each subcloned into the polylinker region of the E. coli pUCBM21 vector (Boehringer Mannheim GmbH, Mannheim, Germany) (DNA segment A, interfaces: EcoRI and Notl; DNA segment B, interfaces: Notl and Hindill). The DNA sequence of the two subcloned DNA segments was confirmed by means of DNA sequencing.
  • the expression plasmid pSA-EK-URO for the core-SA-URO (95-126) fusion gene was then used in a three-fragment ligation from the Nhe / Notl-DNA segment A, the Notl / Hindlll-DNA segment B and the approx. 2.9 kBp long Nhel / Hindlll-pSAM-CORE vector fragment composed. After double digestion, the DNA segments A and B were isolated with the corresponding endonucleases from the corresponding pUCBM21 plasmid derivatives. The desired plasmid pSA-EK-URO was identified by restriction mapping and the DNA sequence of the linker-urodilatin region was checked again by DNA sequencing.
  • PTH Parathormone fragment of amino acids 1-37, amino acid sequence described in Handy, G.N. et al., Proc. Natl. Acad. Be. USA 78 (1981) 7365-7369 (39).
  • the vector pSA-EK-PTH for expressing the core-SA-PT ⁇ (1-37) fusion gene with enterokinase cleavage site was produced according to the strategy described in Example 1 for the core-SA-URO (95-126) fusion gene with enterokinase cleavage site.
  • the DNA sequence of the two subcloned DNA segments was confirmed by means of DNA sequencing.
  • the expression plasmid pSA was then confirmed - EK-PT ⁇ for the core-SA-EK-PTH (l-37) fusion gene in a three-fragment ligation from the Nhel / NcoI-DNA segment C, the NcoI / HindüI-DNA segment D and the approx. 2.9 kBp long Nhel / Hindlll-pSAM-CORE vector fragment composed.
  • the DNA segments C and D were isolated after double digestion with the corresponding endonucleases from the corresponding pUCBM21 plasmid derivatives.
  • the desired plasmid pSA-EK-PTH was identified by restriction mapping and the DNA sequence of the enterokina elinker PTH region checked again by DNA sequencing
  • the plasmid pSA-THRO-PTH is derived from the core-SA-EK-PTH expression plasmid pSA-EK-PTH (see Example 2) by replacing the coding region for the enterokinase linker with a thrombin linker
  • the amino acid sequence of the thrombin linker [GDFLAEGLVPR] used (SEQ ID NO 15) is based on the natural thrombin cleavage site in fibrinogen (amino acid position 6-16) and the minimal recognition sequence for thrombin (Carter, P In Ladisch, MR, Willson, RC, Painton, CC, Builder, SE eds (1990) (12))
  • the plasmid pSA-EK-PTH was digested with Nhel and PvuII, the approximately 2.9 kbp long Nhel / PvuII-pSA-EK-PTH vector fragment was isolated and with that from the 2 complementary oligonucleotides 9 (SEQ ID NO 11) and 10 (SEQ ID NO 12) DNA segment E (FIG. 3) produced by hybridization
  • the desired plasmid construction pSA-THRO-PTH was identified by restriction mapping and the exchanged left region was checked by DNA sequencing.
  • the plasmid pSA-TEV-PTH is derived from the core-SA-EK-PTH expression plasmid pSA-EK-PTH (see Example 2) by replacing the coding region for the enterokinase linker with a TEV linker.
  • the plant virus TEV NIa proteinase ("tobacco etch virus”) recognizes the amino acid sequence ENLYFQiG / S and cleaves between gin and gly or ser (Dougherty, W.G. et al., (1988)) (13).
  • tobacco etch virus recognizes the amino acid sequence ENLYFQiG / S and cleaves between gin and gly or ser (Dougherty, W.G. et al., (1988)) (13).
  • the recombinantly produced enzyme was obtained from GIBCO BRL (Life Technologies, Ine Gaithersburg, MD, USA).
  • the plasmid pSA-EK-PTH was digested with Nhel and PvuII, the approx. 2.9 kbp long Nhel / PvuII-pSA-EK-PTH vector fragment was isolated and with that from the 2 complementary oligonucleotides JI (SEQ ID NO: 13) and ⁇ 2 (SEQ ID NO: 14) DNA segment F (FIG. 3) produced by hybridization.
  • the E. coli Kl 2 strain RM82 (a methionine revertant from ED 8654, Murray, NE et al. (1977)) (14) was in each case with one of the expression plasmids pSA described in Examples 1-4 -EK-URO, pSA-EK-PTH, pSA-THRO-PTH and pSA-TEV-PTH (ampicillin resistance) and the lacW repressor plasmid pUBS500 (kanamycin resistance, preparation and description see: EP-A 0368342) transformed.
  • the RM82 / pUBS500 / pSA-EK-URO, RM82 / pUBS500 / pSA-EK-PTH, RM82 / pUBS500 / pSA-THRO-PTH and RM82 / pUBS500 / pSA-TEV-PTH cells were in DYT medium (1% ( w / v) yeast extract, 1% (w / v) Bacto Tryptone (Difco, Detroit, USA) and 0.5% NaCl), with 50 mg / l ampicillin and 50 mg / l kanamycin up to an optical density at 550 nm attracted from 0.6-0.9 and then induced with IPTG (isopropyl- ⁇ -D-thiogalactoside) (1-5 mmol / l final concentration). After an induction phase of 4-8 hours, the cells were harvested by centrifugation and the cell pellets were washed with 25 mmol / l potassium phosphate buffer
  • the cell pellets each from 1 ml of centrifuged growth medium (RM82 / pUBS500 / pSA-EK-URO, RM82 / pUBS500 / pSA-EK-PTH, RM82 / pUBS500 / pSA-THRO-PTH and
  • RM82 / ⁇ UBS500 / pSA-TEV-PTH cells were resuspended in 0.25 ml 10 mmol / l phosphate buffer, pH 6.8 and 1 mmol / l EDTA and the cells were disrupted by ultrasound treatment. After centrifugation, 1/5 volume of 5xSDS sample buffer (1xSDS sample buffer: 50 mmol / l Tris-HCl, pH 6.8, 1% SDS, 1% mercaptoethanol, 10% glycerol, 0.001% bromophenol blue) was added to the supernatant.
  • 5xSDS sample buffer 50 mmol / l Tris-HCl, pH 6.8, 1% SDS, 1% mercaptoethanol, 10% glycerol, 0.001% bromophenol blue
  • the insoluble cell debris fraction was resuspended in 0.3 ml of lxSDS sample buffer with 6-8 M urea, the samples were incubated for 5 minutes at 95 ° C. and centrifuged. The proteins were then separated by SDS-polyacrylamide gel electrophoresis (PAGE) (Laemmli, UK (1970)) (15) and stained with Coomassie Brilliant Blue R dye.
  • the core-SA fusion proteins synthesized in E. coli were homogeneous and were found exclusively in the insoluble cell debris fraction (IBs). The expression level for the core-SA fusion proteins was 30-50% based on the total E. coli protein
  • E coli RM82 / pUBS500 / pSA-EK-URO, RM82 / pUBS500 / pSA-EK-PTH, RM82 / pUBS500 / pSA-THRO-PTH and RM82 / pUBS500 / pSA-TEV-PTH cells were in 1 1 0, 1 mol / 1 Tris-HCl, pH 7.0 suspended at 0 ° C, 300 mg of lysozyme added and incubated for 20 minutes at 0 ° C.
  • the cells were then mechanically disrupted by means of high pressure dispersion and the DNA by addition of 2 ml 1 mol / 1 MgCl2 and 10 mg DNAse (Boehringer Mannheim # 154709) digested in 30 minutes at 25 ° C. Then 500 ml 60 mmol / l EDTA, 6% Triton® XI 00 and 1.5 mol / 1 NaCl, pH 7.0 was added and incubated for a further 30 minutes at 0 ° C. The insoluble constituents (cell dummies and IBs) were then sedimented by centrifugation
  • the pellet was suspended in 1 1 0.1 mol / 1 Tris-HCl, 20 mmol / l EDTA, pH 6.5, incubated for 30 minutes at 25 ° C. and the IB preparation was isolated by centrifugation
  • IB pellet 25 g were suspended in 200 ml of 10 mmol / l Tris-HCl buffer, 8 mol / 1 urea, 10 mmol / l EDTA, pH 7.0 by stirring for 2 hours at 25 ° C. The insoluble constituents were separated by centrifugation and the clear supernatant processed further
  • the core-SA fusion proteins with enterokinase interface were in a concentration of 0.3 to 3 mg / ml and a substrate / proteinase ratio of 1:20 to 1: 250 (enterokinase, restriction proteinase from calf intestine, Boehringer Mannheim, Mannheim, Germany) in 50 mmol / l Tris-HCl, pH 8.0 digested at 30 ° C. and the time course of the enzymatic cleavage (kinetics) was analyzed by analytical reversed phase HPLC (see Example 9.1). For this purpose, samples (10 to 100 ⁇ l) were taken at intervals of 1 to 3 hours from the reaction mixture over a period of 6 to 24 hours.
  • LysC endoproteinase cleavage (Lys cleavage site)
  • the core SA-EK-URO fusion protein was obtained in a concentration of 0.3 to 3 mg / ml and a substrate / proteinase ratio of 1: 1000 to 1: 25000 (LysC endoproteinase from Lysobacter enzymogenes, sequencing grade; Boehringer Mannheim, Mannheim , Germany) in 50 mmol / l Tris-HCl, pH 8.0 at 30 to 35 ° C and the time course of the enzymatic cleavage was analyzed by analytical reversed phase HPLC (see Example 9.1). For this purpose, samples (10 to 100 ⁇ l) were taken at intervals of 1 to 3 hours from the reaction mixture over a period of 6 to 24 hours.
  • the core-SA-THRO-PTH fusion protein was in a concentration of 0.3 to 3 mg / ml and a substrate / proteinase ratio of 1:50 to 1: 500 (thrombin from human plasma, Boehringer Mannheim, Mannheim, Germany) in 50 mmol / l Tris-HCl, pH 8.8 digested at 25 to 30 ° C and the time course of the enzymatic cleavage was analyzed by analytical reversed phase HPLC (see Example 9.1). For this purpose, samples (10 to 100 ⁇ l) were taken at intervals of 1 to 3 hours from the reaction mixture over a period of 6 to 24 hours. TEV NIa proteinase cleavage (GluAsnLeuTyrPheGln-i-Gly / Ser cleavage sequence)
  • the core-SA-TEV-PTH fusion protein was obtained in a concentration of 0.3 to 3 mg / ml and a substrate / proteinase ratio of 1:50 to 1: 500 (recombinant TEV NIa restriction proteinase, GIBCO BRL Life Technologies, Inc. Gaithersburg , MD, USA) in 50 mmol / l Tris-HCl, pH 8.0, 0.5 mmol / l EDTA and 1 mmol / l DTT at 30 ° C and the time course of the enzymatic cleavage by analytical reversed phase HPLC ( see example 9.1).
  • the reaction mixture was used over a period of 6 to
  • the released core-SA carrier protein and uncleaved core-SA fusion protein were precipitated from the cleavage mixture by lowering the pH (pH ⁇ 6).
  • the cleavage mixture was treated with 1 mol / 1 citric acid to a final concentration of
  • the enzymatically released peptides can be further purified using chromatographic methods known to the person skilled in the art.
  • the bound material was eluted by a gradient of 0 to 1 mmol / l NaCl in equilibration buffer (10 up to 20 SV, 1 SV / hour). 10.2 Purification of the peptides by reversed phase HPLC
  • the sample volume was 10 - 100 ⁇ l, corresponding to 1 100 ⁇ g protein
  • the detection was carried out with a UV detector at 220 nm. Chromatography was carried out at a flow rate of 0.5 ml / min.
  • the identity and purity of the purified peptides was determined by mass spectroscopy (PD-MS and laser desorption spectroscopy), analytical reversed phase HPLC, isoelectric focusing (Bark, JE et al., J. Forensic Sei. Soc. 16 (1976) 115-120 ( 42), SDS PAGE (Laemmli, UK, Nature 227 (1970) 680-685 (43)) and capillary electrophoresis, compared with a chemically produced standard.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Organic Chemistry (AREA)
  • Molecular Biology (AREA)
  • Zoology (AREA)
  • Biophysics (AREA)
  • Engineering & Computer Science (AREA)
  • General Health & Medical Sciences (AREA)
  • Biochemistry (AREA)
  • Biomedical Technology (AREA)
  • Medicinal Chemistry (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Endocrinology (AREA)
  • Wood Science & Technology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • General Engineering & Computer Science (AREA)
  • Biotechnology (AREA)
  • Toxicology (AREA)
  • Physics & Mathematics (AREA)
  • Microbiology (AREA)
  • Plant Pathology (AREA)
  • Cardiology (AREA)
  • Peptides Or Proteins (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)

Abstract

Ein Verfahren zur rekombinanten Herstellung von Peptiden durch Expression einer DNA in Mikroorganismen, welche für ein Fusionsprotein aus Streptavidin und dem genannten Peptid codiert, wobei Streptavidin und Peptid über eine Peptidsequenz, welche durch eine Endoproteinase spaltbar ist, verbunden sind, Isolierung des unlöslichen, inaktiven Proteins, Solubilisierung des inaktiven Proteins mit einem Denaturierungsmittel, Verdünnung des Denaturierungsmittels bei einem pH-Wert zwischen 8,5 und 11, bis die Spaltung des Fusionsproteins durch eine Endoproteinase durchführbar ist, Spaltung des Fusionsproteins, Erniedrigung des pH-Werts, bis Streptavidin und nicht gespaltenes Fusionsprotein präzipitieren, und Reinigung des gewünschten Peptids aus dem Überstand, ist besonders zur Herstellung von Parathormon und Urodilatin sowie deren Fragmenten geeignet.

Description

Verfahren zur Herstellung von Peptiden über Streptavidin-Fusionsproteine
Gegenstand der Erfindung ist ein Verfahren zur rekombinanten Herstellung von Peptiden durch Expression von Fusionsproteinen mit Streptavidin und anschließender enzymatischer Spaltung des Fusionsproteins
Unter Peptiden werden üblicherweise Substanzen verstanden, die aus bis zu ca 100 Ami¬ nosäuren bestehen Die Herstellung solcher Peptide ist entweder chemisch (Kent, S B H et al (1988) (I), Hodson, J H , (1993) (2) oder rekombinant (Kopetzki, E et al (1994) (3) Winnacker, E -L (1987) (4), Harris, T J R (1983) (5)) möglich
Die Nachteile der chemischen Peptidsynthese liegen insbesondere darin, daß eine ökonomische Synthese lediglich bis ca 30 bis 40 Aminosauren möglich ist und sich häufig bei der Synthese unerwünschte Modifizierungen (Fehlsequenzen, nicht abgespaltene Schutzgruppen) bilden Weitere Probleme sind die Racemisierung bei Fragmentkopplung, Schwierigkeiten bei der Abspaltung von Schutzgruppen und schließlich die aufwendige Reinigung
Zur rekombinanten Herstellung von Peptiden können verschiedene Verfahren angewendet werden Beispielsweise kann eine direkte Expression im Cytoplasma von Mikroorganismen oder Zellinien erfolgen Hierfür ist jedoch eine Mindestpolypeptidlange von ca 80 bis 100 Aminosauren erforderlich Kleinere Peptide sind nicht stabil und werden durch Proteolyse abgebaut Zudem enthalten diese Proteine in der Regel ein zusatzliches N-terminales Methio¬ nin, und die Ausbeuten sind sehr gering
Durch Expression loslicher Fusionsproteine mit selektiver Spaltsequenz und anschließender Freisetzung des gewünschten Peptids durch chemische oder enzymatische Spaltung, kann die Herstellung solcher Peptide verbessert werden (Itakura, K et al (1977) (20), EP-B 0 001 930 (21), Gram, H et al (1994) (19), Sharma, A. et al (1992) (22)) Der Nachteil von loslichen Fusionsproteinen ist aber insbesondere, daß sie vorwiegend im nicht strukturierten Peptidbe- reich durch Proteolyse in der Zelle bzw wahrend der Sekretion und Aufarbeitung degradiert werden können Die Herstellung von Streptavidin-Fusionsproteinen ist in der EP-B 0 198 015, bei Sano, T (1991) (9) und Sano, T (1992) (10) beschrieben Solche chimare Proteine umfassen bei Sano als Streptavidinanteil die Aminosäuren 16 - 133 von Streptavidin, einen Polylinker und die Sequenz des "target-Proteins". Als target-Proteine sind von Sano das Maus Metallothionein I Protein und das T7-Gen-10-Protein beschrieben Diese chimaren Proteine enthielten jedoch keine Spaltstelle, über die das "target-Protein" vom Streptavidin-Anteil wieder abgespalten werden kann In der EP-B 0 198 015 wird die Herstellung von Streptavidiniusionsproteinen in Streptomyces beschrieben. Die Isolierung des Peptidanteils aus dem Fusionsprotein ist jedoch sehr aufwendig So muß beispielsweise vor und nach der Spaltung jeweils eine Affinitätschro¬ matographie mit Iminobiotin als Ligand durchgeführt werden
Die Aufgabe der vorliegenden Erfindung besteht darin, ein Verfahren bereitzustellen, mit dem Peptide über Streptavidin-Fusionsproteine in hoher Ausbeute und Reinheit bei möglichst voll- standiger Abtrennung vom Streptavidinanteil zur Verfugung gestellt werden können
Die Aufgabe wird erfindungsgemäß gelost durch ein Verfahren zur rekombinanten Herstellung eines Peptids durch Expression einer DNA in Mikroorganismen, vorzugsweise Prokaryonten, welche für ein Fusionsprotein aus Streptavidin und dem genannten Peptid codiert, wobei Streptavidin und Peptid über eine Peptidsequenz, welche durch eine Endoproteinase spaltbar ist, verbunden sind, Isolierung des unlöslichen, inaktiven Fusionsproteins, Solubilisierung des inaktiven Fusionsproteins mit einem Denaturierungsmittel, Verdünnung des Denaturierungs- mittels bei einem pH-Wert zwischen 8,5 und 11, bis die Spaltung des Fusionsproteins durch eine Endoproteinase durchführbar ist, Spaltung des Fusionsproteins, Erniedrigung des pH-Werts, bis das abgespaltene Streptavidin und nicht gespaltenes Fusionsprotein prazipitie- ren, und Reinigung des gewünschten Peptids aus dem Überstand
Das erfindungsgemaße Verfahren nutzt den Vorteil, daß Streptavidin-Fusionsproteine in Prokaryonten sehr gut exprimierbar sind und sich in Form von unlöslichen inaktiven Proteinen (inclusion bodies) isolieren lassen In Denaturierungsmitteln solubilisierte Streptavidin- Fusionsproteine lassen sich bei pH-Werten über 8,5 so weit verdünnen, daß sie, ohne zu prazipitieren, mit einer Endoproteinase verdaut werden können
Ein weiterer wesentlicher Vorteil des erfindungsgemäßen Verfahrens liegt darin, daß eine Naturierung des Fusionsproteins zum aktiven Protein nicht erforderlich ist Schließlich können das freigesetzte Streptavidin und gegebenenfalls nicht gespaltenes Streptavidin-Fusionsprotein durch Prazipitation bei pH- Werten unter 6 vom gewünschten Peptid abgetrennt werden Das erfindungsgemäße Verfahren ist zur Herstellung einer Vielzahl von kurzkettigen Peptiden geeignet. Insbesondere ist das Verfahren zur Herstellung von natriuretischen Peptiden und Parathormonpeptiden geeignet.
Natriuretische Peptide (NP-Peptide) sind Peptide mit natriuretischer Aktivität, die im Herz- Ventrikel, der Nebenniere und dem Gehirn aus einem Precursorpolypeptid (Prohormon) gebil¬ det werden und als Strukturelement einen Ring aus 17 Aminosäuren aufweisen, der durch eine Disulfidbrϋcke zwischen zwei Cysteinresten ausgebildet wird. Precursorpolypeptide sind z. B. das "atriaT-natriuretische Peptid (ANP 1 - 126) oder Cardiodilatin (CCD 1 - 126) und die "brain"-natriuretischen Peptide vom B- und C-Typ. Bevorzugte NP-Peptide leiten sich von dem "human α atrial-natriuretic peptide" (hαANP) ab. Besonders bevorzugt sind dabei die C-terminalen hαANP-Fragmente der Aminosäuren 95 - 126, 99 - 126 und 102 - 126.
Urodilatin (CDD 95 - 126) ist ein natriuretisches Peptid, welches aus humanem Urin gewon¬ nen werden kann (Forssmann, K. et al. (1988) (23). Das Peptid hat eine Länge von 32 Ami¬ nosäuren, bildet einen Ring aus 17 Aminosäuren durch die Ausbildung einer Disulfidbrücke zwischen zwei Cysteinresten und gehört zu der Cardiodilatin/"atriar -natriuretischen Peptid (CDD/ANP)-Familie. Es entsteht, ebenso wie α-ANP (99 - 126), aus dem ANP-Propeptid (ANP 1 - 126). Urodilatin (CCD 95 - 126) entsteht in vivo vermutlich durch Spaltung dieses Propeptids zwischen den Aminosäuren 94 und 95. Das ca. 3,5 kDa schwere Urodilatin-Peptid unterscheidet sich vom α-ANP (99 - 126)-Peptid durch eine 4- Aminosäuren- Verlängerung am N-Terminus. Die Aminosäuresequenz und die Struktur von Urodilatin sind beispielsweise in Drummer, C. et al. (1993) (24) beschrieben. Urodilatin bindet an die membranständigen ANP-Rezeptoren A und B und aktiviert eine an den Rezeptor gekoppelte intrazelluläre Guanylatcyklase. Dies bewirkt die Bildung des "second messengers" cGMP, der die diureti- schen und natriuretischen Wirkungen in der Niere und die relaxierende Wirkung auf die glatte Gefäßmuskulatur vermittelt. (Heim, J.M. (1989) (25)). Damit ist Urodilatin ein bevorzugtes Therapeutikum zur Prophylaxe und Therapie des akuten Nierenversagens, z. B. bei Patienten nach Herz- oder Lebertransplantationen. (Bub, A. et al. (1992) (26), Drummer, C. et al. (1991) (27) und (1992) (28); Emmeluth, C. et al. (1992) (29); Goetz, K.L. et al. (1990) (30)).
Ebenfalls vorteilhaft kann das erfindungsgemäße Verfahren zur Herstellung von Parathormon (PTH) sowie dessen Fragmente verwendet werden. Die DNA- und Aminosäuresequenz von PTH ist beispielsweise in Rokkones, E. et al. (1994) (16) beschrieben. Das humane Parathor¬ mongen codiert für ein Pre-Pro-PTH Protein von 115 Aminosäuren. Nach Abspaltung der Signalsequenz und des Prosegments besitzt das gereifte PTH Hormon 84 Aminosäuren (PTH 1 - 84). Es hat sich gezeigt, daß PTH, welches rekombinant in E.coli und S. cerevisiae hergestellt wird, instabil ist und rasch abgebaut wird. Die Herstellung von PTH-Fusionspro- teinen ist von Forsberg, G. et al. (1991) (17) beschrieben. Dazu wird eine Nukleinsäure hergestellt, welche für ein Fusionsprotein aus reifem PTH (1 - 84) und ein 15 kD schweres IgG-Bindeprotein codiert. Zwischen beide Proteinanteile ist eine Spaltstelle für Thrombin oder Subtilisin eingefügt. Auch dieses Fusionsprotein ist instabil und wird bei der Expression in E.coli bereits zu einem beträchtlichen Teil abgebaut. Auch durch Sekretion des reifen PTH (1 - 84) Hormones ins Periplasma von E.coli unter Verwendung der Protein A-Signalsequenz konnte die Degradation von PTH (1 - 84) nicht verhindert werden. Die Halbwertszeit von PTH (1 - 84) in E.coli beträgt nur wenige Minuten.
Von Gardella, T.J. et al (1990) (18) wird die Herstellung von PTH (1 - 84) in E.coli über ein mit Faktor Xa spaltbares Fusionsprotein beschrieben. Die Spaltung mit Faktor Xa ist jedoch sehr unvollständig (nach zwei Stunden ca. 50 % Spaltung) oder führt bei längerer Inkubation mit Faktor Xa ebenfalls zum Abbau von PTH (1 - 84).
Von Gram, H. et al. (1994) (19) wird ebenfalls die Herstellung eines PTH-Fragments (PTH 1 - 38) mittels eines Fusionsproteins in E.coli beschrieben. Zur Abspaltung des C-terminal fusionierten PTH (1 - 38) Peptids wurde ein Asp-Pro-Pro-Linker benutzt. Dieser läßt sich mittels eines 2- Stufenprozesses spalten/entfernen. In einer ersten Reaktion wird die säurelabile Asp-Pro-Peptidbindung chemisch hydrolysiert (Inkubation des Fusionsproteins in 60 mM HCl für 24 Std. bei 50°C). Danach wird in einer zweiten Reaktion das N-terminal verbleibende Pro-Pro-Dipeptid enzymatisch mit Dipeptidylpeptidase IV aus L. lactis entfernt. Dieses Verfahren ist jedoch zeitaufwendig und bedingt durch die saure Hydrolyse werden in beträcht¬ lichem Umfang Nebenprodukte gebildet.
Die Spaltung der Fusionsproteine kann enzymatisch mit einer spezifisch spaltenden Proteinase (Restriktionsproteinase) erfolgen. Die Auswahl der Proteinase erfolgt unter Berücksichtigung der Aminosäuresequenz des herzustellenden Peptids. Es ist darauf zu achten, daß die Erken- nungs-/Spaltsequenz der Restriktionsproteinase möglichst nicht in dem gewünschten Peptid und vorzugsweise auch nicht im Carrieranteil (Streptavidinanteil) des Fusionsproteins vorkommt, d.h. sie sollte nur einmal in der Spaltungsregion (Linkerregion) vorkommen. Als spezifisch spaltende Endoproteinasen sind z. B. Enterokinase, Faktor Xa, Thrombin, Subtilisin BPN Varianten / Ubiquitin Protein Peptidase, Renin, Collagenase, Trypsin, Chymotrypsin, Endoproteinase Lys-C, Kallekrein (Carter, P., (12)), TEV Proteinase (Parks, T.D. et al., Anal. Biochem. 216 (1994) 413 - 417) (36), IgA Proteinase (Pohlner, J. et al., Nature 325 (1987) 458 - 462) (37), Kex2p Proteinase (EP-A 0467 839) (38) oder S. aureus V8 Proteinase geeignet.
Vorzugsweise wird Endoproteinase LysC, welche spezifisch am C-terminalen Ende von Lysin Proteine und Peptide spaltet, verwendet. Ein solches Enzym ist beispielsweise aus Pilzen oder Bakterien (DE 30 34 045 C2) bekannt. Endoproteinase LysC eignet sich besonders gut zur Herstellung von Peptiden, die keinen Lysinrest enthalten, wie z. B. Urodilatin.
Unter einer Peptidsequenz, welche durch eine Endoproteinase spaltbar ist, ist im Sinne der vorliegenden Erfindung eine kurzkettige Peptidsequenz zu verstehen, welche vorzugsweise aus 5 - 15 Aminosäuren besteht und die eine Spaltstelle für die gewünschte Endoproteinase C- terminal enthält. Vorzugsweise enthält dieser Linker N-terminal von der gewünschten Endo- proteinaseerkennungssequenz zusätzlich eine Kombination aus mehreren Aminosäuren, aus¬ gewählt aus den Aminosäuren Gly, Thr, Ser, Ala, Pro, Asp, Glu, Arg und Lys. Besonders bevorzugt wird ein Linker verwendet, in dem 2 - 8 dieser zusätzlichen Aminosäuren die negativ geladenen Aminosäuren Asp und/oder Glu sind.
Die Herstellung einer DNA, welche für das Fusionsprotein codiert, kann nach den bekannten Verfahren, wie sie bei Sambrook, J. et al. (1989) (6) beschrieben sind, erfolgen.
Als Streptavidin kann beispielsweise Streptavidin, wie in der EP-B 0 198 015 (7) und EP-A 0 612 325 (8) beschrieben, verwendet werden. Weitere Streptavidin-Derivate oder - Fragmente, wie beispielsweise von Sano, T. et al., (9) beschrieben, sind ebenfalls geeignet. Bevorzugt wird ein Streptavidin verwendet, welches am N-Terminus und/oder C-Terminus trunkiert (verkürzt) ist. Dadurch wird die Aggregation und Proteolyse verhindert (Sano, T. et al., (9)). Vorzugsweise wird ein Streptavidin verwendet, welches mit den Aminosäuren 10 - 20 beginnt und mit den Aminosäuren 130 - 140 endet (Numerierung analog: Argarana, C. E. et al. (1986) (33)). Besonders bevorzugt wird ein Streptavidin der Aminosäuren 16 - 133 oder 13 - 139 verwendet.
Die Herstellung der Fusionsproteine erfolgt durch Expression einer DNA (Nukleinsäuresequenz), welche für das Fusionsprotein codiert, in Mikroorganismen, vorzugs¬ weise in Prokaryonten. Damit das Protein in denaturierter, unlöslicher Form ("inclusion bodies") entsteht, sollte der verwendete Expressionsvektor keine Elemente enthalten, die eine Sekretion des Proteins ins Medium vermitteln. Die Herstellung einer für die Expression geeig¬ neten DNA kann vorzugsweise synthetisch erfolgen. Derartige Verfahren sind dem Fachmann gelaufig und beispielsweise in Beattie, K L und Fowler, R.F (1991) (34), EP-B 0 424 990 (35), Itakura, K et al (1977) (20) beschrieben Die Nukleinsauresequenz der erfindungsge¬ maßen Proteine kann zweckmäßig modifiziert sein Derartige Modifikationen sind beispiels¬ weise
— Veränderung der Nukleinsauresequenz, um verschiedene Erkennungssequenzen von Restriktionsenzymen zur Erleichterung der Schritte der Ligation, Klonierung und Mutagenese einzuführen
— Veränderung der Nukleinsauresequenz zum Einbau von bevorzugten Codons für die Wirtszelle
— Ergänzung der Nukleinsauresequenz um zusatzliche Regulations- und Transkriptionsele¬ mente, um die Expression in der Wirtszelle zu optimieren
Alle weiteren Verfahrensschritte zur Herstellung von geeigneten Expressionsvektoren und zur Expression sind Stand der Technik und dem Fachmann gelaufig Beschrieben sind derartige Methoden beispielsweise bei Sambrook, J et al (1989) fö)
Fusionsproteine können sowohl in Prokaryonten als auch in anderen Zellen, beispielsweise in eukaryontischen Wirtszellen, wie Hefen (z B Saccharomyces, Pichia, Hansenula und Kluyveromyces) und Pilzen, wie Aspergillis und Trichoderma in Form unlöslicher Protein¬ aggregate, sogenannten "inclusion bodies" (IBs), anfallen Inclusion bodies entstehen dann, wenn die Synthesegeschwindigkeit des Proteins in der Zelle großer ist als die Faltungsge¬ schwindigkeit zum aktiven nativen Protein In diesem Fall aggregiert das Protein in der Zelle, vorzugsweise im Cytoplasma Dort wird das Protein in denaturierter, verdichteter und unlösli¬ cher Form in der Zelle abgelagert Dadurch erfahrt die Zelle eine möglichst geringe Störung ihrer anderen Zellfünktionen
Als prokaryontische Wirtsorganismen sind beispielsweise Escherichia, Streptomyces oder Bacillus geeignet Zur Herstellung der erfindungsgemäßen Fusionsproteine werden die Mikro¬ organismen, vorzugsweise Prokaryonten, in üblicher Weise mit dem Vektor, welcher die für das Fusionsprotein codierende DNA enthalt, transformiert und anschließend in üblicher Weise fermentiert Nach Aufschluß der Zellen wird das unlösliche, inaktive Protein (IBs) in üblicher Weise, beispielsweise durch Zentrifugation (Pelletfraktion) isoliert Die gewünschten unlos- liehen Proteinaggregate können ggf. durch Waschen des Pellets, mit z. B. detergentienhaltigen Puffern, weiter angereichert werden.
Die IBs werden nach den dem Fachmann geläufigen Verfahren mit einem Denaturie- rungsmittel, wie z.B. Guanidinhydrochlorid, Harnstoff oder einem Harnstoffderivat (vgl. z. B. US Patent Nr. 5,453,363) solubilisiert und durch Verdünnung oder Dialyse in einen geeigneten nicht denaturierenden Puffer (pH >8.5) überführt. Die Verdünnung erfolgt dabei in einer solchen Weise, daß das verbleibende Denaturierungsmittel die enzymatische Hydrolyse des Fusionsproteins nicht wesentlich beeinflußt.
Vorzugsweise erfolgt die Verdünnung pulsartig, beispielsweise durch Eintropfen des IB- Solubilisats in Puffer (pH >8.5), der kein Denaturierungsmittel enthält.
Eine solche pulsartige Verdünnung ermöglicht eine praktisch gleichzeitige Entfernung der Wirkung des Denaturierungsmittels und Vereinzelung der zu solubilisierenden Moleküle. Dadurch wird eine nicht erwünschte intermolekulare Wechselwirkung (Aggregation) der zu solubilisierenden Moleküle weitgehend vermieden.
Überraschenderweise hat es sich gezeigt, daß die mit dem erfindungsgemäßen Verfahren hergestellte Fusionsproteine in den Wirtszellen nicht abgebaut werden und sich enzymatisch vollständig spalten lassen, ohne daß im Peptidanteil selbst (z. B. PTH oder Urodilatin) in nennenswertem Umfang eine Spaltung stattfindet.
Das erfindungsgemäße Verfahren ist insbesondere geeignet zur Herstellung von Urodilatin, Parathormon und deren Fragmente. Besonders bevorzugt werden die Urodilatinfragmente der Aminosäuren 95 - 126, 99 - 126 oder 102 - 126 sowie das Parathormonfragment der Ami¬ nosäuren 1 - 37 hergestellt.
Die folgenden Beispiele, Publikationen, die Sequenzprotokolle und die Abbildungen erläutern die Erfindung, deren Schutzumfang sich aus den Patentansprüchen ergibt, weiter. Die beschriebenen Verfahren sind als Beispiele zu verstehen, die auch noch nach Modifikationen den Gegenstand der Erfindung beschreiben.
Fig. 1 zeigt die gemäß Beispiel 1 erhaltenen DNA-Segmente A und B.
Fig. 2 zeigt die gemäß Beispiel 2 erhaltenen DNA-Segmente C und D. Fig. 3 zeigt das gemäß Beispiel 3 erhaltene DNA-Segment E und das gemäß Beispiel
4 erhaltene DNA-Segment F.
Beispiel 1
Konstruktion des core-SA-URO(95-126) Fusionsgens mit Endoproteinaselinker
(Plasmid: pSA-EK-URO)
core-SA: verkürztes Streptavidin der Aminosäuren Met-(13 - 139)
URO (95 - 126): Urodilatin oder Cardiodilatinfragment der Aminosäuren 95 - 126 (Sequenz beschrieben in Drummer, C. et al. (1993) (24)).
Der Expressionsvektor für das core-SA-URO(95-126) Fusionsgen mit Endoproteinase LysC- Spaltstelle basiert auf dem Expressionsvektor pSAM-CORE für core-Streptavidin. Die Herstellung und Beschreibung des Plasmids pSAM-CORE ist in der WO 93/09144 (11) beschrieben. Zur Konstruktion von core-SA Fusionsproteinen wurde die singuläre am 3'-Ende lokalisierte Nhel Restriktionsschnittstelle vor dem Stopcodon des core-SA Gens benutzt.
Ein ca. 140 Bp langes für den Linker [VDDDDK] (SEQ ID NO: l) und das Urodilatin(95- 126) Polypeptid [TAPRSLRRSSCFGGRMDRIGAQSGLGCNSFRY] (SEQ ID NO: 2) kodierendes DNA-Fragment wurde aus 2 ca. 70 Bp langen chemisch hergestelllten DNA Segmenten zusammengesetzt. Beim "Gendesign" wurden die in E. coli bevorzugt benutzten Codone (E. coli "Codonusage") berücksichtigt und die einzelnen DNA Segmente mit geeig¬ neten singulären Restriktionsendonukleaseschnittstellen an den Enden versehen.
In zwei Ansätzen wurden die komplementären Oligonukleotide \ (SEQ ID NO: 3) und 2 (SEQ ID NO:4)
1
AATTCGCTAGCGTTGACGACGATGACAAAACGGCGCCGCGTTCCCTGCGTAGATC TTCCTGCTTCGGC (SEQIDNO:3) 2
GGCCGCCGAAGCAGGAAGATCTACGCAGGGAACGCGGCGCCGTTTTGTCATCGTC GTCAACGCTAGCG (SEQIDNO:4)
zu dem DNA Segment A (Fig. 1) und die Oligonukleotide 3 (SEQ ID NO:5) und 4 (SEQ ID NO:6)
3
GGCCGCATGGACCGTATCGGTGCTCAGTCCGGACTGGGTTGCAACTCCTTCCGTT ACTAATGA (SEQ ID NO:5)
4
AGCTTCATTAGTAACGGAAGGAGTTGCAACCCAGTCCGGACTGAGCACCGATACG GTCCATGC (SEQ ID NO:6)
zu dem DNA Segment B, (Fig. 1) "annealt" (Reaktionspuffer: 12,5 mmol/l Tris-HCl, pH 7,0 und 12,5 mmol/l MgCl2 ; Oligonukleotid-Konzentration: jeweils 1 pmol / 60 μl) und die Hybridisierungsprodukte A und B jeweils in die Polylinkerregion des E. coli pUCBM21 Vektors (Boehringer Mannheim GmbH, Mannheim, Deutschland) subkloniert (DNA Segment A, Schnittstellen: EcoRI und Notl; DNA Segment B, Schnittstellen: Notl und Hindill). Mittels DNA Sequenzierung wurde die DNA Sequenz der beiden subklonierten DNA Segmente bestätigt. Danach wurde das Expressionsplasmid pSA-EK-URO für das core-SA- URO(95-126) Fusionsgen in einer Dreifragrnentligation aus dem Nhe/Notl-DNA Segment A , dem Notl/Hindlll-DNA Segment B und dem ca. 2,9 kBp langen Nhel/Hindlll-pSAM-CORE Vektorfragment zusammengesetzt. Dabei wurden die DNA Segmente A und B nach Doppel¬ verdau mit den entsprechenden Endonukleasen aus den entsprechenden pUCBM21 Plasmid- derivaten isoliert. Das gewünschte Plasmid pSA-EK-URO wurde durch Restriktionskartierung identifiziert und die DNA Sequenz des Linker-Urodilatin-Bereichs erneut durch DNA Sequenzierung überprüft. Beispiel 2
Konstruktion des core-SA-PTH(l-37) Fusionsgens mit Enterokinaselinker
(Plasmid: pSA-EK-PTH)
PTH (1 - 37): Parathormonfragment der Aminosäuren 1 - 37, Aminosäuresequenz beschrie¬ ben in Handy, G.N. et al., Proc. Natl. Acad. Sei. USA 78 (1981) 7365 - 7369 (39).
Der Vektor pSA-EK-PTH zur Expression des core-SA-PTΗ(l-37) Fusionsgens mit Enteroki- nasespaltstelle wurde gemäß der im Beispiel 1 beschriebenen Strategie für das core-SA- URO(95-126) Fusionsgen mit Enterokinasespaltstelle hergestellt.
In zwei Ansätzen wurden die komplementären Oligonukleotide 5 (SEQ ID NO:7) und 6 (SEQ ID NO.8)
5
AATTCGCTAGCGGTACCGTCGACGACGATGACAAATCCGTTTCCGAAATCCAGCT GATGCACAACCTGGGTAAACACCTGAACTC (SEQIDNO:7)
6
CATGGAGTTCAGGTGTTTACCCAGGTTGTGCATCAGCTGGATTTCGGAAACGGAT TTGTCATCGTCGTCGACGGTACCGCTAGCG (SEQ ID NO:8)
zu dem DNA Segment C (Fig. 2) und die Oligonukleotide 7 (SEQ ID NO:9) und 8 (SEQ ID NO: 10)
7
CATGGAACGTGTTGAATGGCTGCGTAAAAAACTGCAGGACGTTCACAACTTCGTT GCTCTGTAATGA (SEQIDNO:9)
8
AGCTTCATTACAGAGCAACGAAGTTGTGAACGTCCTGCAGTTTTTTACGCAGCCA TTCAACACGTTC (SEQ ID NO: 10) zu dem DNA Segment D (Fig 2) "annealt" (Reaktionspuffer 12,5 mmol/l Tπs-HCl, pH 7,0 und 12,5 mmol/l MgCl2 , Oligonukleotid-Konzentration jeweils 1 nmol / 60 μl) und die Hybridisierungsprodukte C und D jeweils in die Polylinkerregion des E coli pUCBM21 Vektors subkloniert (DNA Segment C, Schnittstellen EcoRI und Ncol, DNA Segment D, Schnittstellen Ncol und Hindlü) Mittels DNA Sequenzierung wurde die DNA Sequenz der beiden subklonierten DNA Segmente bestätigt Danach wurde das Expressionsplasmid pSA- EK-PTΗ für das core-SA-EK-PTH(l-37) Fusionsgen in einer Dreifragmentligation aus dem Nhel/NcoI-DNA Segment C , dem NcoI/HindüI-DNA Segment D und dem ca 2,9 kBp langen Nhel/Hindlll-pSAM-CORE Vektorfragment zusammengesetzt Dabei wurden die DNA Segmente C und D nach Doppelverdau mit den entsprechenden Endonukleasen aus den entsprechenden pUCBM21 Plasmidderivaten isoliert Das gewünschte Plasmid pSA-EK-PTH wurde durch Restriktionskartierung identifiziert und die DNA Sequenz des Enterokinaselin- ker-PTH-Bereichs erneut durch DNA Sequenzierung überprüft
Beispiel 3
Konstruktion des core-SA-PTH(l-37) Fusionsgens mit Thrombinlinker (Plasmid: pSA-
THRO-PTH)
Das Plasmid pSA-THRO-PTH leitet sich von dem core-SA-EK-PTH Expressionsplasmid pSA-EK-PTH (siehe Beispiel 2) ab, indem die kodierende Region für den Enterokinaselinker durch einen Thrombinlinker ersetzt wurde
Die Aminosauresequenz des verwendeten Thrombinlinkers [GDFLAEGLVPR] (SEQ ID NO 15) basiert auf der naturlichen Thrombinspaltstelle in Fibrinogen (Aminosaureposition 6- 16) und der minimalen Erkennungssequenz für Thrombin (Carter, P In Ladisch, M R , Willson, R C , Painton, C C , Builder, S E eds (1990) (12))
Dazu wurde das Plasmid pSA-EK-PTH mit Nhel und PvuII verdaut, das ca 2,9 kBp lange Nhel/PvuII-pSA-EK-PTH Vektorfragment isoliert und mit dem aus den 2 komplementären Oligonukleotiden 9 (SEQ ID NO 11) und 10 (SEQ ID NO 12) durch Hybridisierung herge¬ stellten DNA Segment E (Fig 3) ligiert
9
CTAGCCCGGGTGACTTCCTGGCTGAAGGTCTGGTTCCGCGTTCCGTTTCCGAAATC CAG (SEQ ID NO 11) 10
CTGGATTTCGGAAACGGAACGCGGAACCAGACCTTCAGCCAGGAAGTCACCCGG G (SEQ ID NO: 12)
Die gewünschte Plasmidkonstruktion pSA-THRO-PTH wurde durch Restriktionskartierung identifiziert und die ausgetauschte Linkeπegion durch DNA Sequenzierung überprüft.
Beispiel 4
Konstruktion des core-SA-PTH(l-37) Fusionsgens mit TEV Linker (Plasmid: pSA-
TEV-PTH)
Das Plasmid pSA-TEV-PTH leitet sich von dem core-SA-EK-PTH Expressionsplasmid pSA- EK-PTH (siehe Beispiel 2) ab, indem die kodierende Region für den Enterokinaselinker durch einen TEV Linker ersetzt wurde.
Die Pflanzenvirus TEV NIa Proteinase ("tobacco etch virus") erkennt die Aminosäuresequenz ENLYFQiG/S und spaltet zwischen Gin und Gly oder Ser (Dougherty, W.G. et al., (1988)) (13). Das rekombinat hergestellte Enzym wurde von GIBCO BRL (Life Technologies, Ine Gaithersburg, MD, USA) bezogen.
Dazu wurde das Plasmid pSA-EK-PTH mit Nhel und PvuII verdaut, das ca. 2,9 kBp lange Nhel/PvuII-pSA-EK-PTH Vektorfragment isoliert und mit dem aus den 2 komplementären Oligonukleotiden JI (SEQ ID NO: 13) und \2 (SEQ ID NO: 14) durch Hybridisierung herge¬ stellten DNA Segment F (Fig. 3) ligiert.
ii
CTAGCGGATCCGAAAACCTGTACTTCCAGTCCGTTTCCGAAATCCAG (SEQ ID NO: 13)
11
CTGGATTTCGGAAACGGACTGGAAGTACAGGTTTTCGGATCCG (SEQ ID NO: 14) Die gewünschte Plasmidkonstruktion pSA-TEV-PTH wurde durch Restriktionskartierung identifiziert und die ausgetauschte Linkerregion durch DNA Sequenzierung überprüft.
Beispiel 5
Expression der core-SA Fusionsproteine in E. coli
Zur Expression der core-SA Fusionsproteine wurde der E. coli Kl 2 Stamm RM82 (eine Methionin Revertante von ED 8654, Murray, N.E. et al.(1977)) (14) jeweils mit einem der in den Beispielen 1 - 4 beschriebenen Expressionsplasmiden pSA-EK-URO, pSA-EK-PTH, pSA-THRO-PTH und pSA-TEV-PTH (Ampicillin-Resistenz) und dem lacW-Repressorplas- mid pUBS500 (Kanamycin-Resistenz, Herstellung und Beschreibung siehe: EP-A 0368342) transformiert.
Die RM82/pUBS500/pSA-EK-URO, RM82/pUBS500/pSA-EK-PTH, RM82/pUBS500/pSA- THRO-PTH und RM82/pUBS500/pSA-TEV-PTH Zellen wurden in DYT-Medium (1% (w/v) Hefeextrakt, 1% (w/v) Bacto Tryptone (Difco, Detroit, USA) und 0,5% NaCl), mit 50 mg/l Ampicillin und 50 mg/l Kanamycin bis zu einer optischen Dichte bei 550 nm von 0,6 - 0,9 angezogen und anschließend mit IPTG (Isopropyl-ß-D-thiogalactosid) (1 - 5 mmol/l Endkon¬ zentration) induziert. Nach einer Induktionsphase von 4 - 8 Stunden wurden die Zellen durch Zentrifugation geerntet und die Zellpellets mit 25 mmol/l Kaliumphosphatpuffer, pH 7,5 gewaschen.
Expressionsanalyse
Die Zellpellets aus jeweils 1 ml abzentrifügiertem Anzuchtmedium (RM82/pUBS500/pSA- EK-URO, RM82/pUBS500/pSA-EK-PTH, RM82/pUBS500/pSA-THRO-PTH und
RM82/ρUBS500/pSA-TEV-PTH Zellen) wurden in 0,25 ml 10 mmol/l Phosphatpuffer, pH 6,8 und 1 mmol/l EDTA resuspendiert und die Zellen durch Ultraschallbehandlung aufge¬ schlossen. Nach Zentrifugation wurde der Überstand mit 1/5 Volumen 5xSDS-Probenpuffer (lxSDS-Probenpuffer: 50 mmol/l Tris-HCl, pH 6,8, 1% SDS, 1% Mercaptoethanol, 10% Glycerin, 0.001% Bromphenolblau) versetzt. Die unlösliche Zelltrümmerfraktion wurde in 0,3 ml lxSDS-Probenpuffer mit 6 - 8 M Harnstoff resuspendiert, die Proben 5 Minuten bei 95°C inkubiert und zentrifugiert. Danach wurden die Proteine durch SDS-Polyacrylamid Gelelek¬ trophorese (PAGE) aufgetrennt (Laemmli, U.K. (1970)) (15) und mit Coomassie Brilliant Blue R Farbstoff angefärbt. Die in E. coli synthetisierten core-SA Fusionsproteine waren homogen und wurden ausschließlichlich in der unlöslichen Zelltrümmerfraktion gefunden (IBs) Die Expressionshohe für die core-SA Fusionsproteine betrug 30 - 50% bezogen auf das E. coli Gesamtprotein
Beispiel 6
Zellyse und Präparation der "inclusion bodies" (IBs)
Jeweils 200 g (Naßgewicht) E coli RM82/pUBS500/pSA-EK-URO, RM82/pUBS500/pSA- EK-PTH, RM82/pUBS500/pSA-THRO-PTH und RM82/pUBS500/pSA-TEV-PTH Zellen wurden in 1 1 0, 1 mol/1 Tris-HCl, pH 7,0 bei 0°C suspendiert, 300 mg Lysozym zugegeben und 20 Minuten bei 0°C inkubiert Danach wurden die Zellen mechanisch mittels Hochdruck¬ dispersion vollständig aufgeschlossen und die DNA durch Zugabe von 2 ml 1 mol/1 MgCl2 und 10 mg DNAse (Boehringer Mannheim # 154709) bei 25°C in 30 Minuten verdaut Anschließend wurden zur Aufschlußlosung 500 ml 60 mmol/l EDTA, 6% Triton® XI 00 und 1,5 mol/1 NaCl, pH 7,0 zugemischt und weitere 30 Minuten bei 0°C inkubiert Danach wurden die unlöslichen Bestandteile (Zelltrummer und IBs) durch Zentrifugation sedimentiert
Das Pellet wurde in 1 1 0,1 mol/1 Tris-HCl, 20 mmol/l EDTA, pH 6,5 suspendiert, 30 Minuten bei 25°C inkubiert und das IB-Präparat durch Zentrifugation isoliert
Solubilisierung der IBs
25 g IB-Pellet (Naßgewicht) wurden in 200 ml 10 mmol/l Tris-HCl Puffer, 8 moL/1 Harnstoff, 10 mmol/l EDTA, pH 7,0 durch 2-stundiges Ruhren bei 25°C suspendiert Die unlöslichen Bestandteile wurden durch Zentrifugation abgetrennt und der klare Überstand weiterverarbei¬ tet
Beispiel 7
Verdünnung des Solubilisats
Die Verdünnung wurde in einem BioFloII-Fermenter (New Brunswick Scientific Co Ine , Edison, N J , USA) bei 25°C unter Rühren (300 UPM) durch kontinuierliche Zugabe von 200 ml Core-SA-Fusionsprotein-Solubilisat in 3,8 1 50 mmol/l Tris HCl pH 9,0 mittels einer Pumpe (Fordermenge 15-40 ml/Std ) bewirkt Beispiel 8
Enzymatische Spaltung der Core-SA Fusionsproteine
Enterokinase Spaltung ( Val Asp4Lys- Spaltsequenz)
Die core-SA Fusionsproteine mit Enterokinaseschnittstelle wurden in einer Konzentration von 0,3 bis 3 mg/ml und einem Substrat / Proteinase Verhältnis von 1:20 bis 1 :250 (Enterokinase, Restriktionsproteinase aus Kälberdarm, Boehringer Mannheim, Mannheim, Deutschland) in 50 mmol/l Tris-HCl, pH 8,0 bei 30°C verdaut und der zeitliche Verlauf der enzymatischen Spal¬ tung (Kinetik) durch analytische Reversed Phase HPLC (siehe Beispiel 9.1) analysiert. Dazu wurden aus dem Reaktionsansatz über einen Zeitraum von 6 bis 24 Stunden Proben ( 10 bis 100 μl) im Abstand von 1 bis 3 Stunden entnommen.
LysC Endoproteinase Spaltung (Lys- Spaltstelle)
Das Core-SA-EK-URO Fusionsprotein wurde in einer Konzentration von 0,3 bis 3 mg/ml und einem Substrat / Proteinase Verhältnis von 1:1000 bis 1 :25000 ( LysC Endoproteinase aus Lysobacter enzymogenes, sequencing grade; Boehringer Mannheim, Mannheim, Deutschland) in 50 mmol/l Tris-HCl, pH 8,0 bei 30 bis 35°C verdaut und der zeitliche Verlauf der enzymatischen Spaltung durch analytische Reversed Phase HPLC (siehe Beispiel 9.1) analysiert. Dazu wurden aus dem Reaktionsansatz über einen Zeitraum von 6 bis 24 Stunden Proben (10 bis 100 μl) im Abstand von 1 bis 3 Stunden entnommen.
Thrombin Spaltung (GDFLAEGLVPR-Spaltsequenz)
Das Core-SA-THRO-PTH Fusionsprotein wurde in einer Konzentration von 0,3 bis 3 mg/ml und einem Substrat / Proteinase Verhältnis von 1 :50 bis 1 :500 (Thrombin aus Humanplasma, Boehringer Mannheim, Mannheim, Deutschland) in 50 mmol/l Tris-HCl, pH 8,8 bei 25 bis 30° C verdaut und der zeitliche Verlauf der enzymatischen Spaltung durch analytische Reversed Phase HPLC (siehe Beispiel 9.1) analysiert. Dazu wurden aus dem Reaktionsansatz über einen Zeitraum von 6 bis 24 Stunden Proben (10 bis 100 μl) im Abstand von 1 bis 3 Stunden entnommen. TEV NIa Proteinase Spaltung (GluAsnLeuTyrPheGln-i-Gly/Ser-Spaltsequenz)
Das Core-SA-TEV-PTH Fusionsprotein wurde in einer Konzentration von 0,3 bis 3 mg/ml und einem Substrat / Proteinase Verhältnis von 1 :50 bis 1:500 (rekombinante TEV NIa Restriktionsproteinase, GIBCO BRL Life Technologies, Inc. Gaithersburg, MD, USA) in 50 mmol/l Tris-HCl, pH 8,0, 0,5 mmol/l EDTA und 1 mmol/l DTT bei 30°C verdaut und der zeitliche Verlauf der enzymatischen Spaltung durch analytische Reversed Phase HPLC (siehe Beispiel 9.1) analysiert. Dazu wurden aus dem Reaktionsansatz über einen Zeitraum von 6 bis
24 Stunden Proben (10 bis 100 μl) im Abstand von 1 bis 3 Stunden entnommen.
Beispiel 9
Abtrennung von Core-SA und nicht gespaltenem Core-SA Fusionsprotein durch
Präzipitation
Das freigesetzte Core-SA Trägerprotein und nicht gespaltenes Core-SA Fusionsprotein wurden aus dem Spaltungsansatz durch pH-Erniedrigung (pH < 6) präzipitiert. Der Spaltungsansatz wurde mit 1 mol/1 Zitronensäure bis zu einer Endkonzentration von
25 mmol/l versetzt, auf pH 3,0 eingestellt und das Präzipitat durch Zentrifugation oder Filtra¬ tion abgetrennt.
Beispiel 10
Reinigung der Peptide URO(95-126) und PTH(l-37)
Die enzymatisch freigesetzten Peptide können mit chromatographischen Methoden, die dem Fachmann bekannt sind, weiter gereinigt werden.
10.1 Reinigung der Peptide durch Kationenaustauschchromatographie an Fractogel EMD-SO3 650(M)
Der Spaltungsansatz wurde auf eine mit 25 mmol/l Citronensäure, pH 3,0 äquilibrierte Fractogel EMD-SO3"-650(M) Säule (3 x 40 cm, V = 283 ml) der Firma Merck (Darmstadt, Deutschland) beladen (1 SV/Std.) und so lange mit dem Äquilibrierungs- puffer gewaschen, bis die Absorption des Eluats bei 280 nm den Leerwert des Puffers erreichte. Die Elution des gebundenen Materials erfolgte durch einen Gradienten von 0 bis 1 mmol/l NaCl in Äquilibrierungspuffer (10 bis 20 SV, 1 SV/Std.). 10.2 Reinigung der Peptide durch Reversed Phase HPLC
Nach Vorreinigung der Peptide mittels Kationenaustauschchromatographie (siehe: Beispiel 10.1) wurde ein Aliquot von 1 bis 2 ml (ca. 100 bis 300 μg) durch semipräpa- rative RP-HPLC unter Fraktionierung weiter aufgereinigt.
Chromatographiebedingiingen:
Säule: Eurospher 100-Cg, 5 μm (4 x 250 mm, V = 3,17 ml)
Knauer, Berlin, Deutschland)
Probenvolumen: 1 - 2 ml (100 - 300 μg Protein)
Detektor: UV, 220 nn
Flußrate: 0,5 ml/min Fließmittel:
A: 0.13% TFA in H2O
B: 0.1% TFA, 80% Acetonitril, 20% H2O (v/v)
Beispiel 11
Analytische Reversed Phase (HPLC)
Die analytische reversed phase (HPLC) wurde mit einer Europhersäule durchgeführt (Europher 100-Cg, 5 μm (4 x 250 mm, V = 3, 17 ml, Knauer, Berlin, Deutschland). Das Probenvolumen betrug 10 - 100 μl, entsprechend 1 - 100 μg Protein. Die Detektion erfolgte mit einem UV-Detektor bei 220 nm. Chromatographiert wurde mit einer Flußrate von 0,5 ml/min.
Fließmittel:
A: 0,13 % Trifluoressigsäure in H2O (Gradient 100 - 0 % in 50 min)
B: 0,1 % Trifluoressigsäure, 80 % Acetonitril, 20 % H2O (v/v) (Gradient 0 - 100 % in
50 min). Beispiel 12
Charakterisierung der gereinigten Peptide
Die Identität und Reinheit der gereinigten Peptide wurde durch Massenspektroskopie (PD-MS und Laser-Desorptionsspektroskopie), analytische reversed phase HPLC, isoelektrische Fokusierung (Bark, J.E. et al., J. Forensic Sei. Soc. 16 (1976) 115 - 120 (42), SDS PAGE (Laemmli, U.K., Nature 227 (1970) 680 - 685 (43)) und Kapillar-Elektrophorese, im Vergleich mit einem chemisch hergestellten Standard, überprüft.
Referenzliste
1) Kent, S B H et al , Banburi Rep 29 (1988) 3 - 20
2) Hodson, J H , Bio/Technology 11 (1993) 1309 - 1310
3) Kopetzki, E et al , Clin Chem 40 (1994) 688 - 704
4) Wmnacker, E -L VCH Publishers, Weinheim and New York (1987)
5) Harris, T J R In Genetic Engineering (Williamson, R ed ), Academic Press, London, vol 4 (1983) 127 - 185
6 ) Sambrook, J et al (1989) In Molecular cloning A laboratory manual Cold Spring Harbor Laboratory Press, Cold Spring Harbor, New York
7) EP-B 0 198 015
8) EP-A 0 612 325
9) Sano, T , Biochem Biophys Res Commun 176 (1991) 571 - 577
10 ) Sano, T et al , Proc Natl Acad Sei , USA 89 (1992) 1534 - 1538
1 1 ) WO 93/09144
12 ) Carter, P In Ladisch, M R , Willson, R.C , Painton, C C , Builder, S E eds Protem
Purification From Molecular Mechanisms to Large-Scale Processes ACS Symposium Series No 427, Ameπcan Chemical Society, (1990) 181-193
13 ) Dougherty, W G et al , EMBO J 7 (1988) 1281-1287 14 ) Murray, N E et al , Mol Gen Genet 150 (1977) 53-61
15 ) Laemmli, U K , Nature 227 (1970) 680-685
16 ) Rokkones, E et al , J Biotechnol 33 (1994) 293 - 306 17 ) Forsberg, G et al , in J Prot Chem 10 (1991) 517 - 526
18 ) Gardella, T J et al , J Biol Chem 265 (1990)
19 ) Gram, H et al , Bio/Technology 12 (1994) 1017 - 1023
20 ) Itakura, K et al , Science 198 (1977) 1056-1063
21 ) EP-B 0 001 930
22 ) Sharma, A et al , Proc Natl Acad Sei USA 89 (1992) 1534-1538
23 ) Forssmann, K et al , Clin Wochensch 66 (1988) 752 - 759
24 ) Drummer, C et al , Pflugers Archiv, European J of Physiol 423 (1993) 372 - 377
25 ) Heim, J M , Biochem Biophys Res Commun 163 (1989) 37 - 41
26 ) Bub, A et al , Histochem J (Suppl.) 24 (1992) 517
27 ) Drummer, C et al , J Am Soc Nephrol 1 (1991) 1109 - 1113
28 ) Drummer, C et al , Am J Physiol 262 (1992) F 744 - 754
29 ) Emmeluth, C et al , Am J Physiol 262 (1992) F 513 - F 516 30.) Goetz, K.L. et al, J. Am. Soc. Nephrol. 1 (1990) 867 - 874
31.) DE 30 34 045 C2
32.) Allen, G. et al., J. Cell. Sei. Suppl. 3 (1985) 29
33.) Argarana CE. et al., Nucl. Acids Res. 14 (1986) 1871 - 1882
34.) Beattie, K.L. und Fowler, R.F., Nature 352 (1991) 548 - 549
35.) EP-B 0424 990
36.) Parks, T.D. et al., Anal. Biochem. 216 (1994) 413 - 417
37.) Pohlner, J. et al., Nature 325 (1987) 458 - 462
38.) EP-A 0467 839
39.) Handy, GN. et al., Proc. Natl. Acad. Sei., USA 78 (1981) 7365 - 7369
SEQUENZPROTOKOLL
(1) ALLGEMEINE ANGABEN:
(i) ANMELDER:
(A) NAME: BOEHRINGER MANNHEIM GMBH
(B) STRASSE: Sandhofer Str. 116
(C) ORT: Mannheim
(E) LAND: Germany
(F) POSTLEITZAHL: D-68305
(G) TELEFON: 08856/60-3446 (H) TELEFAX: 08856/60-3451
(ii) BEZEICHNUNG DER ERFINDUNG: Verfahren zur Herstellung von Peptiden ueber
Streptavidin-Fusionsproteine
(iii) ANZAHL DER SEQUENZEN: 15
(iv) COMPUTER-LESBARE FASSUNG:
(A) DATENTRÄGER: Floppy disk
(B) COMPUTER: IBM PC compatible
(C) BETRIEBSSYSTEM: PC-DOS/MS-DOS
(D) SOFTWARE: Patentin Release #1.0, Version #1.30B (EPA)
(2) ANGABEN ZU SEQ ID NO: 1:
(i) SEQUENZKENNZEICHEN:
(A) LÄNGE: 6 Aminosäuren
(B) ART: Aminosäure
(C) STRANGFORM: Einzelstrang
(D) TOPOLOGIE: linear
(ii) ART DES MOLEKÜLS: Peptid
(xi) SEQUENZBESCHREIBUNG: SEQ ID NO: 1
Val Asp Asp Asp Asp Lys 1 5
(2) ANGABEN ZU SEQ ID NO: 2:
(i) SEQUENZKENNZEICHEN:
(A) LÄNGE: 32 Aminosäuren
(B) ART: Aminosäure
(C) STRANGFORM: Einzelstrang
(D) TOPOLOGIE: linear
(ii) ART DES MOLEKÜLS: Peptid (xi) SEQUENZBESCHREIBUNG: SEQ ID NO: 2:
Thr Ala Pro Arg Ser Leu Arg Arg Ser Ser Cys Phe Gly Gly Arg Met 1 5 10 15
Asp Arg lle Gly Ala Gin Ser Gly Leu Gly Cys Asn Ser Phe Arg Tyr 20 25 30
(2) ANGABEN ZU SEQ ID NO: 3:
(i) SEQUENZKENNZEICHEN:
(A) LÄNGE: 68 Basenpaare
(B) ART: Nucleotid
(C) STRANGFORM: Einzelstrang
(D) TOPOLOGIE: linear
(ii) ART DES MOLEKÜLS: other nucleic acid
(A) BESCHREIBUNG: /desc = "synthetisches Oligonukleotid"
(xi) SEQUENZBESCHREIBUNG: SEQ ID NO: 3: AATTCGCTAG CGTTGACGAC GATGACAAAA CGGCGCCGCG TTCCCTGCGT AGATCTTCCT 60 GCTTCGGC 68
(2) ANGABEN ZU SEQ ID NO: 4:
(i) SEQUENZKENNZEICHEN:
(A) LÄNGE: 68 Basenpaare
(B) ART: Nucleotid
(C) STRANGFORM: Einzelstrang
(D) TOPOLOGIE: linear
(ii) ART DES MOLEKÜLS: other nucleic acid
(A) BESCHREIBUNG: /desc = "synthetisches Oligonukleotid"
(xi) SEQUENZBESCHREIBUNG: SEQ ID NO: 4: GGCCGCCGAA GCAGGAAGAT CTACGCAGGG AACGCGGCGC CGTTTTGTCA TCGTCGTCAA 60 CGCTAGCG 68
(2) ANGABEN ZU SEQ ID NO: 5:
(i) SEQUENZKENNZEICHEN:
(A) LÄNGE: 63 Basenpaare
(B) ART: Nucleotid
(C) STRANGFORM: Einzelstrang
(D) TOPOLOGIE: linear
(ii) ART DES MOLEKÜLS: other nucleic acid
(A) BESCHREIBUNG: /desc = "synthetische Oligonukleotid" (xi) SEQUENZBESCHREIBUNG: SEQ ID NO: 5: GGCCGCATGG ACCGTATCGG TGCTCAGTCC GGACTGGGTT GCAACTCCTT CCGTTACTAA 60 TGA 63
(2) ANGABEN ZU SEQ ID NO: 6:
(i) SEQUENZKENNZEICHEN:
(A) LÄNGE: 63 Basenpaare
(B) ART: Nucleotid
(C) STRANGFORM: Einzelstrang
(D) TOPOLOGIE: linear
(ii) ART DES MOLEKÜLS: other nucleic acid
(A) BESCHREIBUNG: /desc = "synthetisches Oligonukleotid"
(xi) SEQUENZBESCHREIBUNG: SEQ ID NO: 6: AGCTTCATTA GTAACGGAAG GAGTTGCAAC CCAGTCCGGA CTGAGCACCG ATACGGTCCA 60 TGC 63
(2) ANGABEN ZU SEQ ID NO: 7:
(i) SEQUENZKENNZEICHEN:
(A) LÄNGE: 85 Basenpaare
(B) ART: Nucleotid
(C) STRANGFORM: Einzelstrang
(D) TOPOLOGIE: linear
(ii) ART DES MOLEKÜLS: other nucleic acid
(A) BESCHREIBUNG: /desc = "synthetisches Oligonukleotid"
(xi) SEQUENZBESCHREIBUNG: SEQ ID NO: 7: AATTCGCTAG CGGTACCGTC GACGACGATG ACAAATCCGT TTCCGAAATC CAGCTGATGC 60 ACAACCTGGG TAAACACCTG AACTC 85
(2) ANGABEN ZU SEQ ID NO: 8:
(i) SEQUENZKENNZEICHEN:
(A) LÄNGE: 85 Basenpaare
(B) ART: Nucleotid
(C) STRANGFORM: Einzelstrang
(D) TOPOLOGIE: linear ;ii) ART DES MOLEKÜLS: other nucleic acid
(A) BESCHREIBUNG: /desc = "synthetisches Oligonukleotid"
(xi) SEQUENZBESCHREIBUNG: SEQ ID NO: 8: CATGGAGTTC AGGTGTTTAC CCAGGTTGTG CATCAGCTGG ATTTCGGAAA CGGATTTGTC 60 ATCGTCGTCG ACGGTACCGC TAGCG 85
(2) ANGABEN ZU SEQ ID NO: 9:
(i) SEQUENZKENNZEICHEN:
(A) LÄNGE: 67 Basenpaare
(B) ART: Nucleotid
(C) STRANGFORM: Einzelstrang
(D) TOPOLOGIE: linear
(ii) ART DES MOLEKÜLS: other nucleic acid
(A) BESCHREIBUNG: /desc = "synthetisches Oligonukleotid"
(xi) SEQUENZBESCHREIBUNG: SEQ ID NO: 9: CATGGAACGT GTTGAATGGC TGCGTAAAAA ACTGCAGGAC GTTCACAACT TCGTTGCTCT 60 GTAATGA 67
(2) ANGABEN ZU SEQ ID NO: 10:
(i) SEQUENZKENNZEICHEN:
(A) LÄNGE: 59 Basenpaare
(B) ART: Nucleotid
(C) STRANGFORM: Einzelstrang
(D) TOPOLOGIE: linear
(ii) ART DES MOLEKÜLS: other nucleic acid
(A) BESCHREIBUNG: /desc = "synthetisches Oligonukleotid"
(xi) SEQUENZBESCHREIBUNG: SEQ ID NO: 10: CTAGCCCGGG TGACTTCCTG GCTGAAGGTC TGGTTCCGCG TTCCGTTTCC GAAATCCAG 59 (2) ANGABEN ZU SEQ ID NO: 11:
(i) SEQUENZKENNZEICHEN:
(A) LÄNGE: 59 Basenpaare
(B) ART: Nucleotid
(C) STRANGFORM: Einzelstrang
(D) TOPOLOGIE: linear
(ii) ART DES MOLEKÜLS: other nucleic acid
(A) BESCHREIBUNG: /desc = "synthetisches Oligonukleotid"
(xi) SEQUENZBESCHREIBUNG: SEQ ID NO: 11: CTAGCCCGGG TGACTTCCTG GCTGAAGGTC TGGTTCCGCG TTCCGTTTCC GAAATCCAG 59 (2) ANGABEN ZU SEQ ID NO: 12:
(i) SEQUENZKENNZEICHEN:
(A) LÄNGE: 55 Basenpaare
(B) ART: Nucleotid
(C) STRANGFORM: Einzelstrang
(D) TOPOLOGIE: linear
(ii) ART DES MOLEKÜLS: other nucleic acid
(A) BESCHREIBUNG: /desc = "synthetisches Oligonukleotid"
(xi) SEQUENZBESCHREIBUNG: SEQ ID NO: 12: CTGGATTTCG GAAACGGAAC GCGGAACCAG ACCTTCAGCC AGGAAGTCAC CCGGG 55 (2) ANGABEN ZU SEQ ID NO: 13:
(i) SEQUENZKENNZEICHEN:
(A) LÄNGE: 47 Basenpaare
(B) ART: Nucleotid
(C) STRANGFORM: Einzelstrang
(D) TOPOLOGIE: linear
(ii) ART DES MOLEKÜLS: other nucleic acid
(A) BESCHREIBUNG: /desc = "synthetisches Oligonukleotid"
(xi) SEQUENZBESCHREIBUNG: SEQ ID NO: 13: CTAGCGGATC CGAAAACCTG TACTTCCAGT CCGTTTCCGA AATCCAG 47
(2) ANGABEN ZU SEQ ID NO: 14: (i) SEQUENZKENNZEICHEN:
(A) LÄNGE: 43 Basenpaare
(B) ART: Nucleotid
(C) STRANGFORM: Einzelstrang
(D) TOPOLOGIE: linear
(ii) ART DES MOLEKÜLS: other nucleic acid
(A) BESCHREIBUNG: /desc = "synthetisches Oligonukleotid"
(xi) SEQUENZBESCHREIBUNG: SEQ ID NO: 14: CTGGATTTCG GAAACGGACT GGAAGTACAG GTTTTCGGAT CCG 43
(2) ANGABEN ZU SEQ ID NO: 15:
(i) SEQUENZKENNZEICHEN:
(A) LÄNGE: 11 Aminosäuren
(B) ART: Aminosäure
(C) STRANGFORM: Einzelstrang
(D) TOPOLOGIE: linear
(ii) ART DES MOLEKÜLS: Peptid
(xi) SEQUENZBESCHREIBUNG: SEQ ID NO: 15:
Gly Asp Phe Leu Ala Glu Gly Leu Val Pro Arg 1 5 10

Claims

Patentansprüche
1 Verfahren zur rekombinanten Herstellung eines Peptids durch Expression einer DNA in Mikroorganismen, welche für ein Fusionsprotein aus Streptavidin und dem genannten Peptid codiert, wobei Streptavidin und Peptid über eine Peptidsequenz, welche durch eine Endoproteinase spaltbar ist, verbunden sind, Isolierung des unlöslichen, inaktiven Fusionsproteins, Solubilisierung des inaktiven Fusionsproteins mit einem Denaturie¬ rungsmittel, Verdünnung des Denaturierungsmittels bei einem pH- Wert zwischen 8,5 und 11, bis die Spaltung des Fusionsproteins durch eine Endoproteinase durchführbar ist, Spaltung des Fusionsproteins, Erniedrigung des pH-Werts, bis das abgespaltene Streptavidin und nicht gespaltenes Fusionsprotein prazipitieren, und Reinigung des gewünschten Peptids aus dem Überstand.
2. Verfahren nach Anspruch 1, dadurch gekennzeichnet, daß die Verdünnung des solubili- sierten, inaktiven Proteins in wäßrige Pufferlösung erfolgt.
3. Verfahren nach den Ansprüchen 1 - 3, dadurch gekennzeichnet, daß als Peptid Urodilatin, Parathormon oder ein davon abgeleitetes Fragment verwendet wird.
4. Verfahren nach den Ansprüchen 1 - 3, dadurch gekennzeichnet, daß als Peptid ein Fragment von Urodilatin (95 - 126) der Aminosauren 99 - 126 oder 102 - 126 oder ein Fragment von Parathormon der Aminosauren 1 - 37 verwendet wird
EP96938115A 1995-11-16 1996-11-06 Verfahren zur herstellung von peptiden über streptavidin-fusionsproteine Withdrawn EP0861325A1 (de)

Applications Claiming Priority (3)

Application Number Priority Date Filing Date Title
DE19542702 1995-11-16
DE19542702 1995-11-16
PCT/EP1996/004850 WO1997018314A1 (de) 1995-11-16 1996-11-06 Verfahren zur herstellung von peptiden über streptavidin-fusionsproteine

Publications (1)

Publication Number Publication Date
EP0861325A1 true EP0861325A1 (de) 1998-09-02

Family

ID=7777604

Family Applications (1)

Application Number Title Priority Date Filing Date
EP96938115A Withdrawn EP0861325A1 (de) 1995-11-16 1996-11-06 Verfahren zur herstellung von peptiden über streptavidin-fusionsproteine

Country Status (6)

Country Link
US (1) US6136564A (de)
EP (1) EP0861325A1 (de)
JP (1) JP2000500019A (de)
AU (1) AU7566396A (de)
CA (1) CA2237296C (de)
WO (1) WO1997018314A1 (de)

Families Citing this family (36)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20020168718A1 (en) * 1997-04-03 2002-11-14 California Institute Of Technology Enzyme-mediated modification of fibrin for tissue engineering
US7601685B2 (en) * 1998-08-27 2009-10-13 Eidgenossische Technische Hochschule Zurich Growth factor modified protein matrices for tissue engineering
US6958212B1 (en) * 1999-02-01 2005-10-25 Eidgenossische Technische Hochschule Zurich Conjugate addition reactions for the controlled delivery of pharmaceutically active compounds
WO2000044808A1 (en) 1999-02-01 2000-08-03 Hubbell Jeffrey A Biomaterials formed by nucleophilic addition reaction to conjugated unsaturated groups
US7144991B2 (en) 1999-06-07 2006-12-05 Aletheon Pharmaceuticals, Inc. Streptavidin expressed gene fusions and methods of use thereof
AU5597500A (en) * 1999-06-07 2000-12-28 Neorx Corporation Streptavidin expressed gene fusions and methods of use thereof
US7291673B2 (en) * 2000-06-02 2007-11-06 Eidgenossiche Technische Hochschule Zurich Conjugate addition reactions for the controlled delivery of pharmaceutically active compounds
JP4560291B2 (ja) * 2001-12-18 2010-10-13 イジュノシッヒ テクニッヒ ホッフシューラ チューリッヒ 組織操作のための成長因子改変タンパク質マトリクス
US7247609B2 (en) * 2001-12-18 2007-07-24 Universitat Zurich Growth factor modified protein matrices for tissue engineering
EP1465989B1 (de) * 2001-12-18 2008-02-20 Eidgenossisch Technische Hochschule Zurich Wachstumsfaktor-modifizierte proteinmatrizes zur geweberekonstruktion (tissue engineering)
US8282912B2 (en) * 2002-03-22 2012-10-09 Kuros Biosurgery, AG Compositions for tissue augmentation
US8399400B2 (en) 2004-12-01 2013-03-19 Syntaxin, Ltd. Fusion proteins
US8778634B2 (en) 2004-12-01 2014-07-15 Syntaxin, Ltd. Non-cytotoxic protein conjugates
US8603779B2 (en) 2004-12-01 2013-12-10 Syntaxin, Ltd. Non-cytotoxic protein conjugates
GB0426394D0 (en) * 2004-12-01 2005-01-05 Health Prot Agency Fusion proteins
US8512984B2 (en) 2004-12-01 2013-08-20 Syntaxin, Ltd. Non-cytotoxic protein conjugates
JP2008529972A (ja) * 2004-12-22 2008-08-07 クロス・バイオサージェリー・アクチェンゲゼルシャフト 酵素的に分解可能な連結を通じて生物活性因子が組み入れられている合成バイオマテリアル
US8575101B2 (en) 2005-01-06 2013-11-05 Kuros Biosurgery Ag Supplemented matrices for the repair of bone fractures
ES2902872T3 (es) * 2005-01-06 2022-03-30 Kuros Biosurgery Ag Matrices suplementadas para la reparación de fracturas óseas
WO2006073711A2 (en) * 2005-01-06 2006-07-13 Kuros Biosurgery Ag Use of a matrix comprising a contrast agent in soft tissues
GB0610867D0 (en) * 2006-06-01 2006-07-12 Syntaxin Ltd Treatment of pain
PL2136850T3 (pl) 2007-04-13 2012-07-31 Kuros Biosurgery Ag Polimeryczny uszczelniacz tkankowy
WO2009083544A2 (en) 2007-12-28 2009-07-09 Kuros Biosurgery Ag Pdgf fusion proteins incorporated into fibrin foams
PE20120591A1 (es) 2009-04-02 2012-05-23 Roche Glycart Ag Anticuerpos multiespecificos que comprenden anticuerpos de longitud completa y fragmentos fab de cadena sencilla
WO2011034605A2 (en) * 2009-09-16 2011-03-24 Genentech, Inc. Coiled coil and/or tether containing protein complexes and uses thereof
AR080793A1 (es) 2010-03-26 2012-05-09 Roche Glycart Ag Anticuerpos biespecificos
RU2013110875A (ru) 2010-08-24 2014-09-27 Ф.Хоффманн-Ля Рош Аг БИСПЕЦИФИЧЕСКИЕ АНТИТЕЛА, СОДЕРЖАЩИЕ СТАБИЛИЗИРОВАННЫЙ ДИСУЛЬФИДОМ ФРАГМЕНТ Fv
JP5766296B2 (ja) 2010-12-23 2015-08-19 エフ.ホフマン−ラ ロシュ アーゲーF. Hoffmann−La Roche Aktiengesellschaft ポリペプチド−ポリヌクレオチド複合体、およびエフェクター成分の標的化された送達におけるその使用
EP2678002A2 (de) 2011-02-25 2014-01-01 Medtronic, Inc. Therapie für nierenerkrankungen und/oder herzinsuffizienz
WO2012123028A1 (en) 2011-03-16 2012-09-20 Kuros Biosurgery Ag Pharmaceutical formulation for use in spinal fusion
US20130244937A1 (en) 2011-09-02 2013-09-19 Nile Therapeutics, Inc. Chimeric natriuretic peptide compositions and methods of preparation
MX2014009565A (es) 2012-02-10 2014-11-10 Genentech Inc Anticuerpos monocatenarios y otros heteromultimeros.
RU2015100656A (ru) 2012-06-27 2016-08-20 Ф. Хоффманн-Ля Рош Аг Способ получения конъюгатов fc-фрагмента антитела, включающих по меньшей мере одну связывающую группировку, которая специфически связывается с мишенью, и их применения
JP6203838B2 (ja) 2012-06-27 2017-09-27 エフ.ホフマン−ラ ロシュ アーゲーF. Hoffmann−La Roche Aktiengesellschaft 少なくとも2つの異なる結合実体を含む、テーラーメイドの高度に選択的かつ多重特異的なターゲティング実体を選択および作製するための方法、ならびにその使用
US20140056870A1 (en) 2012-08-27 2014-02-27 Allergan, Inc. Fusion proteins
WO2016087416A1 (en) 2014-12-03 2016-06-09 F. Hoffmann-La Roche Ag Multispecific antibodies

Family Cites Families (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JP2624470B2 (ja) * 1984-10-02 1997-06-25 バイオジェン インコーポレイテッド ストレプトアビジン様ポリペプチドの製造
GB8518753D0 (en) * 1985-07-24 1985-08-29 Glaxo Group Ltd Microbiological products
DE3878231T2 (de) * 1987-03-02 1993-05-27 Bissendorf Peptide Gmbh Neues cadiodilatin-fragment, prozess zu dessen herstellung und dessen anwendung.
GB8723661D0 (en) * 1987-10-08 1987-11-11 British Bio Technology Synthetic gene
DE3935738A1 (de) * 1989-10-27 1991-05-08 Forssmann Wolf Georg Arzneimittel, enthaltend das humane parathormon-fragment (1-37) als aktiven wirkstoff
ATE253639T1 (de) * 1991-08-19 2003-11-15 Daiichi Suntory Pharma Co Ltd Verfahren zur herstellung von peptiden

Non-Patent Citations (1)

* Cited by examiner, † Cited by third party
Title
See references of WO9718314A1 *

Also Published As

Publication number Publication date
CA2237296C (en) 2008-10-07
US6136564A (en) 2000-10-24
WO1997018314A1 (de) 1997-05-22
CA2237296A1 (en) 1997-05-22
JP2000500019A (ja) 2000-01-11
AU7566396A (en) 1997-06-05

Similar Documents

Publication Publication Date Title
EP0861325A1 (de) Verfahren zur herstellung von peptiden über streptavidin-fusionsproteine
AU605291B2 (en) Process for the purification of recombinant polypeptides
JP3054192B2 (ja) 副甲状腺ホルモンの製造のための組換えdna法
EP0542863B1 (de) Expression rekombinanter polypeptide mit verbesserter möglichkeit zur reinigung
US5013653A (en) Product and process for introduction of a hinge region into a fusion protein to facilitate cleavage
DE69521752T2 (de) Verfahren für die Herstellung von Proteinen
DE69233008T2 (de) Fusionierung von Peptiden und Proteinen mit Thioredoxin und thioredoxin-ähnlichen Molekülen
DE60208343T2 (de) FUSIONSPROTEINE aus hirudin und proinsulin oder insulin
US8298789B2 (en) Orthogonal process for purification of recombinant human parathyroid hormone (rhPTH) (1-34)
NZ338004A (en) Process for producing peptide with glucagon like peptide-1 (GLP-1) activity by incorporating a protective and helper component to facilitate purification
US5389529A (en) Modified lamβ signal sequence and processes for producing recombinant neurotrophins
EP1931705B1 (de) Verfahren zur amidierung von polypeptiden mit c-terminalen basischen aminosäuren unter verwendung spezifischer endoproteasen
DE102004058306A1 (de) Verfahren zur Herstellung von Carboxy-terminal amidierten Peptiden
AU665034B2 (en) Production of human parathyroid hormone from microorganisms
JPH03228682A (ja) E.コリでの非融合タンパク質の調製方法
EP1066328A1 (de) Chimäres protein welches eine intramolekulare chaperon-ähnliche sequenz enthältund dessen anwendung zur insulinproduktion
WO1992022665A1 (en) Production and recovery of recombinant neurotrophins
EP0851930A1 (de) Verfahren zur herstellung von natriuretischen peptiden über streptavidin-fusionsproteine
USRE37919E1 (en) Recombinant DNA method for production of parathyroid hormone
KR100473443B1 (ko) 단백질의 생산방법
JP2002533072A (ja) β−リポトロピンおよび他のペプチドの組換え合成

Legal Events

Date Code Title Description
PUAI Public reference made under article 153(3) epc to a published international application that has entered the european phase

Free format text: ORIGINAL CODE: 0009012

17P Request for examination filed

Effective date: 19980616

AK Designated contracting states

Kind code of ref document: A1

Designated state(s): AT BE CH DE DK ES FI FR GB GR IE IT LI LU NL PT SE

RAP3 Party data changed (applicant data changed or rights of an application transferred)

Owner name: ROCHE DIAGNOSTICS GMBH

17Q First examination report despatched

Effective date: 20031016

STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: THE APPLICATION IS DEEMED TO BE WITHDRAWN

18D Application deemed to be withdrawn

Effective date: 20040427