EP0626013A1 - $g(b)-LACTAMASE RECOMBINANTE, UTILISABLE EN TANT QUE MOLECULE PORTEUSE POUR LA PREPARATION DE COMPOSITIONS IMMUNOGENES - Google Patents
$g(b)-LACTAMASE RECOMBINANTE, UTILISABLE EN TANT QUE MOLECULE PORTEUSE POUR LA PREPARATION DE COMPOSITIONS IMMUNOGENESInfo
- Publication number
- EP0626013A1 EP0626013A1 EP93905393A EP93905393A EP0626013A1 EP 0626013 A1 EP0626013 A1 EP 0626013A1 EP 93905393 A EP93905393 A EP 93905393A EP 93905393 A EP93905393 A EP 93905393A EP 0626013 A1 EP0626013 A1 EP 0626013A1
- Authority
- EP
- European Patent Office
- Prior art keywords
- lactamase
- recombinant
- sequence
- nucleotide sequence
- protein
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Withdrawn
Links
- 239000000203 mixture Substances 0.000 title claims abstract description 33
- 230000002163 immunogen Effects 0.000 title claims description 19
- 238000002360 preparation method Methods 0.000 title abstract description 11
- 108090000623 proteins and genes Proteins 0.000 claims abstract description 104
- 102000006635 beta-lactamase Human genes 0.000 claims abstract description 92
- 108090000204 Dipeptidase 1 Proteins 0.000 claims abstract description 90
- 239000002773 nucleotide Substances 0.000 claims abstract description 85
- 125000003729 nucleotide group Chemical group 0.000 claims abstract description 85
- 102000004169 proteins and genes Human genes 0.000 claims abstract description 45
- 230000014509 gene expression Effects 0.000 claims abstract description 44
- 108091028043 Nucleic acid sequence Proteins 0.000 claims abstract description 13
- 108091026890 Coding region Proteins 0.000 claims abstract description 7
- 239000013612 plasmid Substances 0.000 claims description 75
- 239000012634 fragment Substances 0.000 claims description 62
- 108090000765 processed proteins & peptides Proteins 0.000 claims description 46
- 241000186365 Mycobacterium fortuitum Species 0.000 claims description 30
- 239000013598 vector Substances 0.000 claims description 26
- 238000003780 insertion Methods 0.000 claims description 23
- 230000037431 insertion Effects 0.000 claims description 23
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 claims description 21
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 claims description 21
- 239000000427 antigen Substances 0.000 claims description 20
- 108091007433 antigens Proteins 0.000 claims description 20
- 102000036639 antigens Human genes 0.000 claims description 20
- 241000894006 Bacteria Species 0.000 claims description 18
- 210000004027 cell Anatomy 0.000 claims description 17
- 230000028993 immune response Effects 0.000 claims description 15
- 229920001184 polypeptide Polymers 0.000 claims description 15
- 102000004196 processed proteins & peptides Human genes 0.000 claims description 15
- 241000713772 Human immunodeficiency virus 1 Species 0.000 claims description 14
- 230000001413 cellular effect Effects 0.000 claims description 14
- 241000588724 Escherichia coli Species 0.000 claims description 13
- 230000001681 protective effect Effects 0.000 claims description 9
- 241001430294 unidentified retrovirus Species 0.000 claims description 9
- 150000001413 amino acids Chemical class 0.000 claims description 8
- 241000725303 Human immunodeficiency virus Species 0.000 claims description 7
- 210000004899 c-terminal region Anatomy 0.000 claims description 7
- 230000028327 secretion Effects 0.000 claims description 7
- 239000002904 solvent Substances 0.000 claims description 7
- 230000000890 antigenic effect Effects 0.000 claims description 6
- 241000186359 Mycobacterium Species 0.000 claims description 5
- 241001467552 Mycobacterium bovis BCG Species 0.000 claims description 5
- 239000003795 chemical substances by application Substances 0.000 claims description 5
- 238000010367 cloning Methods 0.000 claims description 5
- 239000003937 drug carrier Substances 0.000 claims description 5
- 230000010076 replication Effects 0.000 claims description 5
- 241000233866 Fungi Species 0.000 claims description 4
- 208000031886 HIV Infections Diseases 0.000 claims description 4
- 241000713340 Human immunodeficiency virus 2 Species 0.000 claims description 4
- 241001465754 Metazoa Species 0.000 claims description 4
- 102000037865 fusion proteins Human genes 0.000 claims description 4
- 108020001507 fusion proteins Proteins 0.000 claims description 4
- 230000004048 modification Effects 0.000 claims description 4
- 238000012986 modification Methods 0.000 claims description 4
- 241000228212 Aspergillus Species 0.000 claims description 3
- 102000035195 Peptidases Human genes 0.000 claims description 3
- 108091005804 Peptidases Proteins 0.000 claims description 3
- 239000004365 Protease Substances 0.000 claims description 3
- 241000607142 Salmonella Species 0.000 claims description 3
- LWGJTAZLEJHCPA-UHFFFAOYSA-N n-(2-chloroethyl)-n-nitrosomorpholine-4-carboxamide Chemical compound ClCCN(N=O)C(=O)N1CCOCC1 LWGJTAZLEJHCPA-UHFFFAOYSA-N 0.000 claims description 3
- 230000001717 pathogenic effect Effects 0.000 claims description 3
- 230000001018 virulence Effects 0.000 claims description 3
- 101710121417 Envelope glycoprotein Proteins 0.000 claims description 2
- 230000001939 inductive effect Effects 0.000 claims description 2
- 230000010354 integration Effects 0.000 claims description 2
- 108010089520 pol Gene Products Proteins 0.000 claims description 2
- 102100021696 Syncytin-1 Human genes 0.000 claims 1
- 239000013599 cloning vector Substances 0.000 claims 1
- 239000013604 expression vector Substances 0.000 claims 1
- 241001446247 uncultured actinomycete Species 0.000 claims 1
- 239000003981 vehicle Substances 0.000 claims 1
- 229960005486 vaccine Drugs 0.000 abstract description 14
- 235000018102 proteins Nutrition 0.000 description 41
- 230000004927 fusion Effects 0.000 description 18
- 102000004190 Enzymes Human genes 0.000 description 14
- 108090000790 Enzymes Proteins 0.000 description 14
- 108091034117 Oligonucleotide Proteins 0.000 description 14
- 241000187480 Mycobacterium smegmatis Species 0.000 description 12
- JLCPHMBAVCMARE-UHFFFAOYSA-N [3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-hydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methyl [5-(6-aminopurin-9-yl)-2-(hydroxymethyl)oxolan-3-yl] hydrogen phosphate Polymers Cc1cn(C2CC(OP(O)(=O)OCC3OC(CC3OP(O)(=O)OCC3OC(CC3O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c3nc(N)[nH]c4=O)C(COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3CO)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cc(C)c(=O)[nH]c3=O)n3cc(C)c(=O)[nH]c3=O)n3ccc(N)nc3=O)n3cc(C)c(=O)[nH]c3=O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)O2)c(=O)[nH]c1=O JLCPHMBAVCMARE-UHFFFAOYSA-N 0.000 description 11
- 239000000284 extract Substances 0.000 description 11
- 239000000523 sample Substances 0.000 description 11
- 238000010276 construction Methods 0.000 description 9
- 239000002609 medium Substances 0.000 description 9
- 108020004256 Beta-lactamase Proteins 0.000 description 8
- 238000004519 manufacturing process Methods 0.000 description 8
- 108020004414 DNA Proteins 0.000 description 7
- 235000001014 amino acid Nutrition 0.000 description 7
- 239000001963 growth medium Substances 0.000 description 7
- 108700019146 Transgenes Proteins 0.000 description 6
- 125000003275 alpha amino acid group Chemical group 0.000 description 6
- 238000004458 analytical method Methods 0.000 description 6
- 241000222732 Leishmania major Species 0.000 description 5
- 238000004520 electroporation Methods 0.000 description 5
- 230000001131 transforming effect Effects 0.000 description 5
- 241000699670 Mus sp. Species 0.000 description 4
- 241000700605 Viruses Species 0.000 description 4
- 230000003321 amplification Effects 0.000 description 4
- 239000003242 anti bacterial agent Substances 0.000 description 4
- 229940088710 antibiotic agent Drugs 0.000 description 4
- 230000036755 cellular response Effects 0.000 description 4
- 238000011161 development Methods 0.000 description 4
- 229930027917 kanamycin Natural products 0.000 description 4
- 229960000318 kanamycin Drugs 0.000 description 4
- SBUJHOSQTJFQJX-NOAMYHISSA-N kanamycin Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CN)O[C@@H]1O[C@H]1[C@H](O)[C@@H](O[C@@H]2[C@@H]([C@@H](N)[C@H](O)[C@@H](CO)O2)O)[C@H](N)C[C@@H]1N SBUJHOSQTJFQJX-NOAMYHISSA-N 0.000 description 4
- 229930182823 kanamycin A Natural products 0.000 description 4
- 238000003199 nucleic acid amplification method Methods 0.000 description 4
- 238000012360 testing method Methods 0.000 description 4
- 108020004705 Codon Proteins 0.000 description 3
- 241000222697 Leishmania infantum Species 0.000 description 3
- 239000002671 adjuvant Substances 0.000 description 3
- 210000000805 cytoplasm Anatomy 0.000 description 3
- 238000012217 deletion Methods 0.000 description 3
- 230000037430 deletion Effects 0.000 description 3
- 238000009396 hybridization Methods 0.000 description 3
- 238000000338 in vitro Methods 0.000 description 3
- 230000006698 induction Effects 0.000 description 3
- 210000001165 lymph node Anatomy 0.000 description 3
- 239000012528 membrane Substances 0.000 description 3
- 238000000034 method Methods 0.000 description 3
- 239000000047 product Substances 0.000 description 3
- 230000035755 proliferation Effects 0.000 description 3
- 201000008827 tuberculosis Diseases 0.000 description 3
- 238000011144 upstream manufacturing Methods 0.000 description 3
- 238000001262 western blot Methods 0.000 description 3
- LGGRPYXPOUIMKG-OJICBBQQSA-N (2S)-2-[[(2S)-2-[[(2S,3S)-2-[[(2S,3R)-2-[[2-[[(2S,3S)-2-[[(2S,3S)-2-[[(2S)-4-amino-2-[[(2S)-6-amino-2-[[(2S,3R)-2-[[(2S,3R)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[2-[[(2S)-1-[2-[[(2S,3S)-2-[[(2S)-2-[[(2S,3S)-2-[[(2S)-2-[[(2S)-6-amino-2-[[(2S)-2-[[(2S)-6-amino-2-[[(2S)-4-amino-2-[[(2S)-2-[[(2S)-4-amino-2-[[(2S)-1-[(2S)-2-[[(2S,3R)-2-amino-3-hydroxybutanoyl]amino]-5-(diaminomethylideneamino)pentanoyl]pyrrolidine-2-carbonyl]amino]-4-oxobutanoyl]amino]-3-(4-hydroxyphenyl)propanoyl]amino]-4-oxobutanoyl]amino]hexanoyl]amino]-5-(diaminomethylideneamino)pentanoyl]amino]hexanoyl]amino]-5-(diaminomethylideneamino)pentanoyl]amino]-3-methylpentanoyl]amino]-3-(1H-imidazol-4-yl)propanoyl]amino]-3-methylpentanoyl]amino]acetyl]pyrrolidine-2-carbonyl]amino]acetyl]amino]-5-(diaminomethylideneamino)pentanoyl]amino]propanoyl]amino]-3-phenylpropanoyl]amino]-3-(4-hydroxyphenyl)propanoyl]amino]-3-hydroxybutanoyl]amino]-3-hydroxybutanoyl]amino]hexanoyl]amino]-4-oxobutanoyl]amino]-3-methylpentanoyl]amino]-3-methylpentanoyl]amino]acetyl]amino]-3-hydroxybutanoyl]amino]-3-methylpentanoyl]amino]-5-(diaminomethylideneamino)pentanoyl]amino]-N-[(2S)-1-[[(2S)-1-amino-3-(1H-imidazol-4-yl)-1-oxopropan-2-yl]amino]-1-oxopropan-2-yl]pentanediamide Chemical group CC[C@H](C)[C@@H](C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H]([C@@H](C)CC)C(=O)NCC(=O)N2CCC[C@H]2C(=O)NCC(=O)N[C@@H](CCCN=C(N)N)C(=O)N[C@@H](C)C(=O)N[C@@H](CC3=CC=CC=C3)C(=O)N[C@@H](CC4=CC=C(C=C4)O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(=O)N)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)CC)C(=O)NCC(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCCN=C(N)N)C(=O)N[C@@H](CCC(=O)N)C(=O)N[C@@H](C)C(=O)N[C@@H](CC5=CNC=N5)C(=O)N)NC(=O)[C@H](CCCN=C(N)N)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCN=C(N)N)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CC(=O)N)NC(=O)[C@H](CC6=CC=C(C=C6)O)NC(=O)[C@H](CC(=O)N)NC(=O)[C@@H]7CCCN7C(=O)[C@H](CCCN=C(N)N)NC(=O)[C@H]([C@@H](C)O)N LGGRPYXPOUIMKG-OJICBBQQSA-N 0.000 description 2
- 208000030507 AIDS Diseases 0.000 description 2
- ZHNUHDYFZUAESO-UHFFFAOYSA-N Formamide Chemical compound NC=O ZHNUHDYFZUAESO-UHFFFAOYSA-N 0.000 description 2
- 241000222722 Leishmania <genus> Species 0.000 description 2
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 2
- 235000014680 Saccharomyces cerevisiae Nutrition 0.000 description 2
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 2
- 241000191967 Staphylococcus aureus Species 0.000 description 2
- 241000187759 Streptomyces albus Species 0.000 description 2
- 230000024932 T cell mediated immunity Effects 0.000 description 2
- 229960000723 ampicillin Drugs 0.000 description 2
- AVKUERGKIZMTKX-NJBDSQKTSA-N ampicillin Chemical compound C1([C@@H](N)C(=O)N[C@H]2[C@H]3SC([C@@H](N3C2=O)C(O)=O)(C)C)=CC=CC=C1 AVKUERGKIZMTKX-NJBDSQKTSA-N 0.000 description 2
- 230000001580 bacterial effect Effects 0.000 description 2
- 229960005091 chloramphenicol Drugs 0.000 description 2
- WIIZWVCIJKGZOK-RKDXNWHRSA-N chloramphenicol Chemical compound ClC(Cl)C(=O)N[C@H](CO)[C@H](O)C1=CC=C([N+]([O-])=O)C=C1 WIIZWVCIJKGZOK-RKDXNWHRSA-N 0.000 description 2
- 239000013611 chromosomal DNA Substances 0.000 description 2
- 230000000295 complement effect Effects 0.000 description 2
- 230000002255 enzymatic effect Effects 0.000 description 2
- 230000002068 genetic effect Effects 0.000 description 2
- 210000000987 immune system Anatomy 0.000 description 2
- 230000005847 immunogenicity Effects 0.000 description 2
- 238000011534 incubation Methods 0.000 description 2
- 238000002347 injection Methods 0.000 description 2
- 239000007924 injection Substances 0.000 description 2
- 238000011081 inoculation Methods 0.000 description 2
- HQKMJHAJHXVSDF-UHFFFAOYSA-L magnesium stearate Chemical compound [Mg+2].CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O HQKMJHAJHXVSDF-UHFFFAOYSA-L 0.000 description 2
- 244000005700 microbiome Species 0.000 description 2
- 238000010899 nucleation Methods 0.000 description 2
- 150000007523 nucleic acids Chemical group 0.000 description 2
- 244000045947 parasite Species 0.000 description 2
- 244000052769 pathogen Species 0.000 description 2
- 239000000546 pharmaceutical excipient Substances 0.000 description 2
- 230000001737 promoting effect Effects 0.000 description 2
- 238000000746 purification Methods 0.000 description 2
- 108091008146 restriction endonucleases Proteins 0.000 description 2
- 239000013605 shuttle vector Substances 0.000 description 2
- 239000000243 solution Substances 0.000 description 2
- 238000003756 stirring Methods 0.000 description 2
- 239000006228 supernatant Substances 0.000 description 2
- 238000013519 translation Methods 0.000 description 2
- 238000002255 vaccination Methods 0.000 description 2
- 230000003612 virological effect Effects 0.000 description 2
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 2
- YYGNTYWPHWGJRM-UHFFFAOYSA-N (6E,10E,14E,18E)-2,6,10,15,19,23-hexamethyltetracosa-2,6,10,14,18,22-hexaene Chemical compound CC(C)=CCCC(C)=CCCC(C)=CCCC=C(C)CCC=C(C)CCC=C(C)C YYGNTYWPHWGJRM-UHFFFAOYSA-N 0.000 description 1
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 1
- 241000186361 Actinobacteria <class> Species 0.000 description 1
- 241000972773 Aulopiformes Species 0.000 description 1
- 241000304886 Bacilli Species 0.000 description 1
- 241000193830 Bacillus <bacterium> Species 0.000 description 1
- 102100026189 Beta-galactosidase Human genes 0.000 description 1
- 241000589968 Borrelia Species 0.000 description 1
- 101100148606 Caenorhabditis elegans pst-1 gene Proteins 0.000 description 1
- UXVMQQNJUSDDNG-UHFFFAOYSA-L Calcium chloride Chemical compound [Cl-].[Cl-].[Ca+2] UXVMQQNJUSDDNG-UHFFFAOYSA-L 0.000 description 1
- 108010078791 Carrier Proteins Proteins 0.000 description 1
- 102000014914 Carrier Proteins Human genes 0.000 description 1
- KRKNYBCHXYNGOX-UHFFFAOYSA-K Citrate Chemical compound [O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O KRKNYBCHXYNGOX-UHFFFAOYSA-K 0.000 description 1
- 108020003215 DNA Probes Proteins 0.000 description 1
- 239000003298 DNA probe Substances 0.000 description 1
- 102100030204 Echinoderm microtubule-associated protein-like 5 Human genes 0.000 description 1
- 102100027723 Endogenous retrovirus group K member 6 Rec protein Human genes 0.000 description 1
- 101001095863 Enterobacteria phage T4 RNA ligase 1 Proteins 0.000 description 1
- 101710177291 Gag polyprotein Proteins 0.000 description 1
- 208000003098 Ganglion Cysts Diseases 0.000 description 1
- 241000238631 Hexapoda Species 0.000 description 1
- 101001011842 Homo sapiens Echinoderm microtubule-associated protein-like 5 Proteins 0.000 description 1
- 206010020460 Human T-cell lymphotropic virus type I infection Diseases 0.000 description 1
- 241000714260 Human T-lymphotropic virus 1 Species 0.000 description 1
- 241000714259 Human T-lymphotropic virus 2 Species 0.000 description 1
- 108700020134 Human immunodeficiency virus 1 nef Proteins 0.000 description 1
- XQFRJNBWHJMXHO-RRKCRQDMSA-N IDUR Chemical compound C1[C@H](O)[C@@H](CO)O[C@H]1N1C(=O)NC(=O)C(I)=C1 XQFRJNBWHJMXHO-RRKCRQDMSA-N 0.000 description 1
- 101710084021 Large envelope protein Proteins 0.000 description 1
- 108700041076 Leishmania glycoprotein gp63 Proteins 0.000 description 1
- 208000016604 Lyme disease Diseases 0.000 description 1
- 101710125418 Major capsid protein Proteins 0.000 description 1
- 201000005505 Measles Diseases 0.000 description 1
- 102000018697 Membrane Proteins Human genes 0.000 description 1
- 108010052285 Membrane Proteins Proteins 0.000 description 1
- 241000711386 Mumps virus Species 0.000 description 1
- 101100391545 Mus musculus Fxyd3 gene Proteins 0.000 description 1
- 241001467553 Mycobacterium africanum Species 0.000 description 1
- 241000186367 Mycobacterium avium Species 0.000 description 1
- 241000186366 Mycobacterium bovis Species 0.000 description 1
- 241000186364 Mycobacterium intracellulare Species 0.000 description 1
- 241000186362 Mycobacterium leprae Species 0.000 description 1
- 241000588653 Neisseria Species 0.000 description 1
- 101100406843 Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) prr-3 gene Proteins 0.000 description 1
- 101150033790 P24 gene Proteins 0.000 description 1
- 108010081690 Pertussis Toxin Proteins 0.000 description 1
- 241000224016 Plasmodium Species 0.000 description 1
- 208000000474 Poliomyelitis Diseases 0.000 description 1
- 101710192141 Protein Nef Proteins 0.000 description 1
- 241000711798 Rabies lyssavirus Species 0.000 description 1
- 241000242678 Schistosoma Species 0.000 description 1
- 241000270295 Serpentes Species 0.000 description 1
- 241000607768 Shigella Species 0.000 description 1
- 241000187135 Streptomyces albus G Species 0.000 description 1
- 208000037065 Subacute sclerosing leukoencephalitis Diseases 0.000 description 1
- 206010042297 Subacute sclerosing panencephalitis Diseases 0.000 description 1
- 208000005400 Synovial Cyst Diseases 0.000 description 1
- 206010043376 Tetanus Diseases 0.000 description 1
- 239000004098 Tetracycline Substances 0.000 description 1
- BHEOSNUKNHRBNM-UHFFFAOYSA-N Tetramethylsqualene Natural products CC(=C)C(C)CCC(=C)C(C)CCC(C)=CCCC=C(C)CCC(C)C(=C)CCC(C)C(C)=C BHEOSNUKNHRBNM-UHFFFAOYSA-N 0.000 description 1
- 239000002253 acid Substances 0.000 description 1
- 239000004480 active ingredient Substances 0.000 description 1
- 230000002411 adverse Effects 0.000 description 1
- 239000011543 agarose gel Substances 0.000 description 1
- 150000001298 alcohols Chemical class 0.000 description 1
- 230000004075 alteration Effects 0.000 description 1
- WNROFYMDJYEPJX-UHFFFAOYSA-K aluminium hydroxide Chemical compound [OH-].[OH-].[OH-].[Al+3] WNROFYMDJYEPJX-UHFFFAOYSA-K 0.000 description 1
- 210000004102 animal cell Anatomy 0.000 description 1
- 239000004599 antimicrobial Substances 0.000 description 1
- 108010005774 beta-Galactosidase Proteins 0.000 description 1
- 230000003115 biocidal effect Effects 0.000 description 1
- 230000004071 biological effect Effects 0.000 description 1
- 239000001110 calcium chloride Substances 0.000 description 1
- 229910001628 calcium chloride Inorganic materials 0.000 description 1
- TWFZGCMQGLPBSX-UHFFFAOYSA-N carbendazim Chemical compound C1=CC=C2NC(NC(=O)OC)=NC2=C1 TWFZGCMQGLPBSX-UHFFFAOYSA-N 0.000 description 1
- 239000000969 carrier Substances 0.000 description 1
- 230000015556 catabolic process Effects 0.000 description 1
- 210000000170 cell membrane Anatomy 0.000 description 1
- 210000002421 cell wall Anatomy 0.000 description 1
- 238000012512 characterization method Methods 0.000 description 1
- 238000002512 chemotherapy Methods 0.000 description 1
- 210000004978 chinese hamster ovary cell Anatomy 0.000 description 1
- 230000002759 chromosomal effect Effects 0.000 description 1
- 210000000349 chromosome Anatomy 0.000 description 1
- 238000003776 cleavage reaction Methods 0.000 description 1
- 230000021615 conjugation Effects 0.000 description 1
- 239000000470 constituent Substances 0.000 description 1
- 238000005520 cutting process Methods 0.000 description 1
- 230000007711 cytoplasmic localization Effects 0.000 description 1
- 210000001151 cytotoxic T lymphocyte Anatomy 0.000 description 1
- 230000007850 degeneration Effects 0.000 description 1
- 238000006731 degradation reaction Methods 0.000 description 1
- 206010013023 diphtheria Diseases 0.000 description 1
- PRAKJMSDJKAYCZ-UHFFFAOYSA-N dodecahydrosqualene Natural products CC(C)CCCC(C)CCCC(C)CCCCC(C)CCCC(C)CCCC(C)C PRAKJMSDJKAYCZ-UHFFFAOYSA-N 0.000 description 1
- 239000003814 drug Substances 0.000 description 1
- 230000000694 effects Effects 0.000 description 1
- 238000001962 electrophoresis Methods 0.000 description 1
- 108700004025 env Genes Proteins 0.000 description 1
- 101150030339 env gene Proteins 0.000 description 1
- 230000007613 environmental effect Effects 0.000 description 1
- 210000003527 eukaryotic cell Anatomy 0.000 description 1
- 238000010230 functional analysis Methods 0.000 description 1
- 108700004026 gag Genes Proteins 0.000 description 1
- 101150098622 gag gene Proteins 0.000 description 1
- 208000006454 hepatitis Diseases 0.000 description 1
- 231100000283 hepatitis Toxicity 0.000 description 1
- 229940088597 hormone Drugs 0.000 description 1
- 239000005556 hormone Substances 0.000 description 1
- 230000028996 humoral immune response Effects 0.000 description 1
- 230000036039 immunity Effects 0.000 description 1
- 208000015181 infectious disease Diseases 0.000 description 1
- 206010022000 influenza Diseases 0.000 description 1
- 230000000977 initiatory effect Effects 0.000 description 1
- 239000002919 insect venom Substances 0.000 description 1
- 230000003993 interaction Effects 0.000 description 1
- 101150066555 lacZ gene Proteins 0.000 description 1
- 230000001665 lethal effect Effects 0.000 description 1
- 230000021633 leukocyte mediated immunity Effects 0.000 description 1
- 230000000670 limiting effect Effects 0.000 description 1
- 230000005923 long-lasting effect Effects 0.000 description 1
- 210000004698 lymphocyte Anatomy 0.000 description 1
- 210000002540 macrophage Anatomy 0.000 description 1
- 235000019359 magnesium stearate Nutrition 0.000 description 1
- 210000004962 mammalian cell Anatomy 0.000 description 1
- 210000003936 merozoite Anatomy 0.000 description 1
- 102000035118 modified proteins Human genes 0.000 description 1
- 108091005573 modified proteins Proteins 0.000 description 1
- 238000010369 molecular cloning Methods 0.000 description 1
- BSOQXXWZTUDTEL-ZUYCGGNHSA-N muramyl dipeptide Chemical class OC(=O)CC[C@H](C(N)=O)NC(=O)[C@H](C)NC(=O)[C@@H](C)O[C@H]1[C@H](O)[C@@H](CO)O[C@@H](O)[C@@H]1NC(C)=O BSOQXXWZTUDTEL-ZUYCGGNHSA-N 0.000 description 1
- 210000004898 n-terminal fragment Anatomy 0.000 description 1
- 230000007935 neutral effect Effects 0.000 description 1
- 108020004707 nucleic acids Proteins 0.000 description 1
- 102000039446 nucleic acids Human genes 0.000 description 1
- 231100000590 oncogenic Toxicity 0.000 description 1
- 230000002246 oncogenic effect Effects 0.000 description 1
- 230000008520 organization Effects 0.000 description 1
- 230000003071 parasitic effect Effects 0.000 description 1
- 230000036961 partial effect Effects 0.000 description 1
- 239000002245 particle Substances 0.000 description 1
- 230000002093 peripheral effect Effects 0.000 description 1
- 230000035479 physiological effects, processes and functions Effects 0.000 description 1
- 229920002451 polyvinyl alcohol Polymers 0.000 description 1
- 235000019422 polyvinyl alcohol Nutrition 0.000 description 1
- 229920000036 polyvinylpyrrolidone Polymers 0.000 description 1
- 239000001267 polyvinylpyrrolidone Substances 0.000 description 1
- 235000013855 polyvinylpyrrolidone Nutrition 0.000 description 1
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 1
- 210000001236 prokaryotic cell Anatomy 0.000 description 1
- 230000009696 proliferative response Effects 0.000 description 1
- 230000012743 protein tagging Effects 0.000 description 1
- 230000006798 recombination Effects 0.000 description 1
- 238000005215 recombination Methods 0.000 description 1
- 230000001105 regulatory effect Effects 0.000 description 1
- 230000003362 replicative effect Effects 0.000 description 1
- 238000011160 research Methods 0.000 description 1
- 230000004044 response Effects 0.000 description 1
- 230000000717 retained effect Effects 0.000 description 1
- 201000005404 rubella Diseases 0.000 description 1
- 235000019515 salmon Nutrition 0.000 description 1
- 230000007017 scission Effects 0.000 description 1
- 239000003998 snake venom Substances 0.000 description 1
- 239000011780 sodium chloride Substances 0.000 description 1
- 239000007787 solid Substances 0.000 description 1
- 238000001228 spectrum Methods 0.000 description 1
- 210000003046 sporozoite Anatomy 0.000 description 1
- 229940031439 squalene Drugs 0.000 description 1
- TUHBEKDERLKLEC-UHFFFAOYSA-N squalene Natural products CC(=CCCC(=CCCC(=CCCC=C(/C)CCC=C(/C)CC=C(C)C)C)C)C TUHBEKDERLKLEC-UHFFFAOYSA-N 0.000 description 1
- 230000000638 stimulation Effects 0.000 description 1
- 239000000126 substance Substances 0.000 description 1
- 239000000758 substrate Substances 0.000 description 1
- 229960002180 tetracycline Drugs 0.000 description 1
- 229930101283 tetracycline Natural products 0.000 description 1
- 235000019364 tetracycline Nutrition 0.000 description 1
- 150000003522 tetracyclines Chemical class 0.000 description 1
- 231100000419 toxicity Toxicity 0.000 description 1
- 230000001988 toxicity Effects 0.000 description 1
- 238000013518 transcription Methods 0.000 description 1
- 230000035897 transcription Effects 0.000 description 1
- 238000012546 transfer Methods 0.000 description 1
- 230000010415 tropism Effects 0.000 description 1
- 231100000611 venom Toxicity 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/005—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/02—Bacterial antigens
- A61K39/04—Mycobacterium, e.g. Mycobacterium tuberculosis
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/44—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from protozoa
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/74—Vectors or expression systems specially adapted for prokaryotic hosts other than E. coli, e.g. Lactobacillus, Micromonospora
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/14—Hydrolases (3)
- C12N9/78—Hydrolases (3) acting on carbon to nitrogen bonds other than peptide bonds (3.5)
- C12N9/86—Hydrolases (3) acting on carbon to nitrogen bonds other than peptide bonds (3.5) acting on amide bonds in cyclic amides, e.g. penicillinase (3.5.2)
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/02—Fusion polypeptide containing a localisation/targetting motif containing a signal sequence
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/40—Fusion polypeptide containing a tag for immunodetection, or an epitope for immunisation
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/61—Fusion polypeptide containing an enzyme fusion for detection (lacZ, luciferase)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2740/00—Reverse transcribing RNA viruses
- C12N2740/00011—Details
- C12N2740/10011—Retroviridae
- C12N2740/16011—Human Immunodeficiency Virus, HIV
- C12N2740/16111—Human Immunodeficiency Virus, HIV concerning HIV env
- C12N2740/16122—New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2740/00—Reverse transcribing RNA viruses
- C12N2740/00011—Details
- C12N2740/10011—Retroviridae
- C12N2740/16011—Human Immunodeficiency Virus, HIV
- C12N2740/16211—Human Immunodeficiency Virus, HIV concerning HIV gagpol
- C12N2740/16222—New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
Definitions
- Î-lactamase recom-binante usable as a carrier molecule for the preparation of immunogenic compositions.
- the present application relates to new means for the preparation of immunogenic compositions and preferably protective vaccinating compositions, capable of being in the form of "live vaccines", of particles or molecules which can be administered to humans or animals. .
- One of the aims of the present invention is to propose means for developing immunogenic compositions capable of triggering in humans or in animals a cellular and / or humoral immune response (by means of antibodies), against antigenic determinants and in particular epitopes characteristic of different pathogens. More generally, the invention proposes new means for triggering or promoting an immune response against any determined epitope for producing antibodies or a cellular immune response, and in particular when the antigenic determinants are of the hapten type and therefore incapable of triggering by themselves. same this immune response. The invention is also of interest in order to promote an immune response capable of being imparted by an antigen, and in particular to increase the level or the protective character thereof.
- the invention describes in this regard new molecules capable of being used as a vector for the antigenicity of different epitopes, both in immunogenic compositions containing the hybrid (recombinant) molecules thus formed or in live vaccines.
- Different factors can be decisive in the choice of a molecule, in particular a protein capable of behaving as a carrier protein (also called a vector) in order to confer or improve the immunogenicity of a heterologous epitope compared to to this molecule.
- account must be taken of the size parameters of the vector protein as such and of its size relative to that of the epitope which it must contain as well as of the size of the epitope as such.
- the inventors are interested in proteins of the / 3-lactamase family, some of the properties of which have been studied until now in a context different from that of the present invention.
- 3-lactamases are enzymes divided into different classes, depending on their enzymatic activity on different substrates. They are produced by different organisms and in particular by bacteria, for example bacteria of the type E. coli, Staphylococcus aureus, or by mycobacteria. These enzymes are studied for their capacity to protect bacteria against the lethal effects of antibiotics of the / 3-lactams type, and therefore their capacity to confer on certain bacteria resistance to different antibiotics. It is in this context of studying the resistance of bacteria to antibiotics that several authors have published articles describing the purification of certain ⁇ -lactamases.
- heterologous epitope is meant here an amino acid sequence characteristic of a protein and in particular of an antigen different from a / 3-lactamase, at the very least different from the / 3-lactamase chosen as carrier molecule.
- the known properties of different / 3-lactamases such as the fact that they are exported and monomeric, as well as their structural properties are capable of conferring on them numerous advantages for being used as vector carriers of the antigenicity of different epitopes. They have also proved to be interesting in the context of the development of live vaccines.
- the inventors determined the sequence and the structural organization of the gene and predicted by modeling the three-dimensional structure of the protein / 3- lactamase from a mycobacterium, Mycobacterium fortuitum (hereinafter referred to as M. fortuitum). Knowledge of this gene has made it possible to locate regions capable of containing between nucleotides 395 and 1274 of this sequence.
- sequences corresponding to the preceding definitions are constituted by the nucleotide sequences cloned in the plasmids contained in the E. coli strains deposited at the C.N.C.M. under the numbers 1-1170 and 1-1171, as well as any nucleotide sequence hybridizing under stringent conditions with these cloned sequences.
- the sequence shown in FIG. 4 contains the gene coding for M. fortuitum / 3-lactamase, as well as the non-coding parts.
- the nucleotide sequence of the M. fortuitum / 3-lactamase gene is not the only sequence of interest in the context of the invention; indeed fragments or part of the sequence shown in Figure 4 can be interesting.
- an advantageous nucleotide sequence in the context of the invention is the nucleotide sequence corresponding to the non-coding 5 'end of the ⁇ -lactamase gene, this sequence containing the expression signals for the gene for this enzyme.
- This 5 ′ part of the gene sequence can be used for the expression of various nucleotide sequences in cellular hosts of the mycobacteria type. It is suitable for example for the expression in mycobacteria, of / 3-lactamases originating from organisms other than mycobacteria, since it contains expression signals recognized by mycobacteria.
- fragments of the nucleotide sequence represented in FIG. 4 which can be used in the context of the invention, are the sequences coding for a 8 truncated protein whose overall structure is preserved, compared to the native protein, in particular under conditions such that the expression product of this nucleotide sequence is stable and in particular insensitive to the cellular proteases of the host which produces it and / or possibly the subject to which it is administered.
- protein stability is meant in particular the possibility of purifying it or the possibility for this protein to be recognized by an antibody.
- An advantageous nucleotide sequence is a sequence having similarities with the sequence shown in FIG. 4. By similarity is meant in particular the capacity to hybridize under stringent conditions with the sequence of FIG. 4.
- a probe determined from the coding sequence represented in FIG. 5 with which one wishes to test the hybridization of a determined sequence; this probe is labeled with 32 p (10 6 cpm / ml) and it is brought into contact with the sequence tested for 16 hours at 65 ° C. in a hybridization solution (50% formamide, 5 ⁇ SSPE, sperm DNA salmon 200 ⁇ g / ml and 10 x Denhart).
- a hybridization solution 50% formamide, 5 ⁇ SSPE, sperm DNA salmon 200 ⁇ g / ml and 10 x Denhart).
- the membranes on which the hybridization is carried out are then washed twice for 30 minutes with a 1SSC solution, 0.1% SDS at room temperature (20 ° C.) and then washed twice with 0.1SSC, 0.1% SDS. for 30 minutes at
- a nucleotide sequence of the invention is characterized in that it codes for a protein of the type / 3-lactamase comprising the amino acid chain shown in FIG. 4.
- the invention further relates to a recombinant nucleotide sequence characterized in that it comprises: a nucleotide sequence corresponding to one of the preceding definitions, coding for a ⁇ -lactamase, modified by at least one heterologous nucleotide sequence coding for a peptide sequence heterologous comprising at least one epitope, the modification being carried out at at least one site allowing, when the recombinant sequence is expressed, the exposure of the epitope to the surface of / 3-lactamase or its accessibility to the solvent, a nucleotide sequence meeting the previous definitions, coding for a truncated ⁇ -lactamase, modified by at least one 10 heterologous nucleotide sequence encoding a heterologous peptide sequence comprising at least one epitope, the modification being carried out at at least one site allowing, when the recombinant sequence is expressed, the exposure of the epitope to the surface of the / 3-lactamase or
- the exposure at the level of the recombinant protein, of the heterologous epitope corresponds to the accessibility of this epitope to the solvent, in particular to water molecules, or to the availability of this epitope to be presented to antibodies.
- the nucleotide sequence coding for ⁇ -lactamase or for a truncated / 3-lactamase can be modified by at least one heterologous nucleotide sequence.
- the size of the heterologous nucleotide sequence does not constitute an a priori limiting parameter, it is possible to envisage inserting several heterologous sequences within the sequence coding for / 3-lactamase or for a truncated ⁇ -lactamase .
- heterologous sequences comprising at least one epitope and having a size of a few nucleotides may appear advantageous insofar as the problems which may result from a deformation of the modified / 3-lactamase encoded by the 11 recombinant nucleotide sequence of the invention are limited.
- the hybrid thus formed retains the most important characteristics of its structure, in particular its capacity to be recognized by anti-/ 3-lactamase antibodies and anti-heterologous sequence antibodies, as well as its capacity to be purified.
- a protein known as stable according to the invention exhibits at least one of the following properties: the enzymatic activity of / 3-lacta ⁇ tase, if necessary modified in intensity, the ability to be recognized by an antibody, in particular an anti-/ 3- antibody lacta ⁇ nase, or an antibody directed against a heterologous epitope which it contains, when it is a question of the recombinant protein or, an insensitivity to degradation by cellular proteases, the possibility of being purified.
- a first group of heterologous sequences is characterized in that it comprises sequences coding for a peptide or a polypeptide, involved in the virulence of a pathogenic agent or in general for an antigen with protective potential against a 12 factor produced as a result of infection.
- a sequence characteristic of a pathogenic organism is, for example, a sequence of virus, parasite, bacteria or fungus (for example of the genus Aspergillus).
- the sequences of bacteria such as M. leprae, M. tuberculosis, M. intracellulare, M.
- treponemes pertussis toxin, sequences of other microorganisms such as sporozoites and merozoites of plasmodium, sequences of Leishmania or Schistosoma, Shigella, Neisseria, Borrelia, sequences of viruses including the mumps virus, rubella, measles, herpes, influenza, rabies virus, polio, hepatitis, AIDS HIV, HTLV-I, HTLV-II and SIV as well as oncogenic viruses.
- the nucleic acid sequence to be expressed can also code for an immunogenic sequence such as that of snake or insect venom.
- an interesting heterologous nucleotide sequence is, for example, a sequence coding for a peptide sequence of a human retrovirus antigen of HIV type, in particular an envelope, gag, nave or pol antigen of an HIV- retrovirus. 1 or HIV-2.
- an antigen is said to have "protective potential” when it is capable of triggering or promoting a response 13 protective immune system, in particular by production of antibodies or by induction of a cell-mediated immune response, in particular of the CTL type.
- Such an antigen with protective potential can consist of an epitope or even a hapten insufficient in itself to trigger the immune response.
- the invention thus allows the preparation of recombinant proteins of interest in particular for the constitution of immunogenic compositions, in which the epitope exposed on the surface of the recombinant protein is characteristic for example of a hormone, or of any substance which it is sought to attenuate or even neutralize the biological effects.
- a recombinant nucleotide sequence may consist of a nucleotide sequence coding for / 3-lactamase or a truncated ⁇ -lactamase, as described above in which a heterologous sequence coding for the peptide sequence V3 of the envelope antigen would be inserted.
- a heterologous sequence coding for the peptide sequence V3 of the envelope antigen would be inserted.
- different HIV-1 variants or a larger sequence of the envelope of an HIV virus This sequence has been described in the publication by K. Javaherian et al. (Proc. Natl. Acad. Sci. USA 8_6: 6768-6772, 1989).
- the heterologous sequence coding for the V3 peptide sequence is inserted at the BglII site of the sequence coding for ⁇ -lactamase.
- the invention also relates to a recombinant • cloning and / or expression, replicative or integrative vector characterized in that it is modified, in one of its non-essential sites for its replication or its integration, by a nucleotide sequence recombinant described above. 14
- the recombinant nucleotide sequence contained in the vector is under the control of the expression promoter of / 3-lactamase corresponding to the sequence.
- this vector When this vector is modified by the coding sequence alone or by a partial coding sequence for / 3-lactamase, it may also include expression, translation and even secretion signals, of origin different from that of ⁇ - lactamase, chosen according to the host in which one seeks to clone or express this recombinant vector.
- a plasmid of the invention is the plasmid pACYC184BlaM containing the SphI fragment of the sequence of the / 3-lactamase of M. fortuitum presented in FIG. 4, and which is deposited at the C.N.C.M. (National Collection of Microorganisms, Paris, France) in an E.coli HB101 strain (pACYC184BlaM), under the number 1-1171 deposited on February 11, 1992.
- the plasmid pACYC184BlaM contains the Sphl / SphI fragment, of about 4.7 kb, of the genomic DNA of M. fortuitum D316 hybridizing with the BlaOl probe. This fragment carries the first 834 bases of the gene coding for a class A / 3-lactamase, as well as its regulatory regions.
- the culture medium recommended for this strain is an L-Broth medium plus chloramphenicol (30 ⁇ g / ml) and the seeding is carried out on L-Broth medium, the incubation temperature being approximately 37 ° C. with stirring.
- Another preferred plasmid according to 1 st invention contains the gene of the / 3-lactamase M. fortuitum; he 15 This is the plasmid pIPJ39 contained in a strain of E.coli MC1061 (pIPJ39), deposited at the CNCM on February 11, 1992 under the number 1-1170.
- Plasmid pIPJ39 contains the approximately 6 kb BamHI / BamIII fragment of the genomic DNA of M. fortuitum FC1 hybridizing with the BlaOl probe. This fragment carries the gene coding for a class A / 3-lactamase, as well as flanking regions.
- the culture medium recommended for this strain is an L-Broth medium plus ampicillin (100 ⁇ g / ml) and the seeding is carried out with an L-Broth medium and the incubation temperature is approximately 37 ° C. with stirring.
- the subject of the invention is also a recombinant cellular host, characterized in that it is transformed by a recombinant nucleotide sequence described above or by a recombinant vector above, under conditions allowing the expression of the recombinant nucleotide sequence under the form of a stable fusion protein and its exposure or export to the surface of the host or its secretion into the extracellular medium.
- Many cellular hosts can be modified by a recombinant nucleotide sequence or a recombinant vector according to the invention.
- a suitable method for the preparation of recombinant cellular hosts according to the invention is for example 1 electroporation, in accordance with the description of Snapper S. et al (1988, PNAS USA 85: 6985-6991) or the conjugation according for example the technique of Lazraq R. et al (1990, FEMS Microbiol. Lett. 69_: 135-138), or according to the technique of Gormley EP and Davies J. (J. Bacteriol, 173: 6705-6708).
- mycobacteria will be used when the sequence coding for ⁇ -lactamase is a sequence originating in mycobacterium.
- the transfer into a strain of mycobacteria of the gene coding for a / 3-lactamase of mycobacterium makes it possible to facilitate the expression of this sequence, insofar as the recognition and expression, and even secretion, signals contained in the ⁇ -lactamase gene are recognized by the host mycobacteria.
- a strain of Actinomycetes and in particular an avirulent or made avirulent strain can be used, ensuring that the recognition signals are suitable for the expression of the recombinant sequence or of the recombinant vector introduced into the strain. .
- the invention therefore relates to a strain of BCG, transformed by a recombinant nucleotide sequence or a recombinant vector of the invention allowing exposure to the surface of the cell of a recombinant protein (hybrid protein), under conditions ensuring the exposure of the epitope or epitopes against which one seeks to induce an immune response.
- a recombinant protein hybrid protein
- a hybrid protein is said to be exposed when it is extracellular but remains anchored at a point on the surface of the cell that produces it.
- the nucleotide sequences of the invention will be expressed in such a way that the expression products are secreted outside the cell which produces them and consequently released into the medium. 17
- cellular hosts are bacteria, a non-virulent E. coli strain, or a non-virulent strain of enterobacterium such as avirulent salmonella, since the recombinant nucleotide sequence or the above recombinant vector , transforming the bacteria, is placed under the control of expression signals recognized by this bacteria.
- fungi such as Aspergillus.
- Other systems for the expression of the recombinant ⁇ -lactamase according to the invention can for example be constituted by animal cells, for example insect cells or mammalian cells such as CHO cells.
- the vectors specific to the insertion of DNA or 1 ⁇ DNC or even RNA into these cells can be viruses, or plasmids.
- Other systems such as yeast systems such as Saccharomyces Cerevisiae may also be suitable.
- exposed site is meant a site which allows access or recognition of the heterologous peptide sequence and in particular access to the epitope or epitopes or their recognition, in order to obtain an immune response.
- An exposed site is 18 either a site on the surface of the protein / 3-lactamase or a site contained in this protein whose epitope remains recognized by the antibodies, for example even when the protein is denatured.
- the heterologous peptide sequence is inserted upstream of a site normally not exposed on the surface of the ⁇ -lactamase protein, this site being exposed due to the insertion of the heterologous sequence, for example following a folding resulting from interactions between the protein / 3-lactamase and the heterologous sequence.
- a heterologous peptide sequence is inserted into the M. fortuitum ⁇ -lactamase in the region forming the junction between the ⁇ 2 helix and the ⁇ 3 helix of the ⁇ -lactamase.
- Other preferred insertion sites are formed by the regions between the ⁇ 2 sheet and the ⁇ 2 helix, between the o: 3 helix and the ⁇ 4 helix or even between the ⁇ 4 sheet and the ⁇ 5 sheet.
- the heterologous sequence can also be inserted into the C-terminal part of the sequence of ⁇ -lactamase.
- the location of the ⁇ helices and ⁇ sheets giving them their structure will advantageously be determined, relative to the data obtained for the ⁇ -lactamase from S. aureus.
- the insertion is carried out in such a way that the heterologous peptide sequence is accessible to the water molecules of the environment.
- heterologous sequences capable of being inserted into the ⁇ -lactamase or into a truncated ⁇ -lactamase are the sequences which have been described above in the part which relates to the nucleotide sequences. These are, for example, sequences of the HIV retrovirus, in particular sequences of the envelope glycoprotein, the gag, nef or pol proteins, of an HIV-1 or HIV-2 retrovirus. By way of example, mention may be made of the V3 peptide of the HIV-1 envelope.
- the invention allows the production of recombinant ⁇ -lactamase proteins in which the insertion of the heterologous sequence comprising the epitope is accompanied by a deletion of part of the ⁇ - 20 lactamase.
- the invention also allows, according to an advantageous embodiment, the insertion of the heterologous sequence without deletion at the level of ⁇ -lactamase.
- this insertion can be carried out at the C-terminal end of the ⁇ -lactamase, without deletion at the level of the sequence of the latter.
- the invention also relates to an immunogenic composition characterized in that it comprises a recombinant BCG strain described above, in combination with a pharmaceutical vehicle ent suitable for its administration to humans or animals.
- Such a composition is capable of constituting a live vaccine. It can be administered by injection or by any other suitable route.
- Such an immunogenic composition can be used to trigger the immune response, for example to trigger the cellular response and optionally to trigger the production of protective antibodies, or even to contribute to the production of these antibodies in a host to which it is administered.
- the invention relates not only to the manufacture of vaccinating compositions which can be administered to humans but also to the preparation of compositions for the purposes of vaccination in veterinary medicine.
- the immunogenic composition of the invention can also be used as a booster composition to stimulate the production of antibodies initiated by the administration of a protein or of another constituent of the pathogenic agent or more generally of The agent against which an immune response is sought.
- the invention relates to an immunogenic composition characterized in that the strain 21 recombinant it contains as active ingredient is a strain M. bovis type BCG meeting the definitions given above.
- a particular BCG strain is the avirulent strain of INSTITUT PASTEUR No. 1137P2, used for the commercialized vaccine against tuberculosis.
- immunogenic compositions of the invention As a pharmaceutical vehicle suitable for the production of the immunogenic compositions of the invention, mention may be made of the physiological excipients that are usually acceptable, in particular neutral or acid excipients and for example magnesium stearate, polyvinyl pyrrolidone or alcohols.
- This immunogenic composition can also comprise adjuvants of the immune response such as Freund's complete or incomplete adjuvant, aluminum hydroxide, muramyl dipeptide derivatives, a metabolizing oil such as squalene.
- Another immunogenic composition of the invention is characterized in that it comprises a recombinant protein corresponding to the above definitions, in combination with a pharmaceutical vehicle suitable for its administration.
- This composition like the immunogenic composition forming the live vaccine, can be used to trigger the immune response or in the form of a booster composition.
- Plasmid pACYC184 recombined with an insert of approximately 4.7 kb from the ⁇ lactamase gene
- Plasmid pIPJ39 recombined with the ⁇ lactamase gene
- nucleotide sequence is indicated in capital letters and is numbered in the right column.
- the peptide sequence of ⁇ -lactamase is indicated with the three-letter code under the corresponding nucleotide sequence. The numbering is indicated below the sequence.
- the nucleotide sequence from ntl to ntl061 was determined from the plasmid pIPJ319.
- MF Mycobacterium fortuitum SA: Streptomyces albus AU: Staphylococcus aureus
- the different ⁇ helices and ⁇ sheets are indicated by rectangles. This figure also shows the nucleotide sequence and the position of several restriction sites.
- the plasmid pAL817 is a derivative of pAL5000 and is described in the publication Ranes et al, J. Bacteriol. 172: 2793-2797 (1990).
- the cassette containing the kanamycin resistance gene of the transposon Tn903 and the plasmid pSL1180 come from the company Pharmacia.
- the amplification of the V3 fragment is made from the plasmid pTG5167 supplied by Transgene.
- the plasmid pIPJ42 is a derivative of pIPJ39 where the BglII / BamHI fragment, corresponding to the promoter and the aminoterminal fragment of the gene coding for the beta-lactamase of Mycobacterium fortui tum FC1, has been replaced by the BglII / BglII fragment of pACYC184 promoter and to the aminoterminal fragment of the gene coding for the beta-lactamase of Mycobacterium fortuitum D316.
- the plasmid pTG5167 is a derivative of pTG186poly (Guy et al, 1987) where a BglII-EcoRI fragment carrying the gene coding for the GP160 protein of HIV1 / MN has been cloned in the polylinker.
- Figure 9 Construction of the plasmids pRJ27 and pRJ28
- the amplification of the gag11 fragment is made from the plasmid pTG2103 supplied by Transgene.
- the plasmid pTG2103 is a derivative of pTG959 (Guy et al, 1987) where a BglII / EcoRI fragment carrying the gene coding for the P24 protein of HIV1 / LAI has been cloned in the polylinker.
- the amplification of the Gag fragment p24 is made from the plasmid pTG2103 supplied by Transgene.
- the amplification of the gene coding for the GP63 protein of Leishmania major is made directly from the chromosome of this parasite.
- Figure 12 Western type analysis of the expression of the beta-lactamase-V3 polypeptide. The molecular weight markers are indicated to the left of line 1.
- Lane 1 gpl20 protein
- lane 2 standard BCG supernatant
- lane 3 extract of standard BCG
- lane 4 supernatant of recombinant BCG carrying the plasmid pIPJ64
- lane 5 extract of recombinant BCG carrying the plasmid pIPJ64.
- Lane 1 molecular weight markers
- lane 2 Gag P24 protein
- lane 3 extract of standard BCG
- lanes 4 and 5 extracts of recombinant BCG carrying the plasmid pRJ28
- lanes 6 and 7 extracts of recombinant BCG carrying the plasmid pRJ27.
- Line 1 extract of standard BCG
- lane 2 Gag P24 protein
- lane 3 molecular weight markers
- lanes 4 and 5 extracts of recombinant BCG carrying the plasmid pRJ33 and pRJ34, respectively.
- Line 15 Western type analysis of the expression of the beta-lactamase-GP63 polypeptide.
- Line 1 extract of standard BCG
- lane 2 molecular weight markers
- lane 3 extract of recombinant BCG carrying pSAIl.5
- Figure 16 Proliferative responses of cells extracted from the lymph nodes of mice inoculated with BCG carrying the plasmid pRJ28.
- mice receive an intradermal injection of 10 7 cfu of BCG-pRJ28, 4 others receive standard BCG 1173P2. After 14 days, the peripheral lymph nodes are removed for the proliferation test.
- the HIV1-LAI Gag P24 protein is used to induce the proliferation of ganglion cells which have been in contact with the BlaM-V3 fusion protein produced by recombinant BCG. 26 EXPERIMENTAL PART
- a mycobacterial ⁇ -lactamase was used, for its expression in M. bovis BCG, the expression signals being adapted to the mycobacterial context.
- a M. fortuitum ⁇ -lactamase was previously purified by Amicosante et al and Fattorili et al from a mutant strain producing this enzyme in large quantities.
- the N-terminal sequence of ⁇ -lactamase was determined by Amicosante et al:
- APIDDQLAELERRDNVLIGLYAANLQSGRRITHRPDEMFAMXSTFKGYV X corresponds to an indeterminacy.
- nucleotides are indicated in capital letters; each oligonucleotide belonging to the family is determined by choosing one of the nucleotides indicated in parentheses.
- the mixture of these oligonucleotides, called Moligol has been chemically synthesized by incorporating one or other of the nucleotides indicated in parentheses.
- This research also made it possible to define which sequences coded for a ⁇ -lactamase and the signals necessary for the expression of fusion products with ⁇ -lactamase, in which the ⁇ -lactamase is in stable form, and also the signals necessary for the export, even for the secretion, of the recombinant protein produced in a cellular host.
- BCG Bacillus Calmette et Guérin
- BCG Bacillus Calmette et Guérin
- the present invention has made it possible to demonstrate that the use of a vector protein such as ⁇ -lactamase can promote the cloning and expression in mycobacteria, in particular in BCG, of heterologous antigenic determinants.
- a vector protein such as ⁇ -lactamase
- BCG as a cellular host for the expression of ⁇ -lactamase
- use will be made of an exogenous ⁇ -lactamase compared to those which naturally preexist in BCG, in order to avoid or to minimize the phenomena of recombination.
- nucleotide sequence represented in FIG. 4 participating in the structure of ⁇ -lactamase, or necessary for its expression in an appropriate cellular host, in particular the sequence between nucleotides 1 and 394 of the sequence of FIG. 4 containing the gene expression signals, the coding sequence contained in the sequence represented in FIG. 4, and comprising the nucleotides 395 to 1274,
- the second mixture of oligonucleotides consists of oligonucleotides corresponding to the complementary strands of the DNA sequences coding for the C-terminal part of the N-terminal fragment indicated above, that is to say: STFKGYV.
- One of the mixtures contains oligonucleotides of identical or very similar sequence to the 5 'part of BlaM1
- the second mixture contains oligonucleotides complementary to the 3' part of BlaMl.
- These two mixtures are used to synthesize the BlaM1 probe by PCR from the DNA that we have extracted from M. fortuitum FC1 (C. Martin et al, Nature Vol. 345: 739-743, 1990).
- the BlaMl probe was sequenced ( Figure 1). From this sequence, the oligonucleotide, BlaOl: 5 'CTTGAAGGTCGAGCACATCGCGAACAT3' was synthesized and radioactively labeled in order to use it as a probe to locate in a gene bank of M.
- fortuitum D316 (Amicosante et al) a clone having a fragment carrying the gene coding for ⁇ -lactamase.
- This library was constructed by cutting the chromosomal DNA of M. fortuitum D316 by the restriction enzyme SphI and by cloning the fragments at random in the vector pACYC184. The SphI fragments were inserted at the SphI site of pACYC184 and the HB101 strain of E. coli was transformed by this ligation mixture in the presence of calcium chloride. The transforming strains were selected on a LB medium containing 30 ⁇ g / ml of chloramphenicol.
- the resistant strains obtained were subcultured on solid LB medium containing 25 ⁇ g / ml of tetracycline and only those sensitive to this antibiotic were retained.
- a transforming clone containing a fragment hybridizing with BlaOl was isolated.
- This clone contains a plasmid pACYC184 recombinant with an insert of approximately 4.7 kb hybridizing with BlaOl.
- the restriction map of this plasmid was carried out (FIG. 2) and the region hybridizing with BlaOl was sequenced.
- the nucleotide sequence is indicated in FIG. 4. The analysis of this sequence shows a reading phase having similarities with other class ⁇ -lactamases. We therefore concluded that it must have been the gene for structure of M.
- the SphI sequence fragment contains only part of the gene.
- a BglII-SphI restriction fragment (shown in thick lines in FIG. 2) internal to the gene, called Bla02, was used as probe;
- the whole gene was cloned from a library of M. fortuitum FC1. This library was constructed by cloning 4 to 10 kb BamHI chromosomal fragments isolated by electrophoresis on an agarose gel and cloned into the BamHI site of the plasmid pUC18 linearized by cleavage at this site and dephosphorylated.
- the transforming clones were selected on a box of LB medium containing 100 ⁇ g / ml of ampicillin.
- a transforming clone hybridizing with the Bla02 probe was isolated. It contains a recombinant plasmid carrying an insert of approximately 6 kb hybridizing with the Bla02 probe.
- the restriction map of this insert was performed (FIG. 3) and the region hybridizing with the probe was sequenced. It contains the C-terminus of the gene ( Figure 4).
- the two gene fragments obtained from the SphI and BamHI have a common part which allows to reconstitute the whole gene; it is represented in FIG. 4 with the amino acid sequence of the protein deduced from the nucleotide sequence.
- the amino acid sequence has similarities to the sequences of other known class A ⁇ -lactamases.
- An alignment of the sequences of the ⁇ -lactamases of M. fortuitum, of S. albus, of S. aureus is proposed in FIG. 5.
- the position of the different structural patterns, helices and ⁇ sheet determined for the ⁇ -lactamase of S. aureus is indicated on the primary structure of this enzyme in the same figure.
- the position of the structural motifs is proposed to the FIG. 5.
- nt648 to nt719 contains a unique BglII site which will be used for the insertion of foreign DNA fragments coding for various epitopes.
- the insertion of epitopes at the C-terminal position of the protein, ie close to nucleotide 1043, could also be of interest.
- BlaM gene To analyze the expression of the BlaM gene, it was fused with ⁇ -galactosidase, an enzyme that is easy to measure and whose expression in bacteria is easily spotted on a Petri dish. To do this, a BglII-Pstl fragment of 1598 bp, containing a part of the blaM gene and of the upstream region, was isolated and inserted between the BamHI and Pst1 sites of the plasmid pNM482. The resulting blaM-lacZ fusion was then transferred to an E. coli mycobacterium shuttle vector and this construct was used to electroporate E.coli and M. smegmatis.
- lacZ gene has been observed only in M. smegmatis. These results show that the cloned region located upstream of the blaM gene is sufficient to induce expression of the gene and that it must therefore contain most of the signals for initiating transcription and translation. These signals are specific for mycobacteria. They can therefore therefore advantageously be used for the expression of any cloned gene under their control, in the form of an operon fusion or a protein fusion.
- the blaM-lacZ fusion is functional shows that the blaM system can be used for the expression of various heterologous genes or fragments of genes in mycobacteria. Depending on the gene fusions carried out, the resulting fusion proteins may have a cytoplasmic localization, be exported outside the bacteria into the culture medium, or remain anchored to the external membrane. Examples of the use of the Pbla promoter associated with all or part of the gene coding for the beta-lactamase which it controls: expression of antigens or fragments of viral or parasitic antigens and induction of specific immune responses by the BCG expressing the one of these antigens.
- the Pbla promoter ( ⁇ -lactamase promoter) associated with the gene coding for beta-lactamase has been used to express several viral antigenic motifs of HIV1.
- the sequences are given in relation to the publication "Hu an retrovirus and AIDS 1991" a compilation and analysis of nucleic acid and aminoacid sequences, edited by Myers G. et al., Published by Theoretical Biology and Physics, Group T-10, Mail Stop K710, Los Alamos National Laboratory, Los Alamos, New Mexico 877545 USA) or Leishmania GP63 antigen.
- the sequences are given in relation to the publication: Button, LL and Me Master, WR (1988) Molecular cloning of the major surface antigen of Leishmania. J. Exp. 167. 724-729) in M. smegmatis and / or the BCG.
- V3 antigenic motif of HIV1 strain MN and an env fragment of this same strain were expressed in M. smegmatis and / or BCG.
- Gag P24 antigen of HIV1 strain LAI as well as a fragment of the latter (Gag11) were expressed in BCG.
- the major surface protein of Leishmania major and Leishmania infantum GP63 were also expressed by BCG.
- TTTGGATCCCTCTAGACCCGTCGCCACAATGTGCTTGTCTTATAGTTCCT were synthesized by the company GENSET. They served to amplify the env fragment from the plasmid pTG5167 carrying it and originating from TRANSGENE. ( Figure 8).
- the amplified fragment carries the BamHI restriction site at its ends. It is cut by the corresponding restriction enzyme and cloned into the plasmid pIPJ42.
- the recombinant plasmid carrying the fragment coding for the determinant V3 is called pIPJ52.
- plasmid a cassette containing the origin of replication in mycobacteria (ori myco of pAL5000) and the kanamycin resistance gene of Tn903 was inserted between the SplI and BamHI sites.
- This cassette is the EcoRV / Hpal fragment isolated from the plasmid pIPJ46 (FIG. 8).
- the plasmids resulting from the insertion of the EcoRV / Hpal fragment in pIPJ52 in either of the orientations are pIPJ64 and pIPJ65.
- Plasmids pIPJ64 and pIPJ65 were transferred to M. smegmatis and BCG by electroporation.
- the fusion polypeptide expressed by the plasmids pIPJ64 and pIPJ65 consists of the insertion of the V3 motif between the propellers 2 and 3 of beta-lactamase. This polypeptide is identified in the culture medium of the strains of M. smegmatis and BCG transformed by the plasmids pIPJ64 and pIPJ65, by Western blot using the monoclonal antibody F5-5 of 1, 'Hybridolab of the Pasteur Institute.
- AAACTGCAGGGATCCATGGGAAGTGACATAGCA AAACTGCAGGGATCCATGGGAAGTGACATAGCA
- NG2 CCCTGAAGCTTACTCGGCTCTTAGAGTTTT
- the amplified fragment carries the PstI and HindIII sites. It is cut by the corresponding enzymes and cloned in the plasmid pIPJ42 between the PstI and HindIII sites. The resulting plasmid is called pRJ20.
- the Kpnl / Hin dm fragment coding for the beta-lactamase-GaglI fusion was inserted at the Seal site of pRR3 (Ranes, MG, Rauzier, J., Lagranderie, M., Georghiu, M. and Gicquel , B. (1990) Functional analysis of pAL5000, a plasmid from Mycobacterium fortui tum: construction of a "mini" Mycobacterium- escherichia coli shuttle vector. J. Bacteriol. 172. 2793-2797) in both directions. The resulting plasmids were called pRJ27 and pRJ28. Plasmids pRJ27 and pRJ28 were transferred to M. smegmatis and BCG by electroporation.
- the fusion polypeptide expressed by the plasmids pR 27 and pRJ28 consists of the fusion between an amino-terminal fragment of 24 amino acids of beta-lactamase with the fragment gagll since a stop codon is located at the end of gagll.
- the beta-lactamase-GagII fusion polypeptide is not found in the culture medium of M. smegmatis or of BCG transformed by pRJ27 and pRJ28, but in the cytoplasm of these bacteria.
- the fragment coding for the protein GagP24 was inserted at the BglII site of the gene coding for beta-lactamase on the plasmid pIPJ42. To do this, a fragment coding for Gag P24 was synthesized in vitro by PCR from the plasmid pTG2103, originating from TRANSGENE, using the oligonucleotides JGAG1.
- the amplified fragment carries the BglII and BamHI sites. It is cut by the corresponding enzymes and cloned into the plasmid pIPJ42 between the BglII and BamHI sites. The resulting plasmid is called pRJ22.
- the cassette containing the origin of replication in mycobacteria (ori yco of pAL5000) and the kanamycin resistance gene of Tn903 was inserted between the SplI and BamHI sites. It is the EcoRV / Hpal fragment isolated from the plasmid pIPJ46 ( Figure 10). These plasmids resulting from the insertion of the EcoRV / Hpal fragment are called pRJ33 and pRJ34.
- Plasmids pRJ33 and pRJ34 were transferred to M. smegmatis and BCG by electroporation.
- the fusion polypeptide expressed by the plasmids pRJ33 and pRJ34 consists of an amino-terminal fragment of 60 amino acids of beta-lactamase with the protein GagP24 since a stop codon is located at the end of the Gag P24 gene cloned here.
- the beta-lacatamase-GagII fusion polypeptide is not found in the culture medium but in the cytoplasm. It is identified by Western blot using the 1113 monoclonal antibody from the Hybridolab of the Institut Pasteur.
- the GP63 surface antigen of Leishmania infantum and Leishmania major The fragment coding for the GP63 protein lacking the C-terminal transmembrane part was inserted at the BglII site of the gene coding for beta-lactamase on the plasmid pIPJ42. To do this, a fragment coding for the GP63 antigen was synthesized in vitro by PCR. Two GP631 oligonucleotides
- GCGGGATCCTTATGCATGTGCGCGACGTGAACTGGGGC GCGGGATCCTTATGCATGTGCGCGACGTGAACTGGGGC
- GP632 CCGAATTCAAGCTTCTACGCCGTGTTGCCGCCGTCCTT
- the cassette containing the origin of replication in mycobacteria (oriMyco of pAL5000) and the kanamycin resistance gene of Tn903 was inserted between the SplI and BamHI sites.
- pSA1.5 and pSAI1.5 The plasmids resulting from the insertion of the EcoRV / Hpal fragment in one or the other of the orientations are called pSA1.5 and pSAI1.5.
- Plasmids pSA1.5 and pSAIl.5 were transferred to M. smegmatis and BCG by electroporation.
- the fusion polypeptides expressed by these plasmids consist of the fusion between an amino ⁇ terminal fragment of 60 amino acids of beta-lactamase with the protein GP63 deleted from the C-terminal transmembrane part.
- the beta-lactamase-Protein GP63 fusion polypeptides are as in the case of Gag fusions found in the cytoplasm of M. smegmatis and BCG transformed by the plasmids pSA1.5 and pSAI1.5.
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Organic Chemistry (AREA)
- Genetics & Genomics (AREA)
- General Health & Medical Sciences (AREA)
- Engineering & Computer Science (AREA)
- Zoology (AREA)
- Wood Science & Technology (AREA)
- Biochemistry (AREA)
- Molecular Biology (AREA)
- Medicinal Chemistry (AREA)
- Bioinformatics & Cheminformatics (AREA)
- General Engineering & Computer Science (AREA)
- Microbiology (AREA)
- Biotechnology (AREA)
- Biophysics (AREA)
- Biomedical Technology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Gastroenterology & Hepatology (AREA)
- Pharmacology & Pharmacy (AREA)
- Public Health (AREA)
- Immunology (AREA)
- Mycology (AREA)
- Communicable Diseases (AREA)
- Epidemiology (AREA)
- Animal Behavior & Ethology (AREA)
- Pulmonology (AREA)
- Veterinary Medicine (AREA)
- Virology (AREA)
- Physics & Mathematics (AREA)
- Plant Pathology (AREA)
- Toxicology (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
Applications Claiming Priority (3)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| FR9201713 | 1992-02-14 | ||
| FR9201713A FR2687410A1 (fr) | 1992-02-14 | 1992-02-14 | Beta-lactamase recombinante, utilisable en tant que molecule porteuse pour la preparation de compositions immunogenes. |
| PCT/FR1993/000151 WO1993017113A1 (fr) | 1992-02-14 | 1993-02-12 | β-LACTAMASE RECOMBINANTE, UTILISABLE EN TANT QUE MOLECULE PORTEUSE POUR LA PREPARATION DE COMPOSITIONS IMMUNOGENES |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| EP0626013A1 true EP0626013A1 (fr) | 1994-11-30 |
Family
ID=9426670
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| EP93905393A Withdrawn EP0626013A1 (fr) | 1992-02-14 | 1993-02-12 | $g(b)-LACTAMASE RECOMBINANTE, UTILISABLE EN TANT QUE MOLECULE PORTEUSE POUR LA PREPARATION DE COMPOSITIONS IMMUNOGENES |
Country Status (4)
| Country | Link |
|---|---|
| US (1) | US5830457A (ja�@�@) |
| EP (1) | EP0626013A1 (ja�@�@) |
| FR (1) | FR2687410A1 (ja�@�@) |
| WO (1) | WO1993017113A1 (ja�@�@) |
Families Citing this family (16)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US6752993B1 (en) | 1993-11-23 | 2004-06-22 | The Regents Of The University Of California | Abundant extracellular product vaccines and methods for their production and use |
| JPH09505588A (ja) | 1993-11-23 | 1997-06-03 | ザ リージェンツ オブ ザ ユニバーシティ オブ カリフォルニア | 多くの細胞外生成物及びそれらの製造法並びに使用 |
| EP0703295A1 (en) * | 1994-09-26 | 1996-03-27 | Institut Pasteur | Vaccine composition comprising recombinant BCG expressing gp 63 fusion protein |
| US6494654B2 (en) * | 1996-11-04 | 2002-12-17 | Thomas M. Espinosa | Tie down building, system tie down, and method |
| US6153381A (en) * | 1997-08-28 | 2000-11-28 | Millennium Pharmaceuticals, Inc. | Screening for antibiotics |
| CN1191363C (zh) * | 2002-02-11 | 2005-03-02 | 陈秀枢 | β-内酰胺酶/氨基糖苷钝化酶融合基因其表达产物其组合物及其应用 |
| EP1564286A1 (en) * | 2004-02-11 | 2005-08-17 | Université de Liège | Hybrid proteins of beta-lactamase class A |
| WO2009032664A2 (en) * | 2007-08-31 | 2009-03-12 | The Regents Of The University Of Michigan | Methods and compositions for increasing biological molecule stability |
| AU2011230619C1 (en) | 2010-03-25 | 2016-06-23 | Oregon Health & Science University | CMV glycoproteins and recombinant vectors |
| HUE037408T2 (hu) | 2011-06-10 | 2018-08-28 | Univ Oregon Health & Science | CMV glikoproteinek és rekombináns vektorok |
| CA2789539A1 (en) | 2011-09-12 | 2013-03-12 | International Aids Vaccine Initiative | Immunoselection of recombinant vesicular stomatitis virus expressing hiv-1 proteins by broadly neutralizing antibodies |
| ES2631608T3 (es) | 2012-06-27 | 2017-09-01 | International Aids Vaccine Initiative | Variante de la glicoproteína Env del VIH-1 |
| EP2848937A1 (en) | 2013-09-05 | 2015-03-18 | International Aids Vaccine Initiative | Methods of identifying novel HIV-1 immunogens |
| US10058604B2 (en) | 2013-10-07 | 2018-08-28 | International Aids Vaccine Initiative | Soluble HIV-1 envelope glycoprotein trimers |
| EP3069730A3 (en) | 2015-03-20 | 2017-03-15 | International Aids Vaccine Initiative | Soluble hiv-1 envelope glycoprotein trimers |
| US9931394B2 (en) | 2015-03-23 | 2018-04-03 | International Aids Vaccine Initiative | Soluble HIV-1 envelope glycoprotein trimers |
Family Cites Families (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| IE48385B1 (en) * | 1978-08-11 | 1984-12-26 | Univ California | Synthesis of a eucaryotic protein by a microorganism |
| US4820642A (en) * | 1983-04-04 | 1989-04-11 | The Regents Of The University Of California | Amplified expression vector |
| DE69027956T2 (de) * | 1989-05-31 | 1997-03-06 | Ajinomoto Kk | Sekretorische Expressionsvektoren für Mycobakterien sowie Transformanten |
-
1992
- 1992-02-14 FR FR9201713A patent/FR2687410A1/fr active Granted
-
1993
- 1993-02-12 EP EP93905393A patent/EP0626013A1/fr not_active Withdrawn
- 1993-02-12 WO PCT/FR1993/000151 patent/WO1993017113A1/fr not_active Ceased
- 1993-02-12 US US08/284,465 patent/US5830457A/en not_active Expired - Fee Related
Non-Patent Citations (1)
| Title |
|---|
| See references of WO9317113A1 * |
Also Published As
| Publication number | Publication date |
|---|---|
| US5830457A (en) | 1998-11-03 |
| FR2687410B1 (ja�@�@) | 1994-12-16 |
| WO1993017113A1 (fr) | 1993-09-02 |
| FR2687410A1 (fr) | 1993-08-20 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| ES2274580T3 (es) | Vacuna de la tuberculosis. | |
| EP0626013A1 (fr) | $g(b)-LACTAMASE RECOMBINANTE, UTILISABLE EN TANT QUE MOLECULE PORTEUSE POUR LA PREPARATION DE COMPOSITIONS IMMUNOGENES | |
| JP3485916B2 (ja) | 組み換えマイコバクテリアの発現ベヒクルおよびその使用 | |
| US20040203039A1 (en) | Attenuated salmonella SP12 mutants as antigen carriers | |
| EP0712414A1 (fr) | Vecteur recombinant contenant une sequence d'un gene de lipoproteine pour l'expression de sequences de nucleotides | |
| Cirillo et al. | Bacterial vaccine vectors and bacillus Calmette-Guerin | |
| CA2121598A1 (fr) | Promoteur de m. paratuberculosis et son utilisation pour l'expression de sequences immunogenes | |
| US5866403A (en) | Homologously recombinant slow growing mycobacteria and uses therefor | |
| US6776993B2 (en) | Tuberculosis vaccine | |
| EP0666917A1 (fr) | Promoteur de m. paratuberculosis et son utilisation pour l'expression de sequences immunogenes | |
| US6235518B1 (en) | Recombinant immunogenic actinomycetale | |
| CA2344173C (en) | Immunogenic liposome compositions | |
| EP0991663B1 (fr) | Souches de mycobacterium dont le gene erp est modifie et composition vaccinale la contenant | |
| JP2001518781A (ja) | マイコバクテリウム組換えワクチン | |
| RU2429292C1 (ru) | РЕКОМБИНАНТНАЯ ПЛАЗМИДА pAg85A-CBD, ШТАММ Escherichia coli [pREP4, pAg85A-CBD], ХИМЕРНЫЙ БЕЛОК Ag85A-CBD И ИХ ПРИМЕНЕНИЕ | |
| CN116829693A (zh) | 口服冠状病毒感染症疫苗 | |
| Green | The development and use of antigen-antibody-LTB (Ag-MAb-LTB) complexes as immunogens | |
| HK1039064B (en) | Immunogenic liposome compositions | |
| MX2008007399A (es) | Compusto inmunogénico basad0 en virus condicionalmente vivo y metodo para producirlo. | |
| HK1091217B (en) | Tuberculosis vaccine with improved efficacy | |
| HK1091217A1 (zh) | 效能提高的结核病疫苗 |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| PUAI | Public reference made under article 153(3) epc to a published international application that has entered the european phase |
Free format text: ORIGINAL CODE: 0009012 |
|
| 17P | Request for examination filed |
Effective date: 19940823 |
|
| AK | Designated contracting states |
Kind code of ref document: A1 Designated state(s): AT BE CH DE DK ES FR GB GR IE IT LI LU MC NL PT SE |
|
| STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: THE APPLICATION IS DEEMED TO BE WITHDRAWN |
|
| 18D | Application deemed to be withdrawn |
Effective date: 20020829 |