DK2651975T3 - Humant monoklonalt antistof med specificitet for dengue-virus- serotype-1e-protein og anvendelser deraf - Google Patents
Humant monoklonalt antistof med specificitet for dengue-virus- serotype-1e-protein og anvendelser deraf Download PDFInfo
- Publication number
- DK2651975T3 DK2651975T3 DK11848839.4T DK11848839T DK2651975T3 DK 2651975 T3 DK2651975 T3 DK 2651975T3 DK 11848839 T DK11848839 T DK 11848839T DK 2651975 T3 DK2651975 T3 DK 2651975T3
- Authority
- DK
- Denmark
- Prior art keywords
- antibody
- fragment
- human
- cells
- dengue
- Prior art date
Links
- 241000725619 Dengue virus Species 0.000 title claims description 39
- 108090000623 proteins and genes Proteins 0.000 title claims description 38
- 102000004169 proteins and genes Human genes 0.000 title claims description 26
- 210000004027 cell Anatomy 0.000 claims description 108
- 206010012310 Dengue fever Diseases 0.000 claims description 77
- 208000025729 dengue disease Diseases 0.000 claims description 72
- 230000027455 binding Effects 0.000 claims description 69
- 239000012634 fragment Substances 0.000 claims description 68
- 210000003719 b-lymphocyte Anatomy 0.000 claims description 67
- 239000000427 antigen Substances 0.000 claims description 59
- 108091007433 antigens Proteins 0.000 claims description 56
- 102000036639 antigens Human genes 0.000 claims description 56
- 101710204837 Envelope small membrane protein Proteins 0.000 claims description 55
- 101710145006 Lysis protein Proteins 0.000 claims description 55
- 238000000034 method Methods 0.000 claims description 47
- 241000700605 Viruses Species 0.000 claims description 44
- 230000003472 neutralizing effect Effects 0.000 claims description 34
- 239000008194 pharmaceutical composition Substances 0.000 claims description 21
- 108060003951 Immunoglobulin Proteins 0.000 claims description 18
- 102000018358 immunoglobulin Human genes 0.000 claims description 18
- 125000003275 alpha amino acid group Chemical group 0.000 claims description 15
- 201000010099 disease Diseases 0.000 claims description 15
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 claims description 15
- 239000003795 chemical substances by application Substances 0.000 claims description 13
- 108020004707 nucleic acids Proteins 0.000 claims description 10
- 150000007523 nucleic acids Chemical class 0.000 claims description 10
- 102000039446 nucleic acids Human genes 0.000 claims description 10
- 108010054477 Immunoglobulin Fab Fragments Proteins 0.000 claims description 7
- 102000001706 Immunoglobulin Fab Fragments Human genes 0.000 claims description 7
- 239000003937 drug carrier Substances 0.000 claims description 5
- 239000013604 expression vector Substances 0.000 claims description 4
- 238000002649 immunization Methods 0.000 claims description 4
- 230000003053 immunization Effects 0.000 claims description 4
- BWGNESOTFCXPMA-UHFFFAOYSA-N Dihydrogen disulfide Chemical compound SS BWGNESOTFCXPMA-UHFFFAOYSA-N 0.000 claims description 3
- 230000001580 bacterial effect Effects 0.000 claims description 3
- 230000037396 body weight Effects 0.000 claims description 3
- 238000004132 cross linking Methods 0.000 claims description 3
- 101000998953 Homo sapiens Immunoglobulin heavy variable 1-2 Proteins 0.000 claims description 2
- 101001047619 Homo sapiens Immunoglobulin kappa variable 3-20 Proteins 0.000 claims description 2
- 102100036887 Immunoglobulin heavy variable 1-2 Human genes 0.000 claims description 2
- 102100022964 Immunoglobulin kappa variable 3-20 Human genes 0.000 claims description 2
- 210000003527 eukaryotic cell Anatomy 0.000 claims description 2
- 210000004962 mammalian cell Anatomy 0.000 claims description 2
- 230000000202 analgesic effect Effects 0.000 claims 1
- 230000002155 anti-virotic effect Effects 0.000 claims 1
- 208000001490 Dengue Diseases 0.000 description 60
- 208000015181 infectious disease Diseases 0.000 description 47
- 239000000203 mixture Substances 0.000 description 38
- 108010047041 Complementarity Determining Regions Proteins 0.000 description 26
- 230000000694 effects Effects 0.000 description 22
- 238000003556 assay Methods 0.000 description 21
- 230000001225 therapeutic effect Effects 0.000 description 21
- 241000710886 West Nile virus Species 0.000 description 19
- 238000006386 neutralization reaction Methods 0.000 description 19
- 238000001727 in vivo Methods 0.000 description 18
- 238000011282 treatment Methods 0.000 description 16
- 238000002965 ELISA Methods 0.000 description 15
- 230000003612 virological effect Effects 0.000 description 15
- 241000701044 Human gammaherpesvirus 4 Species 0.000 description 14
- 241000699670 Mus sp. Species 0.000 description 13
- 238000004519 manufacturing process Methods 0.000 description 13
- 239000006228 supernatant Substances 0.000 description 13
- 230000001419 dependent effect Effects 0.000 description 11
- 230000000069 prophylactic effect Effects 0.000 description 11
- 239000013598 vector Substances 0.000 description 11
- 241000710831 Flavivirus Species 0.000 description 10
- 238000000338 in vitro Methods 0.000 description 10
- 238000012360 testing method Methods 0.000 description 10
- 101100454807 Caenorhabditis elegans lgg-1 gene Proteins 0.000 description 9
- 241001465754 Metazoa Species 0.000 description 9
- 241000699666 Mus <mouse, genus> Species 0.000 description 9
- 206010058874 Viraemia Diseases 0.000 description 9
- 210000000628 antibody-producing cell Anatomy 0.000 description 9
- 238000010367 cloning Methods 0.000 description 9
- 239000013078 crystal Substances 0.000 description 9
- 239000003814 drug Substances 0.000 description 9
- 238000002474 experimental method Methods 0.000 description 9
- 238000012216 screening Methods 0.000 description 9
- 102100038080 B-cell receptor CD22 Human genes 0.000 description 8
- 101000884305 Homo sapiens B-cell receptor CD22 Proteins 0.000 description 8
- LOKCTEFSRHRXRJ-UHFFFAOYSA-I dipotassium trisodium dihydrogen phosphate hydrogen phosphate dichloride Chemical compound P(=O)(O)(O)[O-].[K+].P(=O)(O)([O-])[O-].[Na+].[Na+].[Cl-].[K+].[Cl-].[Na+] LOKCTEFSRHRXRJ-UHFFFAOYSA-I 0.000 description 8
- 230000006870 function Effects 0.000 description 8
- 230000004927 fusion Effects 0.000 description 8
- 239000002245 particle Substances 0.000 description 8
- 239000002953 phosphate buffered saline Substances 0.000 description 8
- 101100217502 Caenorhabditis elegans lgg-3 gene Proteins 0.000 description 7
- 102000018697 Membrane Proteins Human genes 0.000 description 7
- 108010052285 Membrane Proteins Proteins 0.000 description 7
- 206010028980 Neoplasm Diseases 0.000 description 7
- 238000009472 formulation Methods 0.000 description 7
- 230000002265 prevention Effects 0.000 description 7
- 230000009467 reduction Effects 0.000 description 7
- 238000006722 reduction reaction Methods 0.000 description 7
- 230000004044 response Effects 0.000 description 7
- 210000002966 serum Anatomy 0.000 description 7
- 208000024891 symptom Diseases 0.000 description 7
- 229960005486 vaccine Drugs 0.000 description 7
- 208000009714 Severe Dengue Diseases 0.000 description 6
- 102100021696 Syncytin-1 Human genes 0.000 description 6
- 241000251539 Vertebrata <Metazoa> Species 0.000 description 6
- 201000011510 cancer Diseases 0.000 description 6
- 230000028993 immune response Effects 0.000 description 6
- 230000003993 interaction Effects 0.000 description 6
- 238000002955 isolation Methods 0.000 description 6
- 210000004698 lymphocyte Anatomy 0.000 description 6
- 230000001717 pathogenic effect Effects 0.000 description 6
- 210000003819 peripheral blood mononuclear cell Anatomy 0.000 description 6
- 108020004414 DNA Proteins 0.000 description 5
- 241000282412 Homo Species 0.000 description 5
- 102000008394 Immunoglobulin Fragments Human genes 0.000 description 5
- 108010021625 Immunoglobulin Fragments Proteins 0.000 description 5
- 238000001514 detection method Methods 0.000 description 5
- 230000002708 enhancing effect Effects 0.000 description 5
- 230000036541 health Effects 0.000 description 5
- 230000036039 immunity Effects 0.000 description 5
- 210000001806 memory b lymphocyte Anatomy 0.000 description 5
- 244000052769 pathogen Species 0.000 description 5
- 102000005962 receptors Human genes 0.000 description 5
- 108020003175 receptors Proteins 0.000 description 5
- 239000000126 substance Substances 0.000 description 5
- 102100027207 CD27 antigen Human genes 0.000 description 4
- 101100454808 Caenorhabditis elegans lgg-2 gene Proteins 0.000 description 4
- 101710091045 Envelope protein Proteins 0.000 description 4
- 101000914511 Homo sapiens CD27 antigen Proteins 0.000 description 4
- 108010067060 Immunoglobulin Variable Region Proteins 0.000 description 4
- 102000017727 Immunoglobulin Variable Region Human genes 0.000 description 4
- 241000124008 Mammalia Species 0.000 description 4
- 101710188315 Protein X Proteins 0.000 description 4
- 239000013543 active substance Substances 0.000 description 4
- 229940035676 analgesics Drugs 0.000 description 4
- 239000000730 antalgic agent Substances 0.000 description 4
- 239000003443 antiviral agent Substances 0.000 description 4
- 238000013459 approach Methods 0.000 description 4
- 210000004369 blood Anatomy 0.000 description 4
- 239000008280 blood Substances 0.000 description 4
- 238000004113 cell culture Methods 0.000 description 4
- 239000003153 chemical reaction reagent Substances 0.000 description 4
- 238000004624 confocal microscopy Methods 0.000 description 4
- 239000012228 culture supernatant Substances 0.000 description 4
- 238000010790 dilution Methods 0.000 description 4
- 239000012895 dilution Substances 0.000 description 4
- 229940079593 drug Drugs 0.000 description 4
- 238000001493 electron microscopy Methods 0.000 description 4
- 210000004602 germ cell Anatomy 0.000 description 4
- 230000005764 inhibitory process Effects 0.000 description 4
- 230000003834 intracellular effect Effects 0.000 description 4
- 239000007788 liquid Substances 0.000 description 4
- 238000010859 live-cell imaging Methods 0.000 description 4
- 239000000463 material Substances 0.000 description 4
- 230000007246 mechanism Effects 0.000 description 4
- 239000012528 membrane Substances 0.000 description 4
- 230000008569 process Effects 0.000 description 4
- 230000001681 protective effect Effects 0.000 description 4
- 150000003839 salts Chemical class 0.000 description 4
- 230000003248 secreting effect Effects 0.000 description 4
- 239000007790 solid phase Substances 0.000 description 4
- 238000002560 therapeutic procedure Methods 0.000 description 4
- 210000001519 tissue Anatomy 0.000 description 4
- 238000012546 transfer Methods 0.000 description 4
- 241001529453 unidentified herpesvirus Species 0.000 description 4
- 230000007501 viral attachment Effects 0.000 description 4
- 230000009385 viral infection Effects 0.000 description 4
- QTBSBXVTEAMEQO-UHFFFAOYSA-N Acetic acid Chemical compound CC(O)=O QTBSBXVTEAMEQO-UHFFFAOYSA-N 0.000 description 3
- 239000012103 Alexa Fluor 488 Substances 0.000 description 3
- 239000012114 Alexa Fluor 647 Substances 0.000 description 3
- -1 CD86 Proteins 0.000 description 3
- 102000004127 Cytokines Human genes 0.000 description 3
- 108090000695 Cytokines Proteins 0.000 description 3
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 3
- WSFSSNUMVMOOMR-UHFFFAOYSA-N Formaldehyde Chemical compound O=C WSFSSNUMVMOOMR-UHFFFAOYSA-N 0.000 description 3
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 3
- 241001502974 Human gammaherpesvirus 8 Species 0.000 description 3
- 229920001213 Polysorbate 20 Polymers 0.000 description 3
- 208000036142 Viral infection Diseases 0.000 description 3
- 150000001413 amino acids Chemical class 0.000 description 3
- 230000005875 antibody response Effects 0.000 description 3
- 230000015572 biosynthetic process Effects 0.000 description 3
- 239000000872 buffer Substances 0.000 description 3
- 239000000969 carrier Substances 0.000 description 3
- 238000006243 chemical reaction Methods 0.000 description 3
- 230000000120 cytopathologic effect Effects 0.000 description 3
- 201000009892 dengue shock syndrome Diseases 0.000 description 3
- 238000010494 dissociation reaction Methods 0.000 description 3
- 230000005593 dissociations Effects 0.000 description 3
- 238000005516 engineering process Methods 0.000 description 3
- 239000000499 gel Substances 0.000 description 3
- 210000000987 immune system Anatomy 0.000 description 3
- 230000001965 increasing effect Effects 0.000 description 3
- MYWUZJCMWCOHBA-VIFPVBQESA-N methamphetamine Chemical compound CN[C@@H](C)CC1=CC=CC=C1 MYWUZJCMWCOHBA-VIFPVBQESA-N 0.000 description 3
- 239000011325 microbead Substances 0.000 description 3
- 210000005259 peripheral blood Anatomy 0.000 description 3
- 239000011886 peripheral blood Substances 0.000 description 3
- 210000002381 plasma Anatomy 0.000 description 3
- 239000000256 polyoxyethylene sorbitan monolaurate Substances 0.000 description 3
- 235000010486 polyoxyethylene sorbitan monolaurate Nutrition 0.000 description 3
- 230000003389 potentiating effect Effects 0.000 description 3
- 238000002360 preparation method Methods 0.000 description 3
- 102000004196 processed proteins & peptides Human genes 0.000 description 3
- 108090000765 processed proteins & peptides Proteins 0.000 description 3
- 230000002829 reductive effect Effects 0.000 description 3
- 230000029058 respiratory gaseous exchange Effects 0.000 description 3
- 239000000523 sample Substances 0.000 description 3
- 238000010186 staining Methods 0.000 description 3
- 238000005406 washing Methods 0.000 description 3
- 241001492267 Alcelaphine gammaherpesvirus 1 Species 0.000 description 2
- 241000272517 Anseriformes Species 0.000 description 2
- 241000701061 Ateline gammaherpesvirus 2 Species 0.000 description 2
- 241000283690 Bos taurus Species 0.000 description 2
- OKTJSMMVPCPJKN-UHFFFAOYSA-N Carbon Chemical compound [C] OKTJSMMVPCPJKN-UHFFFAOYSA-N 0.000 description 2
- 241000710815 Dengue virus 2 Species 0.000 description 2
- 241000255925 Diptera Species 0.000 description 2
- 101710121417 Envelope glycoprotein Proteins 0.000 description 2
- 241000725578 Equid gammaherpesvirus 2 Species 0.000 description 2
- 102000009109 Fc receptors Human genes 0.000 description 2
- 108010087819 Fc receptors Proteins 0.000 description 2
- 101000708009 Homo sapiens Sentrin-specific protease 8 Proteins 0.000 description 2
- 102000000588 Interleukin-2 Human genes 0.000 description 2
- 108010002350 Interleukin-2 Proteins 0.000 description 2
- 102000004388 Interleukin-4 Human genes 0.000 description 2
- 108090000978 Interleukin-4 Proteins 0.000 description 2
- 241001677694 Macacine gammaherpesvirus 5 Species 0.000 description 2
- 241001467058 Murid gammaherpesvirus 4 Species 0.000 description 2
- 241001529936 Murinae Species 0.000 description 2
- 241000282320 Panthera leo Species 0.000 description 2
- 108020004511 Recombinant DNA Proteins 0.000 description 2
- 102100031407 Sentrin-specific protease 8 Human genes 0.000 description 2
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 2
- 108700019146 Transgenes Proteins 0.000 description 2
- 108010067390 Viral Proteins Proteins 0.000 description 2
- 230000010530 Virus Neutralization Effects 0.000 description 2
- 239000002253 acid Substances 0.000 description 2
- 230000001154 acute effect Effects 0.000 description 2
- 239000002671 adjuvant Substances 0.000 description 2
- 238000004458 analytical method Methods 0.000 description 2
- 230000009830 antibody antigen interaction Effects 0.000 description 2
- 210000000612 antigen-presenting cell Anatomy 0.000 description 2
- 230000000890 antigenic effect Effects 0.000 description 2
- 230000004071 biological effect Effects 0.000 description 2
- 230000000903 blocking effect Effects 0.000 description 2
- 229910052799 carbon Inorganic materials 0.000 description 2
- 150000001875 compounds Chemical class 0.000 description 2
- 230000002950 deficient Effects 0.000 description 2
- 201000002950 dengue hemorrhagic fever Diseases 0.000 description 2
- 238000013461 design Methods 0.000 description 2
- 238000011161 development Methods 0.000 description 2
- 238000010586 diagram Methods 0.000 description 2
- 210000001723 extracellular space Anatomy 0.000 description 2
- 239000011521 glass Substances 0.000 description 2
- 150000004676 glycans Chemical class 0.000 description 2
- 238000011577 humanized mouse model Methods 0.000 description 2
- 230000028996 humoral immune response Effects 0.000 description 2
- 230000002163 immunogen Effects 0.000 description 2
- 238000001114 immunoprecipitation Methods 0.000 description 2
- 238000002347 injection Methods 0.000 description 2
- 239000007924 injection Substances 0.000 description 2
- 238000007918 intramuscular administration Methods 0.000 description 2
- 238000001990 intravenous administration Methods 0.000 description 2
- 238000002372 labelling Methods 0.000 description 2
- 150000002632 lipids Chemical class 0.000 description 2
- 239000003550 marker Substances 0.000 description 2
- 230000001404 mediated effect Effects 0.000 description 2
- 229940126619 mouse monoclonal antibody Drugs 0.000 description 2
- 230000035772 mutation Effects 0.000 description 2
- 239000002773 nucleotide Substances 0.000 description 2
- 125000003729 nucleotide group Chemical group 0.000 description 2
- 229920003023 plastic Polymers 0.000 description 2
- 239000004033 plastic Substances 0.000 description 2
- 108010052044 polyclonal B cell activator Proteins 0.000 description 2
- 229920001184 polypeptide Polymers 0.000 description 2
- 229920001282 polysaccharide Polymers 0.000 description 2
- 239000005017 polysaccharide Substances 0.000 description 2
- 238000011321 prophylaxis Methods 0.000 description 2
- 238000000159 protein binding assay Methods 0.000 description 2
- 230000005180 public health Effects 0.000 description 2
- 238000003127 radioimmunoassay Methods 0.000 description 2
- 230000008707 rearrangement Effects 0.000 description 2
- 238000003259 recombinant expression Methods 0.000 description 2
- 238000010188 recombinant method Methods 0.000 description 2
- 238000007423 screening assay Methods 0.000 description 2
- 238000000926 separation method Methods 0.000 description 2
- 238000002922 simulated annealing Methods 0.000 description 2
- 239000011780 sodium chloride Substances 0.000 description 2
- JQWHASGSAFIOCM-UHFFFAOYSA-M sodium periodate Chemical compound [Na+].[O-]I(=O)(=O)=O JQWHASGSAFIOCM-UHFFFAOYSA-M 0.000 description 2
- 239000000243 solution Substances 0.000 description 2
- 241000894007 species Species 0.000 description 2
- 230000009870 specific binding Effects 0.000 description 2
- 238000007920 subcutaneous administration Methods 0.000 description 2
- 239000000725 suspension Substances 0.000 description 2
- 229940124597 therapeutic agent Drugs 0.000 description 2
- 230000009261 transgenic effect Effects 0.000 description 2
- 238000012800 visualization Methods 0.000 description 2
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 2
- 238000001262 western blot Methods 0.000 description 2
- UAIUNKRWKOVEES-UHFFFAOYSA-N 3,3',5,5'-tetramethylbenzidine Chemical compound CC1=C(N)C(C)=CC(C=2C=C(C)C(N)=C(C)C=2)=C1 UAIUNKRWKOVEES-UHFFFAOYSA-N 0.000 description 1
- 102100031585 ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1 Human genes 0.000 description 1
- 206010069754 Acquired gene mutation Diseases 0.000 description 1
- 241000256118 Aedes aegypti Species 0.000 description 1
- 229920000936 Agarose Polymers 0.000 description 1
- 239000012099 Alexa Fluor family Substances 0.000 description 1
- 241000959095 Alonsoa Species 0.000 description 1
- 208000002109 Argyria Diseases 0.000 description 1
- 208000031504 Asymptomatic Infections Diseases 0.000 description 1
- 241000271566 Aves Species 0.000 description 1
- 230000003844 B-cell-activation Effects 0.000 description 1
- 241000894006 Bacteria Species 0.000 description 1
- 102100025221 CD70 antigen Human genes 0.000 description 1
- 241000282472 Canis lupus familiaris Species 0.000 description 1
- 241000283707 Capra Species 0.000 description 1
- 229920002134 Carboxymethyl cellulose Polymers 0.000 description 1
- 102000019034 Chemokines Human genes 0.000 description 1
- 108010012236 Chemokines Proteins 0.000 description 1
- 102000008186 Collagen Human genes 0.000 description 1
- 108010035532 Collagen Proteins 0.000 description 1
- 208000035473 Communicable disease Diseases 0.000 description 1
- 241000218631 Coniferophyta Species 0.000 description 1
- 241000557626 Corvus corax Species 0.000 description 1
- 241000938605 Crocodylia Species 0.000 description 1
- FBPFZTCFMRRESA-KVTDHHQDSA-N D-Mannitol Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-KVTDHHQDSA-N 0.000 description 1
- 230000004544 DNA amplification Effects 0.000 description 1
- 241000710827 Dengue virus 1 Species 0.000 description 1
- 101150059079 EBNA1 gene Proteins 0.000 description 1
- 101150113929 EBNA2 gene Proteins 0.000 description 1
- 102100025137 Early activation antigen CD69 Human genes 0.000 description 1
- 238000011510 Elispot assay Methods 0.000 description 1
- 102220575773 Ellis-van Creveld syndrome protein_Q95A_mutation Human genes 0.000 description 1
- 206010014596 Encephalitis Japanese B Diseases 0.000 description 1
- 102000004190 Enzymes Human genes 0.000 description 1
- 108090000790 Enzymes Proteins 0.000 description 1
- 206010015108 Epstein-Barr virus infection Diseases 0.000 description 1
- 108091034120 Epstein–Barr virus-encoded small RNA Proteins 0.000 description 1
- 241000283086 Equidae Species 0.000 description 1
- OTMSDBZUPAUEDD-UHFFFAOYSA-N Ethane Chemical compound CC OTMSDBZUPAUEDD-UHFFFAOYSA-N 0.000 description 1
- 241000206602 Eukaryota Species 0.000 description 1
- 241000874889 Euphilotes enoptes Species 0.000 description 1
- 208000015220 Febrile disease Diseases 0.000 description 1
- 206010054261 Flavivirus infection Diseases 0.000 description 1
- 241000287828 Gallus gallus Species 0.000 description 1
- 108700028146 Genetic Enhancer Elements Proteins 0.000 description 1
- SXRSQZLOMIGNAQ-UHFFFAOYSA-N Glutaraldehyde Chemical compound O=CCCCC=O SXRSQZLOMIGNAQ-UHFFFAOYSA-N 0.000 description 1
- 229920002683 Glycosaminoglycan Polymers 0.000 description 1
- 101000777636 Homo sapiens ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1 Proteins 0.000 description 1
- 101000934356 Homo sapiens CD70 antigen Proteins 0.000 description 1
- 101000934374 Homo sapiens Early activation antigen CD69 Proteins 0.000 description 1
- 101001057504 Homo sapiens Interferon-stimulated gene 20 kDa protein Proteins 0.000 description 1
- 101001055144 Homo sapiens Interleukin-2 receptor subunit alpha Proteins 0.000 description 1
- 101001136981 Homo sapiens Proteasome subunit beta type-9 Proteins 0.000 description 1
- 101000738771 Homo sapiens Receptor-type tyrosine-protein phosphatase C Proteins 0.000 description 1
- 101000884271 Homo sapiens Signal transducer CD24 Proteins 0.000 description 1
- 101000934341 Homo sapiens T-cell surface glycoprotein CD5 Proteins 0.000 description 1
- CPELXLSAUQHCOX-UHFFFAOYSA-N Hydrogen bromide Chemical class Br CPELXLSAUQHCOX-UHFFFAOYSA-N 0.000 description 1
- 102000009786 Immunoglobulin Constant Regions Human genes 0.000 description 1
- 108010009817 Immunoglobulin Constant Regions Proteins 0.000 description 1
- 108700005091 Immunoglobulin Genes Proteins 0.000 description 1
- 102000006992 Interferon-alpha Human genes 0.000 description 1
- 108010047761 Interferon-alpha Proteins 0.000 description 1
- 102000003996 Interferon-beta Human genes 0.000 description 1
- 108090000467 Interferon-beta Proteins 0.000 description 1
- 102000008070 Interferon-gamma Human genes 0.000 description 1
- 108010074328 Interferon-gamma Proteins 0.000 description 1
- 102100026878 Interleukin-2 receptor subunit alpha Human genes 0.000 description 1
- 201000005807 Japanese encephalitis Diseases 0.000 description 1
- 241000710842 Japanese encephalitis virus Species 0.000 description 1
- 208000007766 Kaposi sarcoma Diseases 0.000 description 1
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical group OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 1
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 1
- 101150113776 LMP1 gene Proteins 0.000 description 1
- 239000000232 Lipid Bilayer Substances 0.000 description 1
- 101710122625 Low affinity immunoglobulin gamma Fc region receptor II Proteins 0.000 description 1
- 241000701043 Lymphocryptovirus Species 0.000 description 1
- 208000030289 Lymphoproliferative disease Diseases 0.000 description 1
- OFOBLEOULBTSOW-UHFFFAOYSA-L Malonate Chemical compound [O-]C(=O)CC([O-])=O OFOBLEOULBTSOW-UHFFFAOYSA-L 0.000 description 1
- 229930195725 Mannitol Natural products 0.000 description 1
- 108010090054 Membrane Glycoproteins Proteins 0.000 description 1
- 102000012750 Membrane Glycoproteins Human genes 0.000 description 1
- LSDPWZHWYPCBBB-UHFFFAOYSA-N Methanethiol Chemical compound SC LSDPWZHWYPCBBB-UHFFFAOYSA-N 0.000 description 1
- DBFMBHXVWIURSV-UHFFFAOYSA-N N-isopropylammelide Chemical compound CC(C)NC1=NC(O)=NC(O)=N1 DBFMBHXVWIURSV-UHFFFAOYSA-N 0.000 description 1
- 108020005187 Oligonucleotide Probes Proteins 0.000 description 1
- 241001670273 Ooia Species 0.000 description 1
- 241000283973 Oryctolagus cuniculus Species 0.000 description 1
- 238000012408 PCR amplification Methods 0.000 description 1
- 229910019142 PO4 Inorganic materials 0.000 description 1
- 108090000526 Papain Proteins 0.000 description 1
- 241001494479 Pecora Species 0.000 description 1
- 102000057297 Pepsin A Human genes 0.000 description 1
- 108090000284 Pepsin A Proteins 0.000 description 1
- 208000037581 Persistent Infection Diseases 0.000 description 1
- 229920000954 Polyglycolide Polymers 0.000 description 1
- 241000288906 Primates Species 0.000 description 1
- XBDQKXXYIPTUBI-UHFFFAOYSA-N Propionic acid Chemical class CCC(O)=O XBDQKXXYIPTUBI-UHFFFAOYSA-N 0.000 description 1
- 239000004365 Protease Substances 0.000 description 1
- 102100035764 Proteasome subunit beta type-9 Human genes 0.000 description 1
- 108010076504 Protein Sorting Signals Proteins 0.000 description 1
- 238000010802 RNA extraction kit Methods 0.000 description 1
- 239000012980 RPMI-1640 medium Substances 0.000 description 1
- 241000700159 Rattus Species 0.000 description 1
- 102100037422 Receptor-type tyrosine-protein phosphatase C Human genes 0.000 description 1
- 208000035415 Reinfection Diseases 0.000 description 1
- 241000283984 Rodentia Species 0.000 description 1
- 239000006146 Roswell Park Memorial Institute medium Substances 0.000 description 1
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 1
- 241000290149 Scapteriscus didactylus Species 0.000 description 1
- 241000555744 Sciurus lis Species 0.000 description 1
- 229920002684 Sepharose Polymers 0.000 description 1
- 102100038081 Signal transducer CD24 Human genes 0.000 description 1
- 240000003949 Sporobolus virginicus Species 0.000 description 1
- 238000000692 Student's t-test Methods 0.000 description 1
- 241000282887 Suidae Species 0.000 description 1
- QAOWNCQODCNURD-UHFFFAOYSA-N Sulfuric acid Chemical compound OS(O)(=O)=O QAOWNCQODCNURD-UHFFFAOYSA-N 0.000 description 1
- 102100025244 T-cell surface glycoprotein CD5 Human genes 0.000 description 1
- 210000001744 T-lymphocyte Anatomy 0.000 description 1
- 241000710771 Tick-borne encephalitis virus Species 0.000 description 1
- RTAQQCXQSZGOHL-UHFFFAOYSA-N Titanium Chemical compound [Ti] RTAQQCXQSZGOHL-UHFFFAOYSA-N 0.000 description 1
- 108700005077 Viral Genes Proteins 0.000 description 1
- 238000002835 absorbance Methods 0.000 description 1
- 238000010521 absorption reaction Methods 0.000 description 1
- 238000009825 accumulation Methods 0.000 description 1
- 150000001242 acetic acid derivatives Chemical class 0.000 description 1
- 230000004913 activation Effects 0.000 description 1
- 239000012190 activator Substances 0.000 description 1
- 230000033289 adaptive immune response Effects 0.000 description 1
- 210000005006 adaptive immune system Anatomy 0.000 description 1
- 230000029936 alkylation Effects 0.000 description 1
- 238000005804 alkylation reaction Methods 0.000 description 1
- 125000000539 amino acid group Chemical group 0.000 description 1
- 230000003321 amplification Effects 0.000 description 1
- 238000000540 analysis of variance Methods 0.000 description 1
- 238000010171 animal model Methods 0.000 description 1
- 239000003242 anti bacterial agent Substances 0.000 description 1
- 230000000844 anti-bacterial effect Effects 0.000 description 1
- 230000003441 anti-flavivirus Effects 0.000 description 1
- 229940088710 antibiotic agent Drugs 0.000 description 1
- 238000009175 antibody therapy Methods 0.000 description 1
- 230000009831 antigen interaction Effects 0.000 description 1
- 239000003963 antioxidant agent Substances 0.000 description 1
- 235000006708 antioxidants Nutrition 0.000 description 1
- 229940121357 antivirals Drugs 0.000 description 1
- XKRFYHLGVUSROY-UHFFFAOYSA-N argon Substances [Ar] XKRFYHLGVUSROY-UHFFFAOYSA-N 0.000 description 1
- 229910052786 argon Inorganic materials 0.000 description 1
- 238000003491 array Methods 0.000 description 1
- 108010029566 avian influenza A virus hemagglutinin Proteins 0.000 description 1
- 239000011324 bead Substances 0.000 description 1
- 230000008901 benefit Effects 0.000 description 1
- 150000001558 benzoic acid derivatives Chemical class 0.000 description 1
- 238000004166 bioassay Methods 0.000 description 1
- 239000012472 biological sample Substances 0.000 description 1
- 210000001124 body fluid Anatomy 0.000 description 1
- 210000001185 bone marrow Anatomy 0.000 description 1
- 125000001314 canonical amino-acid group Chemical group 0.000 description 1
- 239000002775 capsule Substances 0.000 description 1
- 150000001718 carbodiimides Chemical class 0.000 description 1
- 230000010261 cell growth Effects 0.000 description 1
- 238000002659 cell therapy Methods 0.000 description 1
- 238000005119 centrifugation Methods 0.000 description 1
- 238000012512 characterization method Methods 0.000 description 1
- 235000013330 chicken meat Nutrition 0.000 description 1
- 210000004978 chinese hamster ovary cell Anatomy 0.000 description 1
- 208000037976 chronic inflammation Diseases 0.000 description 1
- 238000003776 cleavage reaction Methods 0.000 description 1
- 229920001436 collagen Polymers 0.000 description 1
- 230000000052 comparative effect Effects 0.000 description 1
- 230000000295 complement effect Effects 0.000 description 1
- 230000004154 complement system Effects 0.000 description 1
- 230000021615 conjugation Effects 0.000 description 1
- 229920001577 copolymer Polymers 0.000 description 1
- 230000009260 cross reactivity Effects 0.000 description 1
- 230000007123 defense Effects 0.000 description 1
- 230000003111 delayed effect Effects 0.000 description 1
- 230000008021 deposition Effects 0.000 description 1
- 239000010432 diamond Substances 0.000 description 1
- 235000005911 diet Nutrition 0.000 description 1
- 230000037213 diet Effects 0.000 description 1
- 235000014113 dietary fatty acids Nutrition 0.000 description 1
- 230000006806 disease prevention Effects 0.000 description 1
- BFMYDTVEBKDAKJ-UHFFFAOYSA-L disodium;(2',7'-dibromo-3',6'-dioxido-3-oxospiro[2-benzofuran-1,9'-xanthene]-4'-yl)mercury;hydrate Chemical compound O.[Na+].[Na+].O1C(=O)C2=CC=CC=C2C21C1=CC(Br)=C([O-])C([Hg])=C1OC1=C2C=C(Br)C([O-])=C1 BFMYDTVEBKDAKJ-UHFFFAOYSA-L 0.000 description 1
- 238000009826 distribution Methods 0.000 description 1
- 239000002552 dosage form Substances 0.000 description 1
- 231100000673 dose–response relationship Toxicity 0.000 description 1
- 239000008298 dragée Substances 0.000 description 1
- 239000000890 drug combination Substances 0.000 description 1
- 239000000975 dye Substances 0.000 description 1
- 239000012636 effector Substances 0.000 description 1
- 230000008030 elimination Effects 0.000 description 1
- 238000003379 elimination reaction Methods 0.000 description 1
- 238000010828 elution Methods 0.000 description 1
- 239000003995 emulsifying agent Substances 0.000 description 1
- 239000000839 emulsion Substances 0.000 description 1
- 206010014599 encephalitis Diseases 0.000 description 1
- 230000002121 endocytic effect Effects 0.000 description 1
- 230000012202 endocytosis Effects 0.000 description 1
- 230000005183 environmental health Effects 0.000 description 1
- 230000002255 enzymatic effect Effects 0.000 description 1
- 229940088598 enzyme Drugs 0.000 description 1
- 238000003114 enzyme-linked immunosorbent spot assay Methods 0.000 description 1
- 230000032050 esterification Effects 0.000 description 1
- 238000005886 esterification reaction Methods 0.000 description 1
- DNJIEGIFACGWOD-UHFFFAOYSA-N ethyl mercaptane Natural products CCS DNJIEGIFACGWOD-UHFFFAOYSA-N 0.000 description 1
- 238000011156 evaluation Methods 0.000 description 1
- 230000029142 excretion Effects 0.000 description 1
- 239000000194 fatty acid Substances 0.000 description 1
- 229930195729 fatty acid Natural products 0.000 description 1
- 150000004665 fatty acids Chemical class 0.000 description 1
- 230000037406 food intake Effects 0.000 description 1
- 239000012520 frozen sample Substances 0.000 description 1
- 230000005714 functional activity Effects 0.000 description 1
- 229940044627 gamma-interferon Drugs 0.000 description 1
- 238000001415 gene therapy Methods 0.000 description 1
- 230000002068 genetic effect Effects 0.000 description 1
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 1
- 230000013595 glycosylation Effects 0.000 description 1
- 238000006206 glycosylation reaction Methods 0.000 description 1
- 239000003102 growth factor Substances 0.000 description 1
- CPBQJMYROZQQJC-UHFFFAOYSA-N helium neon Chemical compound [He].[Ne] CPBQJMYROZQQJC-UHFFFAOYSA-N 0.000 description 1
- 244000052637 human pathogen Species 0.000 description 1
- 230000004727 humoral immunity Effects 0.000 description 1
- 230000008348 humoral response Effects 0.000 description 1
- 210000004408 hybridoma Anatomy 0.000 description 1
- 150000003840 hydrochlorides Chemical class 0.000 description 1
- 210000004201 immune sera Anatomy 0.000 description 1
- 229940042743 immune sera Drugs 0.000 description 1
- 238000003018 immunoassay Methods 0.000 description 1
- 238000010166 immunofluorescence Methods 0.000 description 1
- 229940072221 immunoglobulins Drugs 0.000 description 1
- 230000006872 improvement Effects 0.000 description 1
- 238000000099 in vitro assay Methods 0.000 description 1
- 238000010921 in-depth analysis Methods 0.000 description 1
- 238000011534 incubation Methods 0.000 description 1
- 230000001524 infective effect Effects 0.000 description 1
- 230000004054 inflammatory process Effects 0.000 description 1
- 208000037797 influenza A Diseases 0.000 description 1
- 239000004615 ingredient Substances 0.000 description 1
- 230000015788 innate immune response Effects 0.000 description 1
- 229910052500 inorganic mineral Inorganic materials 0.000 description 1
- 229940028885 interleukin-4 Drugs 0.000 description 1
- 238000007912 intraperitoneal administration Methods 0.000 description 1
- PGLTVOMIXTUURA-UHFFFAOYSA-N iodoacetamide Chemical compound NC(=O)CI PGLTVOMIXTUURA-UHFFFAOYSA-N 0.000 description 1
- 239000010410 layer Substances 0.000 description 1
- 230000021633 leukocyte mediated immunity Effects 0.000 description 1
- 239000002502 liposome Substances 0.000 description 1
- 239000012160 loading buffer Substances 0.000 description 1
- 230000007774 longterm Effects 0.000 description 1
- 210000001165 lymph node Anatomy 0.000 description 1
- 210000003563 lymphoid tissue Anatomy 0.000 description 1
- 229920002521 macromolecule Polymers 0.000 description 1
- 210000002540 macrophage Anatomy 0.000 description 1
- 238000012423 maintenance Methods 0.000 description 1
- 230000036210 malignancy Effects 0.000 description 1
- 239000000594 mannitol Substances 0.000 description 1
- 235000010355 mannitol Nutrition 0.000 description 1
- 238000013507 mapping Methods 0.000 description 1
- 230000035800 maturation Effects 0.000 description 1
- 238000005259 measurement Methods 0.000 description 1
- 108020004999 messenger RNA Proteins 0.000 description 1
- 230000002503 metabolic effect Effects 0.000 description 1
- 230000004060 metabolic process Effects 0.000 description 1
- 229930182817 methionine Natural products 0.000 description 1
- 239000000693 micelle Substances 0.000 description 1
- 238000002493 microarray Methods 0.000 description 1
- 239000003094 microcapsule Substances 0.000 description 1
- 238000000386 microscopy Methods 0.000 description 1
- 239000004005 microsphere Substances 0.000 description 1
- 239000011707 mineral Substances 0.000 description 1
- 230000004048 modification Effects 0.000 description 1
- 238000012986 modification Methods 0.000 description 1
- 210000005087 mononuclear cell Anatomy 0.000 description 1
- 210000002864 mononuclear phagocyte Anatomy 0.000 description 1
- 230000000877 morphologic effect Effects 0.000 description 1
- 238000010172 mouse model Methods 0.000 description 1
- OHDXDNUPVVYWOV-UHFFFAOYSA-N n-methyl-1-(2-naphthalen-1-ylsulfanylphenyl)methanamine Chemical compound CNCC1=CC=CC=C1SC1=CC=CC2=CC=CC=C12 OHDXDNUPVVYWOV-UHFFFAOYSA-N 0.000 description 1
- 239000002077 nanosphere Substances 0.000 description 1
- 239000006070 nanosuspension Substances 0.000 description 1
- 238000003199 nucleic acid amplification method Methods 0.000 description 1
- 239000002751 oligonucleotide probe Substances 0.000 description 1
- 231100000590 oncogenic Toxicity 0.000 description 1
- 230000002246 oncogenic effect Effects 0.000 description 1
- 238000005457 optimization Methods 0.000 description 1
- 210000000056 organ Anatomy 0.000 description 1
- 150000007524 organic acids Chemical class 0.000 description 1
- 235000005985 organic acids Nutrition 0.000 description 1
- 230000008520 organization Effects 0.000 description 1
- 230000003647 oxidation Effects 0.000 description 1
- 238000007254 oxidation reaction Methods 0.000 description 1
- 239000006179 pH buffering agent Substances 0.000 description 1
- 238000004806 packaging method and process Methods 0.000 description 1
- 229940055729 papain Drugs 0.000 description 1
- 235000019834 papain Nutrition 0.000 description 1
- 244000045947 parasite Species 0.000 description 1
- 231100000255 pathogenic effect Toxicity 0.000 description 1
- 230000037361 pathway Effects 0.000 description 1
- 229940111202 pepsin Drugs 0.000 description 1
- 235000021317 phosphate Nutrition 0.000 description 1
- 150000003013 phosphoric acid derivatives Chemical class 0.000 description 1
- 230000004962 physiological condition Effects 0.000 description 1
- 239000006187 pill Substances 0.000 description 1
- 239000013612 plasmid Substances 0.000 description 1
- 229920000747 poly(lactic acid) Polymers 0.000 description 1
- 229920002401 polyacrylamide Polymers 0.000 description 1
- 210000002729 polyribosome Anatomy 0.000 description 1
- 239000013641 positive control Substances 0.000 description 1
- 230000000770 proinflammatory effect Effects 0.000 description 1
- 230000002062 proliferating effect Effects 0.000 description 1
- 230000035755 proliferation Effects 0.000 description 1
- 230000002797 proteolythic effect Effects 0.000 description 1
- 238000000746 purification Methods 0.000 description 1
- 239000002510 pyrogen Substances 0.000 description 1
- 238000004451 qualitative analysis Methods 0.000 description 1
- 238000003908 quality control method Methods 0.000 description 1
- 238000011002 quantification Methods 0.000 description 1
- 230000002285 radioactive effect Effects 0.000 description 1
- 238000002708 random mutagenesis Methods 0.000 description 1
- 230000000306 recurrent effect Effects 0.000 description 1
- 238000005932 reductive alkylation reaction Methods 0.000 description 1
- 230000001105 regulatory effect Effects 0.000 description 1
- 230000010076 replication Effects 0.000 description 1
- 238000011160 research Methods 0.000 description 1
- 108091008146 restriction endonucleases Proteins 0.000 description 1
- 230000001177 retroviral effect Effects 0.000 description 1
- 238000012552 review Methods 0.000 description 1
- 230000007017 scission Effects 0.000 description 1
- 230000028327 secretion Effects 0.000 description 1
- 230000035945 sensitivity Effects 0.000 description 1
- 238000012163 sequencing technique Methods 0.000 description 1
- 230000000405 serological effect Effects 0.000 description 1
- 230000019491 signal transduction Effects 0.000 description 1
- 239000002356 single layer Substances 0.000 description 1
- 238000002741 site-directed mutagenesis Methods 0.000 description 1
- 239000002002 slurry Substances 0.000 description 1
- 239000007787 solid Substances 0.000 description 1
- 230000037439 somatic mutation Effects 0.000 description 1
- 238000001228 spectrum Methods 0.000 description 1
- 210000000952 spleen Anatomy 0.000 description 1
- 239000007858 starting material Substances 0.000 description 1
- 238000006467 substitution reaction Methods 0.000 description 1
- 150000003467 sulfuric acid derivatives Chemical class 0.000 description 1
- 239000001117 sulphuric acid Substances 0.000 description 1
- 235000011149 sulphuric acid Nutrition 0.000 description 1
- 230000001629 suppression Effects 0.000 description 1
- 239000000375 suspending agent Substances 0.000 description 1
- 239000006188 syrup Substances 0.000 description 1
- 235000020357 syrup Nutrition 0.000 description 1
- 239000003826 tablet Substances 0.000 description 1
- 230000008685 targeting Effects 0.000 description 1
- 230000002123 temporal effect Effects 0.000 description 1
- 229940124598 therapeutic candidate Drugs 0.000 description 1
- 238000011287 therapeutic dose Methods 0.000 description 1
- 239000002562 thickening agent Substances 0.000 description 1
- 238000004448 titration Methods 0.000 description 1
- 230000000699 topical effect Effects 0.000 description 1
- 231100000331 toxic Toxicity 0.000 description 1
- 230000002588 toxic effect Effects 0.000 description 1
- 230000005030 transcription termination Effects 0.000 description 1
- 230000009466 transformation Effects 0.000 description 1
- 238000011830 transgenic mouse model Methods 0.000 description 1
- 102000035160 transmembrane proteins Human genes 0.000 description 1
- 108091005703 transmembrane proteins Proteins 0.000 description 1
- 210000003171 tumor-infiltrating lymphocyte Anatomy 0.000 description 1
- 230000002792 vascular Effects 0.000 description 1
- 239000003981 vehicle Substances 0.000 description 1
- 230000035899 viability Effects 0.000 description 1
- 210000000605 viral structure Anatomy 0.000 description 1
- 239000008215 water for injection Substances 0.000 description 1
- 238000009736 wetting Methods 0.000 description 1
- 239000000080 wetting agent Substances 0.000 description 1
- DGVVWUTYPXICAM-UHFFFAOYSA-N β‐Mercaptoethanol Chemical compound OCCS DGVVWUTYPXICAM-UHFFFAOYSA-N 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/08—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from viruses
- C07K16/10—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from viruses from RNA viruses
- C07K16/1081—Togaviridae, e.g. flavivirus, rubella virus, hog cholera virus
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
- A61K39/42—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum viral
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K45/00—Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
- A61K45/06—Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
- A61P31/14—Antivirals for RNA viruses
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/21—Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/34—Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/51—Complete heavy chain or Fd fragment, i.e. VH + CH1
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/515—Complete light chain, i.e. VL + CL
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/55—Fab or Fab'
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/565—Complementarity determining region [CDR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
- Y02A—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
- Y02A50/00—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
- Y02A50/30—Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Medicinal Chemistry (AREA)
- Virology (AREA)
- General Health & Medical Sciences (AREA)
- Organic Chemistry (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Immunology (AREA)
- Epidemiology (AREA)
- Molecular Biology (AREA)
- Microbiology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Mycology (AREA)
- Engineering & Computer Science (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Genetics & Genomics (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Oncology (AREA)
- General Chemical & Material Sciences (AREA)
- Communicable Diseases (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
Claims (24)
1. Isoleret antistof eller fragment deraf der binder specifikt til et Dengue-virus-serotype-l-kappe (E) -protein eller fragment deraf, hvor antistoffet er et humant antistof med neutraliserende aktivitet, der krydsbinder to E-proteiner i en virus, hvor krydsbindingen af to E-proteiner omfatter binding til DI og forbindelsesleddet mellem DI og II på et E-protein og Dili på et tilstødende E-protein.
2. Antistof eller fragment deraf ifølge krav 1, hvor antistoffet eller fragmentet deraf er valgt fra gruppen bestående af: (a) et helt immunoglobulinmolekyle; (b) et scFv; (c) et Fab-fragment; (d) en F(ab')2; og (e) et disulfid-forbundet Fv.
3. Antistof eller fragment deraf ifølge krav 1 eller 2, hvor antistoffet eller fragmentet deraf omfatter: et -tungkæde immunoglobulin konstant domæne valgt fra gruppen bestående af: (a) et human-IgM konstant domæne; (b) et human-IgGl konstant domæne; (c) et human-IgG2 konstant domæne; (d) et human-IgG3 konstant domæne; (e) et human-IgG4 konstant domæne; og (f) et human-IgAl/2 konstant domæne;
4. Antistof eller fragment deraf ifølge krav 1 eller 2, hvor antistoffet eller fragmentet deraf omfatter: en tung kæde omfattende mindst en CDR valgt fra gruppen af CDR'er med aminosyresekvenserne SYGMH, VIWYDGSKTYYGDSVKG eller GIAGGWAFW.
5. Antistoffet eller fragment deraf ifølge krav 1 eller 2, hvor antistoffet eller fragmentet deraf omfatter: en tung kæde omfattende de tre CDR'er med aminosyresekvenserne SYGMH, VIWYDGSKTYYGDSVKG og GIAGGWAFW.
6. Antistoffet eller fragment deraf ifølge krav 1 eller 2, hvor antistoffet eller fragmentet deraf omfatter: en tungkæde med aminosyresekvensen EVQLVESGGGVVQPGRSLRLSCAASGFSFSSYGMHWVRQAPGKG LEWVAVIWYDGSKTYYGDSVKGRFTISKDNSKKMVNLQMDSLGV EDTAF YY C ARGI AGG WAF W GIDL WGQGTLVT V S S.
7. Antistoffet eller fragment deraf ifølge krav 1 eller 2, hvor antistoffet eller fragmentet deraf omfatter: en tungkæde-struktur af IGHVl-2*02 og mindst en af CDR'erne med aminosyresekvensen SYGMH, VIWYDGSKTYYGDSVKG eller GIAGGWAFW.
8. Antistoffet eller fragment deraf ifølge krav 1 eller 2, hvor antistoffet eller fragmentet deraf omfatter: et letkæde immunoglobulin konstant domæne valgt fra gruppen bestående af: (a) et human-Ig-kappa konstant domæne; og (b) et human-Ig-lambda konstant domæne.
9. Antistoffet eller fragment deraf ifølge krav 1 eller 2, hvor antistoffet eller fragmentet deraf omfatter: en letkæde omfattende mindst en CDR valgt fra gruppen af CDR'er med aminosyresekvenserne RASQNVYSYLG, GVTSRAT eller QQYAG.
10. Antistoffet eller fragment deraf ifølge krav 1 eller 2, hvor antistoffet eller fragmentet deraf omfatter: en letkæde omfattende de tre CDR'er med aminosyresekvenserne RASQNVYSYLG, GVTSRAT og QQYAG.
11. Antistoffet eller fragment deraf ifølge krav 1 eller 2, hvor antistoffet eller fragmentet deraf omfatter: en letkæde med aminosyresekvensen DVVMTQSPGTLSLSPGERATLSCRASQNVYSYLGWYQHKPGRSPR LLIFG VTSRATG VPDRFSG SG SGTDFTLTISRLEPEDFAVYY C QQ Y A GSAYTFGQGTKVEIKR eller DIVMTQSPGTLSLSPGERATLSCRASQNVYSYLGWYQHKPGRSPR LLIFGVTSRATGVPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYA GSAYTFGQGTKVEIKR.
12. Antistoffet eller fragment deraf ifølge krav 1 eller 2, hvor antistoffet eller fragmentet deraf omfatter: en letkæde-struktur af IGKV3-20*01 og mindst en af CDR'erne med aminosyresekvenserne RASQNVYSYLG, GVTSRAT eller QQYAG.
13. Antistoffet eller fragment deraf ifølge et hvilket som helst af kravene 1-12, hvor antistoffet: binder til en Dengue-virus med bindingsspecificiteten af et antistof med tungkæde-aminosyresekvensen EVQLVESGGGVVQPGRSLRLSCAASGFSFSSYGMHWVRQAPGKG LEWVAVIWYDGSKTYYGDSVKGRFTISKDNSKKMVNLQMDSLGV EDTAFYYCARGIAGGWAFWGIDLWGQGTLVTVSS og letkæde-aminosyresekvens DVVMTQSPGTLSLSPGERATLSCRASQNVYSYLGWYQHKPGRSPR LLIFGVTSRATGVPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYA GSAYTFGQGTKVEIKR eller DIVMTQSPGTLSLSPGERATLSCRASQNVYSYLGWYQHKPGRSPR LLIFGVTSRATGVPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYA GSAYTFGQGTKVEIKR.
14. Antistoffet eller fragment deraf ifølge et hvilket som helst af kravene 1-12, hvor antistoffet: er et antistof med tungkæde-aminosyresekvensen EVQLVESGGGVVQPGRSLRLSCAASGFSFSSYGMHWVRQAPGKG LEWVAVIWYDGSKTYYGDSVKGRFTISKDNSKKMVNLQMDSLGV EDTAFYYCARGIAGGWAFWGIDLWGQGTLVTVSS og letkæde-aminosyresekvensen DVVMTQSPGTLSLSPGERATLSCRASQNVYSYLGWYQHKPGRSPR LLIFGVTSRATGVPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYA GSAYTFGQGTKVEIKR eller DIVMTQSPGTLSLSPGERATLSCRASQNVYSYLGWYQHKPGRSPR LLIFGVTSRATGVPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYA GSAYTFGQGTKVEIKR.
15. Antistoffet eller fragment deraf ifølge et hvilket som helst af kravene 1-14, hvor antistoffet eller fragmentet deraf binder til et antigen med en affinitetskonstant (Kd) på mindre end 1 x 10'8 M, og eventuelt binder til et antigen med en affinitetskonstant (Kd) på mindre end 1 x 10'9 M.
16. Antistoffet eller fragment deraf ifølge et hvilket som helst af kravene 1-15, hvor antistoffet er afledt af en B-celle fra en patient, der er kommet sig efter Dengue-virusinfektion.
17. Farmaceutisk sammensætning omfattende antistoffet eller fragmentet deraf ifølge et hvilket som helst af kravene 1-16 og en farmaceutisk acceptabel bærer, der er effektiv til at reducere eller forebygge Dengue-virusinfektion hos et individ.
18. Farmaceutisk sammensætning ifølge krav 17, endvidere omfattende et andet middel.
19. Antistof eller fragment deraf ifølge et hvilket som helst af kravene 1-16 til anvendelse i en fremgangsmåde til passiv immunisering mod Dengue-virusinfektion omfattende indgivelse til et individ afen effektiv mængde af antistoffet eller fragmentet deraf ifølge et hvilket som helst af kravene 1-16.
20. Antistof eller fragment deraf ifølge et hvilket som helst af kravene 1-16 til anvendelse i en fremgangsmåde til behandling af Dengue-virusinfektion omfattende indgivelse til et individ, som har behov derfor, af en mængde antistof eller fragment deraf ifølge et hvilket som helst af kravene 1-16, der er effektivt til at reducere eller forebygge sygdommen.
21. Antistoffet til anvendelsen ifølge krav 20, hvor: antistoffet indgives intravenøst (IV), subkutant (SC), intramuskulært (IM), transdermalt, eller oralt; eller antistoffet indgives i en mængde i området fra 1 til 100 milligram pr. kilogram af individets kropsvægt; eller anvendelsen endvidere omfatter indgivelse af et andet middel, eventuelt hvor det andet middel er antivirus-lægemiddel eller smertestillende lægemiddel.
22. Isoleret nukleinsyre, der koder for antistoffet eller fragmentet deraf ifølge et hvilket som helst af kravene 1-16.
23. Ekspressionsvektor omfattende nukleinsyren ifølge krav 22.
24. Værtscelle omfattende ekspressionsvektoren ifølge krav 23, eventuelt hvor værtscellen er en bakteriecelle, en eukaryotisk celle, eller en pattedyrscelle.
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US42308510P | 2010-12-14 | 2010-12-14 | |
| PCT/SG2011/000436 WO2012082073A1 (en) | 2010-12-14 | 2011-12-14 | Human monoclonal antibody with specificity for dengue virus serotype 1 e protein and uses thereof |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| DK2651975T3 true DK2651975T3 (da) | 2017-10-30 |
Family
ID=46244986
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| DK11848839.4T DK2651975T3 (da) | 2010-12-14 | 2011-12-14 | Humant monoklonalt antistof med specificitet for dengue-virus- serotype-1e-protein og anvendelser deraf |
Country Status (27)
| Country | Link |
|---|---|
| US (2) | US9376486B2 (da) |
| EP (1) | EP2651975B1 (da) |
| JP (2) | JP6483337B2 (da) |
| KR (2) | KR101781546B1 (da) |
| CN (1) | CN103534270B (da) |
| AU (2) | AU2011341744B2 (da) |
| BR (1) | BR112013015129B1 (da) |
| CA (1) | CA2821268C (da) |
| CO (1) | CO6801636A2 (da) |
| CY (1) | CY1119854T1 (da) |
| DK (1) | DK2651975T3 (da) |
| EA (1) | EA201390874A1 (da) |
| ES (1) | ES2644236T3 (da) |
| HR (1) | HRP20171580T1 (da) |
| HU (1) | HUE035609T2 (da) |
| IL (1) | IL226957B (da) |
| LT (1) | LT2651975T (da) |
| MX (1) | MX348152B (da) |
| MY (1) | MY166537A (da) |
| PH (1) | PH12017501075A1 (da) |
| PL (1) | PL2651975T3 (da) |
| PT (1) | PT2651975T (da) |
| RS (1) | RS56737B1 (da) |
| SG (2) | SG10201510111PA (da) |
| SI (1) | SI2651975T1 (da) |
| WO (1) | WO2012082073A1 (da) |
| ZA (1) | ZA201304459B (da) |
Families Citing this family (16)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| ES2566957T3 (es) | 2007-09-26 | 2016-04-18 | Chugai Seiyaku Kabushiki Kaisha | Región constante de anticuerpo modificado |
| BR112013015129B1 (pt) * | 2010-12-14 | 2022-11-16 | National University Of Singapore | Anticorpo isolado ou fragmento do mesmo e composição farmacêutica |
| EP2834265A4 (en) * | 2012-04-02 | 2015-10-14 | Univ North Carolina | METHODS AND COMPOSITIONS FOR DENGUE VIRUS EPITOPES |
| WO2014064707A1 (en) * | 2012-10-26 | 2014-05-01 | International Centre For Genetic Engineering And Biotechnology | Pichia pastoris -expressed dengue virus like particles |
| MX365957B (es) | 2013-06-26 | 2019-06-20 | Univ North Carolina Chapel Hill | Métodos y composiciones para vacunas del virus del dengue. |
| CN113817053A (zh) | 2014-02-11 | 2021-12-21 | 威特拉公司 | 用于登革病毒的抗体分子及其应用 |
| EA201791754A1 (ru) | 2015-02-05 | 2019-01-31 | Чугаи Сейяку Кабусики Кайся | АНТИТЕЛА, СОДЕРЖАЩИЕ ЗАВИСЯЩИЙ ОТ КОНЦЕНТРАЦИИ ИОНОВ АНТИГЕНСВЯЗЫВАЮЩИЙ ДОМЕН, ВАРИАНТЫ Fc-ОБЛАСТИ, IL-8-СВЯЗЫВАЮЩИЕ АНТИТЕЛА И ИХ ПРИМЕНЕНИЯ |
| AU2017238651B2 (en) | 2016-03-25 | 2024-06-13 | Visterra, Inc. | Formulation of antibody molecules to dengue virus |
| CA3026050A1 (en) | 2016-08-05 | 2018-02-08 | Chugai Seiyaku Kabushiki Kaisha | Composition for prophylaxis or treatment of il-8 related diseases |
| SG10201607778XA (en) | 2016-09-16 | 2018-04-27 | Chugai Pharmaceutical Co Ltd | Anti-Dengue Virus Antibodies, Polypeptides Containing Variant Fc Regions, And Methods Of Use |
| EP3765494A4 (en) | 2018-03-15 | 2022-03-23 | Chugai Seiyaku Kabushiki Kaisha | ANTI-DENGUE VIRUS ANTIBODIES WITH CROSS-REACTIVITY AGAINST ZIKA VIRUS AND METHODS OF USE |
| US10526398B2 (en) * | 2018-06-12 | 2020-01-07 | National Defense Medical Center | Anti-dengue virus antibodies and applications thereof |
| US20210188948A1 (en) * | 2018-08-07 | 2021-06-24 | Chan Zuckerberg Biohub, Inc. | Antibodies against dengue virus and related methods |
| US20230018080A1 (en) * | 2019-11-20 | 2023-01-19 | The University Of North Carolina At Chapel Hill | Methods and compositions for recombinant dengue viruses or vaccine and diagnostic development |
| WO2022161597A1 (en) * | 2021-01-26 | 2022-08-04 | Eth Zurich | Method for rapid identification of cross-reactive and/or rare antibodies |
| WO2022162009A1 (en) | 2021-01-26 | 2022-08-04 | Eth Zurich | Method for rapid identification of cross-reactive and/or rare antibodies |
Family Cites Families (31)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4342566A (en) | 1980-02-22 | 1982-08-03 | Scripps Clinic & Research Foundation | Solid phase anti-C3 assay for detection of immune complexes |
| DE3223885A1 (de) | 1982-06-26 | 1983-12-29 | Basf Ag, 6700 Ludwigshafen | Makroporoese, hydrophile traeger fuer enzyme |
| US4816567A (en) | 1983-04-08 | 1989-03-28 | Genentech, Inc. | Recombinant immunoglobin preparations |
| US5225539A (en) | 1986-03-27 | 1993-07-06 | Medical Research Council | Recombinant altered antibodies and methods of making altered antibodies |
| US5651991A (en) | 1987-10-28 | 1997-07-29 | Nippon Shinyaku Co. Ltd. | Drug carriers |
| US5994392A (en) | 1988-02-26 | 1999-11-30 | Neuromedica, Inc. | Antipsychotic prodrugs comprising an antipsychotic agent coupled to an unsaturated fatty acid |
| US5530101A (en) | 1988-12-28 | 1996-06-25 | Protein Design Labs, Inc. | Humanized immunoglobulins |
| US5314995A (en) | 1990-01-22 | 1994-05-24 | Oncogen | Therapeutic interleukin-2-antibody based fusion proteins |
| KR940003548U (ko) | 1992-08-14 | 1994-02-21 | 김형술 | 세탁물 건조기 |
| DK0640622T3 (da) | 1993-02-26 | 2000-10-23 | Drug Delivery System Inst Ltd | Polysaccharidderivat og lægemiddelbærer |
| US5922545A (en) | 1993-10-29 | 1999-07-13 | Affymax Technologies N.V. | In vitro peptide and antibody display libraries |
| DE699079T1 (de) | 1994-03-07 | 1997-09-25 | Dendritech Inc | Bioaktive und/oder gezielte dendrimere-konjugate |
| US5786387A (en) | 1994-03-23 | 1998-07-28 | Meiji Seika Kabushiki Kaisha | Lipid double-chain derivative containing polyoxyethylene |
| JP3699141B2 (ja) | 1994-09-24 | 2005-09-28 | 伸彦 由井 | 超分子構造の生体内分解性医薬高分子集合体及びその調製方法 |
| US5490840A (en) | 1994-09-26 | 1996-02-13 | General Electric Company | Targeted thermal release of drug-polymer conjugates |
| DE4440337A1 (de) | 1994-11-11 | 1996-05-15 | Dds Drug Delivery Services Ges | Pharmazeutische Nanosuspensionen zur Arzneistoffapplikation als Systeme mit erhöhter Sättigungslöslichkeit und Lösungsgeschwindigkeit |
| US6071890A (en) | 1994-12-09 | 2000-06-06 | Genzyme Corporation | Organ-specific targeting of cationic amphiphile/DNA complexes for gene therapy |
| US5739277A (en) | 1995-04-14 | 1998-04-14 | Genentech Inc. | Altered polypeptides with increased half-life |
| US6106866A (en) | 1995-07-31 | 2000-08-22 | Access Pharmaceuticals, Inc. | In vivo agents comprising cationic drugs, peptides and metal chelators with acidic saccharides and glycosaminoglycans, giving improved site-selective localization, uptake mechanism, sensitivity and kinetic-spatial profiles, including tumor sites |
| CA2217134A1 (en) | 1996-10-09 | 1998-04-09 | Sumitomo Pharmaceuticals Co., Ltd. | Sustained release formulation |
| EA006972B1 (ru) | 1998-12-23 | 2006-06-30 | Пфайзер Инк. | Моноклональное антитело человека к ctla-4 и способы его применения |
| EP1792991A1 (en) | 1999-08-24 | 2007-06-06 | Medarex, Inc. | Human CTLA-4 antibodies and their uses |
| US20040126829A1 (en) | 2001-12-18 | 2004-07-01 | Hildebrand William H. | Anti-HLA assay and methods |
| WO2003080672A1 (en) | 2002-03-22 | 2003-10-02 | Aprogen, Inc. | Humanized antibody and process for preparing same |
| CA2894300A1 (en) * | 2003-12-08 | 2005-06-23 | The Government Of The United States Of America, As Represented By The Secreatary, Department Of Health And Human Services | Monoclonal antibodies that bind or neutralize dengue virus |
| US7981431B2 (en) * | 2007-06-08 | 2011-07-19 | National Health Research Institutes | Consensus dengue virus envelope protein domain III polypeptides (cED III) and their methods of use |
| GB0724065D0 (en) | 2007-12-10 | 2008-01-16 | Sparrow Paul A | A spirit level |
| WO2009152147A2 (en) | 2008-06-09 | 2009-12-17 | La Jolla Institute For Allergy And Immunology | Compositions and methods for dengue virus (dv) treatment and vaccination |
| BRPI0914012B1 (pt) * | 2008-10-13 | 2022-02-15 | Institute For Research In Biomedicine | Composição farmacêutica e uso da composição farmacêutica |
| WO2010093335A1 (en) * | 2009-02-10 | 2010-08-19 | Nanyang Technological University | Antibodies for diagnosis and treatment of flaviviral infections |
| BR112013015129B1 (pt) | 2010-12-14 | 2022-11-16 | National University Of Singapore | Anticorpo isolado ou fragmento do mesmo e composição farmacêutica |
-
2011
- 2011-12-14 BR BR112013015129-3A patent/BR112013015129B1/pt active IP Right Grant
- 2011-12-14 SG SG10201510111PA patent/SG10201510111PA/en unknown
- 2011-12-14 KR KR1020137018382A patent/KR101781546B1/ko active IP Right Grant
- 2011-12-14 PT PT118488394T patent/PT2651975T/pt unknown
- 2011-12-14 SG SG2013045745A patent/SG191155A1/en unknown
- 2011-12-14 CN CN201180066887.9A patent/CN103534270B/zh active Active
- 2011-12-14 JP JP2013544435A patent/JP6483337B2/ja active Active
- 2011-12-14 EA EA201390874A patent/EA201390874A1/ru unknown
- 2011-12-14 KR KR1020177026209A patent/KR101904232B1/ko active IP Right Grant
- 2011-12-14 SI SI201131313T patent/SI2651975T1/en unknown
- 2011-12-14 PL PL11848839T patent/PL2651975T3/pl unknown
- 2011-12-14 MY MYPI2013002206A patent/MY166537A/en unknown
- 2011-12-14 DK DK11848839.4T patent/DK2651975T3/da active
- 2011-12-14 MX MX2013006710A patent/MX348152B/es active IP Right Grant
- 2011-12-14 US US13/993,983 patent/US9376486B2/en active Active
- 2011-12-14 RS RS20171031A patent/RS56737B1/sr unknown
- 2011-12-14 LT LTEP11848839.4T patent/LT2651975T/lt unknown
- 2011-12-14 EP EP11848839.4A patent/EP2651975B1/en active Active
- 2011-12-14 AU AU2011341744A patent/AU2011341744B2/en active Active
- 2011-12-14 CA CA2821268A patent/CA2821268C/en active Active
- 2011-12-14 HU HUE11848839A patent/HUE035609T2/hu unknown
- 2011-12-14 ES ES11848839.4T patent/ES2644236T3/es active Active
- 2011-12-14 WO PCT/SG2011/000436 patent/WO2012082073A1/en active Application Filing
-
2013
- 2013-06-13 IL IL226957A patent/IL226957B/en active IP Right Grant
- 2013-06-18 ZA ZA201304459A patent/ZA201304459B/en unknown
- 2013-07-12 CO CO13165679A patent/CO6801636A2/es active IP Right Grant
-
2016
- 2016-06-01 US US15/170,838 patent/US10294293B2/en active Active
- 2016-12-08 AU AU2016269515A patent/AU2016269515A1/en not_active Abandoned
-
2017
- 2017-06-08 PH PH12017501075A patent/PH12017501075A1/en unknown
- 2017-10-17 HR HRP20171580TT patent/HRP20171580T1/hr unknown
- 2017-10-20 JP JP2017203328A patent/JP2018046835A/ja not_active Withdrawn
- 2017-11-08 CY CY20171101173T patent/CY1119854T1/el unknown
Also Published As
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US10294293B2 (en) | Human monoclonal antibody with specificity for dengue virus serotype 1 E protein and uses thereof | |
| JP2023062036A (ja) | ジカウイルスエピトープに特異的に結合する新規抗体及びその使用 | |
| US9145454B2 (en) | Monoclonal antibodies for Ebola and Marburg viruses | |
| CN111344302B (zh) | 特异性结合至寨卡病毒表位的多特异性抗体及其用途 | |
| CN107531779B (zh) | 血清型交叉反应性登革热中和抗体和其用途 | |
| CA3175110A1 (en) | Human monoclonal antibodies to severe acute respiratory syndrome coronavirus 2 (sars-cov-2) | |
| US20240101646A1 (en) | Sars-cov-2 coronavirus antibodies and uses thereof | |
| WO2011124635A1 (en) | Binding molecules against chikungunya virus and uses thereof | |
| EP2374816B1 (en) | Binding molecules against Chikungunya virus and uses thereof | |
| JP2011072248A (ja) | 狂犬病ウイルスに対するヒト抗体ならびにその組成物 | |
| CN118076630A (zh) | 抗hbv抗体及其用途 | |
| WO2022266546A2 (en) | Cross-reactive coronavirus antibodies |