CN113520899A - Recombinant collagen product for skin photodamage repair - Google Patents
Recombinant collagen product for skin photodamage repair Download PDFInfo
- Publication number
- CN113520899A CN113520899A CN202110321963.1A CN202110321963A CN113520899A CN 113520899 A CN113520899 A CN 113520899A CN 202110321963 A CN202110321963 A CN 202110321963A CN 113520899 A CN113520899 A CN 113520899A
- Authority
- CN
- China
- Prior art keywords
- skin
- collagen
- cream
- recombinant collagen
- use according
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Granted
Links
- 102000008186 Collagen Human genes 0.000 title claims abstract description 128
- 108010035532 Collagen Proteins 0.000 title claims abstract description 128
- 229920001436 collagen Polymers 0.000 title claims abstract description 128
- 230000008832 photodamage Effects 0.000 title claims description 17
- 230000008439 repair process Effects 0.000 title abstract description 18
- 239000002537 cosmetic Substances 0.000 claims abstract description 19
- 230000006378 damage Effects 0.000 claims abstract description 18
- 239000006071 cream Substances 0.000 claims description 27
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 claims description 12
- 239000011550 stock solution Substances 0.000 claims description 8
- 125000003275 alpha amino acid group Chemical group 0.000 claims description 6
- 239000006210 lotion Substances 0.000 claims description 6
- 239000003814 drug Substances 0.000 claims description 5
- 238000001467 acupuncture Methods 0.000 claims description 4
- 230000003750 conditioning effect Effects 0.000 claims description 4
- 239000007943 implant Substances 0.000 claims description 4
- 239000008267 milk Substances 0.000 claims description 4
- 210000004080 milk Anatomy 0.000 claims description 4
- 235000013336 milk Nutrition 0.000 claims description 4
- 239000007921 spray Substances 0.000 claims description 4
- 230000000475 sunscreen effect Effects 0.000 claims description 4
- 239000000516 sunscreening agent Substances 0.000 claims description 4
- 239000000839 emulsion Substances 0.000 claims 2
- 235000013402 health food Nutrition 0.000 claims 2
- 210000003491 skin Anatomy 0.000 abstract description 86
- 239000000835 fiber Substances 0.000 abstract description 45
- 230000000694 effects Effects 0.000 abstract description 23
- 210000002615 epidermis Anatomy 0.000 abstract description 14
- 208000027418 Wounds and injury Diseases 0.000 abstract description 13
- 208000014674 injury Diseases 0.000 abstract description 13
- 210000002950 fibroblast Anatomy 0.000 abstract description 10
- 230000002500 effect on skin Effects 0.000 abstract description 8
- 230000035755 proliferation Effects 0.000 abstract description 8
- 210000001626 skin fibroblast Anatomy 0.000 abstract description 7
- 230000003796 beauty Effects 0.000 abstract description 3
- 210000001339 epidermal cell Anatomy 0.000 abstract description 3
- 230000000638 stimulation Effects 0.000 abstract description 3
- 208000024891 symptom Diseases 0.000 abstract description 3
- 208000028990 Skin injury Diseases 0.000 abstract description 2
- 230000012010 growth Effects 0.000 abstract description 2
- 230000002757 inflammatory effect Effects 0.000 abstract description 2
- 241000699670 Mus sp. Species 0.000 description 37
- 239000000243 solution Substances 0.000 description 28
- 210000004207 dermis Anatomy 0.000 description 26
- 206010030113 Oedema Diseases 0.000 description 23
- 206010015150 Erythema Diseases 0.000 description 21
- 231100000321 erythema Toxicity 0.000 description 21
- 241000699666 Mus <mouse, genus> Species 0.000 description 17
- 239000000047 product Substances 0.000 description 15
- 210000004969 inflammatory cell Anatomy 0.000 description 14
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 13
- 206010040880 Skin irritation Diseases 0.000 description 12
- 231100000475 skin irritation Toxicity 0.000 description 12
- 230000036556 skin irritation Effects 0.000 description 12
- 230000015572 biosynthetic process Effects 0.000 description 11
- 210000004027 cell Anatomy 0.000 description 11
- 238000002474 experimental method Methods 0.000 description 11
- 206010051814 Eschar Diseases 0.000 description 10
- 231100000333 eschar Toxicity 0.000 description 10
- 239000004745 nonwoven fabric Substances 0.000 description 10
- 238000009281 ultraviolet germicidal irradiation Methods 0.000 description 10
- 210000004209 hair Anatomy 0.000 description 9
- 238000010186 staining Methods 0.000 description 9
- 210000001519 tissue Anatomy 0.000 description 9
- 241000283973 Oryctolagus cuniculus Species 0.000 description 8
- 230000008595 infiltration Effects 0.000 description 8
- 238000001764 infiltration Methods 0.000 description 8
- 230000007794 irritation Effects 0.000 description 8
- 238000005406 washing Methods 0.000 description 8
- 241000251468 Actinopterygii Species 0.000 description 7
- 241000283690 Bos taurus Species 0.000 description 7
- 239000006144 Dulbecco’s modified Eagle's medium Substances 0.000 description 7
- 210000004204 blood vessel Anatomy 0.000 description 7
- 239000002609 medium Substances 0.000 description 7
- 230000021164 cell adhesion Effects 0.000 description 6
- 238000007490 hematoxylin and eosin (H&E) staining Methods 0.000 description 6
- 238000000034 method Methods 0.000 description 6
- 230000008961 swelling Effects 0.000 description 6
- 239000006285 cell suspension Substances 0.000 description 5
- 230000002497 edematous effect Effects 0.000 description 5
- 239000007788 liquid Substances 0.000 description 5
- WZUVPPKBWHMQCE-UHFFFAOYSA-N Haematoxylin Chemical compound C12=CC(O)=C(O)C=C2CC2(O)C1C1=CC=C(O)C(O)=C1OC2 WZUVPPKBWHMQCE-UHFFFAOYSA-N 0.000 description 4
- 241001465754 Metazoa Species 0.000 description 4
- 241000282898 Sus scrofa Species 0.000 description 4
- 241000700605 Viruses Species 0.000 description 4
- 238000002835 absorbance Methods 0.000 description 4
- 238000012258 culturing Methods 0.000 description 4
- 235000019441 ethanol Nutrition 0.000 description 4
- 239000008103 glucose Substances 0.000 description 4
- 210000003780 hair follicle Anatomy 0.000 description 4
- 231100001083 no cytotoxicity Toxicity 0.000 description 4
- 230000004044 response Effects 0.000 description 4
- 229920006395 saturated elastomer Polymers 0.000 description 4
- 108091003079 Bovine Serum Albumin Proteins 0.000 description 3
- LYCAIKOWRPUZTN-UHFFFAOYSA-N Ethylene glycol Chemical compound OCCO LYCAIKOWRPUZTN-UHFFFAOYSA-N 0.000 description 3
- WSFSSNUMVMOOMR-UHFFFAOYSA-N Formaldehyde Chemical compound O=C WSFSSNUMVMOOMR-UHFFFAOYSA-N 0.000 description 3
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 3
- 241000283977 Oryctolagus Species 0.000 description 3
- 229940098773 bovine serum albumin Drugs 0.000 description 3
- 229940079593 drug Drugs 0.000 description 3
- 238000004043 dyeing Methods 0.000 description 3
- 230000007935 neutral effect Effects 0.000 description 3
- 210000000056 organ Anatomy 0.000 description 3
- 239000012188 paraffin wax Substances 0.000 description 3
- 238000002360 preparation method Methods 0.000 description 3
- 238000002791 soaking Methods 0.000 description 3
- 238000012360 testing method Methods 0.000 description 3
- 206010003694 Atrophy Diseases 0.000 description 2
- 208000005623 Carcinogenesis Diseases 0.000 description 2
- 238000002965 ELISA Methods 0.000 description 2
- 206010020565 Hyperaemia Diseases 0.000 description 2
- 206010061218 Inflammation Diseases 0.000 description 2
- XUMBMVFBXHLACL-UHFFFAOYSA-N Melanin Chemical compound O=C1C(=O)C(C2=CNC3=C(C(C(=O)C4=C32)=O)C)=C2C4=CNC2=C1C XUMBMVFBXHLACL-UHFFFAOYSA-N 0.000 description 2
- CTQNGGLPUBDAKN-UHFFFAOYSA-N O-Xylene Chemical compound CC1=CC=CC=C1C CTQNGGLPUBDAKN-UHFFFAOYSA-N 0.000 description 2
- 206010051246 Photodermatosis Diseases 0.000 description 2
- 108010087230 Sincalide Proteins 0.000 description 2
- 102000004142 Trypsin Human genes 0.000 description 2
- 108090000631 Trypsin Proteins 0.000 description 2
- 230000002159 abnormal effect Effects 0.000 description 2
- 239000002253 acid Substances 0.000 description 2
- 230000001154 acute effect Effects 0.000 description 2
- 230000037444 atrophy Effects 0.000 description 2
- 230000036952 cancer formation Effects 0.000 description 2
- 231100000504 carcinogenesis Toxicity 0.000 description 2
- 238000010609 cell counting kit-8 assay Methods 0.000 description 2
- 238000004113 cell culture Methods 0.000 description 2
- 210000003855 cell nucleus Anatomy 0.000 description 2
- 230000008859 change Effects 0.000 description 2
- 239000003153 chemical reaction reagent Substances 0.000 description 2
- 230000035617 depilation Effects 0.000 description 2
- 230000002951 depilatory effect Effects 0.000 description 2
- 238000001514 detection method Methods 0.000 description 2
- 230000004069 differentiation Effects 0.000 description 2
- 230000008034 disappearance Effects 0.000 description 2
- 238000001035 drying Methods 0.000 description 2
- 239000000686 essence Substances 0.000 description 2
- 238000011156 evaluation Methods 0.000 description 2
- 235000013305 food Nutrition 0.000 description 2
- 230000006870 function Effects 0.000 description 2
- 239000001963 growth medium Substances 0.000 description 2
- 230000004054 inflammatory process Effects 0.000 description 2
- 238000004519 manufacturing process Methods 0.000 description 2
- 239000003550 marker Substances 0.000 description 2
- 238000011587 new zealand white rabbit Methods 0.000 description 2
- 239000002773 nucleotide Substances 0.000 description 2
- 125000003729 nucleotide group Chemical group 0.000 description 2
- DHRLEVQXOMLTIM-UHFFFAOYSA-N phosphoric acid;trioxomolybdenum Chemical compound O=[Mo](=O)=O.O=[Mo](=O)=O.O=[Mo](=O)=O.O=[Mo](=O)=O.O=[Mo](=O)=O.O=[Mo](=O)=O.O=[Mo](=O)=O.O=[Mo](=O)=O.O=[Mo](=O)=O.O=[Mo](=O)=O.O=[Mo](=O)=O.O=[Mo](=O)=O.OP(O)(O)=O DHRLEVQXOMLTIM-UHFFFAOYSA-N 0.000 description 2
- 239000013612 plasmid Substances 0.000 description 2
- 230000008569 process Effects 0.000 description 2
- 230000005855 radiation Effects 0.000 description 2
- 238000007789 sealing Methods 0.000 description 2
- IZTQOLKUZKXIRV-YRVFCXMDSA-N sincalide Chemical compound C([C@@H](C(=O)N[C@@H](CCSC)C(=O)NCC(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC=1C=CC=CC=1)C(N)=O)NC(=O)[C@@H](N)CC(O)=O)C1=CC=C(OS(O)(=O)=O)C=C1 IZTQOLKUZKXIRV-YRVFCXMDSA-N 0.000 description 2
- 230000037075 skin appearance Effects 0.000 description 2
- 210000004003 subcutaneous fat Anatomy 0.000 description 2
- 230000008719 thickening Effects 0.000 description 2
- 239000012588 trypsin Substances 0.000 description 2
- 239000008096 xylene Substances 0.000 description 2
- AXDJCCTWPBKUKL-UHFFFAOYSA-N 4-[(4-aminophenyl)-(4-imino-3-methylcyclohexa-2,5-dien-1-ylidene)methyl]aniline;hydron;chloride Chemical compound Cl.C1=CC(=N)C(C)=CC1=C(C=1C=CC(N)=CC=1)C1=CC=C(N)C=C1 AXDJCCTWPBKUKL-UHFFFAOYSA-N 0.000 description 1
- 206010058820 Acantholysis Diseases 0.000 description 1
- 206010000349 Acanthosis Diseases 0.000 description 1
- 208000019300 CLIPPERS Diseases 0.000 description 1
- 208000018380 Chemical injury Diseases 0.000 description 1
- 238000001712 DNA sequencing Methods 0.000 description 1
- 201000004624 Dermatitis Diseases 0.000 description 1
- 241000588724 Escherichia coli Species 0.000 description 1
- 206010062016 Immunosuppression Diseases 0.000 description 1
- 108010019160 Pancreatin Proteins 0.000 description 1
- 206010033733 Papule Diseases 0.000 description 1
- 206010034972 Photosensitivity reaction Diseases 0.000 description 1
- 108010081750 Reticulin Proteins 0.000 description 1
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 1
- 206010058679 Skin oedema Diseases 0.000 description 1
- 206010041303 Solar dermatitis Diseases 0.000 description 1
- 241000282887 Suidae Species 0.000 description 1
- 230000005856 abnormality Effects 0.000 description 1
- 230000001464 adherent effect Effects 0.000 description 1
- 230000004888 barrier function Effects 0.000 description 1
- 210000002469 basement membrane Anatomy 0.000 description 1
- 230000009286 beneficial effect Effects 0.000 description 1
- 230000008901 benefit Effects 0.000 description 1
- 230000033228 biological regulation Effects 0.000 description 1
- 230000005540 biological transmission Effects 0.000 description 1
- 230000036760 body temperature Effects 0.000 description 1
- 230000037396 body weight Effects 0.000 description 1
- 239000000872 buffer Substances 0.000 description 1
- 230000010261 cell growth Effects 0.000 description 1
- 230000004663 cell proliferation Effects 0.000 description 1
- 238000001516 cell proliferation assay Methods 0.000 description 1
- 230000003833 cell viability Effects 0.000 description 1
- 238000006243 chemical reaction Methods 0.000 description 1
- 238000011097 chromatography purification Methods 0.000 description 1
- 230000001684 chronic effect Effects 0.000 description 1
- 231100000762 chronic effect Toxicity 0.000 description 1
- 208000021930 chronic lymphocytic inflammation with pontine perivascular enhancement responsive to steroids Diseases 0.000 description 1
- 238000002983 circular dichroism Methods 0.000 description 1
- 238000000978 circular dichroism spectroscopy Methods 0.000 description 1
- 238000001142 circular dichroism spectrum Methods 0.000 description 1
- 239000000470 constituent Substances 0.000 description 1
- 238000010276 construction Methods 0.000 description 1
- 208000035250 cutaneous malignant susceptibility to 1 melanoma Diseases 0.000 description 1
- 230000003013 cytotoxicity Effects 0.000 description 1
- 231100000135 cytotoxicity Toxicity 0.000 description 1
- 231100000263 cytotoxicity test Toxicity 0.000 description 1
- 230000007547 defect Effects 0.000 description 1
- 230000002950 deficient Effects 0.000 description 1
- 238000004925 denaturation Methods 0.000 description 1
- 230000036425 denaturation Effects 0.000 description 1
- UKZQEOHHLOYJLY-UHFFFAOYSA-M ethyl eosin Chemical compound [K+].CCOC(=O)C1=CC=CC=C1C1=C2C=C(Br)C(=O)C(Br)=C2OC2=C(Br)C([O-])=C(Br)C=C21 UKZQEOHHLOYJLY-UHFFFAOYSA-M 0.000 description 1
- 238000004299 exfoliation Methods 0.000 description 1
- 239000013613 expression plasmid Substances 0.000 description 1
- 238000004108 freeze drying Methods 0.000 description 1
- 238000010353 genetic engineering Methods 0.000 description 1
- 210000004907 gland Anatomy 0.000 description 1
- 230000036541 health Effects 0.000 description 1
- 208000002557 hidradenitis Diseases 0.000 description 1
- 230000000544 hyperemic effect Effects 0.000 description 1
- 238000007654 immersion Methods 0.000 description 1
- 230000001506 immunosuppresive effect Effects 0.000 description 1
- 230000002779 inactivation Effects 0.000 description 1
- 230000006698 induction Effects 0.000 description 1
- 230000001678 irradiating effect Effects 0.000 description 1
- BPHPUYQFMNQIOC-NXRLNHOXSA-N isopropyl beta-D-thiogalactopyranoside Chemical compound CC(C)S[C@@H]1O[C@H](CO)[C@H](O)[C@H](O)[C@H]1O BPHPUYQFMNQIOC-NXRLNHOXSA-N 0.000 description 1
- 238000011031 large-scale manufacturing process Methods 0.000 description 1
- 230000003902 lesion Effects 0.000 description 1
- 239000011159 matrix material Substances 0.000 description 1
- 201000001441 melanoma Diseases 0.000 description 1
- 230000004060 metabolic process Effects 0.000 description 1
- 230000003020 moisturizing effect Effects 0.000 description 1
- 230000004660 morphological change Effects 0.000 description 1
- 210000004940 nucleus Anatomy 0.000 description 1
- 229940055695 pancreatin Drugs 0.000 description 1
- 230000000737 periodic effect Effects 0.000 description 1
- 239000012466 permeate Substances 0.000 description 1
- 238000007539 photo-oxidation reaction Methods 0.000 description 1
- 230000008845 photoaging Effects 0.000 description 1
- 230000036211 photosensitivity Effects 0.000 description 1
- 231100000760 phototoxic Toxicity 0.000 description 1
- 230000019612 pigmentation Effects 0.000 description 1
- 238000012545 processing Methods 0.000 description 1
- 230000001737 promoting effect Effects 0.000 description 1
- 102000004169 proteins and genes Human genes 0.000 description 1
- 108090000623 proteins and genes Proteins 0.000 description 1
- 238000000746 purification Methods 0.000 description 1
- 238000003908 quality control method Methods 0.000 description 1
- 238000011084 recovery Methods 0.000 description 1
- 230000009467 reduction Effects 0.000 description 1
- 230000009759 skin aging Effects 0.000 description 1
- 230000037394 skin elasticity Effects 0.000 description 1
- 239000007974 sodium acetate buffer Substances 0.000 description 1
- 238000001228 spectrum Methods 0.000 description 1
- 230000004083 survival effect Effects 0.000 description 1
- 239000000725 suspension Substances 0.000 description 1
- 210000000106 sweat gland Anatomy 0.000 description 1
- 238000003786 synthesis reaction Methods 0.000 description 1
- 230000002194 synthesizing effect Effects 0.000 description 1
- 230000001131 transforming effect Effects 0.000 description 1
- 230000024883 vasodilation Effects 0.000 description 1
- XOSXWYQMOYSSKB-LDKJGXKFSA-L water blue Chemical compound CC1=CC(/C(\C(C=C2)=CC=C2NC(C=C2)=CC=C2S([O-])(=O)=O)=C(\C=C2)/C=C/C\2=N\C(C=C2)=CC=C2S([O-])(=O)=O)=CC(S(O)(=O)=O)=C1N.[Na+].[Na+] XOSXWYQMOYSSKB-LDKJGXKFSA-L 0.000 description 1
- 239000001993 wax Substances 0.000 description 1
Images
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K8/00—Cosmetics or similar toiletry preparations
- A61K8/18—Cosmetics or similar toiletry preparations characterised by the composition
- A61K8/30—Cosmetics or similar toiletry preparations characterised by the composition containing organic compounds
- A61K8/64—Proteins; Peptides; Derivatives or degradation products thereof
- A61K8/65—Collagen; Gelatin; Keratin; Derivatives or degradation products thereof
-
- A—HUMAN NECESSITIES
- A23—FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
- A23L—FOODS, FOODSTUFFS, OR NON-ALCOHOLIC BEVERAGES, NOT COVERED BY SUBCLASSES A21D OR A23B-A23J; THEIR PREPARATION OR TREATMENT, e.g. COOKING, MODIFICATION OF NUTRITIVE QUALITIES, PHYSICAL TREATMENT; PRESERVATION OF FOODS OR FOODSTUFFS, IN GENERAL
- A23L33/00—Modifying nutritive qualities of foods; Dietetic products; Preparation or treatment thereof
- A23L33/10—Modifying nutritive qualities of foods; Dietetic products; Preparation or treatment thereof using additives
- A23L33/17—Amino acids, peptides or proteins
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/39—Connective tissue peptides, e.g. collagen, elastin, laminin, fibronectin, vitronectin, cold insoluble globulin [CIG]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P17/00—Drugs for dermatological disorders
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P17/00—Drugs for dermatological disorders
- A61P17/16—Emollients or protectives, e.g. against radiation
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61Q—SPECIFIC USE OF COSMETICS OR SIMILAR TOILETRY PREPARATIONS
- A61Q17/00—Barrier preparations; Preparations brought into direct contact with the skin for affording protection against external influences, e.g. sunlight, X-rays or other harmful rays, corrosive materials, bacteria or insect stings
- A61Q17/04—Topical preparations for affording protection against sunlight or other radiation; Topical sun tanning preparations
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61Q—SPECIFIC USE OF COSMETICS OR SIMILAR TOILETRY PREPARATIONS
- A61Q19/00—Preparations for care of the skin
- A61Q19/004—Aftersun preparations
-
- A—HUMAN NECESSITIES
- A23—FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
- A23V—INDEXING SCHEME RELATING TO FOODS, FOODSTUFFS OR NON-ALCOHOLIC BEVERAGES AND LACTIC OR PROPIONIC ACID BACTERIA USED IN FOODSTUFFS OR FOOD PREPARATION
- A23V2002/00—Food compositions, function of food ingredients or processes for food or foodstuffs
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Animal Behavior & Ethology (AREA)
- General Health & Medical Sciences (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Engineering & Computer Science (AREA)
- Dermatology (AREA)
- Chemical & Material Sciences (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Pharmacology & Pharmacy (AREA)
- Medicinal Chemistry (AREA)
- Epidemiology (AREA)
- Organic Chemistry (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Biomedical Technology (AREA)
- Nutrition Science (AREA)
- Mycology (AREA)
- Food Science & Technology (AREA)
- Gastroenterology & Hepatology (AREA)
- Zoology (AREA)
- Immunology (AREA)
- Polymers & Plastics (AREA)
- Toxicology (AREA)
- Birds (AREA)
- Medicinal Preparation (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Cosmetics (AREA)
Abstract
The invention belongs to the field of dermatology, and particularly relates to a recombinant collagen product for repairing skin ultraviolet injury. The invention provides a recombinant collagen, which has good repairing effect on ultraviolet-damaged skin, good adhesion effect on fibroblasts, no stimulation to skin and good safety, and can promote the proliferation of skin fibroblasts; meanwhile, the recombinant collagen can remarkably improve the inflammatory symptoms after skin injury, keep the moisture of the epidermal layer, induce the growth of epidermal cells of the skin, help to repair collagen fibers of the dermal layer and repair the skin with light injury, and can be used for preparing cosmetics or medical beauty products.
Description
Technical Field
The invention belongs to the field of dermatology, and particularly relates to a recombinant collagen product for repairing skin photodamage.
Background
The skin is the largest organ of the human body, the total area of the skin can reach 1.5 to 2 square meters on average, and the total weight of the skin accounts for 5 to 15 percent of the total weight of the human body. The skin has important barrier function, can protect internal tissues and organs from being invaded by external viruses and physical and chemical injuries, and has the functions of perspiration, cold and heat feeling, pressure, body temperature regulation and the like. In daily life, the skin is inevitably irradiated by sunlight, and ultraviolet rays in the sunlight cause photodamage to the skin, including phototoxic reaction, photosensitivity, photoaging, and carcinogenesis. Most of ultraviolet rays in the sunlight are UVA with the wavelength of 320-400nm, and the UVA can permeate into the epidermis to generate the photooxidation of melanin, so that the skin is quickly changed into tan; UVB in the sun with the wavelength of 280-320nm can cause solar erythema, immunosuppression and carcinogenesis. Excessive ultraviolet radiation can cause not only acute effects such as erythema, inflammation, papules, blisters, flaking, pigmentation, etc. but also chronic effects such as skin aging, DNA abnormalities, malignant melanoma, etc.
Collagen is the major component of the dermis layer of the skin and is present in amounts up to 75% of the dry weight of the skin. Collagen in skin has a characteristic triple helix structure that self-assembles to form a periodic network of fibers that provide tensile strength and elasticity to the skin. Studies have shown that uv radiation affects the metabolism of collagen in the dermis. Collagen fiber bundles have certain elasticity, and ultraviolet irradiation may cause collagen fiber denaturation, thereby causing the reduction of skin elasticity. Collagen is used as key protein in skin, has the functions of good biocompatibility, moisturizing, nourishing skin and the like, and is widely applied to skin care products.
At present, collagen in the market mainly comes from tissues of animals such as fish, pigs, cows and the like, the risk of virus transmission may exist, and animal collagen has the defects of poor water solubility, complex processing process, easy inactivation of collagen in the preparation process and the like because the animal collagen has different sources and is difficult to control the quality. The recombinant collagen prepared by the genetic engineering technology completely eliminates the hidden danger of animal viruses, and has the advantages of easy quality control and uniform molecular weight.
The invention provides a recombinant collagen, which has good repairing effect on ultraviolet-damaged skin, good adhesion effect on fibroblasts, no stimulation to skin and good safety, and can promote the proliferation of skin fibroblasts; meanwhile, the recombinant collagen can remarkably improve the inflammatory symptoms after skin injury, keep the moisture of the epidermal layer, induce the growth of epidermal cells of the skin, help to repair collagen fibers of the dermal layer and repair the skin with light injury, and can be used for preparing cosmetics or medical beauty products.
Disclosure of Invention
The invention aims to provide the application of recombinant collagen in skin photodamage repair. The method specifically comprises the following steps:
in a first aspect, the invention provides the use of a recombinant collagen for the manufacture of a product for repairing photodamage to skin.
Preferably, the amino acid sequence of the recombinant collagen is as follows:
GSPGLPGPRGEQGPTGPTGPAGPRGLQGLQGLQGERGEQGPTGPAGPRGLQGERGEQGPTGLAGKAGEAGAKGETGPAGPQGPRGEQGPQGLPGKDGEAGAQGRPGKRGKQGQKGEKGEPGTQGAKGDRGETGPVGPRGERGEAGPAGKDGERGFPGERGVEGQNGQDGLPGKDGKDGQNGKDGLPGKDGKDGQNGKDGLPGKDGKDGQDGKDGLPGKDGKDGLPGKDGKDGQPGKPGKYGPPGPPGPPGPPGPPGPPGPPGPPGPPGPP。
preferably, the photodamage is ultraviolet damage.
Preferably, the product for repairing photodamage of skin comprises drugs, cosmetics, medical and cosmetic products, foods.
Preferably, the cosmetic comprises stock solution, lotion, essence cream, toner, conditioning water, cream, mask, makeup cream, eye cream, spray, sunscreen cream, foundation, body lotion.
Preferably, the medical cosmetic product comprises a stock solution, a dressing, a cold pack, a gel, a sponge, a film, a hydro-acupuncture, an implant, a milk, a cream, a paste.
In a second aspect, the present invention provides a use of recombinant collagen in the manufacture of a product for preventing photodamage to skin.
Preferably, the amino acid sequence of the recombinant collagen is as follows:
GSPGLPGPRGEQGPTGPTGPAGPRGLQGLQGLQGERGEQGPTGPAGPRGLQGERGEQGPTGLAGKAGEAGAKGETGPAGPQGPRGEQGPQGLPGKDGEAGAQGRPGKRGKQGQKGEKGEPGTQGAKGDRGETGPVGPRGERGEAGPAGKDGERGFPGERGVEGQNGQDGLPGKDGKDGQNGKDGLPGKDGKDGQNGKDGLPGKDGKDGQDGKDGLPGKDGKDGLPGKDGKDGQPGKPGKYGPPGPPGPPGPPGPPGPPGPPGPPGPPGPP。
preferably, the photodamage is ultraviolet damage.
Preferably, the product for preventing photodamage to skin comprises a pharmaceutical, cosmetic, cosmeceutical, food product.
Preferably, the cosmetic comprises stock solution, lotion, essence cream, toner, conditioning water, cream, mask, makeup cream, eye cream, spray, sunscreen cream, foundation, body lotion.
Preferably, the medical cosmetic product comprises a stock solution, a dressing, a cold pack, a gel, a sponge, a film, a hydro-acupuncture, an implant, a milk, a cream, a paste.
The invention has the beneficial effects that:
(1) the recombinant collagen provided by the invention has no cytotoxicity, good safety, no stimulation to skin, good adhesion to fibroblasts and capability of promoting the proliferation of skin fibroblasts;
(2) the recombinant collagen provided by the invention has a remarkable repairing effect on ultraviolet-damaged skin, can improve the inflammation symptom of the skin after being exposed to the sun, keeps the moisture of the epidermal layer, induces the epidermal cell growth of the skin, and helps to repair the collagen fiber of the dermal layer, and the repairing effect of the skin after being exposed to the sun is better than that of the existing collagen sold on the market;
(3) the recombinant collagen provided by the invention has good biocompatibility, no virus hidden danger, good water solubility, suitability for large-scale production and easy addition, and can be used for cosmetics or medical beauty products to help repair photodamaged skin.
Drawings
FIG. 1 circular dichroism spectroscopy of recombinant collagen prepared in example 1 of the present invention;
FIG. 2 shows the cytotoxicity of recombinant collagen prepared in example 1 of the present invention;
FIG. 3 shows the cell proliferation effect of the recombinant collagen prepared in example 1 of the present invention;
FIG. 4 shows the cell adhesion effect of the recombinant collagen prepared in example 1 of the present invention;
FIG. 5 shows skin irritation of New Zealand rabbits by the recombinant collagen prepared in example 1 of the present invention;
FIG. 6 HE staining results of mouse skin tissues of blank group, model group and experimental group;
FIG. 7 HE staining results of skin tissues of mice of different control groups;
FIG. 8 Masson staining results of mouse skin tissues of blank group, model group and experimental group;
FIG. 9 Masson staining results of skin tissues of mice in different control groups.
Detailed Description
The technical solution of the present invention is further described with reference to the following specific examples, but the scope of the present invention is not limited to the following.
EXAMPLE 1 preparation of recombinant collagen
1. Determining the amino acid sequence comprising recombinant collagen as shown below:
MHHHHHHADEQEEKAKVRTELIQELAQGLGGFEKKNFPTLGDEDLDHTYMTKLLTYLQEREQAENSWRKRLLKGIQDHALDLVPRGSPGLPGPRGEQGPTGPTGPAGPRGLQGLQGLQGERGEQGPTGPAGPRGLQGERGEQGPTGLAGKAGEAGAKGETGPAGPQGPRGEQGPQGLPGKDGEAGAQGRPGKRGKQGQKGEKGEPGTQGAKGDRGETGPVGPRGERGEAGPAGKDGERGFPGERGVEGQNGQDGLPGKDGKDGQNGKDGLPGKDGKDGQNGKDGLPGKDGKDGQDGKDGLPGKDGKDGLPGKDGKDGQPGKPGKYGPPGPPGPPGPPGPPGPPGPPGPPGPPGPP。
2. construction of recombinant collagen expression strains
Synthesizing a nucleotide sequence encoding the amino acid sequence described in the above 1, constructing an expression plasmid containing the nucleotide sequence, and confirming the successful synthesis of the plasmid by DNA sequencing; transforming the plasmid into an escherichia coli BL21-DE3 strain, adding glycerol into the successfully transformed positive clone strain, and storing the strain in a refrigerator at-80 ℃ for later use;
3. preparation and purification of recombinant collagen
Taking a trace amount of frozen recombinant collagen expression strain, carrying out IPTG induction culture, treating by using trypsin, carrying out chromatography purification to obtain recombinant collagen, and freeze-drying and storing, wherein the amino acid sequence of the recombinant collagen is as follows:
GSPGLPGPRGEQGPTGPTGPAGPRGLQGLQGLQGERGEQGPTGPAGPRGLQGERGEQGPTGLAGKAGEAGAKGETGPAGPQGPRGEQGPQGLPGKDGEAGAQGRPGKRGKQGQKGEKGEPGTQGAKGDRGETGPVGPRGERGEAGPAGKDGERGFPGERGVEGQNGQDGLPGKDGKDGQNGKDGLPGKDGKDGQNGKDGLPGKDGKDGQDGKDGLPGKDGKDGLPGKDGKDGQPGKPGKYGPPGPPGPPGPPGPPGPPGPPGPPGPPGPP。
example 2 detection of recombinant collagen
1. Circular dichroism detection
The recombinant collagen prepared in example 1 was dissolved in PBS buffer (pH 7.0), sodium acetate buffer (pH3.0) and ethylene glycol, respectively, to a final concentration of 1 mg/mL. And (3) performing spectrum scanning on the recombinant collagen solution by using a circular dichroscope, wherein the scanning wavelength is 210-260nm, the scanning temperature is 4 ℃, the wavelength stepping is 0.5nm, the average time is 0.5 second, and the CD spectra are average values of three times of scanning.
As shown in fig. 1, the recombinant collagen produced in example 1 of the present invention has a positive peak at about 220nm, and is a recombinant collagen having a triple helix structure, which corresponds to the triple helix structure of collagen.
2. Cytotoxicity test
HeLa cells grown completely adherent were digested with 0.25% trypsin and prepared to a cell density of 1X 10 using complete medium (1% FBS, 2% Penicilin-Streptomyces, DMEM medium)5Cell suspension per mL. 100 μ L of cell suspension was transferred and inoculated into 96-well culture plates and placed at 37 ℃ with 5% CO2Culturing in an incubator with saturated humidity for 24 h. The complete culture solution was aspirated, and recombinant collagen solutions (0.001, 0.005, 0.01, 0.05, 0.1mg/ml) prepared in example 1 at different concentrations diluted in high-glucose DMEM medium were added to the experimental group, with 4 multiple wells per concentration; control group was prepared by adding equal amount of yeast to cellsAdding recombinant collagen into high-glucose DMEM medium, and adding 5% CO at 37 deg.C in the blank2Culturing in an incubator with saturated humidity for 24 h. To each group, 10. mu.L of CCK-8 reagent was added, incubated in a cell incubator for 1-4h, and the absorbance value (OD value) of each well was measured at a wavelength of 450nm using an enzyme-linked immunosorbent assay. Cell viability was calculated from the absorbance mean of each group according to the following formula:
the experimental results are shown in fig. 2, and after the recombinant collagen prepared in the embodiment 1 of the present invention is added at different concentrations, the cell survival rates are all above 100%, and the recombinant collagen has no cytotoxicity and good safety.
3. Cell proliferation assay
Human skin fibroblast (HFF-1) grown to 70-80% of the culture dish area is digested with 0.25% pancreatin, and the whole culture solution is used to prepare the cell with density of 1 × 105Cell suspension per mL. 100. mu.L of the cell suspension was inoculated into a 96-well plate and placed at 37 ℃ in 5% CO2Culturing in an incubator with saturated humidity. After 24h of cell culture, the complete culture medium was aspirated. The experimental group was added with 0.1mg/ml of the recombinant collagen solution prepared in example 1 diluted in high-glucose DMEM medium (4 multiple wells were set); the control group is prepared by adding equivalent amount of high-glucose DMEM medium without recombinant collagen into cells, and the blank group is prepared by adding equivalent amount of DMEM medium without cells, and continuing to maintain at 37 deg.C and 5% CO2Culturing in an incubator with saturated humidity for 24h, 48h, 72h and 96h respectively. At intervals, 10. mu.L of CCK-8 reagent was added to each group, incubated in a cell incubator for 1-4h, and the absorbance (OD) of each well was measured at a wavelength of 450nm using an enzyme linked immunosorbent assay. The relative proliferation rate (RGR) of the cells was calculated from the absorbance mean of each group according to the following formula:
as shown in fig. 3, the relative proliferation rates of the cells cultured up to 24h, 48h, 72h and 96h in the experimental group added with the recombinant collagen prepared in example 1 of the present invention are all greater than 100% and tend to increase with time, compared with the blank control group (100%), which indicates that the recombinant collagen prepared in example 1 of the present invention can promote the proliferation of human skin fibroblasts.
4. Cell adhesion experiment
The recombinant collagen prepared in example 1 of the present invention was diluted to 0.1mg/mL with PBS, 24-well cell culture plates without TC treatment were selected, and 500. mu.L of each well of the well plate was treated with 1% heat-denatured BSA and 0.1mg/mL of the recombinant collagen prepared in example 1, and incubated in a refrigerator at 4 ℃ for 24 hours. Mouse fibroblast (L929) growing to 70-80% of the culture dish area is prepared into a cell density of 3 × 10 by using a high-sugar DMEM culture medium5Cell suspension per mL; sucking out the liquid in the 24-well plate, and adding 500 mu L of mouse fibroblast suspension into each well; after 5h, the effect of cell adhesion was observed by means of an inverted microscope.
The experimental result is shown in fig. 4, the fibroblasts growing in Bovine Serum Albumin (BSA) are in a round and non-spread state, while most of the fibroblasts growing in the recombinant collagen are in a spread and adhered state, which indicates that the recombinant collagen prepared in example 1 of the present invention has good cell adhesion performance.
5. Skin irritation test
(1) Procedure of experiment
The back hairs on both sides of the spine of the New Zealand white rabbit are shaved off, the area is about 10cm multiplied by 15cm, and the hair removal cream is applied for 1 to 2 minutes and then washed off. After the hair removal, four areas of the same area are divided on the back and marked with a marker pen. After 24 hours of depilation, nonwoven fabrics (2.5 cm. times.2.5 cm) impregnated with the recombinant collagen solution (1mg/ml) prepared in example 1 were applied flat to two areas of the back skin of each rabbit, the other two areas served as controls, and were fixed with a band-aid having the drug portion removed. After 4h, the band-aid was cut off, the nonwoven fabric was removed, and the test site was gently scrubbed with warm water. After removing the nonwoven fabric for 1 hour, the contact area of the four experimental and control areas on the back of each rabbit was observed for the formation of erythema or eschar. Scoring was performed according to GB/T16886.10-2005 and erythema and eschar formation were recorded: no erythema, 0 point; very slight erythema (barely visible), 1 point; clear erythema, 2 points; moderate erythema, score 3; severe erythema (purplish red) to eschar formation, 4 points. Edema formation: no edema, score 0; very mild edema (barely visible), 1 point; clear edema (swelling, no excess of regional margin), 2 points; moderate edema (swelling of about 1mm), score 3; severe edema (swelling over 1mm and beyond the contact zone) was scored 4. The sum of the two scores is the total score. The product was evaluated for non-irritation according to GB/T16886.10-2005 evaluation criteria for irritation. In addition, erythema and edema at the contact site at each time point of 24h, 48h and 72h after nonwoven fabric removal were observed and recorded.
(2) Results of the experiment
Skin irritation response skin appearance map: observing four experimental and control areas on the back of each white rabbit after 1h, 24h, 48h and 72h of the non-woven fabric is removed, observing whether erythema or eschar is formed on the contact part, grading and recording according to a grading standard, wherein the result is shown in figure 5, the experimental part of the rabbit of each time point experimental group has no erythema or eschar formation and is similar to the skin state of the control part, and the score is recorded as 0 according to the grading standard; there was no edema, similar to the skin condition of the control site, and the score was 0 according to the score criteria.
Skin irritation response score: according to table 1, the dressing containing the recombinant collagen prepared in this example 1 was divided into 0 points on average for the dorsal skin irritation score of 4 new zealand rabbits; a score of 0, graded according to the intensity of skin irritation, indicates no abnormal change, i.e. no irritation, on the skin contact area.
TABLE 1 skin irritation score Table
The experiments show that the recombinant collagen prepared in the embodiment 1 is of a triple helical structure, has no cytotoxicity and irritation, and is good in safety; but also can promote the proliferation of human skin fibroblasts and has good cell adhesion performance.
Example 2 ultraviolet injury skin repair experiment
(1) Procedure of experiment
The back hairs on both sides of the spine of the New Zealand white rabbit are shaved off, the area is about 10cm multiplied by 15cm, and the hair removal cream is applied for 1 to 2 minutes and then washed off. After the hair removal, four areas of the same area are divided on the back and marked with a marker pen. After 24 hours of depilation, nonwoven fabrics (2.5 cm. times.2.5 cm) impregnated with the recombinant collagen solution (1mg/ml) prepared in example 1 were applied flat to two areas of the back skin of each rabbit, the other two areas served as controls, and were fixed with a band-aid having the drug portion removed. After 4h, the band-aid was cut off, the nonwoven fabric was removed, and the test site was gently scrubbed with warm water. After removing the nonwoven fabric for 1 hour, the contact area of the four experimental and control areas on the back of each rabbit was observed for the formation of erythema or eschar. Scoring was performed according to GB/T16886.10-2005 and erythema and eschar formation were recorded: no erythema, 0 point; very slight erythema (barely visible), 1 point; clear erythema, 2 points; moderate erythema, score 3; severe erythema (purplish red) to eschar formation, 4 points. Edema formation: no edema, score 0; very mild edema (barely visible), 1 point; clear edema (swelling, no excess of regional margin), 2 points; moderate edema (swelling of about 1mm), score 3; severe edema (swelling over 1mm and beyond the contact zone) was scored 4. The sum of the two scores is the total score. The product was evaluated for non-irritation according to GB/T16886.10-2005 evaluation criteria for irritation. In addition, erythema and edema at the contact site at each time point of 24h, 48h and 72h after nonwoven fabric removal were observed and recorded.
(2) Results of the experiment
Skin irritation response skin appearance map: observing four experimental and control areas on the back of each white rabbit after 1h, 24h, 48h and 72h of the non-woven fabric is removed, observing whether erythema or eschar is formed on the contact part, grading and recording according to a grading standard, wherein the result is shown in figure 5, the experimental part of the rabbit of each time point experimental group has no erythema or eschar formation and is similar to the skin state of the control part, and the score is recorded as 0 according to the grading standard; there was no edema, similar to the skin condition of the control site, and the score was 0 according to the score criteria.
Skin irritation response score: according to table 2, the dressing containing the recombinant collagen prepared in this example 1 was divided into 0 points on average for the dorsal skin irritation score of 4 new zealand rabbits; a score of 0, graded according to the intensity of skin irritation, indicates no abnormal change, i.e. no irritation, on the skin contact area.
TABLE 2 skin irritation score Table
The experiments show that the recombinant collagen prepared in the embodiment 1 is of a triple helical structure, has no cytotoxicity and irritation, and is good in safety; but also can promote the proliferation of human skin fibroblasts and has good cell adhesion performance.
Example 2 ultraviolet injury skin repair experiment
1. Procedure of experiment
30 healthy adult mice of SPF grade, female, with a body weight of 27 + -2 g were selected. The mice were shaved on their backs with a hair clipper and depilated with depilatory cream in an area of approximately 2 x 4 cm. Mice were randomized into 6 groups: blank group, model group, experimental group (recombinant collagen solution prepared in example 1, concentration of 1.5mg/ml), control group 1 (commercial fish collagen solution, concentration of 1.5mg/ml), control group 2 (commercial pig collagen solution, concentration of 1.5mg/ml), control group 3 (commercial bovine collagen solution, collagen concentration of 1.5 mg/ml). Wherein the blank group was not treated except for depilatory; the model set does not undergo any repair process.
Establishing an ultraviolet injury model of hairless mice: irradiating model group and experimental group mice by UVA (wavelength: 320-440nm) and UVB (280-320nm) ultraviolet lamp tubes with continuous wavelengths, quantifying irradiation dose by an ultraviolet radiometer, wherein the total irradiation amount of UVA and UVB is 100mJ/cm2Can cause acute skin inflammation of the skin on the back of the mouse.
And (3) treatment: after 1h of irradiation, the damaged skin of the mice in the corresponding experimental group and the control group was smeared with the recombinant collagen solution, the commercially available fish collagen solution, the commercially available pig collagen solution and the commercially available bovine collagen solution prepared in example 1 of the present invention, respectively, at a dose of 4 ml/day. On treatment days 2 and 4, mice are dislocated and killed, back skin is taken, and skin tissues are immediately frozen; a portion of the harvested skin tissue was fixed with 10% neutral formaldehyde for 48 h. The fixed skin tissue is taken, soaked in wax, dehydrated, transparent and embedded, and then paraffin section is carried out, wherein the section thickness is 3.5 mu m.
In order to observe the difference in the histology of the skin of the mice before and after the treatment, HE staining was performed on the skin sections of the mice on the 2 nd and 4 th days of the treatment to observe the morphology of the nucleus and epidermis, and Masson staining was performed on the skin sections to observe the morphological change of the collagen fiber.
HE staining: dewaxing and dehydrating the paraffin sections, then carrying out HE (high intensity intrinsic) staining, carrying out water immersion, staining with hematoxylin for 5-8min, and washing with running water for 1 min; differentiating the differentiation liquid for 1-3s, and washing for 1 min; returning the blue liquid to blue for 30-60 s; soaking in 95% ethanol for alcoholization for 1 min; dip-dyeing with alcohol-soluble eosin for 5-8 s; soaking in 95% ethanol I, II for 2-3s each; soaking in 100% ethanol I, II, and dehydrating for 1 min; drying by using an electric hair drier; the xylene is transparent for 5-15 min; sealing the neutral gum, drying at room temperature, and taking a picture.
Masson staining: dewaxing and dehydrating the paraffin section, performing Masson trichrome staining, staining for 5-10min by Weigert hematoxylin, and washing; differentiating the differentiation liquid for 5-15s, and washing with water; returning blue liquid to blue for 1-5min, and washing with water; dyeing ponceau fuchsin for 5-10 min; weak acid washing for 1 min; washing with phosphomolybdic acid solution for 1-2 min; weak acid washing for 1 min; dyeing for 2min by aniline blue; quickly dehydrating by 95% ethanol; absolute ethyl alcohol I, II and III are respectively 5-10 s; xylene I, II and III are respectively 1-2 min; and (5) sealing by using neutral gum.
2. Results of the experiment
2.1 HE staining of mouse skin
The blank mice were not irradiated with ultraviolet light and treated except for depilating, and as can be seen from fig. 6, on day 2 after depilating, the lower layer of the epidermal layer of the skin of the blank mice was observed to undulate in a wavy manner, wherein the epidermis grew downward to form a skin process; the skin of the back of the mouse is thin, the granular layer and the transparent layer are not obvious, and the basal layer and the spinous layer can be seen; the dermis is mainly composed of a papillary layer and a reticular layer, no obvious boundary exists between the papillary layer and the reticular layer, the fibers are compact and ordered, the shape of the cell nucleus is good, inflammatory cells are not generated, and the shape of the accessory is good. On day 4, the skin appendages of the mice in the blank group extended from the epidermis to the dermis, the fibers of the dermis were continuous and orderly arranged, the morphology of the cell nucleus was good, there were no inflammatory cells, and the morphology of subcutaneous fat and reticular fibers was good. As can be seen, the skin of the blank group of mice was entirely healthy on days 2 and 4.
The mice of the model group after ultraviolet irradiation were not treated, and as can be seen from fig. 6, HE staining results of the skin on day 2 after ultraviolet irradiation showed that the skin of the mice had damaged the whole epidermis, edema of the local basal layer, and loss of the local structure; the dermal layer vessels dilated and congested, the reticular layer was loose and edematous, and a large amount of inflammatory cell infiltration was observed. On day 4, the epidermal structure of the skin of the mouse is more complete than that of the skin of the mouse on the next day, but the edema is thickened, the fibers of the dermal layer are obviously thickened and are more loose, the matrix among the fibers is increased, and a large amount of inflammatory cells are infiltrated. It can be seen that, in the absence of any treatment, on the fourth day after the uv light injury, the mice show a continuous increase in skin edema, a continuous increase in inflammatory cell infiltration, and an increase in the degree of injury.
Mice in the experimental group were treated with the recombinant collagen solution (1.5mg/ml, 4 ml/day) prepared in example 1 of the present invention by applying it 1h after the UV irradiation. As can be seen from fig. 6, after the experimental group was treated with the recombinant collagen solution prepared in example 1 of the present invention on day 2, the epidermal layer of the mouse was edematous and thickened, and had inflammatory cell infiltration; by day 4, the epidermal edema subsided, the dermal structure was intact, the collagen fibers were closely arranged, and the adnexa and subcutaneous fat morphology were good. As can be seen from the comparison of model groups, the recombinant collagen solution prepared in the embodiment 1 of the invention has a good effect on repairing the skin damaged by ultraviolet light, and the damaged skin of the mice recovers the fourth day after the damage, and the shape of the skin is similar to that of the skin of the healthy mice in the blank group.
Mice in control group 1 were treated with a commercially available fish collagen solution (1.5mg/ml, 4 ml/day) 1h after UV irradiation. As can be seen from FIG. 7, the epidermal layer of the mice is seriously damaged by the treatment of the 2 nd day, the dermal layer is loose and edema, inflammatory cell infiltration and blood vessel hyperemia and expansion are obvious. On day 4, the epidermis structure is complete but local basal layer is edematous, acanthosis is loosened, dermis layer is loose and edematous, fiber is thickened, stroma is increased, the number of accessory devices is obviously reduced, hair follicles are seriously damaged, and inflammatory cells are infiltrated. The results showed that the repair effect was not significant in control 1.
Mice in control group 2 were treated with a commercially available bovine collagen solution (1.5mg/ml, 4 ml/day) 1h after UV irradiation. As can be seen from fig. 7, by day 2, the mice had significant epidermal lesions, incomplete structures, partial exfoliation, edema of the dermis, thickening and breaking of the fibers, infiltration of inflammatory cells, damaged hair follicles (atrophy and disappearance of the fibrous sheath), vasodilation and congestion. On day 4, the epidermal structure of the skin of the mouse is complete but discontinuous compared with that on the next day, and the part of the skin is broken; edema of the dermis layer, thickening and breaking of fibers are more obvious, and blood vessels are dilated and congested; the number of accessories is significantly reduced. The results showed that the repair effect was not significant in control 2.
Mice in control group 3 were treated with a commercially available porcine collagen solution (1.5mg/ml, 4 ml/day) 1h after UV irradiation. As can be seen from fig. 7, by day 2 of treatment, the epidermal layer of the mice was significantly damaged, the structure was incomplete, and the local basal layer was damaged; loose edema of the dermis, infiltration of inflammatory cells, damaged hair follicles (atrophy or even disappearance of the fibrous sheath). On day 4, the epidermis is intact but partially defective, damaging the basal lamina, accompanied by acantholysis; the dermis is loose and edematous, the fiber is thickened, and the stroma is increased; the number of the accessory organs is obviously reduced, hair follicles are seriously damaged, and inflammatory cells infiltrate. The results showed that the repair effect was not significant in control group 3.
Therefore, the recombinant collagen prepared in the embodiment 1 of the invention has a remarkable repairing effect on the skin of the mouse with ultraviolet injury, and the repairing effect is superior to that of commercially available fish collagen, commercially available bovine collagen and commercially available pig collagen.
2.2 Masson staining of mouse skin
The blank group of mice was not exposed to uv irradiation and treatment except for hair removal. As can be seen from fig. 8, collagen fibers in the dermal papilla layer of the skin of the blank group of mice were fine and interwoven into a web on day 2; in addition, the hair-sebaceous gland unit, eccrine sweat gland and apocrine sweat gland are all surrounded by the thin reticular collagen, and the blood vessel is also surrounded by the thin layer of the thin collagen fiber; the collagen fibers of the reticular layer are the largest constituent of the dermis, and the collagen fibers therebetween form a coarse fiber bundle, which is slightly wavy in longitudinal section and extends in all directions in a horizontal plane, with fibroblasts interspersed among the collagen fibers. On day 4, the collagen fibers of the dermis layer of the skin of the mouse are compact and continuous, and the number and the shape of the accessories are good and are surrounded by the collagen fibers; the collagen fibers form relatively uniform and thick fiber bundles, which are slightly wavy in longitudinal section and extend in all directions in a horizontal plane, and fibroblasts are scattered among the collagen fibers. As can be seen, the collagen fibers and the appendages in the dermis layer of the skin of the blank mice on days 2 and 4 were in good and healthy states.
Mice in the model group after uv irradiation were not treated. As shown in fig. 8, the collagen fibers in the dermis of the skin of the mice in the ultraviolet irradiation model group on day 2 were disorganized, and were significantly reduced, broken, crushed, thickened, twisted and gathered into a mass; collagen fibers in the dermis are coarser at day 4, and aggregate into larger collagen bundles, and blood vessels in the dermis dilate. It can be seen that the damage to collagen fibers in the skin of mice continued to worsen at the fourth day after the uv light damage without any treatment.
Mice in the experimental group were treated with the recombinant collagen solution (1.5mg/ml, 4 ml/day) prepared in example 1 of the present invention by applying it 1h after the UV irradiation. As shown in fig. 8, the collagen fibers in the dermis layer of the skin of the mouse are disorganized by the treatment day 2, and the collagen fibers are obviously reduced and are broken, crushed and curled; the collagen fibers of the dermis layer are obviously increased on the 4 th day, the arrangement is compact and orderly, the shape of the attachment is normal, the continuous collagen fibers are in a slight wavy shape, and fibroblasts are distributed among the collagen fibers. Compared with the model group, the recombinant collagen solution has good repairing effect on collagen fibers of the dermis layer of the ultraviolet injury skin, and the collagen fibers are recovered to be in a health state similar to that of the blank group.
Mice in control group 1 were treated with a commercially available fish collagen solution (1.5mg/ml, 4 ml/day) 1h after UV irradiation. As can be seen in FIG. 9, the collagen fibers in the dermis were significantly reduced, broken, kinked, aggregated and the blood vessels were hyperemic and dilated by day 2; at the fourth day, the collagen fibers in the dermis layer are broken, aggregated into blocks, arranged loosely and infiltrated by inflammatory cells. The results showed that the repair effect was not significant in control 1.
Mice in control group 2 were treated with a commercially available bovine collagen solution (1.5mg/ml, 4 ml/day) 1h after UV irradiation. As can be seen in fig. 9, by day 2 of treatment, collagen fibers in the dermis were significantly reduced, broken, kinked, aggregated, and blood vessels were dilated and engorged; at day 4, collagen fibers in the dermis layer were broken, aggregated into clumps, loose arrangement, blood vessel hyperemia and dilatation, and inflammatory cell infiltration. The results showed that the repair effect was not significant in control 2.
Mice in control group 3 were treated with a commercially available porcine collagen solution (1.5mg/ml, 4 ml/day) 1h after UV irradiation. As can be seen in fig. 9, collagen fibers in the dermis were significantly reduced, broken, distorted and aggregated, and inflammatory cell infiltration on day 2 of treatment; at the fourth day, the collagen fibers in the dermis are broken, aggregated and loosely arranged. The results showed that the repair effect was not significant in control group 3.
Therefore, the recombinant collagen provided by the invention has an obvious repairing effect on the skin of a mouse with ultraviolet injury, and the effect is superior to that of the collagen of commercially available fish, cattle and pig.
In conclusion, the recombinant collagen provided by the invention has a remarkable repairing effect on the skin of a mouse with ultraviolet injury, can promote the recovery of collagen fibers in the dermis of the skin with ultraviolet injury, and has an effect remarkably superior to that of various commercially available collagen products.
Claims (9)
1. The application of the recombinant collagen in preparing products for repairing skin photodamage or preventing skin photodamage.
2. The use of claim 1, wherein the amino acid sequence of said recombinant collagen is as follows:
GSPGLPGPRGEQGPTGPTGPAGPRGLQGLQGLQGERGEQGPTGPAGPRGLQGERGEQGPTGLAGKAGEAGAKGETGPAGPQGPRGEQGPQGLPGKDGEAGAQGRPGKRGKQGQKGEKGEPGTQGAKGDRGETGPVGPRGERGEAGPAGKDGERGFPGERGVEGQNGQDGLPGKDGKDGQNGKDGLPGKDGKDGQNGKDGLPGKDGKDGQDGKDGLPGKDGKDGLPGKDGKDGQPGKPGKYGPPGPPGPPGPPGPPGPPGPPGPPGPPGPP。
3. use according to claim 1 or 2, wherein the photodamage is ultraviolet damage.
4. Use according to claim 1 or 2, wherein the products for repairing photodamage of the skin comprise cosmetics, medical cosmetic products, health foods, pharmaceuticals.
5. The use according to claim 4, wherein the cosmetic comprises a stock solution, an emulsion, an essence cream, a toner, a conditioning water, a cream, a mask, a makeup cream, an eye cream, a spray, a sunscreen cream, a foundation, a body lotion.
6. Use according to claim 4, wherein the medical cosmetic product comprises a stock solution, a dressing, a cold pack, a gel, a sponge, a film, a hydro-acupuncture, an implant, a milk, a cream, a paste.
7. Use according to claim 1 or 2, wherein the product for preventing photodamage of the skin comprises cosmetics, cosmeceutical products, health foods, pharmaceuticals.
8. The use according to claim 7, wherein the cosmetic comprises a stock solution, an emulsion, an essence cream, a toner, a conditioning water, a cream, a mask, a makeup cream, an eye cream, a spray, a sunscreen cream, a foundation, a body lotion.
9. Use according to claim 7, wherein the medical cosmetic product comprises a stock solution, a dressing, a cold pack, a gel, a sponge, a film, a hydro-acupuncture, an implant, a milk, a cream, a paste.
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CN202110321963.1A CN113520899B (en) | 2021-03-25 | 2021-03-25 | Recombinant collagen product for skin photodamage repair |
Applications Claiming Priority (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CN202110321963.1A CN113520899B (en) | 2021-03-25 | 2021-03-25 | Recombinant collagen product for skin photodamage repair |
Publications (2)
Publication Number | Publication Date |
---|---|
CN113520899A true CN113520899A (en) | 2021-10-22 |
CN113520899B CN113520899B (en) | 2022-05-17 |
Family
ID=78094505
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
CN202110321963.1A Active CN113520899B (en) | 2021-03-25 | 2021-03-25 | Recombinant collagen product for skin photodamage repair |
Country Status (1)
Country | Link |
---|---|
CN (1) | CN113520899B (en) |
Cited By (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN117624342A (en) * | 2023-10-31 | 2024-03-01 | 广州市金因源生物技术有限公司 | Preparation method of hydrolyzed collagen and application of hydrolyzed collagen on skin |
Citations (6)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN106115792A (en) * | 2016-06-23 | 2016-11-16 | 兰州大学 | One prepares Fe with collagen protein for biomineralization template2o3the method of nanoparticle |
CN106176282A (en) * | 2016-08-19 | 2016-12-07 | 山西锦波生物医药股份有限公司 | Protein facial mask liquid and production method |
CN107753389A (en) * | 2016-11-30 | 2018-03-06 | 江苏创铭医疗器械有限公司 | A kind of recombined collagen foaming pectin facial mask and preparation method thereof |
CN108059184A (en) * | 2017-12-28 | 2018-05-22 | 兰州大学 | A kind of method that ZnO nanoparticle is prepared using recombined collagen as biomineralization template |
CN108404220A (en) * | 2017-12-28 | 2018-08-17 | 兰州大学 | A kind of biodegradable aqueogel and preparation method thereof |
CN112516000A (en) * | 2020-12-25 | 2021-03-19 | 江苏江山聚源生物技术有限公司 | Repair stock solution containing recombinant collagen |
-
2021
- 2021-03-25 CN CN202110321963.1A patent/CN113520899B/en active Active
Patent Citations (6)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN106115792A (en) * | 2016-06-23 | 2016-11-16 | 兰州大学 | One prepares Fe with collagen protein for biomineralization template2o3the method of nanoparticle |
CN106176282A (en) * | 2016-08-19 | 2016-12-07 | 山西锦波生物医药股份有限公司 | Protein facial mask liquid and production method |
CN107753389A (en) * | 2016-11-30 | 2018-03-06 | 江苏创铭医疗器械有限公司 | A kind of recombined collagen foaming pectin facial mask and preparation method thereof |
CN108059184A (en) * | 2017-12-28 | 2018-05-22 | 兰州大学 | A kind of method that ZnO nanoparticle is prepared using recombined collagen as biomineralization template |
CN108404220A (en) * | 2017-12-28 | 2018-08-17 | 兰州大学 | A kind of biodegradable aqueogel and preparation method thereof |
CN112516000A (en) * | 2020-12-25 | 2021-03-19 | 江苏江山聚源生物技术有限公司 | Repair stock solution containing recombinant collagen |
Cited By (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN117624342A (en) * | 2023-10-31 | 2024-03-01 | 广州市金因源生物技术有限公司 | Preparation method of hydrolyzed collagen and application of hydrolyzed collagen on skin |
Also Published As
Publication number | Publication date |
---|---|
CN113520899B (en) | 2022-05-17 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
CN103908424A (en) | Beautifying and nursing essence and preparation method thereof | |
JP2009513581A (en) | Latex or topical formulation containing this fraction and cosmetic treatment method | |
KR102473093B1 (en) | Cosmetic composition for improving skin condition comprising hemp seed oil, plant callus culture filtrate and peptides as active ingredient | |
CN104921983A (en) | Medical biological repairing dressing for pregnant woman striae gravidarum and preparation method thereof | |
CN105007990B (en) | The purposes of cosmetic composition from fish artemia hatching solution, its production method and its aesthetic appearance for being used to improving skin | |
CN110478306A (en) | Facial mask of the culture supernatant containing placenta mesenchyma stem cell and preparation method thereof | |
CN109833221A (en) | A kind of anti-ageing aging facial treatment milk of eye and preparation method thereof | |
CN113520899B (en) | Recombinant collagen product for skin photodamage repair | |
CN105056307A (en) | Artificial skin and preparation method thereof | |
KR20210141142A (en) | Cosmetic compositions for skin care and hair care and preparation methods thereof | |
KR20090108812A (en) | Anti-aging cosmetic composition for skin | |
KR102026409B1 (en) | Pharmaceutical composition comprising root bark or cortex powder of elm tree for wound healing and skin regeneration | |
CN111743826A (en) | Freckle-removing, wrinkle-resisting and moisturizing emulsion | |
KR102168532B1 (en) | Cosmetic composition for enhancing skin elasticity or improving skin wrinkle containing herb extracts | |
CA1266831A (en) | Cosmetic composition comprising lysed extracts of hafnia | |
CN105853341B (en) | A kind of anti-aging skin care product and preparation method thereof containing epidermal stem cells secretin | |
CH696659A5 (en) | Cosmetic composition for the treatment and / or prevention of skin stretchmarks | |
DE60007973T2 (en) | MATRIX PROTEIN COMPOSITIONS FOR Grafting In Non-Mineralized Tissues | |
CN112190529A (en) | Sheep casing collagen powder and application thereof in preparation of anti-aging skin care product | |
CN103520708A (en) | Composition capable of promoting wound healing and reducing scarring | |
CN108721202B (en) | Roselle stem cell freeze-dried powder eye cream and preparation method thereof | |
CN106420392A (en) | Collagen gel with congelation state | |
JP6152205B1 (en) | Cosmetics, pharmaceutical compositions, and methods for producing them | |
KR100490212B1 (en) | Anti-aging cosmetics composition containing amino acid complex | |
CN113143789A (en) | Composition and its use in skin care |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
PB01 | Publication | ||
PB01 | Publication | ||
SE01 | Entry into force of request for substantive examination | ||
SE01 | Entry into force of request for substantive examination | ||
TA01 | Transfer of patent application right | ||
TA01 | Transfer of patent application right |
Effective date of registration: 20211103 Address after: 430030 a413, No. 74, Baofeng Second Road, Qiaokou District, Wuhan City, Hubei Province Applicant after: Collagen (Wuhan) Biotechnology Co.,Ltd. Address before: No. 249, Donggang West Road, Chengguan District, Lanzhou City, Gansu Province 730000 Applicant before: Gansu Tianji Biotechnology Co.,Ltd. |
|
GR01 | Patent grant | ||
GR01 | Patent grant |