CN107982190A - A kind of essence element and preparation method thereof - Google Patents
A kind of essence element and preparation method thereof Download PDFInfo
- Publication number
- CN107982190A CN107982190A CN201711406366.9A CN201711406366A CN107982190A CN 107982190 A CN107982190 A CN 107982190A CN 201711406366 A CN201711406366 A CN 201711406366A CN 107982190 A CN107982190 A CN 107982190A
- Authority
- CN
- China
- Prior art keywords
- oligopeptides
- essence
- skin
- present
- pregnancy
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Pending
Links
- 238000002360 preparation method Methods 0.000 title claims description 12
- 108010038807 Oligopeptides Proteins 0.000 claims abstract description 126
- 102000015636 Oligopeptides Human genes 0.000 claims abstract description 126
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 claims abstract description 81
- AJLNZWYOJAWBCR-OOPVGHQCSA-N (4s)-4-acetamido-5-[[(2s)-1-[[(2s)-1-[[(2s)-5-amino-1-[[(2s)-1-[[(2s)-1-amino-5-(diaminomethylideneamino)-1-oxopentan-2-yl]amino]-5-(diaminomethylideneamino)-1-oxopentan-2-yl]amino]-1,5-dioxopentan-2-yl]amino]-4-methylsulfanyl-1-oxobutan-2-yl]amino]-4-car Chemical compound OC(=O)CC[C@H](NC(C)=O)C(=C)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCN=C(N)N)C(=O)N[C@@H](CCCN=C(N)N)C(N)=O AJLNZWYOJAWBCR-OOPVGHQCSA-N 0.000 claims abstract description 28
- 241000206575 Chondrus crispus Species 0.000 claims abstract description 24
- FBPFZTCFMRRESA-KVTDHHQDSA-N D-Mannitol Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-KVTDHHQDSA-N 0.000 claims abstract description 20
- 229930195725 Mannitol Natural products 0.000 claims abstract description 20
- 239000000284 extract Substances 0.000 claims abstract description 20
- 239000000594 mannitol Substances 0.000 claims abstract description 20
- 235000010355 mannitol Nutrition 0.000 claims abstract description 20
- 230000002992 thymic effect Effects 0.000 claims abstract description 17
- 239000004909 Moisturizer Substances 0.000 claims abstract description 14
- 230000001333 moisturizer Effects 0.000 claims abstract description 14
- 239000002994 raw material Substances 0.000 claims abstract description 5
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 claims description 30
- 125000003275 alpha amino acid group Chemical group 0.000 claims description 23
- 229920002385 Sodium hyaluronate Polymers 0.000 claims description 20
- 229940010747 sodium hyaluronate Drugs 0.000 claims description 20
- 235000011187 glycerol Nutrition 0.000 claims description 15
- 238000002156 mixing Methods 0.000 claims description 15
- DGAQECJNVWCQMB-PUAWFVPOSA-M Ilexoside XXIX Chemical compound C[C@@H]1CC[C@@]2(CC[C@@]3(C(=CC[C@H]4[C@]3(CC[C@@H]5[C@@]4(CC[C@@H](C5(C)C)OS(=O)(=O)[O-])C)C)[C@@H]2[C@]1(C)O)C)C(=O)O[C@H]6[C@@H]([C@H]([C@@H]([C@H](O6)CO)O)O)O.[Na+] DGAQECJNVWCQMB-PUAWFVPOSA-M 0.000 claims description 14
- FHKSXSQHXQEMOK-UHFFFAOYSA-N hexane-1,2-diol Chemical compound CCCCC(O)CO FHKSXSQHXQEMOK-UHFFFAOYSA-N 0.000 claims description 14
- 229910052708 sodium Inorganic materials 0.000 claims description 14
- 239000011734 sodium Substances 0.000 claims description 14
- YWIVKILSMZOHHF-QJZPQSOGSA-N sodium;(2s,3s,4s,5r,6r)-6-[(2s,3r,4r,5s,6r)-3-acetamido-2-[(2s,3s,4r,5r,6r)-6-[(2r,3r,4r,5s,6r)-3-acetamido-2,5-dihydroxy-6-(hydroxymethyl)oxan-4-yl]oxy-2-carboxy-4,5-dihydroxyoxan-3-yl]oxy-5-hydroxy-6-(hydroxymethyl)oxan-4-yl]oxy-3,4,5-trihydroxyoxane-2- Chemical compound [Na+].CC(=O)N[C@H]1[C@H](O)O[C@H](CO)[C@@H](O)[C@@H]1O[C@H]1[C@H](O)[C@@H](O)[C@H](O[C@H]2[C@@H]([C@@H](O[C@H]3[C@@H]([C@@H](O)[C@H](O)[C@H](O3)C(O)=O)O)[C@H](O)[C@@H](CO)O2)NC(C)=O)[C@@H](C(O)=O)O1 YWIVKILSMZOHHF-QJZPQSOGSA-N 0.000 claims description 14
- FYGDTMLNYKFZSV-URKRLVJHSA-N (2s,3r,4s,5s,6r)-2-[(2r,4r,5r,6s)-4,5-dihydroxy-2-(hydroxymethyl)-6-[(2r,4r,5r,6s)-4,5,6-trihydroxy-2-(hydroxymethyl)oxan-3-yl]oxyoxan-3-yl]oxy-6-(hydroxymethyl)oxane-3,4,5-triol Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@H]1OC1[C@@H](CO)O[C@@H](OC2[C@H](O[C@H](O)[C@H](O)[C@H]2O)CO)[C@H](O)[C@H]1O FYGDTMLNYKFZSV-URKRLVJHSA-N 0.000 claims description 12
- 229920002498 Beta-glucan Polymers 0.000 claims description 12
- 108010020346 Polyglutamic Acid Proteins 0.000 claims description 12
- 229920002643 polyglutamic acid Polymers 0.000 claims description 12
- WCVRQHFDJLLWFE-UHFFFAOYSA-N pentane-1,2-diol Chemical class CCCC(O)CO WCVRQHFDJLLWFE-UHFFFAOYSA-N 0.000 claims description 11
- 239000000203 mixture Substances 0.000 claims description 9
- 108010046075 Thymosin Proteins 0.000 claims description 4
- 102000007501 Thymosin Human genes 0.000 claims description 4
- 239000004480 active ingredient Substances 0.000 claims description 4
- LCJVIYPJPCBWKS-NXPQJCNCSA-N thymosin Chemical compound SC[C@@H](N)C(=O)N[C@H](CO)C(=O)N[C@H](CC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](C)C(=O)N[C@H](C(C)C)C(=O)N[C@H](CC(O)=O)C(=O)N[C@H](C(C)C)C(=O)N[C@H](CO)C(=O)N[C@H](CO)C(=O)N[C@H](CCC(O)=O)C(=O)N[C@H]([C@@H](C)CC)C(=O)N[C@H]([C@H](C)O)C(=O)N[C@H](C(C)C)C(=O)N[C@H](CCCCN)C(=O)N[C@H](CC(O)=O)C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N[C@H](CCC(O)=O)C(=O)N[C@H](CCCCN)C(=O)N[C@H](CCCCN)C(=O)N[C@H](CCC(O)=O)C(=O)N[C@H](C(C)C)C(=O)N[C@H](C(C)C)C(=O)N[C@H](CCC(O)=O)C(=O)N[C@H](CCC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@H](CCC(O)=O)C(O)=O LCJVIYPJPCBWKS-NXPQJCNCSA-N 0.000 claims description 4
- 239000002253 acid Substances 0.000 claims description 3
- 210000001541 thymus gland Anatomy 0.000 claims description 3
- 238000009738 saturating Methods 0.000 claims 1
- 230000035935 pregnancy Effects 0.000 abstract description 41
- 206010040925 Skin striae Diseases 0.000 abstract description 39
- 230000008439 repair process Effects 0.000 abstract description 18
- 230000032683 aging Effects 0.000 abstract description 9
- 230000036541 health Effects 0.000 abstract description 7
- 230000004060 metabolic process Effects 0.000 abstract description 6
- 230000004089 microcirculation Effects 0.000 abstract description 5
- 230000036559 skin health Effects 0.000 abstract description 5
- 230000002045 lasting effect Effects 0.000 abstract description 4
- 239000002537 cosmetic Substances 0.000 abstract description 3
- 239000008213 purified water Substances 0.000 description 45
- 210000003491 skin Anatomy 0.000 description 41
- 239000000047 product Substances 0.000 description 23
- 230000000694 effects Effects 0.000 description 16
- 239000000843 powder Substances 0.000 description 16
- 210000004027 cell Anatomy 0.000 description 12
- 230000037303 wrinkles Effects 0.000 description 11
- 230000015572 biosynthetic process Effects 0.000 description 8
- 206010000496 acne Diseases 0.000 description 7
- 238000003786 synthesis reaction Methods 0.000 description 7
- KIUKXJAPPMFGSW-DNGZLQJQSA-N (2S,3S,4S,5R,6R)-6-[(2S,3R,4R,5S,6R)-3-Acetamido-2-[(2S,3S,4R,5R,6R)-6-[(2R,3R,4R,5S,6R)-3-acetamido-2,5-dihydroxy-6-(hydroxymethyl)oxan-4-yl]oxy-2-carboxy-4,5-dihydroxyoxan-3-yl]oxy-5-hydroxy-6-(hydroxymethyl)oxan-4-yl]oxy-3,4,5-trihydroxyoxane-2-carboxylic acid Chemical compound CC(=O)N[C@H]1[C@H](O)O[C@H](CO)[C@@H](O)[C@@H]1O[C@H]1[C@H](O)[C@@H](O)[C@H](O[C@H]2[C@@H]([C@@H](O[C@H]3[C@@H]([C@@H](O)[C@H](O)[C@H](O3)C(O)=O)O)[C@H](O)[C@@H](CO)O2)NC(C)=O)[C@@H](C(O)=O)O1 KIUKXJAPPMFGSW-DNGZLQJQSA-N 0.000 description 6
- 208000002874 Acne Vulgaris Diseases 0.000 description 6
- 210000001015 abdomen Anatomy 0.000 description 6
- 230000003712 anti-aging effect Effects 0.000 description 6
- 229920002674 hyaluronan Polymers 0.000 description 6
- 229960003160 hyaluronic acid Drugs 0.000 description 6
- 230000003020 moisturizing effect Effects 0.000 description 6
- 238000003756 stirring Methods 0.000 description 6
- 102000008186 Collagen Human genes 0.000 description 5
- 108010035532 Collagen Proteins 0.000 description 5
- 229920001436 collagen Polymers 0.000 description 5
- 210000004177 elastic tissue Anatomy 0.000 description 5
- 230000008676 import Effects 0.000 description 5
- 108090000765 processed proteins & peptides Proteins 0.000 description 5
- 230000037394 skin elasticity Effects 0.000 description 5
- 230000006378 damage Effects 0.000 description 4
- 230000012010 growth Effects 0.000 description 4
- 239000007788 liquid Substances 0.000 description 4
- 210000001519 tissue Anatomy 0.000 description 4
- 230000003255 anti-acne Effects 0.000 description 3
- 230000008859 change Effects 0.000 description 3
- 210000000038 chest Anatomy 0.000 description 3
- 239000013065 commercial product Substances 0.000 description 3
- 230000000052 comparative effect Effects 0.000 description 3
- 238000001816 cooling Methods 0.000 description 3
- 108010015792 glycyllysine Proteins 0.000 description 3
- 230000001771 impaired effect Effects 0.000 description 3
- 230000006872 improvement Effects 0.000 description 3
- 239000010410 layer Substances 0.000 description 3
- 231100000241 scar Toxicity 0.000 description 3
- 230000008591 skin barrier function Effects 0.000 description 3
- 210000004927 skin cell Anatomy 0.000 description 3
- 239000003643 water by type Substances 0.000 description 3
- 208000002863 Abdominal Pregnancy Diseases 0.000 description 2
- HQVDJTYKCMIWJP-YUMQZZPRSA-N Lys-Asn-Gly Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(=O)NCC(O)=O HQVDJTYKCMIWJP-YUMQZZPRSA-N 0.000 description 2
- XUMBMVFBXHLACL-UHFFFAOYSA-N Melanin Chemical compound O=C1C(=O)C(C2=CNC3=C(C(C(=O)C4=C32)=O)C)=C2C4=CNC2=C1C XUMBMVFBXHLACL-UHFFFAOYSA-N 0.000 description 2
- YBAFDPFAUTYYRW-UHFFFAOYSA-N N-L-alpha-glutamyl-L-leucine Natural products CC(C)CC(C(O)=O)NC(=O)C(N)CCC(O)=O YBAFDPFAUTYYRW-UHFFFAOYSA-N 0.000 description 2
- RGJZPXFZIUUQDN-BPNCWPANSA-N Tyr-Val-Ala Chemical compound [H]N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](C)C(O)=O RGJZPXFZIUUQDN-BPNCWPANSA-N 0.000 description 2
- 208000013427 abdominal ectopic pregnancy Diseases 0.000 description 2
- POJWUDADGALRAB-UHFFFAOYSA-N allantoin Chemical compound NC(=O)NC1NC(=O)NC1=O POJWUDADGALRAB-UHFFFAOYSA-N 0.000 description 2
- 230000001153 anti-wrinkle effect Effects 0.000 description 2
- 230000010261 cell growth Effects 0.000 description 2
- 108010060199 cysteinylproline Proteins 0.000 description 2
- 238000011161 development Methods 0.000 description 2
- 230000018109 developmental process Effects 0.000 description 2
- 201000003511 ectopic pregnancy Diseases 0.000 description 2
- 230000002500 effect on skin Effects 0.000 description 2
- 229920001971 elastomer Polymers 0.000 description 2
- 239000000806 elastomer Substances 0.000 description 2
- 210000002615 epidermis Anatomy 0.000 description 2
- 238000011156 evaluation Methods 0.000 description 2
- 235000019197 fats Nutrition 0.000 description 2
- 239000000835 fiber Substances 0.000 description 2
- 210000004907 gland Anatomy 0.000 description 2
- 150000004676 glycans Chemical class 0.000 description 2
- XBGGUPMXALFZOT-UHFFFAOYSA-N glycyl-L-tyrosine hemihydrate Natural products NCC(=O)NC(C(O)=O)CC1=CC=C(O)C=C1 XBGGUPMXALFZOT-UHFFFAOYSA-N 0.000 description 2
- 108010034529 leucyl-lysine Proteins 0.000 description 2
- 238000000034 method Methods 0.000 description 2
- 238000012986 modification Methods 0.000 description 2
- 230000004048 modification Effects 0.000 description 2
- 210000003205 muscle Anatomy 0.000 description 2
- 230000001151 other effect Effects 0.000 description 2
- BASFCYQUMIYNBI-UHFFFAOYSA-N platinum Chemical compound [Pt] BASFCYQUMIYNBI-UHFFFAOYSA-N 0.000 description 2
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 2
- 238000012545 processing Methods 0.000 description 2
- 230000001737 promoting effect Effects 0.000 description 2
- 238000011160 research Methods 0.000 description 2
- 210000002784 stomach Anatomy 0.000 description 2
- 238000007920 subcutaneous administration Methods 0.000 description 2
- 238000012360 testing method Methods 0.000 description 2
- 230000003442 weekly effect Effects 0.000 description 2
- QCDWFXQBSFUVSP-UHFFFAOYSA-N 2-phenoxyethanol Chemical compound OCCOC1=CC=CC=C1 QCDWFXQBSFUVSP-UHFFFAOYSA-N 0.000 description 1
- 102000007469 Actins Human genes 0.000 description 1
- 108010085238 Actins Proteins 0.000 description 1
- XEXJJJRVTFGWIC-FXQIFTODSA-N Ala-Asn-Arg Chemical compound C[C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)N[C@@H](CCCN=C(N)N)C(=O)O)N XEXJJJRVTFGWIC-FXQIFTODSA-N 0.000 description 1
- WKOBSJOZRJJVRZ-FXQIFTODSA-N Ala-Glu-Glu Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(O)=O WKOBSJOZRJJVRZ-FXQIFTODSA-N 0.000 description 1
- VGPWRRFOPXVGOH-BYPYZUCNSA-N Ala-Gly-Gly Chemical compound C[C@H](N)C(=O)NCC(=O)NCC(O)=O VGPWRRFOPXVGOH-BYPYZUCNSA-N 0.000 description 1
- SUMYEVXWCAYLLJ-GUBZILKMSA-N Ala-Leu-Gln Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(O)=O SUMYEVXWCAYLLJ-GUBZILKMSA-N 0.000 description 1
- NINQYGGNRIBFSC-CIUDSAMLSA-N Ala-Lys-Ser Chemical compound NCCCC[C@H](NC(=O)[C@@H](N)C)C(=O)N[C@@H](CO)C(O)=O NINQYGGNRIBFSC-CIUDSAMLSA-N 0.000 description 1
- ADSGHMXEAZJJNF-DCAQKATOSA-N Ala-Pro-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@@H]1CCCN1C(=O)[C@H](C)N ADSGHMXEAZJJNF-DCAQKATOSA-N 0.000 description 1
- XQNRANMFRPCFFW-GCJQMDKQSA-N Ala-Thr-Asn Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)O)NC(=O)[C@H](C)N)O XQNRANMFRPCFFW-GCJQMDKQSA-N 0.000 description 1
- POJWUDADGALRAB-PVQJCKRUSA-N Allantoin Natural products NC(=O)N[C@@H]1NC(=O)NC1=O POJWUDADGALRAB-PVQJCKRUSA-N 0.000 description 1
- DBKNLHKEVPZVQC-LPEHRKFASA-N Arg-Ala-Pro Chemical compound NC(N)=NCCC[C@H](N)C(=O)N[C@@H](C)C(=O)N1CCC[C@@H]1C(O)=O DBKNLHKEVPZVQC-LPEHRKFASA-N 0.000 description 1
- IASNWHAGGYTEKX-IUCAKERBSA-N Arg-Arg-Gly Chemical compound NC(N)=NCCC[C@H](N)C(=O)N[C@@H](CCCN=C(N)N)C(=O)NCC(O)=O IASNWHAGGYTEKX-IUCAKERBSA-N 0.000 description 1
- HJVGMOYJDDXLMI-AVGNSLFASA-N Arg-Arg-Lys Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@@H](N)CCCNC(N)=N HJVGMOYJDDXLMI-AVGNSLFASA-N 0.000 description 1
- OTCJMMRQBVDQRK-DCAQKATOSA-N Arg-Asp-Leu Chemical compound [H]N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(C)C)C(O)=O OTCJMMRQBVDQRK-DCAQKATOSA-N 0.000 description 1
- BJNUAWGXPSHQMJ-DCAQKATOSA-N Arg-Gln-Met Chemical compound [H]N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCSC)C(O)=O BJNUAWGXPSHQMJ-DCAQKATOSA-N 0.000 description 1
- NKNILFJYKKHBKE-WPRPVWTQSA-N Arg-Gly-Val Chemical compound [H]N[C@@H](CCCNC(N)=N)C(=O)NCC(=O)N[C@@H](C(C)C)C(O)=O NKNILFJYKKHBKE-WPRPVWTQSA-N 0.000 description 1
- DGFXIWKPTDKBLF-AVGNSLFASA-N Arg-His-Val Chemical compound CC(C)[C@@H](C(=O)O)NC(=O)[C@H](CC1=CN=CN1)NC(=O)[C@H](CCCN=C(N)N)N DGFXIWKPTDKBLF-AVGNSLFASA-N 0.000 description 1
- AGVNTAUPLWIQEN-ZPFDUUQYSA-N Arg-Ile-Glu Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CCC(=O)O)C(=O)O)NC(=O)[C@H](CCCN=C(N)N)N AGVNTAUPLWIQEN-ZPFDUUQYSA-N 0.000 description 1
- OTZMRMHZCMZOJZ-SRVKXCTJSA-N Arg-Leu-Glu Chemical compound [H]N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(O)=O OTZMRMHZCMZOJZ-SRVKXCTJSA-N 0.000 description 1
- BECXEHHOZNFFFX-IHRRRGAJSA-N Arg-Ser-Tyr Chemical compound [H]N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(O)=O BECXEHHOZNFFFX-IHRRRGAJSA-N 0.000 description 1
- QUBKBPZGMZWOKQ-SZMVWBNQSA-N Arg-Trp-Arg Chemical compound C1=CC=C2C(C[C@H](NC(=O)[C@H](CCCN=C(N)N)N)C(=O)N[C@@H](CCCN=C(N)N)C(O)=O)=CNC2=C1 QUBKBPZGMZWOKQ-SZMVWBNQSA-N 0.000 description 1
- UVTGNSWSRSCPLP-UHFFFAOYSA-N Arg-Tyr Natural products NC(CCNC(=N)N)C(=O)NC(Cc1ccc(O)cc1)C(=O)O UVTGNSWSRSCPLP-UHFFFAOYSA-N 0.000 description 1
- GMCOADLDNLGOFE-ZLUOBGJFSA-N Asn-Asp-Cys Chemical compound C([C@@H](C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CS)C(=O)O)N)C(=O)N GMCOADLDNLGOFE-ZLUOBGJFSA-N 0.000 description 1
- GIQCDTKOIPUDSG-GARJFASQSA-N Asn-Lys-Pro Chemical compound C1C[C@@H](N(C1)C(=O)[C@H](CCCCN)NC(=O)[C@H](CC(=O)N)N)C(=O)O GIQCDTKOIPUDSG-GARJFASQSA-N 0.000 description 1
- VWADICJNCPFKJS-ZLUOBGJFSA-N Asn-Ser-Asp Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(O)=O)C(O)=O VWADICJNCPFKJS-ZLUOBGJFSA-N 0.000 description 1
- AMGQTNHANMRPOE-LKXGYXEUSA-N Asn-Thr-Ser Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CO)C(O)=O AMGQTNHANMRPOE-LKXGYXEUSA-N 0.000 description 1
- TZQWZQSMHDVLQL-QEJZJMRPSA-N Asn-Trp-Gln Chemical compound C1=CC=C2C(=C1)C(=CN2)C[C@@H](C(=O)N[C@@H](CCC(=O)N)C(=O)O)NC(=O)[C@H](CC(=O)N)N TZQWZQSMHDVLQL-QEJZJMRPSA-N 0.000 description 1
- RTFXPCYMDYBZNQ-SRVKXCTJSA-N Asn-Tyr-Asn Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC(N)=O)C(O)=O RTFXPCYMDYBZNQ-SRVKXCTJSA-N 0.000 description 1
- AXXCUABIFZPKPM-BQBZGAKWSA-N Asp-Arg-Gly Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)NCC(O)=O AXXCUABIFZPKPM-BQBZGAKWSA-N 0.000 description 1
- OMMIEVATLAGRCK-BYPYZUCNSA-N Asp-Gly-Gly Chemical compound OC(=O)C[C@H](N)C(=O)NCC(=O)NCC(O)=O OMMIEVATLAGRCK-BYPYZUCNSA-N 0.000 description 1
- WSGVTKZFVJSJOG-RCOVLWMOSA-N Asp-Gly-Val Chemical compound [H]N[C@@H](CC(O)=O)C(=O)NCC(=O)N[C@@H](C(C)C)C(O)=O WSGVTKZFVJSJOG-RCOVLWMOSA-N 0.000 description 1
- DJCAHYVLMSRBFR-QXEWZRGKSA-N Asp-Met-Val Chemical compound CC(C)[C@@H](C(O)=O)NC(=O)[C@H](CCSC)NC(=O)[C@@H](N)CC(O)=O DJCAHYVLMSRBFR-QXEWZRGKSA-N 0.000 description 1
- QTIZKMMLNUMHHU-DCAQKATOSA-N Asp-Pro-His Chemical compound C1C[C@H](N(C1)C(=O)[C@H](CC(=O)O)N)C(=O)N[C@@H](CC2=CN=CN2)C(=O)O QTIZKMMLNUMHHU-DCAQKATOSA-N 0.000 description 1
- UAXIKORUDGGIGA-DCAQKATOSA-N Asp-Pro-Lys Chemical compound C1C[C@H](N(C1)C(=O)[C@H](CC(=O)O)N)C(=O)N[C@@H](CCCCN)C(=O)O UAXIKORUDGGIGA-DCAQKATOSA-N 0.000 description 1
- XABFFGOGKOORCG-CIUDSAMLSA-N Cys-Asp-Leu Chemical compound [H]N[C@@H](CS)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(C)C)C(O)=O XABFFGOGKOORCG-CIUDSAMLSA-N 0.000 description 1
- PFAQXUDMZVMADG-AVGNSLFASA-N Cys-Gln-Tyr Chemical compound [H]N[C@@H](CS)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(O)=O PFAQXUDMZVMADG-AVGNSLFASA-N 0.000 description 1
- CYHMMWIOEUVHHZ-IHRRRGAJSA-N Cys-Met-Tyr Chemical compound SC[C@H](N)C(=O)N[C@@H](CCSC)C(=O)N[C@H](C(O)=O)CC1=CC=C(O)C=C1 CYHMMWIOEUVHHZ-IHRRRGAJSA-N 0.000 description 1
- NMWZMKLDGZXRKP-BZSNNMDCSA-N Cys-Phe-Phe Chemical compound [H]N[C@@H](CS)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CC1=CC=CC=C1)C(O)=O NMWZMKLDGZXRKP-BZSNNMDCSA-N 0.000 description 1
- ALTQTAKGRFLRLR-GUBZILKMSA-N Cys-Val-Val Chemical compound CC(C)[C@@H](C(=O)N[C@@H](C(C)C)C(=O)O)NC(=O)[C@H](CS)N ALTQTAKGRFLRLR-GUBZILKMSA-N 0.000 description 1
- 102000009123 Fibrin Human genes 0.000 description 1
- 108010073385 Fibrin Proteins 0.000 description 1
- BWGVNKXGVNDBDI-UHFFFAOYSA-N Fibrin monomer Chemical compound CNC(=O)CNC(=O)CN BWGVNKXGVNDBDI-UHFFFAOYSA-N 0.000 description 1
- LGIKBBLQVSWUGK-DCAQKATOSA-N Gln-Leu-Gln Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(O)=O LGIKBBLQVSWUGK-DCAQKATOSA-N 0.000 description 1
- IHSGESFHTMFHRB-GUBZILKMSA-N Gln-Lys-Ala Chemical compound OC(=O)[C@H](C)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](N)CCC(N)=O IHSGESFHTMFHRB-GUBZILKMSA-N 0.000 description 1
- CELXWPDNIGWCJN-WDCWCFNPSA-N Gln-Lys-Thr Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H]([C@@H](C)O)C(O)=O CELXWPDNIGWCJN-WDCWCFNPSA-N 0.000 description 1
- ININBLZFFVOQIO-JHEQGTHGSA-N Gln-Thr-Gly Chemical compound C[C@H]([C@@H](C(=O)NCC(=O)O)NC(=O)[C@H](CCC(=O)N)N)O ININBLZFFVOQIO-JHEQGTHGSA-N 0.000 description 1
- KKCUFHUTMKQQCF-SRVKXCTJSA-N Glu-Arg-Leu Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(O)=O KKCUFHUTMKQQCF-SRVKXCTJSA-N 0.000 description 1
- NKSGKPWXSWBRRX-ACZMJKKPSA-N Glu-Asn-Cys Chemical compound C(CC(=O)O)[C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)N[C@@H](CS)C(=O)O)N NKSGKPWXSWBRRX-ACZMJKKPSA-N 0.000 description 1
- CKRUHITYRFNUKW-WDSKDSINSA-N Glu-Asn-Gly Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(N)=O)C(=O)NCC(O)=O CKRUHITYRFNUKW-WDSKDSINSA-N 0.000 description 1
- MXPBQDFWIMBACQ-ACZMJKKPSA-N Glu-Cys-Cys Chemical compound OC(=O)CC[C@H](N)C(=O)N[C@@H](CS)C(=O)N[C@@H](CS)C(O)=O MXPBQDFWIMBACQ-ACZMJKKPSA-N 0.000 description 1
- UERORLSAFUHDGU-AVGNSLFASA-N Glu-Phe-Asn Chemical compound C1=CC=C(C=C1)C[C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)O)NC(=O)[C@H](CCC(=O)O)N UERORLSAFUHDGU-AVGNSLFASA-N 0.000 description 1
- ALMBZBOCGSVSAI-ACZMJKKPSA-N Glu-Ser-Asn Chemical compound C(CC(=O)O)[C@@H](C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(=O)N)C(=O)O)N ALMBZBOCGSVSAI-ACZMJKKPSA-N 0.000 description 1
- MFVQGXGQRIXBPK-WDSKDSINSA-N Gly-Ala-Glu Chemical compound NCC(=O)N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(O)=O MFVQGXGQRIXBPK-WDSKDSINSA-N 0.000 description 1
- QXPRJQPCFXMCIY-NKWVEPMBSA-N Gly-Ala-Pro Chemical compound C[C@@H](C(=O)N1CCC[C@@H]1C(=O)O)NC(=O)CN QXPRJQPCFXMCIY-NKWVEPMBSA-N 0.000 description 1
- OVSKVOOUFAKODB-UWVGGRQHSA-N Gly-Arg-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@@H](NC(=O)CN)CCCN=C(N)N OVSKVOOUFAKODB-UWVGGRQHSA-N 0.000 description 1
- TZOVVRJYUDETQG-RCOVLWMOSA-N Gly-Asp-Val Chemical compound CC(C)[C@@H](C(O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)CN TZOVVRJYUDETQG-RCOVLWMOSA-N 0.000 description 1
- DHDOADIPGZTAHT-YUMQZZPRSA-N Gly-Glu-Arg Chemical compound NCC(=O)N[C@@H](CCC(O)=O)C(=O)N[C@H](C(O)=O)CCCN=C(N)N DHDOADIPGZTAHT-YUMQZZPRSA-N 0.000 description 1
- FEUPVVCGQLNXNP-IRXDYDNUSA-N Gly-Phe-Phe Chemical compound C([C@H](NC(=O)CN)C(=O)N[C@@H](CC=1C=CC=CC=1)C(O)=O)C1=CC=CC=C1 FEUPVVCGQLNXNP-IRXDYDNUSA-N 0.000 description 1
- JJGBXTYGTKWGAT-YUMQZZPRSA-N Gly-Pro-Glu Chemical compound NCC(=O)N1CCC[C@H]1C(=O)N[C@@H](CCC(O)=O)C(O)=O JJGBXTYGTKWGAT-YUMQZZPRSA-N 0.000 description 1
- NSVOVKWEKGEOQB-LURJTMIESA-N Gly-Pro-Gly Chemical compound NCC(=O)N1CCC[C@H]1C(=O)NCC(O)=O NSVOVKWEKGEOQB-LURJTMIESA-N 0.000 description 1
- POJJAZJHBGXEGM-YUMQZZPRSA-N Gly-Ser-Lys Chemical compound C(CCN)C[C@@H](C(=O)O)NC(=O)[C@H](CO)NC(=O)CN POJJAZJHBGXEGM-YUMQZZPRSA-N 0.000 description 1
- XHVONGZZVUUORG-WEDXCCLWSA-N Gly-Thr-Lys Chemical compound NCC(=O)N[C@@H]([C@H](O)C)C(=O)N[C@H](C(O)=O)CCCCN XHVONGZZVUUORG-WEDXCCLWSA-N 0.000 description 1
- KOYUSMBPJOVSOO-XEGUGMAKSA-N Gly-Tyr-Ile Chemical compound [H]NCC(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H]([C@@H](C)CC)C(O)=O KOYUSMBPJOVSOO-XEGUGMAKSA-N 0.000 description 1
- DKJWUIYLMLUBDX-XPUUQOCRSA-N Gly-Val-Cys Chemical compound NCC(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CS)C(=O)O DKJWUIYLMLUBDX-XPUUQOCRSA-N 0.000 description 1
- 102000003886 Glycoproteins Human genes 0.000 description 1
- 108090000288 Glycoproteins Proteins 0.000 description 1
- JBCLFWXMTIKCCB-UHFFFAOYSA-N H-Gly-Phe-OH Natural products NCC(=O)NC(C(O)=O)CC1=CC=CC=C1 JBCLFWXMTIKCCB-UHFFFAOYSA-N 0.000 description 1
- NOQPTNXSGNPJNS-YUMQZZPRSA-N His-Asn-Gly Chemical compound [H]N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC(N)=O)C(=O)NCC(O)=O NOQPTNXSGNPJNS-YUMQZZPRSA-N 0.000 description 1
- LSQHWKPPOFDHHZ-YUMQZZPRSA-N His-Asp-Gly Chemical compound C1=C(NC=N1)C[C@@H](C(=O)N[C@@H](CC(=O)O)C(=O)NCC(=O)O)N LSQHWKPPOFDHHZ-YUMQZZPRSA-N 0.000 description 1
- UROVZOUMHNXPLZ-AVGNSLFASA-N His-Leu-Gln Chemical compound NC(=O)CC[C@@H](C(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](N)CC1=CN=CN1 UROVZOUMHNXPLZ-AVGNSLFASA-N 0.000 description 1
- WZDCVAWMBUNDDY-KBIXCLLPSA-N Ile-Glu-Ala Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](C)C(=O)O)N WZDCVAWMBUNDDY-KBIXCLLPSA-N 0.000 description 1
- HUORUFRRJHELPD-MNXVOIDGSA-N Ile-Leu-Glu Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(=O)O)C(=O)O)N HUORUFRRJHELPD-MNXVOIDGSA-N 0.000 description 1
- IOVUXUSIGXCREV-DKIMLUQUSA-N Ile-Leu-Phe Chemical compound CC[C@H](C)[C@H](N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@H](C(O)=O)CC1=CC=CC=C1 IOVUXUSIGXCREV-DKIMLUQUSA-N 0.000 description 1
- YSGBJIQXTIVBHZ-AJNGGQMLSA-N Ile-Lys-Leu Chemical compound CC[C@H](C)[C@H](N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(O)=O YSGBJIQXTIVBHZ-AJNGGQMLSA-N 0.000 description 1
- WCNWGAUZWWSYDG-SVSWQMSJSA-N Ile-Thr-Ser Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CO)C(=O)O)N WCNWGAUZWWSYDG-SVSWQMSJSA-N 0.000 description 1
- BCISUQVFDGYZBO-QSFUFRPTSA-N Ile-Val-Asp Chemical compound CC[C@H](C)[C@H](N)C(=O)N[C@@H](C(C)C)C(=O)N[C@H](C(O)=O)CC(O)=O BCISUQVFDGYZBO-QSFUFRPTSA-N 0.000 description 1
- TYYLDKGBCJGJGW-UHFFFAOYSA-N L-tryptophan-L-tyrosine Natural products C=1NC2=CC=CC=C2C=1CC(N)C(=O)NC(C(O)=O)CC1=CC=C(O)C=C1 TYYLDKGBCJGJGW-UHFFFAOYSA-N 0.000 description 1
- 241000880493 Leptailurus serval Species 0.000 description 1
- BQSLGJHIAGOZCD-CIUDSAMLSA-N Leu-Ala-Ser Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@@H](CO)C(O)=O BQSLGJHIAGOZCD-CIUDSAMLSA-N 0.000 description 1
- OIARJGNVARWKFP-YUMQZZPRSA-N Leu-Asn-Gly Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)NCC(O)=O OIARJGNVARWKFP-YUMQZZPRSA-N 0.000 description 1
- MYGQXVYRZMKRDB-SRVKXCTJSA-N Leu-Asp-Lys Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@H](C(O)=O)CCCCN MYGQXVYRZMKRDB-SRVKXCTJSA-N 0.000 description 1
- FIYMBBHGYNQFOP-IUCAKERBSA-N Leu-Gly-Gln Chemical compound CC(C)C[C@@H](C(=O)NCC(=O)N[C@@H](CCC(=O)N)C(=O)O)N FIYMBBHGYNQFOP-IUCAKERBSA-N 0.000 description 1
- JLWZLIQRYCTYBD-IHRRRGAJSA-N Leu-Lys-Arg Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O JLWZLIQRYCTYBD-IHRRRGAJSA-N 0.000 description 1
- HVHRPWQEQHIQJF-AVGNSLFASA-N Leu-Lys-Glu Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(O)=O)C(O)=O HVHRPWQEQHIQJF-AVGNSLFASA-N 0.000 description 1
- VULJUQZPSOASBZ-SRVKXCTJSA-N Leu-Pro-Glu Chemical compound [H]N[C@@H](CC(C)C)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCC(O)=O)C(O)=O VULJUQZPSOASBZ-SRVKXCTJSA-N 0.000 description 1
- QONKWXNJRRNTBV-AVGNSLFASA-N Leu-Pro-Met Chemical compound CC(C)C[C@@H](C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCSC)C(=O)O)N QONKWXNJRRNTBV-AVGNSLFASA-N 0.000 description 1
- SXOFUVGLPHCPRQ-KKUMJFAQSA-N Leu-Tyr-Cys Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CS)C(O)=O SXOFUVGLPHCPRQ-KKUMJFAQSA-N 0.000 description 1
- CGHXMODRYJISSK-NHCYSSNCSA-N Leu-Val-Asp Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](C(C)C)C(=O)N[C@H](C(O)=O)CC(O)=O CGHXMODRYJISSK-NHCYSSNCSA-N 0.000 description 1
- 108010055060 Lumixyl Proteins 0.000 description 1
- OPTCSTACHGNULU-DCAQKATOSA-N Lys-Cys-Val Chemical compound CC(C)[C@@H](C(O)=O)NC(=O)[C@H](CS)NC(=O)[C@@H](N)CCCCN OPTCSTACHGNULU-DCAQKATOSA-N 0.000 description 1
- QBEPTBMRQALPEV-MNXVOIDGSA-N Lys-Ile-Glu Chemical compound OC(=O)CC[C@@H](C(O)=O)NC(=O)[C@H]([C@@H](C)CC)NC(=O)[C@@H](N)CCCCN QBEPTBMRQALPEV-MNXVOIDGSA-N 0.000 description 1
- XIZQPFCRXLUNMK-BZSNNMDCSA-N Lys-Leu-Phe Chemical compound CC(C)C[C@@H](C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)O)NC(=O)[C@H](CCCCN)N XIZQPFCRXLUNMK-BZSNNMDCSA-N 0.000 description 1
- VUTWYNQUSJWBHO-BZSNNMDCSA-N Lys-Leu-Tyr Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(O)=O VUTWYNQUSJWBHO-BZSNNMDCSA-N 0.000 description 1
- YUAXTFMFMOIMAM-QWRGUYRKSA-N Lys-Lys-Gly Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)NCC(O)=O YUAXTFMFMOIMAM-QWRGUYRKSA-N 0.000 description 1
- BOJYMMBYBNOOGG-DCAQKATOSA-N Lys-Pro-Ala Chemical compound [H]N[C@@H](CCCCN)C(=O)N1CCC[C@H]1C(=O)N[C@@H](C)C(O)=O BOJYMMBYBNOOGG-DCAQKATOSA-N 0.000 description 1
- HKXSZKJMDBHOTG-CIUDSAMLSA-N Lys-Ser-Ala Chemical compound OC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CCCCN HKXSZKJMDBHOTG-CIUDSAMLSA-N 0.000 description 1
- GILLQRYAWOMHED-DCAQKATOSA-N Lys-Val-Ser Chemical compound OC[C@@H](C(O)=O)NC(=O)[C@H](C(C)C)NC(=O)[C@@H](N)CCCCN GILLQRYAWOMHED-DCAQKATOSA-N 0.000 description 1
- IUYCGMNKIZDRQI-BQBZGAKWSA-N Met-Gly-Ala Chemical compound CSCC[C@H](N)C(=O)NCC(=O)N[C@@H](C)C(O)=O IUYCGMNKIZDRQI-BQBZGAKWSA-N 0.000 description 1
- WPTHAGXMYDRPFD-SRVKXCTJSA-N Met-Lys-Glu Chemical compound CSCC[C@H](N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(O)=O)C(O)=O WPTHAGXMYDRPFD-SRVKXCTJSA-N 0.000 description 1
- VQILILSLEFDECU-GUBZILKMSA-N Met-Pro-Ala Chemical compound [H]N[C@@H](CCSC)C(=O)N1CCC[C@H]1C(=O)N[C@@H](C)C(O)=O VQILILSLEFDECU-GUBZILKMSA-N 0.000 description 1
- YJNDFEWPGLNLNH-IHRRRGAJSA-N Met-Tyr-Cys Chemical compound CSCC[C@H](N)C(=O)N[C@H](C(=O)N[C@@H](CS)C(O)=O)CC1=CC=C(O)C=C1 YJNDFEWPGLNLNH-IHRRRGAJSA-N 0.000 description 1
- -1 Methylaminoethanol sodium tartrate Chemical compound 0.000 description 1
- 206010062575 Muscle contracture Diseases 0.000 description 1
- PESQCPHRXOFIPX-UHFFFAOYSA-N N-L-methionyl-L-tyrosine Natural products CSCCC(N)C(=O)NC(C(O)=O)CC1=CC=C(O)C=C1 PESQCPHRXOFIPX-UHFFFAOYSA-N 0.000 description 1
- 108010047562 NGR peptide Proteins 0.000 description 1
- JEGFCFLCRSJCMA-IHRRRGAJSA-N Phe-Arg-Ser Chemical compound C1=CC=C(C=C1)C[C@@H](C(=O)N[C@@H](CCCN=C(N)N)C(=O)N[C@@H](CO)C(=O)O)N JEGFCFLCRSJCMA-IHRRRGAJSA-N 0.000 description 1
- RBRNEFJTEHPDSL-ACRUOGEOSA-N Phe-Phe-Lys Chemical compound C([C@@H](C(=O)N[C@@H](CCCCN)C(O)=O)NC(=O)[C@@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 RBRNEFJTEHPDSL-ACRUOGEOSA-N 0.000 description 1
- ZJPGOXWRFNKIQL-JYJNAYRXSA-N Phe-Pro-Pro Chemical compound C([C@H](N)C(=O)N1[C@@H](CCC1)C(=O)N1[C@@H](CCC1)C(O)=O)C1=CC=CC=C1 ZJPGOXWRFNKIQL-JYJNAYRXSA-N 0.000 description 1
- FRMKIPSIZSFTTE-HJOGWXRNSA-N Phe-Tyr-Phe Chemical compound [H]N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC1=CC=CC=C1)C(O)=O FRMKIPSIZSFTTE-HJOGWXRNSA-N 0.000 description 1
- FKYKZHOKDOPHSA-DCAQKATOSA-N Pro-Leu-Ser Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(O)=O FKYKZHOKDOPHSA-DCAQKATOSA-N 0.000 description 1
- VEUACYMXJKXALX-IHRRRGAJSA-N Pro-Tyr-Ser Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CO)C(O)=O VEUACYMXJKXALX-IHRRRGAJSA-N 0.000 description 1
- 206010057071 Rectal tenesmus Diseases 0.000 description 1
- BTKUIVBNGBFTTP-WHFBIAKZSA-N Ser-Ala-Gly Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](C)C(=O)NCC(O)=O BTKUIVBNGBFTTP-WHFBIAKZSA-N 0.000 description 1
- QFBNNYNWKYKVJO-DCAQKATOSA-N Ser-Arg-Lys Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)[C@@H](NC(=O)[C@@H](N)CO)CCCN=C(N)N QFBNNYNWKYKVJO-DCAQKATOSA-N 0.000 description 1
- GYXVUTAOICLGKJ-ACZMJKKPSA-N Ser-Glu-Cys Chemical compound C(CC(=O)O)[C@@H](C(=O)N[C@@H](CS)C(=O)O)NC(=O)[C@H](CO)N GYXVUTAOICLGKJ-ACZMJKKPSA-N 0.000 description 1
- UQFYNFTYDHUIMI-WHFBIAKZSA-N Ser-Gly-Ala Chemical compound OC(=O)[C@H](C)NC(=O)CNC(=O)[C@@H](N)CO UQFYNFTYDHUIMI-WHFBIAKZSA-N 0.000 description 1
- JIPVNVNKXJLFJF-BJDJZHNGSA-N Ser-Ile-Lys Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CCCCN)C(=O)O)NC(=O)[C@H](CO)N JIPVNVNKXJLFJF-BJDJZHNGSA-N 0.000 description 1
- LRZLZIUXQBIWTB-KATARQTJSA-N Ser-Lys-Thr Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H]([C@@H](C)O)C(O)=O LRZLZIUXQBIWTB-KATARQTJSA-N 0.000 description 1
- MQUZANJDFOQOBX-SRVKXCTJSA-N Ser-Phe-Ser Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CO)C(O)=O MQUZANJDFOQOBX-SRVKXCTJSA-N 0.000 description 1
- FBLNYDYPCLFTSP-IXOXFDKPSA-N Ser-Phe-Thr Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H]([C@@H](C)O)C(O)=O FBLNYDYPCLFTSP-IXOXFDKPSA-N 0.000 description 1
- BSXKBOUZDAZXHE-CIUDSAMLSA-N Ser-Pro-Glu Chemical compound [H]N[C@@H](CO)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCC(O)=O)C(O)=O BSXKBOUZDAZXHE-CIUDSAMLSA-N 0.000 description 1
- AZWNCEBQZXELEZ-FXQIFTODSA-N Ser-Pro-Ser Chemical compound OC[C@H](N)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CO)C(O)=O AZWNCEBQZXELEZ-FXQIFTODSA-N 0.000 description 1
- JURQXQBJKUHGJS-UHFFFAOYSA-N Ser-Ser-Ser-Ser Chemical compound OCC(N)C(=O)NC(CO)C(=O)NC(CO)C(=O)NC(CO)C(O)=O JURQXQBJKUHGJS-UHFFFAOYSA-N 0.000 description 1
- YBXMGKCLOPDEKA-NUMRIWBASA-N Thr-Asp-Glu Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(O)=O YBXMGKCLOPDEKA-NUMRIWBASA-N 0.000 description 1
- VYEHBMMAJFVTOI-JHEQGTHGSA-N Thr-Gly-Gln Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)NCC(=O)N[C@@H](CCC(N)=O)C(O)=O VYEHBMMAJFVTOI-JHEQGTHGSA-N 0.000 description 1
- JQAWYCUUFIMTHE-WLTAIBSBSA-N Thr-Gly-Tyr Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)NCC(=O)N[C@@H](CC1=CC=C(O)C=C1)C(O)=O JQAWYCUUFIMTHE-WLTAIBSBSA-N 0.000 description 1
- ODXKUIGEPAGKKV-KATARQTJSA-N Thr-Leu-Cys Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CS)C(=O)O)N)O ODXKUIGEPAGKKV-KATARQTJSA-N 0.000 description 1
- GQPQJNMVELPZNQ-GBALPHGKSA-N Thr-Ser-Trp Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CO)C(=O)N[C@@H](CC1=CNC2=CC=CC=C21)C(=O)O)N)O GQPQJNMVELPZNQ-GBALPHGKSA-N 0.000 description 1
- BEZTUFWTPVOROW-KJEVXHAQSA-N Thr-Tyr-Arg Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CC1=CC=C(C=C1)O)C(=O)N[C@@H](CCCN=C(N)N)C(=O)O)N)O BEZTUFWTPVOROW-KJEVXHAQSA-N 0.000 description 1
- GSEJCLTVZPLZKY-UHFFFAOYSA-N Triethanolamine Chemical compound OCCN(CCO)CCO GSEJCLTVZPLZKY-UHFFFAOYSA-N 0.000 description 1
- IYHRKILQAQWODS-VJBMBRPKSA-N Trp-Trp-Glu Chemical compound C1=CC=C2C(=C1)C(=CN2)C[C@@H](C(=O)N[C@@H](CC3=CNC4=CC=CC=C43)C(=O)N[C@@H](CCC(=O)O)C(=O)O)N IYHRKILQAQWODS-VJBMBRPKSA-N 0.000 description 1
- QJBWZNTWJSZUOY-UWJYBYFXSA-N Tyr-Ala-Cys Chemical compound C[C@@H](C(=O)N[C@@H](CS)C(=O)O)NC(=O)[C@H](CC1=CC=C(C=C1)O)N QJBWZNTWJSZUOY-UWJYBYFXSA-N 0.000 description 1
- LGEYOIQBBIPHQN-UWJYBYFXSA-N Tyr-Ala-Ser Chemical compound OC[C@@H](C(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CC1=CC=C(O)C=C1 LGEYOIQBBIPHQN-UWJYBYFXSA-N 0.000 description 1
- ZNFPUOSTMUMUDR-JRQIVUDYSA-N Tyr-Asn-Thr Chemical compound [H]N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(O)=O ZNFPUOSTMUMUDR-JRQIVUDYSA-N 0.000 description 1
- YLRLHDFMMWDYTK-KKUMJFAQSA-N Tyr-Cys-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@H](CS)NC(=O)[C@@H](N)CC1=CC=C(O)C=C1 YLRLHDFMMWDYTK-KKUMJFAQSA-N 0.000 description 1
- GULIUBBXCYPDJU-CQDKDKBSSA-N Tyr-Leu-Ala Chemical compound [O-]C(=O)[C@H](C)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H]([NH3+])CC1=CC=C(O)C=C1 GULIUBBXCYPDJU-CQDKDKBSSA-N 0.000 description 1
- FMXFHNSFABRVFZ-BZSNNMDCSA-N Tyr-Lys-Leu Chemical compound [H]N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(O)=O FMXFHNSFABRVFZ-BZSNNMDCSA-N 0.000 description 1
- SCZJKZLFSSPJDP-ACRUOGEOSA-N Tyr-Phe-Leu Chemical compound [H]N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CC(C)C)C(O)=O SCZJKZLFSSPJDP-ACRUOGEOSA-N 0.000 description 1
- FPCIBLUVDNXPJO-XPUUQOCRSA-N Val-Cys-Gly Chemical compound CC(C)[C@H](N)C(=O)N[C@@H](CS)C(=O)NCC(O)=O FPCIBLUVDNXPJO-XPUUQOCRSA-N 0.000 description 1
- VCAWFLIWYNMHQP-UKJIMTQDSA-N Val-Glu-Ile Chemical compound CC[C@H](C)[C@@H](C(=O)O)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](C(C)C)N VCAWFLIWYNMHQP-UKJIMTQDSA-N 0.000 description 1
- GBIUHAYJGWVNLN-UHFFFAOYSA-N Val-Ser-Pro Natural products CC(C)C(N)C(=O)NC(CO)C(=O)N1CCCC1C(O)=O GBIUHAYJGWVNLN-UHFFFAOYSA-N 0.000 description 1
- 235000018936 Vitellaria paradoxa Nutrition 0.000 description 1
- 241001135917 Vitellaria paradoxa Species 0.000 description 1
- SNGZVXPRGLTKNU-RGMNGODLSA-N [Na].C(CC)N[C@@H](CCO)C(=O)O Chemical compound [Na].C(CC)N[C@@H](CCO)C(=O)O SNGZVXPRGLTKNU-RGMNGODLSA-N 0.000 description 1
- 208000019790 abdominal distention Diseases 0.000 description 1
- 238000010521 absorption reaction Methods 0.000 description 1
- 238000009825 accumulation Methods 0.000 description 1
- 239000011149 active material Substances 0.000 description 1
- 108010076324 alanyl-glycyl-glycine Proteins 0.000 description 1
- 229960000458 allantoin Drugs 0.000 description 1
- KOSRFJWDECSPRO-UHFFFAOYSA-N alpha-L-glutamyl-L-glutamic acid Natural products OC(=O)CCC(N)C(=O)NC(CCC(O)=O)C(O)=O KOSRFJWDECSPRO-UHFFFAOYSA-N 0.000 description 1
- 108010094001 arginyl-tryptophyl-arginine Proteins 0.000 description 1
- 108010038633 aspartylglutamate Proteins 0.000 description 1
- 230000003796 beauty Effects 0.000 description 1
- 230000009286 beneficial effect Effects 0.000 description 1
- 239000008280 blood Substances 0.000 description 1
- 210000004369 blood Anatomy 0.000 description 1
- 210000000481 breast Anatomy 0.000 description 1
- 210000001217 buttock Anatomy 0.000 description 1
- 230000024245 cell differentiation Effects 0.000 description 1
- 230000004663 cell proliferation Effects 0.000 description 1
- 230000035606 childbirth Effects 0.000 description 1
- 210000002808 connective tissue Anatomy 0.000 description 1
- 208000006111 contracture Diseases 0.000 description 1
- 210000000736 corneocyte Anatomy 0.000 description 1
- 201000010251 cutis laxa Diseases 0.000 description 1
- 108010016616 cysteinylglycine Proteins 0.000 description 1
- 239000003814 drug Substances 0.000 description 1
- 229940079593 drug Drugs 0.000 description 1
- 238000005516 engineering process Methods 0.000 description 1
- SFNALCNOMXIBKG-UHFFFAOYSA-N ethylene glycol monododecyl ether Chemical compound CCCCCCCCCCCCOCCO SFNALCNOMXIBKG-UHFFFAOYSA-N 0.000 description 1
- 238000000605 extraction Methods 0.000 description 1
- 206010016256 fatigue Diseases 0.000 description 1
- 229950003499 fibrin Drugs 0.000 description 1
- 108010078144 glutaminyl-glycine Proteins 0.000 description 1
- 108010042598 glutamyl-aspartyl-glycine Proteins 0.000 description 1
- 108010055341 glutamyl-glutamic acid Proteins 0.000 description 1
- 108010049041 glutamylalanine Proteins 0.000 description 1
- 108010079547 glutamylmethionine Proteins 0.000 description 1
- 229960005150 glycerol Drugs 0.000 description 1
- 108010075431 glycyl-alanyl-phenylalanine Proteins 0.000 description 1
- 108010079413 glycyl-prolyl-glutamic acid Proteins 0.000 description 1
- 108010010147 glycylglutamine Proteins 0.000 description 1
- 108010050848 glycylleucine Proteins 0.000 description 1
- 108010081551 glycylphenylalanine Proteins 0.000 description 1
- 108010087823 glycyltyrosine Proteins 0.000 description 1
- 230000035876 healing Effects 0.000 description 1
- 230000003054 hormonal effect Effects 0.000 description 1
- 229940088597 hormone Drugs 0.000 description 1
- 239000005556 hormone Substances 0.000 description 1
- 239000001257 hydrogen Substances 0.000 description 1
- 229910052739 hydrogen Inorganic materials 0.000 description 1
- 125000002887 hydroxy group Chemical group [H]O* 0.000 description 1
- 206010020718 hyperplasia Diseases 0.000 description 1
- 229940100556 laureth-23 Drugs 0.000 description 1
- AGBQKNBQESQNJD-UHFFFAOYSA-M lipoate Chemical compound [O-]C(=O)CCCCC1CCSS1 AGBQKNBQESQNJD-UHFFFAOYSA-M 0.000 description 1
- 235000019136 lipoic acid Nutrition 0.000 description 1
- 108010003700 lysyl aspartic acid Proteins 0.000 description 1
- 108010044348 lysyl-glutamyl-aspartic acid Proteins 0.000 description 1
- 108010009298 lysylglutamic acid Proteins 0.000 description 1
- 108010064235 lysylglycine Proteins 0.000 description 1
- 108010054155 lysyllysine Proteins 0.000 description 1
- 239000000463 material Substances 0.000 description 1
- 239000011159 matrix material Substances 0.000 description 1
- 230000004630 mental health Effects 0.000 description 1
- 230000036651 mood Effects 0.000 description 1
- 210000004400 mucous membrane Anatomy 0.000 description 1
- 230000009707 neogenesis Effects 0.000 description 1
- 235000016709 nutrition Nutrition 0.000 description 1
- 230000035764 nutrition Effects 0.000 description 1
- 239000004006 olive oil Substances 0.000 description 1
- 235000008390 olive oil Nutrition 0.000 description 1
- 206010033675 panniculitis Diseases 0.000 description 1
- 230000035515 penetration Effects 0.000 description 1
- 229960005323 phenoxyethanol Drugs 0.000 description 1
- 108010065135 phenylalanyl-phenylalanyl-phenylalanine Proteins 0.000 description 1
- 108010051242 phenylalanylserine Proteins 0.000 description 1
- 239000000049 pigment Substances 0.000 description 1
- 229910052697 platinum Inorganic materials 0.000 description 1
- 239000003910 polypeptide antibiotic agent Substances 0.000 description 1
- 229920001282 polysaccharide Polymers 0.000 description 1
- 239000005017 polysaccharide Substances 0.000 description 1
- 230000002265 prevention Effects 0.000 description 1
- 108010087846 prolyl-prolyl-glycine Proteins 0.000 description 1
- 108010004914 prolylarginine Proteins 0.000 description 1
- ULWHHBHJGPPBCO-UHFFFAOYSA-N propane-1,1-diol Chemical class CCC(O)O ULWHHBHJGPPBCO-UHFFFAOYSA-N 0.000 description 1
- 102000004169 proteins and genes Human genes 0.000 description 1
- 108090000623 proteins and genes Proteins 0.000 description 1
- 230000005855 radiation Effects 0.000 description 1
- 238000011084 recovery Methods 0.000 description 1
- 230000009467 reduction Effects 0.000 description 1
- 230000028327 secretion Effects 0.000 description 1
- 108010048818 seryl-histidine Proteins 0.000 description 1
- 108010007375 seryl-seryl-seryl-arginine Proteins 0.000 description 1
- 229940057910 shea butter Drugs 0.000 description 1
- 239000002356 single layer Substances 0.000 description 1
- 206010040882 skin lesion Diseases 0.000 description 1
- 231100000444 skin lesion Toxicity 0.000 description 1
- 230000036558 skin tension Effects 0.000 description 1
- 238000004659 sterilization and disinfection Methods 0.000 description 1
- 239000004575 stone Substances 0.000 description 1
- 230000035882 stress Effects 0.000 description 1
- 210000004304 subcutaneous tissue Anatomy 0.000 description 1
- 230000037072 sun protection Effects 0.000 description 1
- 208000012271 tenesmus Diseases 0.000 description 1
- 229960002663 thioctic acid Drugs 0.000 description 1
- 108010061238 threonyl-glycine Proteins 0.000 description 1
- 230000000451 tissue damage Effects 0.000 description 1
- 231100000827 tissue damage Toxicity 0.000 description 1
- 229960004418 trolamine Drugs 0.000 description 1
- 108010044292 tryptophyltyrosine Proteins 0.000 description 1
- 108010079202 tyrosyl-alanyl-cysteine Proteins 0.000 description 1
- 108010035534 tyrosyl-leucyl-alanine Proteins 0.000 description 1
- 238000002604 ultrasonography Methods 0.000 description 1
- 210000000689 upper leg Anatomy 0.000 description 1
- 230000002087 whitening effect Effects 0.000 description 1
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K8/00—Cosmetics or similar toiletry preparations
- A61K8/18—Cosmetics or similar toiletry preparations characterised by the composition
- A61K8/30—Cosmetics or similar toiletry preparations characterised by the composition containing organic compounds
- A61K8/33—Cosmetics or similar toiletry preparations characterised by the composition containing organic compounds containing oxygen
- A61K8/34—Alcohols
- A61K8/345—Alcohols containing more than one hydroxy group
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K8/00—Cosmetics or similar toiletry preparations
- A61K8/18—Cosmetics or similar toiletry preparations characterised by the composition
- A61K8/30—Cosmetics or similar toiletry preparations characterised by the composition containing organic compounds
- A61K8/64—Proteins; Peptides; Derivatives or degradation products thereof
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K8/00—Cosmetics or similar toiletry preparations
- A61K8/18—Cosmetics or similar toiletry preparations characterised by the composition
- A61K8/96—Cosmetics or similar toiletry preparations characterised by the composition containing materials, or derivatives thereof of undetermined constitution
- A61K8/98—Cosmetics or similar toiletry preparations characterised by the composition containing materials, or derivatives thereof of undetermined constitution of animal origin
- A61K8/981—Cosmetics or similar toiletry preparations characterised by the composition containing materials, or derivatives thereof of undetermined constitution of animal origin of mammals or bird
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61Q—SPECIFIC USE OF COSMETICS OR SIMILAR TOILETRY PREPARATIONS
- A61Q19/00—Preparations for care of the skin
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61Q—SPECIFIC USE OF COSMETICS OR SIMILAR TOILETRY PREPARATIONS
- A61Q19/00—Preparations for care of the skin
- A61Q19/08—Anti-ageing preparations
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Veterinary Medicine (AREA)
- Animal Behavior & Ethology (AREA)
- General Health & Medical Sciences (AREA)
- Public Health (AREA)
- Birds (AREA)
- Epidemiology (AREA)
- Dermatology (AREA)
- Emergency Medicine (AREA)
- Zoology (AREA)
- Gerontology & Geriatric Medicine (AREA)
- Cosmetics (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
Abstract
The present invention provides a kind of essence element, belong to cosmetic technical field, by being prepared including following raw material：Oligopeptides 1, oligopeptides 2, oligopeptides 3, oligopeptides 5, hexapeptide 3, thymic extract, moisturizer, mannitol, Chondrus crispus and water.Essence element provided by the invention reaches 98% to striae of pregnancy reparation effective percentage, and lasting use, contribute to the tolerance of lifting skin entirety, the metabolism of accelerated ageing cell, the ecosystem for improving skin microcirculation, reducing skin health, health is presented, compacts, lubricate texture, so as to achieve the purpose that to repair striae of pregnancy.
Description
Technical field
The present invention relates to cosmetic technical field, and in particular to a kind of essence element and preparation method thereof.
Background technology
The formation of striae of pregnancy makes the elastic fibers of skin mainly due to the gestational period hormonal influence, in addition abdominal distention
Damage or be broken with collagenous fibres, skin of abdomen is thinning to attenuate, and it is different, different in size pink or purplish red some width occur
The wavy decorative pattern of color.After childbirth, these decorative patterns can fade away, and leave white or argenteous glossiness scar strain line,
That is striae of pregnancy.Striae of pregnancy is mainly appeared on stomach wall, it is also possible to appears in outside, buttocks, chest, rear waist and arm in thigh
Etc..Primipara is the most obvious.Once striae of pregnancy occur would not disappear, and with cutis laxa, breast tenesmus, stomach fat
Accumulation, has seriously affected figure and the physical and mental health in women's postpartum.The generation of striae of pregnancy is very universal in women, have 60%~
90% pregnant woman is perplexed be subject to striae of pregnancy.Therefore striae of pregnancy is explored by people's extensive concern and constantly.
The change of gestation skin tension and the change of hormone are by it is believed that be the main reason for striae of pregnancy occurs.It is pregnant
Skin can little by little be stretched with the development of subcutaneous tissue such as fat and muscle tissue during being pregnent, when more than certain limit
When, cause skin corium connective tissue damage, the destruction of collagenous fibres and elastomer, the extensibility and elasticity for causing affected area subtract
It is weak, so as to produce the skin lesion of striated.
Due to generality existing for striae of pregnancy and permanent, it destroys the beauty of women, and then influences its mood, to suffering from
Suffer from pregnant woman and bring very big stress, have impact on its quality of life.Therefore, striae of pregnancy is subject to that people's is extensive all the time
Concern.Striae of pregnancy is also the hot spot of medical field research all the time, its treatment method is also in constantly exploring.Current existing external application
Drug treatment has glycolic, but can not repair striae of pregnancy completely.
The content of the invention
In view of this, it is an object of the invention to provide a kind of essence element, striae of pregnancy can be repaired.
In order to realize foregoing invention purpose, the present invention provides following technical scheme：
The present invention provides a kind of essence element, it is prepared by the raw material including following weight percent composition：
The amino acid sequence of the oligopeptides -1 is as shown in SEQ ID No.1, the amino acid sequence such as SEQ of the oligopeptides -2
Shown in ID No.2, the amino acid sequence of the oligopeptides -3 is as shown in SEQ ID No.3, and the amino acid sequence of the oligopeptides -5 is such as
Shown in SEQ ID No.4, the amino acid sequence of the hexapeptide -3 is as shown in SEQ ID No.5；
The active ingredient of the thymic extract includes thymosin extrasin.
Preferably, the moisturizer include glycerine, 1,2- pentanediols, 1,2- hexylene glycols, beta glucan, polyglutamic acid sodium and
Sodium Hyaluronate.
Preferably, glycerine and 1, the 2- pentanediol, 1,2- hexylene glycols, Sodium Hyaluronate, beta glucan, polyglutamic acid sodium
Mass ratio be (5~15):(0.01~0.03):(0.01~0.05):(0.05~0.2):(0.03~0.2):(0.1~
0.6)。
Present invention also offers the preparation method of the essence element described in above-mentioned technical proposal, comprise the following steps：
1) after water is mixed with moisturizer, mannitol and Chondrus crispus, mixed liquor is obtained；
2) mixed liquor for obtaining the step 1) and oligopeptides -1, oligopeptides -2, oligopeptides -3, oligopeptides -5, hexapeptide -3 and chest
Gland extract mixes, and obtains essence element.
Preferably, during the step 1) mixing, the temperature of water is 80~83 DEG C.
Preferably, during the step 2) mixing, the temperature of mixed liquor is 42~45 DEG C.
The present invention is to provide a kind of essence element, it is prepared by the raw material including following weight percent composition：Oligopeptides-
10.1~2.0%；Oligopeptides -20.1~2.0%；Oligopeptides -30.01~1.5%；Oligopeptides -50.01~1.5%；Hexapeptide -30.1~
2.0%；Moisturizer 5.2~16.08%；Mannitol 0.2~1.0%；Chondrus crispus 0.2~1.0%；Thymic extract
0.1~2.0%；The water of surplus；The amino acid sequence of the oligopeptides -1 is as shown in SEQ ID No.1, the amino of the oligopeptides -2
Acid sequence as shown in SEQ ID No.2, the amino acid sequence of the oligopeptides -3 as shown in SEQ ID No.3, the oligopeptides -5
Amino acid sequence is as shown in SEQ ID No.4, and the amino acid sequence of the hexapeptide -3 is as shown in SEQ ID No.5；The thymus gland
The active ingredient of extract includes thymosin extrasin.
Oligopeptides -1 in essence element provided by the invention, which has, to be repaired epidermis, anti-aging, lightens the stain, calm down wrinkle, grow
The effect of profit；Oligopeptides -2, which has, promotes cytothesis and growth, repairs impaired skin barrier；Oligopeptides -3 has deep layer reparation,
Anti-acne, repairs acne hole acne print, and effectively pre- anti-wrinkle occurs；Oligopeptides -5, which has, to be gone to wrinkle, moisturizing, anti-ageing reparation, increase skin resistance
Power and other effects, can promote collagen, elastic fibers and hyaluronic acid synthesis, improve the water content of skin；Hexapeptide -3 has light
Slide, compact, softening skin, reduce wrinkle, the appearance of microgroove, the effect of the aging of delaying skin, have the effect of similar creotoxin,
Promote collagen, elastic fibers and hyaluronic acid synthesis, improve the water content of skin；Thymic extract has anti-aging, comforts
Flat wrinkle, compact tender skin the effect of.Essence element depth of penetration skin deep tissues provided by the invention, effectively antagonize skin and are damaged
Aging, it is tired out, relaxation phenomena such as.The bioactivation element beneficial to skin barrier function is especially added with, contains precious high activity
Cell neogenesis nutrition repair factor, is continuously injected into impaired each layer skin histology, abundant liquid elite can promote
Into cytothesis, strengthen cell self-renewal, can help to lift the tolerance of skin entirety, the metabolism of accelerated ageing cell, change
Kind skin microcirculation, the ecosystem for reducing skin health, are presented health, compact, lubricate texture, gestation cannot be repaired by solving
The problem of line.
Essence element provided by the invention is by promoting synthesis (such as hyaluronic acid, collagenous fibres, the elasticity of extracellular macromolecular
Fibrin etc.), increase moisture content of skin, and then increase skin elasticity, moisturizing；Make that subcutaneous dermal tissue is full, flesh is fine
It is close to tie up marshalling, so as to reduce and smooth away wrinkles.The present invention is that damaged cell is repaired and adjusted on a molecular scale
It is whole, improve or update its tissue and metabolism, such as promote the growth of Skin Cell, prevention skin is subject to various damages, adjusts cell
Balance of middle pigment etc., then the optimum structure and state of skin are created, fundamentally reach skin care, the mesh to slow down aging
's.
The results show of the embodiment of the present invention：Essence element reaches striae of pregnancy reparation effective percentage 98%, and lasting use, has
Help be lifted the tolerance of skin entirety, the metabolism of accelerated ageing cell, the ecology for improving skin microcirculation, reducing skin health
System, is presented health, compacts, lubricates texture, so as to achieve the purpose that to repair striae of pregnancy.Compared with comparative example, the present invention provides
Essence element 72% is improved to the effective percentage of striae of pregnancy reparation.
Embodiment
The present invention provides a kind of essence element, it is prepared by the raw material including following weight percent composition：Oligopeptides-
10.1~2.0%；Oligopeptides -20.1~2.0%；Oligopeptides -30.01~1.5%；Oligopeptides -50.01~1.5%；Hexapeptide -30.1~
2.0%；5.2~16.08% mannitol 0.2~1.0% of moisturizer；Chondrus crispus 0.2~1.0%；Thymic extract 0.1
~2.0%；The water of surplus；The amino acid sequence of the oligopeptides -1 is as shown in SEQ ID No.1, the amino acid sequence of the oligopeptides -2
Row are as shown in SEQ ID No.2, and the amino acid sequence of the oligopeptides -3 is as shown in SEQ ID No.3, the amino of the oligopeptides -5
Acid sequence is as shown in SEQ ID No.4, and the amino acid sequence of the hexapeptide -3 is as shown in SEQ ID No.5；The thymus gland extraction
The active ingredient of thing includes thymosin extrasin.
Essence element provided by the invention includes the water of surplus, and the water is preferably purified water.
Essence element provided by the invention includes percentage by weight for 0.1~2.0% oligopeptides -1, preferably 0.5~
1.5%, more preferably 0.8~1.2%.In the present invention, the oligopeptides -1 is preferably solved in purified water, after obtaining the solution of oligopeptides -1
Reuse, the amount of the purified water is that the 2~5% of water inventory is purified in essence element.In the present invention, the oligopeptides -1 has
The effect of repairing epidermis, anti-aging, lightening the stain, calm down wrinkle, moisten, can promote absorption of the Skin Cell to nutriment,
Promote the division and growth of Skin Cell, promote the synthesis (such as elastomer albumen) of hyaluronic acid and functional protein；Increase
Moisture content of skin, and then increase skin elasticity, moisturizing；Smooth away wrinkles：Promotion corium confluent monolayer cells secretion synthesis collagenous fibres,
The functional moleculars such as polysaccharide, glycoprotein, make that subcutaneous dermal tissue is full, muscle fibre marshalling is close, so as to reduce and eliminate wrinkle
Line；Whitening sun protection, promotes neonatal cell growth, substitutes the cell by ultraviolet radiation damage, thin to reduce melanin in skin
The quantity of born of the same parents, can effectively contain the recurrence of color spot.
In the present invention, the amino acid sequence of the oligopeptides -1 is as follows：
NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR
The present invention is not particularly limited the source of the oligopeptides -1, is routinely selected using those skilled in the art commercially available
Product, the product that specially purchase is sold in Shenzhen Song Le bio tech ltd in embodiments of the present invention, oligopeptides-
1 specification is 5mg/ bottles.
It is provided by the invention including percentage by weight be 0.1~2.0% oligopeptides -2, be preferably 0.5~1.5%, it is more excellent
Elect 0.8~1.2% as.In the present invention, the oligopeptides -2 is preferably solved in purified water, is reused after obtaining the solution of oligopeptides -2, institute
The amount for stating purified water is that the 2~5% of water inventory is purified in essence element.In the present invention, the oligopeptides -2 promote cytothesis and
Growth, repairs impaired skin barrier.
In the present invention, the amino acid sequence of the oligopeptides -2 is as follows：
GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKS
A
The present invention is not particularly limited the source of the oligopeptides -2, is routinely selected using those skilled in the art commercially available
Product, the product that specially purchase is sold in Shenzhen Song Le bio tech ltd in embodiments of the present invention, oligopeptides-
2 specification is 5mg/ bottles.
Essence element provided by the invention includes percentage by weight for 0.01~1.5% oligopeptides -3, preferably 0.1~
1.0%, more preferably 0.5~0.8%.In the present invention, the oligopeptides -3 is preferably solved in purified water, after obtaining the solution of oligopeptides -3
Reuse, the amount of the purified water is that the 2~5% of water inventory is purified in essence element.In the present invention, the oligopeptides -3 has deep
Layer is repaired, anti-acne, repairs acne hole acne print, and effectively pre- anti-wrinkle occurs, and can improve the microenvironment of cell growth, promotes elasticity fine
The synthesis of peacekeeping collagen；Accelerate corneocyte renewal, make skin high resilience, the state tender in cunning；Promote into fibre
Cell proliferation and differentiation is tieed up, for the reparation and red blood silk reparation after newly generated acne hole, laser, after point spot mole anti-acne.
In the present invention, the amino acid sequence of the oligopeptides -3 is as follows：
MPALPEDGGSGAFPPGFFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGV
CANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAK
S
The present invention is not particularly limited the source of the oligopeptides -3, is routinely selected using those skilled in the art commercially available
Product, the product that specially purchase is sold in Shenzhen Song Le bio tech ltd in embodiments of the present invention, oligopeptides-
3 specification is 5mg/ bottles.
Essence element provided by the invention includes percentage by weight for 0.01~1.5% oligopeptides -5, preferably 0.1~
1.0%, more preferably 0.4~0.8%.In the present invention, the oligopeptides -5 is preferably solved in purified water, after obtaining the solution of oligopeptides -5
Reuse, the amount of the purified water is that the 2~5% of water inventory is purified in essence element.In the present invention, the oligopeptides -5 has and goes
Wrinkle, moisturizing, anti-ageing reparation, increase skin resistance and other effects, promote collagen, elastic fibers and hyaluronic acid synthesis, carry
The water content of high skin.
In the present invention, the amino acid sequence of the oligopeptides -5 is as follows：
LGQDMVSPEATNSSSSSFSSPSSAGRHVRSYNHLQGDVRWRKLFSFTKYFLKIEKNGKVSGTKKENCPY
SILEITSVEIGVVAVKAINSNYYLAMNKKGKLYGSKEFNNDCKLKERIEENGYNTYASFNWQHNGRQMYVALNGKGA
PRRGQKTRRKNTSAHFLPMVVHS
The present invention is not particularly limited the source of the oligopeptides -5, is routinely selected using those skilled in the art commercially available
Product, the product that specially purchase is sold in Shenzhen Song Le bio tech ltd in embodiments of the present invention, oligopeptides-
5 specification is 5mg/ bottles.
Essence element provided by the invention includes weight percent hundred for 0.1~2.0% hexapeptide -3, preferably 0.5~
1.5%, more preferably 0.8~1.2%.In the present invention, the hexapeptide -3 is preferably solved in purified water, after obtaining the solution of hexapeptide -3
Reuse, the amount of the purified water is that the 5~10% of water inventory is purified in essence element.In the present invention, the hexapeptide -3 has
It is smooth, compact, softening skin, reduce wrinkle, the appearance of microgroove, the aging of delaying skin, have the effect of similar creotoxin, can promote
Into collagen, elastic fibers and hyaluronic acid synthesize, and improve the water content of skin.
In the present invention, the amino acid sequence of the hexapeptide -3 is：AGGMGAAN
The present invention is not particularly limited the source of the hexapeptide -3, is routinely selected using those skilled in the art commercially available
Product.In embodiments of the present invention, the purchase of hexapeptide -3 is in the sale of Chongqing promise biotechnology development corporation, Ltd.
Product.
Essence element provided by the invention includes the moisturizer that percentage by weight is 5.2~16.08%, is preferably 7~12%,
More preferably 8~10%.In the present invention, the moisturizer preferably includes glycerine, 1,2- pentanediols, 1,2- hexylene glycols, β-Portugal
Glycan, polyglutamic acid sodium and Sodium Hyaluronate, glycerine and 1, the 2- pentanediol, 1,2- hexylene glycols, Sodium Hyaluronate, β-Portugal gather
Sugar, the mass ratio of polyglutamic acid sodium are (5~15):(0.01~0.03):(0.01~0.05):(0.05~0.2):(0.03~
0.2):(0.1~0.6), more preferably (8~12):0.02:(0.02~0.04):(0.1~0.15):(0.1~0.15):
(0.2~0.5), is most preferably 10:0.02:0.03:0.12:0.12:(0.3~0.4).Source of the present invention to the moisturizer
It is not particularly limited, the commercial product routinely selected using those skilled in the art.In the present invention, the moisturizer energy
Enough increase the wettability of skin.In the present invention, the Sodium Hyaluronate can moment deep moisturizing, increase skin elasticity with
Power, helps and recovers the normal oil-water balance of skin, improves dry and relaxation skin.
Essence element provided by the invention includes percentage by weight for 0.2~1.0% Chondrus crispus, preferably 0.4~
0.8%, more preferably 0.5~0.7%.In the present invention, the Chondrus crispus can increase the viscosity of essence element.The present invention
It is preferred that being reused after Chondrus crispus is made powdery, the present invention is not particularly limited the source of the Chondrus crispus powder,
The commercial product routinely selected using those skilled in the art is specially purchase in embodiments of the present invention in rich platinum (weight
Celebrating) Chemical Co., Ltd.'s Guangzhou Branch product.
Essence element provided by the invention includes percentage by weight for 0.2~1.0% mannitol, preferably 0.4~
0.8%, more preferably 0.5~0.7%.The present invention is not particularly limited the source of the mannitol, using this area skill
The commercial goods that art personnel routinely select.In the present invention, the mannitol is used as the matrix of product, in addition by
It is relatively more in hydroxyl, it can be combined with water in the form of hydrogen bond, moisturizing can also be played in cosmetics and promote what is permeated by adding
Effect.
Essence element provided by the invention includes mass percent for 0.1~2.0% thymic extract, preferably 0.5~
1.5%, more preferably 0.6~1.0%.The present invention is not particularly limited the source of the thymic extract, using this area
The commercial product that technical staff routinely selects, in embodiments of the present invention specific purchase are developed in Chongqing promise biotechnology
The product of Co., Ltd's sale.In the present invention, the thymic extract has anti-aging, smooth out wrinkles, the work(for the tender skin that compacts
Effect, after being combined with the actin in cell, makes cell be in the state of full jade-like stone profit, display water outlet that can be from inside to outside is tender bright
Pool, lifting are compacted, vigorous state, and have the Healing for promoting skin and mucous membrane wound face, and reduce scar contracture
With skin deformity hyperplasia, the scar especially left after acne, pimple curative effect are preferable.
Essence element provided by the invention includes the water of surplus, and the water is preferably purified water.
Present invention also offers the preparation method of the essence element described in above-mentioned technical proposal, comprise the following steps：
1) after water is mixed with moisturizer, mannitol and Chondrus crispus powder, mixed liquor is obtained；
2) mixed liquor for obtaining the step 1) and oligopeptides -1, oligopeptides -2, oligopeptides -3, oligopeptides -5, hexapeptide -3 and chest
After the mixing of gland extract, essence element is obtained.
In the present invention, the moisturizer preferably includes glycerine, 1,2- pentanediols, 1,2- hexylene glycols, beta glucan, poly- paddy
Propylhomoserin sodium and Sodium Hyaluronate.
In the present invention, the hybrid mode of the water and moisturizer, mannitol and Chondrus crispus powder is preferably by water
Successively with after glycerine, mannitol, 1,2- pentanediols, 1,2- hexylene glycols, polyglutamic acid sodium, Sodium Hyaluronate mixing, being contained
There is the feed liquid of mannitol；It will mix, obtain with beta glucan, Chondrus crispus powder after the feed liquid cooling containing mannitol
To mixed liquor.In the present invention, during the mixing, the temperature of water is preferably 80~83 DEG C, more preferably 81~82 DEG C, described
The temperature of water increases the solubility of material and plays certain disinfection at the same time；The feed liquid cooling containing mannitol
Degree is preferably to be cooled to 50~52 DEG C.
In the present invention, the oligopeptides -1 is preferably solved in purified water, is reused after obtaining the solution of oligopeptides -1, the purified water
Amount be essence element in purify water inventory 2~5%.In the present invention, the oligopeptides -2 is preferably solved in purified water, obtains widow
Reused after the solution of peptide -2, the amount of the purified water is that the 2~5% of water inventory is purified in essence element.In the present invention, the widow
Peptide -3 is preferably solved in purified water, is reused after obtaining the solution of oligopeptides -3, and the amount of the purified water is to purify water inventory in essence element
2~5%.In the present invention, the oligopeptides -5 is preferably solved in purified water, is reused after obtaining the solution of oligopeptides -5, the purifying
The amount of water is that the 2~5% of water inventory is purified in essence element.In the present invention, the hexapeptide -3 is preferably solved in purified water, obtains six
Reused after the solution of peptide -3, the amount of the purified water is that the 5~10% of water inventory is purified in essence element.
After the present invention preferably cools down the mixed liquor, with the solution of oligopeptides -1, the solution of oligopeptides -2, the solution of oligopeptides -3, widow
After the solution of peptide -5, the solution of hexapeptide -3 and thymic extract mixing, essence element is obtained.In the present invention, the mixed liquor cooling
Degree be preferably 42~45 DEG C, more preferably 43~44 DEG C, the temperature of the mixture while solubility increase, guarantee
The activity and effect of active material.The present invention to the mixed liquor and the solution of oligopeptides -1, the solution of oligopeptides -2, the solution of oligopeptides -3,
The solution of oligopeptides -5, the solution of hexapeptide -3, the mode of thymic extract mixing are preferably by the way of stirring, and the present invention is to the stirring
Condition be not particularly limited, using the condition of those skilled in the art's convention stir.
The present invention is preferably to the application method of essence element：By essence element drop in striae of pregnancy position, with ultrasound
Introducing apparatus imports essence 10~15min of element, and after importing, the element massage of remaining essence is absorbed.In the present invention, the essence element
Usage amount be preferably 1~5ml, more preferably 2~4ml, be most preferably 3ml.
With reference to the embodiment of the present invention, the technical solution in the present invention is clearly and completely described.Based on this
Embodiment in invention, all other reality that those of ordinary skill in the art are obtained without making creative work
Example is applied, belongs to the scope of protection of the invention.
Embodiment 1
In terms of essence element total amount, oligopeptides -10.1g, oligopeptides -20.1g, oligopeptides -30.01g, oligopeptides -50.01g, hexapeptide -
32g, thymic extract 1g, glycerine 5g, 1,2- pentanediol 0.01g, 1,2- hexylene glycol 0.01g, beta glucan 0.03g, polyglutamic
Sour sodium 0.1g, Sodium Hyaluronate 0.05g, mannitol 0.2g, Chondrus crispus powder 0.2g, purified water 91.18g.
The preparation method of essence element：
Oligopeptides -1 is dissolved in the purified water of 2g, the solution of oligopeptides -1 is obtained, oligopeptides -2 is dissolved in the purified water of 2g, obtain widow
The solution of peptide -2, oligopeptides -3 is dissolved in the purified water of 2g, obtains the solution of oligopeptides -3, and oligopeptides -5 is dissolved in the purified water of 2g, is obtained
The solution of oligopeptides -5, hexapeptide -3 is dissolved in the purified water of 10g, obtains the solution of hexapeptide -3；
73.18g purified waters are heated to 88 DEG C, insulated and stirred 20min, then purified water is cooled to 80 DEG C, by purified water
Mix, stirred to completely molten with glycerine, mannitol, 1,2- pentanediols, 1,2- hexylene glycols, polyglutamic acid sodium and Sodium Hyaluronate
Solution, obtains mixed liquor, mixed liquor is cooled to 50 DEG C, mixes, the mixing of Chondrus crispus powder, is stirred to complete with beta glucan
Fully dissolved, obtains the mixed liquor containing Chondrus crispus powder, after the mixed liquor containing Chondrus crispus powder is cooled to 42 DEG C, with
The solution of oligopeptides -1, the solution of oligopeptides -2, the solution of oligopeptides -3, the solution of oligopeptides -5, the solution of hexapeptide -3, thymic extract mixing, stirring is extremely
It is completely dissolved, obtains essence element.
Embodiment 2
In terms of essence element total amount, oligopeptides -12kg, oligopeptides -22kg, oligopeptides -31.5kg, oligopeptides -51.5kg, hexapeptide -32kg,
Thymic extract 1.8kg, glycerine 15kg, 1,2- pentanediol 0.03kg, 1,2- hexylene glycol 0.05kg, Sodium Hyaluronate 0.2kg, β-
Glucan 0.2kg, polyglutamic acid sodium 0.6kg, mannitol 1.0kg, Chondrus crispus powder 1.0kg, purified water 71.12kg.
The preparation method of essence element：
Oligopeptides -1 is dissolved in the purified water of 5kg, the solution of oligopeptides -1 is obtained, oligopeptides -2 is dissolved in the purified water of 5kg, obtain
The solution of oligopeptides -2, oligopeptides -3 is dissolved in the purified water of 4kg, obtains the solution of oligopeptides -3, and oligopeptides -5 is dissolved in the purified water of 4kg,
The solution of oligopeptides -5 is obtained, hexapeptide -3 is dissolved in the purified water of 5kg, obtains the solution of hexapeptide -3；
48.12kg purified waters are heated to 95 DEG C, insulated and stirred 30min, then purified water is cooled to 83 DEG C, by purified water
Mix, stirred to completely molten with glycerine, mannitol, 1,2- pentanediols, 1,2- hexylene glycols, polyglutamic acid sodium and Sodium Hyaluronate
Solution, obtains mixed liquor, mixed liquor is cooled to 52 DEG C, mixes, the mixing of Chondrus crispus powder, is stirred to complete with beta glucan
Fully dissolved, obtains the mixed liquor containing Chondrus crispus powder, after the mixed liquor containing Chondrus crispus powder is cooled to 45 DEG C, with
The solution of oligopeptides -1, the solution of oligopeptides -2, the solution of oligopeptides -3, the solution of oligopeptides -5, the solution of hexapeptide -3, thymic extract mixing, stirring is extremely
It is completely dissolved, obtains essence element.
Embodiment 3
In terms of essence element total amount, oligopeptides -11.5kg, oligopeptides -21.5kg, oligopeptides -31.0kg, oligopeptides -51.0kg, hexapeptide -
31.5kg, thymic extract 1.2kg, glycerine 8kg, 1,2- pentanediol 0.02kg, 1,2- hexylene glycol 0.03kg, Sodium Hyaluronate
0.15kg, beta glucan 0.15kg, polyglutamic acid sodium 0.4kg, mannitol 0.8kg, Chondrus crispus powder 0.8kg, purified water
81.95kg。
The preparation method of essence element：
Oligopeptides -1 is dissolved in the purified water of 5kg, the solution of oligopeptides -1 is obtained, oligopeptides -2 is dissolved in the purified water of 5kg, obtain
The solution of oligopeptides -2, oligopeptides -3 is dissolved in the purified water of 4kg, obtains the solution of oligopeptides -3, and oligopeptides -5 is dissolved in the purified water of 4kg,
The solution of oligopeptides -5 is obtained, hexapeptide -3 is dissolved in the purified water of 5kg, obtains the solution of hexapeptide -3；
58.95kg purified waters are heated to 90 DEG C, insulated and stirred 25min, then purified water is cooled to 83 DEG C, by purified water
Mix, stirred to completely molten with glycerine, mannitol, 1,2- pentanediols, 1,2- hexylene glycols, polyglutamic acid sodium and Sodium Hyaluronate
Solution, obtains mixed liquor, mixed liquor is cooled to 50 DEG C, mixes, the mixing of Chondrus crispus powder, is stirred to complete with beta glucan
Fully dissolved, obtains the mixed liquor containing Chondrus crispus powder, after the mixed liquor containing Chondrus crispus powder is cooled to 45 DEG C, with
The solution of oligopeptides -1, the solution of oligopeptides -2, the solution of oligopeptides -3, the solution of oligopeptides -5, the solution of hexapeptide -3, thymic extract mixing, stirring is extremely
It is completely dissolved, obtains essence element.
Embodiment 4
The essence element that embodiment 1~3 is prepared carries out clinical efficacy test, to evaluate the reparation striae of pregnancy of essence element
The effect of.
Choose 100 striae of pregnancy patients (other health indexes are normal), the age at 24-38 Sui, selected subject
Belly is divided into two regions using ventrimeson as boundary, choose wherein side by random principle uses position as product, separately
Side is as blank control position.Striae of pregnancy at fresh and similar the order of severity one is chosen per side to be marked, and is carried out pregnant
Line of being pregnent repairs clinical judge.Product carries out weekly first-order factor importing using position, is used continuously 8 weeks, blank control position is not
Make any processing.After the course for the treatment of, obtained essence element using effect feedback in interview evaluation above-described embodiment.
In use, it is clean with warm water to repair position (striae of pregnancy position)；
Essence element 3ml produced by the present invention, which is dripped to, again need to repair position, and uniform smear is opened；
With ultrasonic introducing apparatus import operation 10-15 minutes (according to striae of pregnancy lines, slowly upwards, laterally, vertical row
Walk, serious position can stop 3-5 seconds and be further continued for walking, and so operate repeatedly)；After the factor imports, by remaining essence element
It is massaged into it to fully absorb, the results are shown in Table 1.
Striae of pregnancy repairing effect criterion
(1) it is effective：Abdominal pregnancy line disappears or is obviously improved, and belly relaxation dermostenosis, skin elasticity recovers substantially；
(2) effectively:Abdominal pregnancy line improves, and belly relaxation skin makes moderate progress, and skin elasticity has a certain recovery；
(3) it is invalid:Striae of pregnancy improves unobvious, and belly relaxes skin substantially without improvement.
Efficient=(effective+effectively)/nx100%.
1 essence of table element repairs striae of pregnancy result
It can be drawn according to table 1, striae of pregnancy reparation effective percentage reaches 98%, and lasting use, contributes to lifting skin whole
The tolerance of body, the metabolism of accelerated ageing cell, the ecosystem for improving skin microcirculation, reducing skin health, presentation health,
Compact, lubricate texture, so as to achieve the purpose that to repair striae of pregnancy.
Comparative example 1
Carry out clinical efficacy test to the essence element product of the prior art, the component that the essence element product of the prior art contains
There are tetrapeptide -30, antibacterial peptide, decapeptide -12, olive oil, glycerine, propane diols, laureth -23, shea butter, lipoic acid, two
Methylaminoethanol sodium tartrate, allantoin, Phenoxyethanol, triethanolamine.Clinical trial condition is：Choose 50 striae of pregnancy patients
(other health indexes are normal), the age, belly was divided into two by selected subject using ventrimeson as boundary at 24-38 Sui
Region, chooses wherein side by random principle and uses position as product, opposite side is as blank control position.Selected per side
Take striae of pregnancy at fresh and similar the order of severity one to be marked, carry out striae of pregnancy and repair clinical judge.Product uses position
First-order factor importing is carried out weekly, is used continuously 8 weeks, any processing is not made at blank control position.After the course for the treatment of, interview evaluation
Obtained essence element using effect feedback in above-described embodiment.
In use, it is clean with warm water to repair position (striae of pregnancy position)；
Existing essence element product 3ml, which will be dripped to, again need to repair position, and uniform smear is opened；
With ultrasonic introducing apparatus import operation 10-15 minutes (according to striae of pregnancy lines, slowly upwards, laterally, vertical row
Walk, serious position can stop 3-5 seconds and be further continued for walking, and so operate repeatedly)；After the factor imports, by remaining existing cyanines
Magnificent element product is massaged into it and fully absorbs, and the results are shown in Table 2.
The existing essence element product of table 2 repairs striae of pregnancy result
It can be drawn according to table 2, it is 26% that existing essence element product, which is repaired striae of pregnancy efficient,.
As seen from the above embodiment, essence element reaches striae of pregnancy reparation effective percentage 98%, and lasting use, helps to carry
The tolerance of skin entirety is risen, the metabolism of accelerated ageing cell, improve skin microcirculation, the ecosystem of reduction skin health,
Health is presented, compacts, lubricate texture, so as to achieve the purpose that to repair striae of pregnancy.Compared with comparative example, essence provided by the invention
Element improves 72% to the effective percentage of striae of pregnancy reparation.
The above is only the preferred embodiment of the present invention, it is noted that for the ordinary skill people of the art
For member, various improvements and modifications may be made without departing from the principle of the present invention, these improvements and modifications also should
It is considered as protection scope of the present invention.
Sequence table
<110>Biological Co., Ltd is ground by China of Shenzhen
Shenzhen Research Institute of Tsinghua University
<120>A kind of essence element and preparation method thereof
<160> 5
<170> SIPOSequenceListing 1.0
<210> 1
<211> 53
<212> PRT
<213>Artificial sequence (Artificial Sequence)
<400> 1
Asn Ser Asp Ser Glu Cys Pro Leu Ser His Asp Gly Tyr Cys Leu His
1 5 10 15
Asp Gly Val Cys Met Tyr Ile Glu Ala Leu Asp Lys Tyr Ala Cys Asn
20 25 30
Cys Val Val Gly Tyr Ile Gly Glu Arg Cys Gln Tyr Arg Asp Leu Lys
35 40 45
Trp Trp Glu Leu Arg
50
<210> 2
<211> 70
<212> PRT
<213>Artificial sequence (Artificial Sequence)
<400> 2
Gly Pro Glu Thr Leu Cys Gly Ala Glu Leu Val Asp Ala Leu Gln Phe
1 5 10 15
Val Cys Gly Asp Arg Gly Phe Tyr Phe Asn Lys Pro Thr Gly Tyr Gly
20 25 30
Ser Ser Ser Arg Arg Ala Pro Gln Thr Gly Ile Val Asp Glu Cys Cys
35 40 45
Phe Arg Ser Cys Asp Leu Arg Arg Leu Glu Met Tyr Cys Ala Pro Leu
50 55 60
Lys Pro Ala Lys Ser Ala
65 70
<210> 3
<211> 147
<212> PRT
<213>Artificial sequence (Artificial Sequence)
<400> 3
Met Pro Ala Leu Pro Glu Asp Gly Gly Ser Gly Ala Phe Pro Pro Gly
1 5 10 15
Phe Phe Lys Asp Pro Lys Arg Leu Tyr Cys Lys Asn Gly Gly Phe Phe
20 25 30
Leu Arg Ile His Pro Asp Gly Arg Val Asp Gly Val Arg Glu Lys Ser
35 40 45
Asp Pro His Ile Lys Leu Gln Leu Gln Ala Glu Glu Arg Gly Val Val
50 55 60
Ser Ile Lys Gly Val Cys Ala Asn Arg Tyr Leu Ala Met Lys Glu Asp
65 70 75 80
Gly Arg Leu Leu Ala Ser Lys Cys Val Thr Asp Glu Cys Phe Phe Phe
85 90 95
Glu Arg Leu Glu Ser Asn Asn Tyr Asn Thr Tyr Arg Ser Arg Lys Tyr
100 105 110
Thr Ser Trp Tyr Val Ala Leu Lys Arg Thr Gly Gln Tyr Lys Leu Gly
115 120 125
Ser Lys Thr Gly Pro Gly Gln Lys Ala Ile Leu Phe Leu Pro Met Ser
130 135 140
Ala Lys Ser
145
<210> 4
<211> 169
<212> PRT
<213>Artificial sequence (Artificial Sequence)
<400> 4
Leu Gly Gln Asp Met Val Ser Pro Glu Ala Thr Asn Ser Ser Ser Ser
1 5 10 15
Ser Phe Ser Ser Pro Ser Ser Ala Gly Arg His Val Arg Ser Tyr Asn
20 25 30
His Leu Gln Gly Asp Val Arg Trp Arg Lys Leu Phe Ser Phe Thr Lys
35 40 45
Tyr Phe Leu Lys Ile Glu Lys Asn Gly Lys Val Ser Gly Thr Lys Lys
50 55 60
Glu Asn Cys Pro Tyr Ser Ile Leu Glu Ile Thr Ser Val Glu Ile Gly
65 70 75 80
Val Val Ala Val Lys Ala Ile Asn Ser Asn Tyr Tyr Leu Ala Met Asn
85 90 95
Lys Lys Gly Lys Leu Tyr Gly Ser Lys Glu Phe Asn Asn Asp Cys Lys
100 105 110
Leu Lys Glu Arg Ile Glu Glu Asn Gly Tyr Asn Thr Tyr Ala Ser Phe
115 120 125
Asn Trp Gln His Asn Gly Arg Gln Met Tyr Val Ala Leu Asn Gly Lys
130 135 140
Gly Ala Pro Arg Arg Gly Gln Lys Thr Arg Arg Lys Asn Thr Ser Ala
145 150 155 160
His Phe Leu Pro Met Val Val His Ser
165
<210> 5
<211> 8
<212> PRT
<213>Artificial sequence (Artificial Sequence)
<400> 5
Ala Gly Gly Met Gly Ala Ala Asn
1 5
Claims (6)
1. a kind of essence element, is prepared by the raw material including following weight percent composition：
The amino acid sequence of the oligopeptides -1 is as shown in SEQ ID No.1, the amino acid sequence such as SEQ ID of the oligopeptides -2
Shown in No.2, the amino acid sequence of the oligopeptides -3 is as shown in SEQ ID No.3, the amino acid sequence such as SEQ of the oligopeptides -5
Shown in ID No.4, the amino acid sequence of the hexapeptide -3 is as shown in SEQ ID No.5；
The active ingredient of the thymic extract includes thymosin extrasin.
2. essence element according to claim 1, it is characterised in that the moisturizer includes glycerine, 1,2- pentanediols, 1,2-
Hexylene glycol, beta glucan, polyglutamic acid sodium and Sodium Hyaluronate.
3. essence according to claim 2 element, it is characterised in that glycerine and 1, the 2- pentanediol, 1,2- hexylene glycols, saturating
Bright matter acid sodium, beta glucan, the mass ratio of polyglutamic acid sodium are (5~15):(0.01~0.03):(0.01~0.05):(0.05
~0.2):(0.03~0.2):(0.1~0.6).
4. the preparation method of the essence element described in claims 1 to 3 any one, comprises the following steps：
1) after water is mixed with moisturizer, mannitol and Chondrus crispus, mixed liquor is obtained；
2) mixed liquor that the step 1) obtains and oligopeptides -1, oligopeptides -2, oligopeptides -3, oligopeptides -5, hexapeptide -3 and thymus gland are carried
Take thing to mix, obtain essence element.
5. preparation method according to claim 4, it is characterised in that during the step 1) mixing, the temperature of water for 80~
83℃。
6. preparation method according to claim 4, it is characterised in that during the step 2) mixing, the temperature of mixed liquor
For 42~45 DEG C.
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN201711406366.9A CN107982190A (en) | 2017-12-22 | 2017-12-22 | A kind of essence element and preparation method thereof |
Applications Claiming Priority (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN201711406366.9A CN107982190A (en) | 2017-12-22 | 2017-12-22 | A kind of essence element and preparation method thereof |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| CN107982190A true CN107982190A (en) | 2018-05-04 |
Family
ID=62042331
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| CN201711406366.9A Pending CN107982190A (en) | 2017-12-22 | 2017-12-22 | A kind of essence element and preparation method thereof |
Country Status (1)
| Country | Link |
|---|---|
| CN (1) | CN107982190A (en) |
Cited By (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20220373441A1 (en) * | 2021-05-24 | 2022-11-24 | Hyundai Motor Company | Method of predicting lifespan of material |
-
2017
- 2017-12-22 CN CN201711406366.9A patent/CN107982190A/en active Pending
Cited By (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20220373441A1 (en) * | 2021-05-24 | 2022-11-24 | Hyundai Motor Company | Method of predicting lifespan of material |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| KR101678621B1 (en) | Composition comprising spicules for skin care | |
| CN101791283B (en) | Cosmetic capable of eliminating striae gravidarum and scars | |
| CN104856892A (en) | Cosmetic or skin care product preparation rich in growth factors and preparation method therefor | |
| CN104921983A (en) | Medical biological repairing dressing for pregnant woman striae gravidarum and preparation method thereof | |
| CN102085172B (en) | Skin care cosmetic taking American wild yam extract as main component and preparation method thereof | |
| CN111110623A (en) | Self-repairing small needle nutrient solution formula | |
| CN107496325A (en) | Facial mask containing peony essential oil, green cucumber extract solution and snail stoste and preparation method thereof | |
| CN113318058A (en) | Collagen supplement, autologous collagen liquid for radiofrequency cosmetology, and use method and application thereof | |
| CN103948525B (en) | Anti-aging active composition for epidermis | |
| CN108686255A (en) | It is a kind of to prevent the biological dressing and preparation method thereof that scar is formed | |
| CN109745618A (en) | A kind of restorative procedure of striae of pregnancy | |
| CN108030721A (en) | A kind of Essence and preparation method thereof | |
| WO2018000665A1 (en) | Essential liquid for making breasts plump and firm and preventing breast diseases | |
| CN110478306A (en) | Facial mask of the culture supernatant containing placenta mesenchyma stem cell and preparation method thereof | |
| CN109431854A (en) | A kind of bFGF acne hole maintenance freeze-dried powder preparation and preparation method thereof | |
| CN108743921A (en) | It is a kind of to prevent the reparation liquid and its preparation method and application that scar is formed | |
| CN107929112A (en) | A kind of essence and preparation method thereof | |
| CN105902477A (en) | Biological preparation capable of improving eye vitality comprehensively and preparation method thereof | |
| KR20220114509A (en) | Cleansing agent composition and cleanser prepared thereby | |
| CN110585111A (en) | Anti-aging cosmetic additive and preparation method thereof | |
| CN106344435A (en) | Skin protection cream capable of eliminating striae gravidarum | |
| CN107982190A (en) | A kind of essence element and preparation method thereof | |
| CN105106033A (en) | Phycocyanin facial mask and preparation method thereof | |
| CN104983495A (en) | Positive pressure silicon gel elastic scar eliminating band and preparation method thereof | |
| KR20180134468A (en) | Cosmetic compositions comprising spicule, marine collagen and deep ocean water and their preparation |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| PB01 | Publication | ||
| PB01 | Publication | ||
| SE01 | Entry into force of request for substantive examination | ||
| SE01 | Entry into force of request for substantive examination | ||
| RJ01 | Rejection of invention patent application after publication |
Application publication date: 20180504 |
|
| RJ01 | Rejection of invention patent application after publication |