CN101365786B - Plants having improved growth characteristics and methods for making same

Info

Abstract

Description

Claims

CN101365786B

Publication number: CN101365786B
Application number: CN200680052158.7A
Authority: CN
Inventors: V·弗兰卡德; C·勒佐; A·I·桑兹莫林纳罗; C·达曼
Original assignee: CropDesign NV
Current assignee: CropDesign NV
Priority date: 2005-12-01
Filing date: 2006-11-29
Publication date: 2014-03-05
Anticipated expiration: 2026-11-29
Also published as: ZA200805634B; CN101365786A

The present invention relates generally to the field of molecular biology and concerns a method for improving various plant growth characteristics by modulating expression in a plant of a nucleic acid encoding a GRP (Growth-Related Protein). The present invention also concerns plants having modulated expression of a nucleic acid encoding a GRP, which plants have improved growth characteristics relative to corresponding wild type plants or other control plants. The invention also provides constructs useful in the methods of the invention. The GRP may be one of the following: Seed Yield Regulator (SYR), FG-GAP1 CYP90B, CDC27, AT-hook transcription factors, DOF transcription factors and Cyclin Dependent Kinase Inhibitors (CKIs).

Plant and the production method thereof with the growth characteristics of improvement

Technical field

Relate generally to biology field of the present invention and relating to by regulating the expression of the nucleic acid of coding GRP (growth associated protein) to improve the method for various plants growth characteristics in plant.The plant that the invention still further relates to the GRP coding nucleic acid expression with adjusting, this plant is compared the growth characteristics with improvement with corresponding wild-type plant or other control plants.The present invention also provides the construct for method of the present invention.

Background technology

In view of world population constantly increases, obtainablely for agriculture land area, constantly reduce, the diversity that improves farm efficiency and increase gardening plant remains the major objective of research.Ordinary method utilization for farm crop and gardening plant improvement selects breeding technique to identify the plant with desired characteristic.Yet, this type of selects breeding technique to have several shortcomings, be that these technology are normally labor-intensive and cause producing the plant conventionally comprise heterogeneous hereditary fill-in, described heterogeneous hereditary fill-in may always not cause transmitting from mother plant the proterties of expectation.Molecular biological progress has made the mankind can operate the idioplasm (germplasm) of animal and plant.The genetically engineered of plant needs separated and operates genetic material (form with DNA or RNA exists conventionally) and subsequently genetic material imported to plant.Such technology has caused producing the plant of economy, agronomy or the Horticultural Characters with various improvement.The proterties with special economic implications is for example high yield of growth characteristics.Output is normally defined the production of measurable tool economic worth from farm crop.This can define aspect quantity and/or quality.Output directly depends on several factors, for example the number of organ and size, plant structure (for example, the number of branch), seed production etc.The growth of root, dietetic alimentation and stress tolerance/resistance (stresstolerance/resistance) can be also the important factors of determine output.

Seed production is the proterties of particularly important, because the seed of many plants is very important for the nutrition of humans and animals.No matter consumption by direct seed itself or by being based upon the consumption of the meat product on the seed of processing, farm crop for example corn, rice, wheat, canola and soybean have occupied the over half of total people's energy intake.They are the source of the meta-bolites for industrial processes of sugar, oil and numerous species still.Seed comprise embryo (new bud and the source of root) and endosperm (sprout and the early growth of seedling in for the source of nutrition of embryonic development).The growth of seed involves many genes, and meta-bolites need to be transferred to the seed of growth from root, leaf and stem.Endosperm, the metabolic precursor thereof that can assimilate especially carbohydrate, oil and protein, is synthesized storage macromole filling seed.

Another important character of many farm crop is early growth gesture (early vigour).In temperate zone and tropical rice growing kind, improve the free-revving engine that early growth gesture is the modern rice procedure of breeding.It is very important that long root for the suitable soil anchor of water direct seeding rice.When rice directly being sowed into flood field (flooded field) and when plant must be emerged the water surface fast, longer stem will be associated with growth potential.When carrying out bar sowing time, longer mesocotyl and coleoptile are particularly importants for good coming up.Early growth gesture also can be caused by the plant adaptability increasing, and the increase of described plant adaptability can be owing to plant for example to the better adaptation of its environment (more can tackle various abiotic or biological Stress Factors).The plant with early growth gesture also shows the neat seedling of better crop (establishment of the crop), and (farm crop grow in the mode of homogeneous more, be that majority of plant reaches each stage of growth in the substantially the same time), and show better growth and common higher output.

An important character is the abiotic stress patience improving again.Abiotic stress is the major cause of world wide crop loss, and it makes the mean yield of most of staple crops plant subtract (people such as Wang, Planta (2003) 218:1-14) more than 50%.Abiotic stress can be caused by arid, salinity, extreme temperature, chemical toxicity and oxidative stress.For worldwide peasant, the ability that improves Plant Tolerance abiotic stress has huge economic advantages, and it makes can be under disadvantageous condition and regional culture farm crop that originally may not crop culture.

Therefore can be by one in the above-mentioned factor of optimization because usually increasing crop yield.

Depend on end-use, the improvement of some yield traits may be better than the improvement of other proterties.Such as for application such as feed or timber production or biofuel source, may expect to increase the leaf part of plant, for application such as flour, starch or oil production, the increase of planting subparameter may be special expectation.Even, in kind of subparameter, depend on purposes, some parameters can be better than other parameters.Different mechanism can be facilitated the seed production of increase---and no matter its form for the seed size of increase is still the form of the number seeds of increase.

A method that increases (seed) output in plant can be the intrinsic growth mechanism that changes plant.Such mechanism is the cell cycle.

Have now found that can be by regulating the GRP (growth associated protein) in coded plant the expression of nucleic acid in plant improve the various growth characteristics of plant.GRP can be one of following: seed production conditioning agent (Seed Yield Regulator) (SYR), FG-GAP, CYP90B, CDC27, AT hook transcription factor (AT-hook transcription factars), DOF transcription factor and cell cycle protein dependent kinase inhibitor (CKI).

Background

seed production conditioning agent (SYR)

Existence increases the lasting needs of gene to finding new seed production, used so far for example except other strategies, by controlling hormone levels (WO 03/050287), by manipulation cell cycle (WO 2005/061702), the several method being undertaken by controlling the gene (WO2004/058980) of participation salt stress reaction.

SYR is the new albumen not characterized yet so far.SYR shows certain homology (sequence identity of about 48% on DNA level to being called Arabidopsis plant (Arabidopsis) albumen of ARGOS, about 45% sequence identity on protein level) (the people such as Hu, Plant Cell15,1951-1961,2003; US 2005/0108793).The people such as Hu infer ARGOS to be the albumen of tool unique function and to be encoded by individual gene.In Arabidopsis, to cross the main phenotype of expression be blooming of the Leaf biomass that increases and delay to ARGOS.

FG-GAP

FG-GAP albumen is the transmembrane protein of supposition.It is characterized in that the existence of the existence of one or more FG-GAP structural domain (Pfam accession number PF01839) and the N-terminal signal peptide of protein and the membrane spaning domain in C-terminal half part.

Such protein D EX1 separation is from Arabidopsis plant and work during pollen development according to reports (the people Plant Physiol.127 such as Paxson-Sowders, 1739-1749,2001).Dex1 mutant plant is presented in pollen wall pattern formation (pattern formation) has defect.DEX1 genes encoding is positioned to 896 amino acid whose albumen of plasma membrane through prediction, wherein residue 1 to 860 is positioned at cell outside, and residue 880 to 895 is positioned at the tenuigenin side of film, and residue 861 to 879 is potential membrane spaning domain.12 potential N glycosylation sites are present in DEX1.Therefore, this protein have by severe, modified and with the various ingredients of cell walls is interactional may.DEX1 shows the maximal sequence similarity to the hemolysin sample albumen from vibrio cholerae (V.cholerae), yet about 200 amino acid whose fragments (amino acid 439-643) of DEX1 also show the limited similarity to the calcium binding domains of alpha-6 integrin.In this region, have the calcium binding partner of at least 2 group supposition, it is also present in the Arabidopsis calmodulin (AC009853) of prediction.Therefore, to seem may be calcium binding protein to DEX1.DEX1 is the vegetable-protein of uniqueness seemingly; In bacterium, fungi or animal, there is not homologue.

By the structure of the DEX1 of the change of observing and prediction, formed several suppositions (people such as Paxson-Sowders, 2001) of the effect in pollen wall forms about this albumen in dex1 plant:

(a) DEX1 may be linker albumen.It can be combined with sporule film and participate in prototheca (primexine) or sporopollenin (sporopollenin) are attached to plasma membrane.Sporule surface lacks the structural modification that this albumen can cause prototheca.Many potential N glycosylation sites were consistent with DEX1 and callose wall, intine or both adhering to.

(b) DEX1 may be the component of prototheca matrix and may in the initial polymerization of prototheca, work.Ca ^{+ 2}the change of ionic concn seems synthetic extremely important to pollen wall; Beta-glucan synthase is subject to the Ca of micro-molar concentration in callose wall forming process ^{+ 2}activation.

(c) DEX1 may be the part of asperities ER and the processing that participates in prototheca precursor and/or to the transportation of film.Conforming to the overall shortage of prototheca precursor with overall change appears in the delay of prototheca.Prototheca matrix is comprised of polysaccharide, protein and Mierocrystalline cellulose at first, is then incorporated to the material that has more resistance.Therefore, DEX1 may participate in formation or the transportation of many different componentss.

CYP90R

Brassinosteroids (BR) is that a class is for the very important plant hormone of Promoting plant growth, division and growth.Term BR totally refers to the polyhydroxylated steroid derivatives of the natural generation of kind more than 40, and it has the structural similarity with animal steroid hormone.In these plant hormones, brassinolide shows tool biologic activity (about summary, Clouse (2002) Brassinosteroids.TheArabidopsis Book:1-23).

Used biological chemistry and mutation analysis to illustrate BR biosynthetic pathway.BR is by least two branch's bio-chemical pathways that start from identical initial precursor campesterol synthetic people (1997) Physiol Plant 100:710-715 such as () Fujioka.Found the most of Codocyte pigment of found BR biosynthesis gene p450 monooxygenases (CYP) (Bishop and Yokota (2001) Plant CellPhysiol 42:114-120).The oxidation of the many chemical substances of CYP enzyme superfamily catalysis, herein, the essential oxidizing reaction in catalysis BR biosynthesizing more specifically.The intermediate product campestanol that a step in the important step of having identified is hydroxylation BR and the steroid side chain of 6-oxo campestanol, thus 6-deoxidation formed respectively for cathasterone and cathasterone.These two parallel oxidation steps are always also referred to as early stage steroid C-22 α-hydroxylation step people (1998) Plant Cell 10:231-243 such as () Choe.In Arabidopsis, specific CYP enzyme CYP90B1 or DWF4 carry out this step (the general reference about plant CYP nomenclature is shown in, the people such as Nelson (2004) PlantPhys 135:756-772).

Owing to inserting T-DNA in DWF4 locus and lack the arabidopsis mutant type plant of steroid 22 α hydroxylase activities, show owing to lacking the dwarfing phenotype that cell elongation causes people (1998) Plant Cell 10:231-243 such as () Choe.The biological chemistry of using BR biosynthesizing intermediate product to carry out is fed and be studies show that, all downstreams compound has all been saved this phenotype, and known precursor can not.

Using cauliflower mosaic virus 35 S promoter to produce dystopy crosses and expresses the transgenic arabidopsis of Arabidopis thaliana DWF4 genomic fragment and tobacco plant (being both dicotyledons) (people (2001) the Plant J 26 (6) such as Choe: 573-582).Plant height, the sum of branch and the sum of seed when the phenotypic characteristic of plant shows hypocotyl length, maturation are compared with control plant, in transgenic plant, are increased.The people such as Choe find that the seed production increasing has the more seed of more number owing to every strain plant, in the scope that is increased in standard deviation of seed size.In WO00/47715, further describe these experiments.

Patent US 6,545, and 200 relate to the nucleic acid fragment of coding sterol biosynthesis gene, and more specifically claimed coding has C-8, the nucleotide sequence of the polypeptide of 7 sterol isomerase activities.The partial nucleotide sequence of encoding D WF4 is disclosed.

US 2004/0060079 relates to the monocotyledonous method of improvement with anticipant character that produces.Provide and wherein the nucleotide sequence (being called OsDWF4 or CYP90B2) of coding rice DWF4 has been placed in to the example under constitutive promoter (rice actin promoter) control.In the transgenosis rice of 36 strains expression chimeric construct bodies, there are 14 strains to show, compare every fringe Number of kernels of increase with non-transformed control plant.Described in contriver, the output increase of comparing transgenic plant with wild-type is that the overall number increase due to seed causes, because do not find significant difference on " 10 weights ".

CDC27

Depend on final purposes, the improvement of some yield traits can be better than other proterties.For example for application examples, produce as feed or timber, or biofuel source, the increase of leaf part may expect, and for application examples, as the production of flour, starch or oil, the increase of planting subparameter may be to expect especially.Even, in kind of subparameter, depend on purposes, some parameters can be better than other parameters.Different mechanism can promote to increase seed production---its form with the seed size that increases or with the form of the number seeds that increases no matter.Such mechanism is the cell cycle.

By the cell cycle develop g and D for all multicellular organisms be essence and for cell proliferation, be vital.The main ingredient of cell cycle is high conservative in yeast, Mammals and plant.Cell cycle is divided into following period in succession: G0-G1-S-G2-M conventionally.DNA replication dna or synthetic conventionally in S phase (" S " represents that DNA is synthetic) generation, chromosomal mitotic division is separated in M phase (" M " represents mitotic division) generation, be inserted with interval (gap phase) therebetween, G1 (phase of cell growth before DNA replication dna) and G2 (after DNA replication dna, cell is prepared the period of division).After division of cytoplasm (final step of M phase), complete cell fission.Exited the cell cycle and become static cell and be regarded as the phase in G0.Can stimulate cell in this phase to reenter the cell cycle in the G1 phase." G " representative " interval " in G1, G2 and G0.Completing of cell cycle progression makes daughter cell can accept the complete copy of parental gene group in fission process.

Cell fission is subject to two main cell cycle events, and the synthetic initial sum of DNA is mitotic initial, control.To the conversion of each event in these critical events, be subject to each time the control of the specified protein mixture (participating in DNA replication dna and division) as restriction point (checkpoint).In Mammals and vegetable cell, on G1/S border, the expression of the synthetic necessary gene of DNA is subject to regulation and control (La Thangue, 1994 of transcription factor E2F family; The people such as Muller, 2001; The people such as De Veylder, 2002).Cell cycle enter by E2F/Rb mixture to regulate and control/trigger, described E2F/Rb mixture integrated signal also makes it possible to transcribing of activating cells cycle genes.Conversion between the different times of cell cycle, and the development of passing through thus the cell cycle, forming and activating and drive by different different dimerization serine/threonine protein kitase (being commonly referred to cell cycle protein dependent kinase (CDK)).The precondition of these kinase whose activity is and the physical bond of specific cells cyclin, activates the expression that the time occurring depends primarily on cyclin.The combination of cyclin is held the conformational change of leaf by the N of the CDK of induction combination and is promoted location and the substrate specificity of mixture.As monomer CDK, it is activated when cyclin is combined, thereby has kinase activity.The level of cyclin fluctuates in the cell cycle, from but determine that CDK activates the principal element of time of origin.In cell cycle process, the periodicity of these mixtures that comprise cyclin and CDK activates the Timing that has mediated cell cycle conversion (restriction point).

Existence guarantees that mechanism once only occurs DNA replication dna in the cell cycle.For example, CDC16, CDC23 and CDC27 albumen be called anaphase-promoting complex (anaphase promotingcomplex) (APC) or the part of the high molecular weight component of cell cycle body (referring to Romanowski and Madine, Trends in Cell Biology 6,184-188,1996, with Wuarin and Nurse, Cell 85,785-787 (1996).This mixture in yeast is comprised of at least 8 albumen, PROTEIN C DC16, the CDC23 that comprises TPR-(three tetradecapeptide repeating units) and CDC27 and 5 other subunits (people 1996 such as Peters that are called APC1, APC2, APC4, APC5 and APC7, Science274,1199-1201).Its substrate of APC target, is connected to carry out proteolytic degradation by catalysis ubiqutin molecule and these substrates.APC dependence protein matter hydrolysis be while change in mid-term to the later stage sister strand separated with finally from mitotic division, exit necessary.Later stage inhibitor protein Pds1p and mitotic cell cyclin such as cell periodic protein B be APC substrate (people 1998 such as Ciosk, Cell 93,1067-1076; The people such as Cohen-Fix 1996, Genes Dev 10,3081-3093; The people such as Sudakin 1995, Mol Biol Cell 6,185-198; The people such as Jorgensen 1998, Mol Cell Biol 18,468-476; Townsley and Ruderman 1998, Trends CellBiol 8,238-244).In order to produce the activity of ubiqutin ligase enzyme, at least CDC16, CDC23 and CDC27 need to be phosphorylated in the M phase (Ollendorf and Donoghue 1997, J Biol Chem272,32011-32018).The APC activating is at the whole G1 phase sustainable existence of cell cycle subsequently, thereby prevent the too early appearance of type B cell cyclin, described too early appearance can cause entering uncontrollably the S phase (Irniger and Nasmyth 1997, J Cell Sci 110,1523-1531).In yeast, proved the sudden change of any at least 2 component CDC16 of APC and CDC27 in the middle of all can causing the DNA over-replicate by the M phase (Heichman and Roberts 1996, Cell 85,39-48).Nothing mitotic division and fissional this core DNA replication dna process is subsequently called DNA endoreduplication, and it causes the cell size increasing.

CDC16, CDC23 and CDC27 comprise the (TPR of 34Tai repeating unit; 34 amino acid longs) albumen.The minimum consensus sequence of the suggestion of TPR primitive (motif) is as follows: X ₃-W-X ₂-L-G-X ₂-Y-X ₈-A-X ₃-F-X ₂-A-X ₄-P-X ₂, wherein X be any amino acid (people 1994 such as Lamb, EMBO J 13,4321-4328).Consensus sequence can be shown significant degeneracy, and in non-total residue, has minimum homology or without homology.The hydrophobicity of important seemingly total residue and size but not its identity.In yeast and higher eucaryote, in mitotic division (comprising AC protein ingredient CDC16, CDC23 and CDC27), transcribe, the input of montage, protein and neural (Goebl and the Yanagida 1991 of occurring, Trends Biochem Sci 16, all there is TPR primitive in the multiple protein working in 173-177) therein.TPR forms αhelix; Series connection repeating unit be organized into the superhelix that is ideally suited as protein identification interface (Groves and Barford1999, Curr Opin Struct Biol 9,383-389).In α spiral, conventionally there are 2 amphipathic structural domains, one is positioned at NH ₂end regions, near COOH end regions, (people 1990 such as Sikorski, Cell 60,307-317) for another.

From different bioseparation CDC27 (also referred to as Hobbit; Other titles comprise CDC27, BimA, Nuc2 or makos), described biology comprises Aspergillus nidulans (Aspergillus nidulans), yeast, fruit bat, people and each kind of plant (for example Arabidopis thaliana (Arabidopsis thaliana) and rice (Oryzasativa)).The gene of coding CDC27 is present in most of genomes with single copy, but can for example in Arabidopis thaliana, find 2 copies in identical genome exceptionally.These 2 genes of coding CDC27 albumen are called after CDC27A and CDC27B (being respectively MIPS call number At3g16320 and At2g20000).

Disclosed International Patent Application WO 01/02430 has been described CDC27A (CDC27A1 and CDC27A2) and CDC27B sequence.Also in the document, described wherein from NH ₂end regions has lacked the CDC27B aminoacid sequence of 161 amino acid whose brachymemmas.About being coded in NH ₂the CDC27B gene of the CDC27B polypeptide of end regions brachymemma has been quoted GenBank accession number AC006081 in the document.Reported in literature NH ₂end regions is guarded in the CDC27 of different sources homologue.The CDC27 sequence of mentioning in WO01/02430 is described to can be used for changing endoreduplication.

DNA endoreduplication betides in flowering plant natively, for example, during seed development.DNA endoreduplication causes having the nucleus of expansion of the DNA content of raising.Someone thinks that the DNA content increasing during endoreduplication may provide the genetic expression of increase during endosperm development and Grain Filling, because it conforms to protein accumulation with the upper enzymic activity increasing of this time people such as (, (1992) Genet.Eng.14:65-88) Kowles.In cereal species, cell endosperm by endoreduplication sign period stored seeds reserve.The magnitude of DNA endoreduplication and endosperm fresh weight height correlation, this is implying the vital role of DNA endoreduplication in determining endosperm quality people (2000) Plant Cell Environ.23:657-663 such as () Engelen-Eigles.In corn for example, endosperm accounts for 70 to 90% of seed quality (kernel mass); Therefore, the factor of mediation endosperm development, the mode weighing by simple grain also can be determined the seed production of corn to a great extent.Thereby the endoreduplication of increase is indicated the seed biomass of increase conventionally, but never relevant to the number seeds increasing.

aT hook transcription factor

In belonging to the polypeptide of the transcription factor family relevant to Chromatin Remodeling (Chromatin remodeling), there is AT hook structure territory.AT hook primitive is comprised of about 13 (about 9 sometimes) amino acid, and these amino acid participate in DNA combination and have being rich in the preference in the region of A/T.In Arabidopis thaliana, there are at least 34 albumen that comprise AT hook structure territory.These albumen are enjoyed homology in the major part of sequence, and wherein AT hook structure territory is special high conservative region.

International Patent Application WO 2005/030966 has been described the plant transcription factor in the several AT of comprising hook structures territory and this type of transcription factor for generation of the purposes with the plant of the biomass of increase and the stress tolerance of increase.This application relates to the member of transcription factor G1073 clade, and point out: " use of tissue specificity or inducible promoter can relax and may cross and express relevant less desirable morphology effect (for example, when the size of increase be less desirable time) to G1073 clade member's composing type ".The data that provide in this application relate to dicotyledons.

Contrary with these instructions, have now found that no matter to express by constitutive promoter and drive or drive in tissue specificity mode, containing the polynucleotide of the AT hook transcription factor (it comprises the member of clade G1073) of DUF296 structural domain, the expression in monocotyledons all causes encoded packets, compare with suitable control plant, do not there is hardly or completely the plant that biomass increases.This shows that the relevant instruction of expressing this type of transcription factor in dicotyledons may not be so easily for monocotyledons.Now also find that any of seed production who obtains is increased in degree or depends in nature used tissue-specific promoter.

dOF transcription factor

Dof domain protein is that the DNA binding domains with high conservative (has single C ₂-C ₂zinc refers to) plant idiosyncratic transcription factor.In the past ten years, in unifacial leaf and dicotyledons (comprising corn, barley, wheat, rice, tobacco, Arabidopis thaliana, summer squash, potato and pea), many Dof domain proteins have been identified.Shown that Dof domain protein is used as transcriptional activator in various plants specific biological process or thing is met in resistance.

cell cycle protein dependent kinase inhibitor (CKI)

Increase the ability of plant seed output (no matter being by number seeds, seed biomass, seed development, seed plumpness or any other seed correlated character) in agricultural for example, is produced as the biotechnology of material (medicine, antibody or vaccine) with even many non-agricultural application examples, all there are many purposes.The change that increases the intrinsic growth mechanism that a method of seed production in plant can be by plant realizes.

The intrinsic growth mechanism of plant is to be referred to as the continuous events of the high-sequential of ' cell cycle '.Develop the basis of the g and D that is all multicellular organisms and be vital for the propagation of cell by the cell cycle.The main ingredient of cell cycle is high conservative in yeast, Mammals and plant.Cell cycle is divided into following period in succession: G0-G1-S-G2-M conventionally.DNA replication dna or synthetic conventionally in S phase (" S " represents that DNA is synthetic) generation, chromosomal mitotic division is separated in M phase (" M " represents mitotic division) generation, interval is with interval therebetween, G1 (phase of cell growth before DNA replication dna) and G2 (after DNA replication dna, cell is prepared the period of division).After division of cytoplasm (final step of M phase), complete cell fission.Exit the cell cycle and become static cell and be regarded as the phase in G0.Can stimulate cell in this phase to make it reentering the cell cycle in the G1 phase." G " representative " interval " in G1, G2 and G0.Cell cycle process complete the complete copy that makes each daughter cell can accept parental gene group between cell division phase.

Cell fission is subject to two main cell periodic events, and the synthetic initial sum of DNA is mitotic initial, control.The restriction point (checkpoint) consisting of specified protein mixture (participate in DNA replication dna and division) is being controlled to each conversion of each event in these critical events.In Mammals and vegetable cell, on G1/S border, the expression of the synthetic necessary gene of DNA is subject to regulation and control (La Thangue, 1994 of transcription factor E2F family; The people such as Muller, 2001; The people such as DeVeylder, 2002).Cell cycle enter by E2F/Rb mixture to regulate and control/trigger, described E2F/Rb mixture integrated signal also can be activated transcribing of cell cycle gene.Conversion between the different times of cell cycle, and thus by the progress of cell cycle, forming and activating and drive by different different dimerization serine/threonine protein kitase (being commonly referred to cell cycle protein dependent kinase (CDK)).The precondition of these kinase whose activity is and the physical bond of specific cells cyclin that the time of origin of activation depends primarily on the expression of cyclin.The combination of cyclin is the conformational change of N petiolarea of the CDK of induction combination, thereby facilitates location and the substrate specificity of mixture.As monomer CDK, it is activated when cyclin is combined, thereby has kinase activity.The level of cyclin fluctuates in the cell cycle, from but determine the principal element of the time of origin that CDK activates.The periodicity that comprises these mixtures of cyclin and CDK in cell cycle process activates the Timing that has mediated cell cycle conversion (restriction point).Other factors of regulation and control CDK activity comprise that cell cycle protein dependent kinase inhibitor (CKI or ICK, KIP, CIP, INK), CDK activate kinases (CAK), CDK Phosphoric acid esterase (Cdc25) and CDK subunit (the CKS) (people 1999 such as Mironov; Reed 1996).

According to the experiment of using the endosperm of corn seed infer exist mitotic division CDK inhibitor (Grafi and Larkins (1995) Science 269,1262-1264).After this, at different plant species such as Arabidopis thaliana (people (1997) Nature 386 (6624): the 451-2 such as Wang; People (2001) the Plant Cell 13:1653-1668 such as De Veylder; The people such as Lui (2000) Plant J 21:379-385), tobacco (people (2002) the Plant Physiol 2,002 130 (4) such as Jasinski: 871-82), identified several CKI in red autumnal leaves lamb's-quarters (Chenopodium rubrum) (people (1999) the Plant Phys 120:339 such as Fountain) or corn (corn) (people (2005) the Plant Physiol 138:2323-2336 such as Coelho).The albumen of coding is characterised in that, shows and p21 ^cip1/ p27 ^kip1/ p57 ^kip2aminoterminal cyclin/Cdk binding domains of the animal CKI of type has about 45 carboxyl terminal amino acid fragments of homology.Outside this carboxyl terminal region, plant CKI shows extremely low homology.

In Monsanto Technology LLC disclosed International Patent Application WO 2005/007829 under one's name, the nucleic acid molecule of multiple separation that coding has the polypeptide of cell cycle protein dependent kinase inhibitor activity has been described.

Disclosed International Patent Application WO 02/28893 and WO 99/14331 (both at CropDesign N.V. under one's name) have described different plant cell cycle protein dependent kinase inhibitors.In these applications, mentioned the purposes of these inhibitor for increasing output.

Summary of the invention

The expression that now has been surprisingly found that the nucleic acid that increases the active of SYR albumen and/or coding SYR albumen in plant is compared the plant with the seed production of increase and/or the growth velocity of increase by causing with corresponding wild-type plant.Now also find surprisingly, SYR crossing in rice expressed the main seed production that increases, and Leaf biomass and flowering time are not subject to obvious impact, (the main phenotype of crossing expression with ARGOS in Arabidopis thaliana is contrary, described main phenotype shows the blooming of the Leaf biomass that increases and the delay (people such as Hu, Plant Cell 15,1951-1961,2003; US2005/0108793)).

According to one embodiment of the invention, provide for increasing the seed production of plant and/or the method for growth velocity, the method is included in the expression that increases the nucleic acid of the active of SYR polypeptide or its homologue and/or this proteinoid of increase coding in plant; Optionally selection has the plant of the growth characteristics of improvement.

Advantageously, within relating to the scope of SYR, implement method of the present invention and cause producing such plant, described plant has the growth characteristics of multiple improvement, the seed production for example improving and do not affect the biomass (when comparing with corresponding control plant) of trophicity plant part and the life cycle suitable with corresponding control plant and without the delay of flowering time.More advantageously, the enforcement of the inventive method causes having the plant to the patience of abiotic stress of comparing raising with corresponding wild-type (or other contrast) plant.

The expression that now has been surprisingly found that the nucleic acid that regulates the active of FG-GAP albumen and/or coding FG-GAP albumen in plant can cause generation to compare the growth characteristics with improvement with corresponding wild-type plant, the plant of the output particularly increasing.

According to another embodiment of the invention, provide for improveing the method for the growth characteristics of plant, it is included in the expression of the nucleic acid that regulates the active of FG-GAP polypeptide or its homologue and/or adjusting coding FG-GAP polypeptide or its homologue in plant and optionally selects to have the plant of the growth characteristics of improvement.

Advantageously, within relating to the scope of FG-GAP polypeptide or its homologue, the enforcement of the inventive method causes having the growth characteristics of multiple improvement, the plant of growth, the output of raising, the structure of the biomass of raising, improvement or the cell fission of raising for example improving (each all with wild-type plant accordingly Comparatively speaking).Preferably, the growth characteristics of improvement at least comprises the output of comparing increase with corresponding wild-type plant.

Now have been surprisingly found that the non-constitutive expression that increases the nucleic acid of coding CYP90B polypeptide or its homologue in plant can produce the plant of comparing the output with increase with suitable control plant.

According to an embodiment more of the present invention, the method for increasing plant biomass is provided, the method comprises increases the non-constitutive expression of the nucleic acid of coding CYP90B polypeptide or its homologue in plant.

The expression that has now found that the nucleic acid that preferentially increases coding CDC27 polypeptide in plant shoot apical meristem can produce the plant of comparing the number seeds with increase with suitable control plant, and described CDC27 polypeptide is at the NH of polypeptide ₂end regions has the TPR structural domain of at least one inactivation.

Therefore the method that the invention provides number seeds for increasing plant (comparing with the number seeds of suitable control plant), the method comprises preferentially increases the NH that is coded in polypeptide in plant shoot apical meristem ₂end regions has the expression of nucleic acid of CDC27 polypeptide of the TPR structural domain of at least one inactivation.

Have now found that, preferentially in monocotyledonous endosperm tissue, increase encoded packets and can produce with suitable control plant and compare containing the expression of AT hook structure territory and the nucleic acid of the polypeptide of DUF296 structural domain, there is the plant of the seed production of increase.

Therefore an embodiment more of the present invention provides the method that increases monocotyledonous seed production for comparing with suitable control plant, and the method comprises preferentially increases encoded packets containing the expression of the nucleic acid of the polypeptide of AT hook structure territory and DUF296 structural domain in monocotyledonous endosperm tissue.

Have now found that increasing the expression of the nucleic acid of encoding D OF transcription factor polypeptide in plant can produce the plant of comparing the output with increase with suitable control plant.

According to an embodiment more of the present invention, the method for increasing plant biomass is provided, the method comprises increases the expression of the nucleic acid of encoding D OF transcription factor polypeptide in plant.

Have now found that the preferential expression of endogenous CKI gene in albumen tissue reduces and can produce, the seed production that the plant of preferential minimizing does not occur with the expression of endogenous CKI gene in albumen tissue is wherein compared, and has the plant of higher seed production.Thereby the invention provides for compare the method for the seed production that increases plant with suitable control plant, the method comprises the expression that preferentially reduces endogenous CKI gene in the endosperm tissue of plant.

Detailed Description Of The Invention

The term " output of increase " of definition refers to corresponding wild-type or other control plants and compares herein, the increase of the biomass (weight) of one or more parts of plant (particularly can gather in the crops part), the increase of this biomass can be ground or underground.The increase of underground biomass is attributable to the increase of the biomass of plant part such as stem tuber, rhizome, bulb etc.Particularly preferably be following any one or multinomial increase: the length of the biomass of the root of increase, the volume of the root of increase, the number of the root of increase, the diameter of the root of increase and the root of increase.The output that term increases also comprises the increase of seed production.

The term " seed production of increase " of definition is compared following any one or multinomial increase for representing with corresponding wild-type plant herein: the seed ultimate production (i) increasing, and it comprises that the increase of seed biomass (seed weight) and its can be the increases of every strain plant or the seed weight on single seed basis; (ii) number of the every paniculiform flower (" little Hua ") increasing; (iii) number of the full seed increasing; (iv) seed size increasing; (v) the seed volume increasing; (vi) the single seed area (seed area) increasing; (vii) the single seeded length and/or the width that increase; (viii) harvest index increasing, this exponential representation is for gathering in the crops for example output of the seed ratio to total biomass of part; (ix) the full rate (fill rate) increasing, (its number that is full seed, divided by the overall number of seed, is then multiplied by 100); (x) thousand seed weight (TKW) increasing, wherein calculates described thousand seed weight from number and its gross weight of the full seed of counting.The TKW increasing can be produced by the seed size increasing and/or seed weight.The TKW increasing can be produced by the increase of embryo size and/or endosperm size.

Take corn as example, and the increase of output can show as one or more in following: the increase of the length/diameter of the increase of the number of the fringe of every strain plant, tassel row number, a row grain number, grain weight, TKW, fringe, etc.Take rice as example, and output increase can show as following one or more increase: the number of the paniculiform number of every strain plant, every paniculiform small ear, the number of every paniculiform flower, the increase of the full rate of seed, the increase of TKW, etc.The increase of output also can cause the structure changing, or can occur because of the structure changing.

By implementing the growth characteristics of the improvement that method of the present invention obtains, in the scope of use that relates to CDC27, cause having the plant of the number seeds of increase.The number seeds increasing comprises with suitable control plant to be compared, the increase of the full rate of the increase of the increase of seed overall number and/or full seed number and/or seed (its be multiplied by again 100 divided by the overall number of seed for full seed number), this increase can be the increase of every strain plant and/or the increase of per hectare or acre.Take corn as example, and the increase of number seeds is usually expressed as increase, tassel row number, the row grain increase of number, the increase of the full rate of seed of the spike number of every strain plant, etc.Take rice as example, and the increase of number seeds is usually expressed as the number of the paniculiform number of every strain plant, every paniculiform small ear, the increase of the number of every paniculiform flower (little Hua) (it is expressed as the ratio of full seed number to the number of main panicle (primary panicles)), the increase of the full rate of seed.

Therefore the invention provides the method for comparing the number seeds that increases plant for the number seeds of the control plant with suitable, the method comprises the expression of the nucleic acid that preferentially increases coding CDC27 polypeptide in plant shoot apical meristem, and described polypeptide is at the NH of polypeptide ₂end regions has the TPR structural domain of at least one inactivation.

Within method of the present invention relates to the scope of SYR, preferably implement the plant that described method causes producing the seed production with increase.More preferably, the seed production of increase comprise one or more aspects in (full) number seeds, seed gross weight, seed size, thousand seed weight, full rate and harvest index separately with control plant increase Comparatively speaking.Therefore, according to the present invention, provide the method for increasing plant seed output, the method is included in the expression of the nucleic acid of active and/or coding SYR polypeptide or its homologue that increase SYR polypeptide in plant.

Within method of the present invention relates to the scope of FG-GAP, preferably carry out described method and cause producing the output with increase, the plant of the biomass more particularly increasing and/or the seed production of increase.Preferably, the seed production of increase comprise in (full) number seeds, seed gross weight, seed size, thousand seed weight and harvest index one or more separately with control plant increase Comparatively speaking.Therefore, according to the present invention, provide for increasing plant biomass, increased especially the method for biomass and/or increase seed production, the method is included in the expression of the nucleic acid of active and/or coding FG-GAP polypeptide or its homologue that regulate FG-GAP polypeptide in plant.

Within method of the present invention relates to the scope of CYP90B, the output preferably increasing comprises one or more aspects (each aspect is all for suitable control plant) of following aspect: the seed area of the HI of increase, the TKW of increase, increase and the seed length of increase.Therefore, according to the present invention, provide for comparing with suitable control plant, increased the method for plant biomass, particularly seed production, the method is included in the non-constitutive expression that increases the nucleic acid of coding CYP90B polypeptide or its homologue in plant.

Within method of the present invention relates to the scope of AT hook transcription factor, increase the seed production in monocotyledons.Therefore provide for, compare with suitable control plant, increase the method for monocotyledonous seed production, the method comprises preferentially increases encoded packets containing the expression of the nucleic acid of the polypeptide of AT hook structure territory and DUF296 structural domain in monocotyledonous endosperm tissue.

Within method of the present invention relates to the scope of DOF transcription factor, the output preferably increasing is the seed production increasing.According to a preferred feature of the present invention, provide for, compare with the seed production of suitable control plant, increase the method for plant seed output, the method is included in the expression that increases the nucleic acid of encoding D OF transcription factor polypeptide in plant.

Within method of the present invention relates to the scope of CKI, the growth characteristics of improvement is the seed production increasing.Therefore the invention provides for, compare with suitable control plant, increase the method for the seed production of plant, the method comprises the expression that preferentially reduces endogenous CKI gene in the endosperm tissue of plant.

Because the plant of improvement of the present invention has the output (seed production) of increase, therefore these plants may show in (at least part of period of its life cycle), compare the growth velocity of increase with the growth velocity of the corresponding wild-type plant of respective stage in life cycle.The growth velocity increasing can be specific to one or more parts or the cell type (comprising seed) of plant, or can substantially spread all over whole plant.The plant with the growth velocity of increase can have shorter life cycle.The life cycle of plant is used in reference to: from dry mature seed, grow to the needed time in stage that plant produces the dry mature seed that is similar to parent material.This life cycle can be subject to the impact of for example early growth gesture of factor, growth velocity, flowering time and seed maturity speed.The increase of growth velocity can occur in life cycle in one or more stages of life cycle of plant or whole plant substantially.The growth velocity increasing in the plant commitment of life cycle can be reflected as the growth potential of enhancing.The increase of growth velocity can change the harvest cycle of plant, thereby permission plant ratio originally can late sowing kind and/or early harvest.If growth velocity obtains enough increases, it may allow to sow the seed (for example completely sow again after rice plant and gather in the crops rice plant in sowing and results within a conventional vegetative period) of identical plant species again.Similarly, if growth velocity obtains enough increases, it may allow to sow different plant species (for example after sowing and results rice, for example, sow again and optionally gather in the crops soybean, potato or any other suitable plant) again.The in the situation that of some plants, the results of carrying out additional times from identical stock also may be fine.The harvest cycle that changes plant can cause every acre year biomass yield increase (increase of the number of times (in a year) that this can Growth and yield owing to any specific plant).The increase of growth velocity also can allow transgenic plant to cultivate in than the wider geographic area of its wild type counterparts, because the regional limits of crop culture is normally by the adverse environment conditional decision of implantation time (early season) or harvest time (season in evening).If shorten harvest cycle, can avoid these disadvantageous conditions.Can be by determining growth velocity from growth curve (mapping obtains to growth experiment) the various parameters of derivation, this type of parameter can be: T-Mid (plant reaches its maximum sized 50% time spent) and T-90 (plant reaches its maximum sized 90% time spent), etc.Term used herein " flowering time " should refer to that seed germination started to the time period of blooming between starting.

The enforcement of the inventive method has produced the plant of the growth velocity with increase.

Therefore, according to the present invention, provide the method for increasing the growth velocity of plant, the method is included in the expression that increases the nucleic acid of the active of SYR polypeptide or its homologue and/or this albumen of increase coding in plant.

According to the present invention, the method for increasing the growth velocity of plant is provided, the method is included in plant the expression that regulates the active of (preferably increasing) FG-GAP polypeptide or its homologue and/or regulate the nucleic acid of (preferably increasing) this albumen of encoding.

According to the present invention, the method for increasing the growth velocity of plant is provided, the method is included in the non-constitutive expression that increases the nucleic acid of coding CYP90B polypeptide or its homologue in plant.

According to the present invention, the method for increasing the growth velocity of plant is provided, the method is included in the expression that increases the nucleic acid of encoding D OF transcription factor polypeptide in plant.

According to the present invention, provide for, with respect to suitable control plant, increase the method for the growth velocity of plant, the method comprises the expression that preferentially reduces endogenous cell cyclin-dependent kinase inhibitor (CKI) gene in the endosperm tissue of plant.

No matter plant is still exposed to different coercing under non-stress condition, all generation is compared to the increase of output and/or seed production and/or growth velocity with control plant.Plant is conventionally by growing and react to being exposed to coerce more lentamente.Under serious stress conditions, plant even may stop growing completely.On the other hand, slight coerce be defined as herein plant and be exposed to this and coerce after, do not cause plant to stop growing and lose any of ability who regrows and coerce.In the sense of the present invention, slightly coerce and cause the plant of being coerced to be compared with the control plant under non-stress condition, growth reduces less than 40%, 35% or 30%, preferably less than 25%, 20% or 15%, more preferably less than 14%, 13%, 12%, 11% or 10% or lower.Due to the progress of agricultural practice (irrigation, fertilising, pesticide-treated), in the crop plants of cultivation, conventionally can not run into serious coercing.Therefore, by the growth weakening of the slight stress-inducing upper less desirable feature of agricultural normally.Slightly coercing can be that the typical case that plant may touch coerces.These are coerced can be plant contact to biological and/or abiotic (environment) of every day coerce.Typical abiotic or environment-stress comprises that the temperature stress, salt stress, the water that by atypical heat or cold/freezing temperature, are caused coerce that (arid or too much water), anoxic are coerced, chemical toxicity and oxidative stress.Abiotic stress can be by water, to coerce (especially due to arid), salt stress, oxidative stress or ion to coerce the osmotic stress causing.Chemical substance also can cause abiotic stress (for example mineral substance of too high or too low concentration or nutrition).Biology is coerced normally by pathogenic agent coercing of causing of bacterium, virus, fungi and insect for example.Term used herein " non-stress condition " refers to that these envrionment conditionss exceed plant weather condition every day that can run into and permission plant optimum growh and other abiotic conditions indistinctively.Those skilled in the art will understand normal edaphic condition and the weather condition in given geographical position.

Within method of the present invention relates to the scope of SYR, the enforcement of described method causes producing the plant of the abiotic stress resistance with increase.As reported in the people such as Wang (Planta (2003) 218:1-14), abiotic stress causes adversely affecting the growth of plant and a series of morphology of productivity, physiology, biological chemistry and molecule change.Known arid, salinity, extreme temperature and oxidative stress connect each other, and can the infringement to growth and cell by similar mechanism induction.For example, arid and/or salinification main manifestations are osmotic stress, thereby cause the destruction of homeostasis and ion distribution in cell.Oxidative stress is often accompanied by high temperature or low temperature, salinity or drought stress, and it can cause functional and sex change structural protein.As a result of, these different environment-stress activate similar cellular signal transduction pathways and cell response conventionally, and for example the generation of stress protein is, the accumulation of the rise of antioxidant, miscible solute and cessation of growth cessation.

Because different environment-stress can activate similar approach, so the present invention carries out with drought stress illustrates, (using in the scope of SYR polypeptide and its coding nucleic acid the present invention relates to) should do not regarded as and only be confined to drought stress, and more should regard as, reflects that in general manner SYR polypeptide or its homologue participate in a kind of performance of abiotic stress.In addition, also can under non-stress condition or under slight drought condition, implement the inventive method, thereby produce the plant of comparing the growth characteristics (output of increase especially) with improvement with corresponding wild-type or other control plants.

Between drought stress and high-salt stress, there is according to reports " dialogue (crosstalk) " people (2003) Plant Physiol 133:1755-1767 such as () Rabbani of special high level.Therefore, clearly SYR polypeptide or its homologue with and purposes in giving plant arid resistance, can avoid for the protection of plant the infringement of multiple other abiotic stress too.Similarly, clearly SYR albumen (as defined here) and its are given the purposes of salt tolerance in plant, also can avoid for the protection of plant the infringement of multiple other abiotic stress.In addition, the people such as Rabbani (2003, Plant Physiol 133:1755-1767) are reported in and between dicotyledons and monocotyledons, have similar stress resistance and the molecular mechanism of replying.Therefore, method of the present invention advantageously can be used for any plant.

Herein the term " abiotic stress " of definition be used in reference to that water coerces that (because arid or too much water cause), anoxic are coerced, salt stress, temperature stress (because hot, cold or ice-cold temperature causes), chemical toxicity is coerced with oxidative stress in any one or more coerce.According to an aspect of the present invention, abiotic stress is osmotic stress, is selected from that water is coerced, salt stress, oxidative stress and ion coerce.Preferably, to coerce be drought stress to water.Term salt stress is not limited to common salt (NaCl), can also be NaCl, KCl, LiCl, MgCl ₂, CaCl ₂etc. in any one or more salt.

The resistance to abiotic stress increasing finds expression in the plant biomass increasing under abiotic stress condition.In the scope of purposes that the present invention relates to SYR polypeptide and its coding nucleic acid, the output of such increase can comprise one or more following aspects (every aspect all with corresponding wild-type plant Comparatively speaking): the number of every paniculiform flower of the full seed number of increase, the seed ultimate production of increase, increase is, the root of the full rate of the seed of increase, the harvest index of increase, the thousand seed weight of increase, increase is grown or the root diameter of increase.

The enforcement of the inventive method produces the plant of the abiotic stress resistance with increase.When the enforcement of the inventive method has caused growing under non-stress condition or under slight drought condition, compare with the corresponding wild-type plant of growing under comparable condition or other control plants, there is the plant of the growth characteristics (output particularly increasing and/or the gesture of emerging (or early growth gesture) of increase) of improvement.

According to the present invention, the method for increasing the abiotic stress resistance of plant is provided, the method is included in the expression that regulates the nucleic acid of coding SYR polypeptide or its homologue in plant.According to an aspect of the present invention, abiotic stress be selected from that water is coerced, salt stress, oxidative stress and ion one or more the osmotic stress in coercing.Preferably, to coerce be drought stress to water.

The present invention also provides for improving the method for the abiotic stress resistance of plant, and the method is included in the activity that increases SYR albumen or its homologue in plant.

Within method of the present invention relates to the scope of DOF transcription factor, can under slight drought condition, implement present method, to produce the plant of comparing the output with increase with suitable control plant.As reported in the people such as Wang (Planta (2003) 218:1-14), abiotic stress causes adversely affecting a series of morphology, physiology, biological chemistry and the molecule of plant-growth and productivity to change.Known arid, salinity, extreme temperature and oxidative stress be connect each other and can the infringement to growth and cell by the induction of similar mechanism.The people such as Rabbani (Plant Physiol (2003) 133:1755-1767) have described " dialogue " that between drought stress and high-salt stress, there be special high level.For example, arid and/or salinification main manifestations are osmotic stress, thereby cause homeostasis in cell and the destruction of ion distribution.Oxidative stress (being conventionally accompanied by high temperature or low temperature, salinity or drought stress) can cause functional and sex change structural protein.Therefore, these different environment-stress activate similar cellular signal transduction pathways and cell response conventionally, and for example the generation of stress protein is, the accumulation of the rise of antioxidant, miscible solute and cessation of growth cessation.

When the enforcement of the inventive method causes growing under slight drought condition, compare with the suitable control plant of growing under comparable condition, there is the plant of the output of increase.Therefore, according to the present invention, provide the method for increasing the output of growing plants under slight drought condition, the method is included in the expression that increases the nucleic acid of encoding D OF transcription factor polypeptide in plant.

Advantageously can in any plant, improve the growth characteristics of above-mentioned improvement.Within method of the present invention relates to the scope of purposes of AT hook transcription factor, described method can be used for monocotyledons.

Term used herein " plant " comprises the ancestors of complete plant, plant and the part of offspring and plant, comprise seed, branch, stem, leaf, root (comprising stem tuber), flower and tissue and organ, wherein aforementioned each all comprise goal gene/nucleic acid or the genetic modification in goal gene/nucleic acid.Term " plant " also comprises vegetable cell, suspension culture, callus ,Pei, meristem zone, gametophyte, sporophyte, pollen and sporule, same, wherein above-mentioned each all comprise goal gene/nucleic acid.

The plant that is particularly useful for method of the present invention comprises all plants, particularly monocotyledons and the dicotyledons that belongs to vegitabilia (Viridiplantae) superfamily, comprises the feed or the leguminous forage that are selected from following plants, ornamental plant, alimentary crop, tree or shrub: Acer (Acer spp.), Actinidia (Actinidia spp.), Abelmoschus (Abelmoschus spp.), Agropyron (Agropyronspp.), allium (Allium spp.), Amaranthus (Amaranthus spp.), pineapple (Ananascomosus), Anona (Annona spp.), celery (Apium graveolens), Arachis (Arachis spp), Jack-fruit belongs to (Artocarpus spp.), officinalis (Asparagusofficinalis), Avena (Avena spp.) (oat (Avena sativa) for example, wild swallow grass (Avenafatua), than praising oat (Avena byzantina), Avena fatua var.sativa, hybrid oat (Avena hybrida)), carambola (Averrhoa carambola), wax gourd (Benincasahispida), Brazil's chestnut (Bertholletia excelsea), beet (Beta vulgaris), Btassica (Brassica spp) (colea (Brassica napus) for example, overgrown with weeds blue or green (Brassica rapassp.) [canola, oilseed rape (oilseed rape), rape (turnip rape)]), Cadabafarinosa, tea (Camellia sinensis), Canna generalis Bailey (Canna indica), Capsicum (Capsicum spp.), Carex elata, papaya (Carica papaya), Carissa macrocarpa (Carissa macrocarpa), hickory (Carya spp.), safflower (Carthamustinctorius), Castanea (Castanea spp.), cultivation witloof (Cichorium endivia), Cinnamomum (Cinnamomum spp.), watermelon (Citrullus lanatus), Citrus (Citrus spp.), cocoanut (Cocos spp.), Coffea (Coffea spp.), taro (Colocasia esculenta), Cola spp, coriander (Coriandrum sativum), Corylus (Corylus spp.), hawthorn (Crataegus spp.), Stigma Croci (Crocus sativus), Cucurbita (Cucurbita spp.), Cucumis (Cucumis spp.), Lay Cirsium (Cynara spp.), Daucus carota L. (Daucus carota), beggar-ticks (Desmodium spp.), longan (Dimocarpus longan), Wild yam (Dioscorea spp.), Diospyros (Diospyros spp.), Echinochloa (Echinochloa spp.), oil palm belongs to (Elaeis) (oil palm (Elaeis guineensis) for example, America oil palm (Elaeis oleifera)), Finger-millet (Eleusine coracana), loquat (Eriobotrya japonica), haw young (Eugeniauniflora), Fagopyrum (Fagopyrum spp.), Fagus (Fagus spp.), Fructus Fici (Ficus carica), Fortunella (Fortunella spp.), Fragaria (Fragaria spp.), ginkgo (Ginkgo biloba), Glycine (Glycine spp.) (soybean (Glycine max for example, Soja hispida or Soja max)), upland cotton (Gossypium hirsutum), Helianthus (Helianthus spp) (for example Sunflower Receptacle (Helianthus annuus)), tawny daylily (Hemerocallisfulva), hibiscus (Hibiscus spp.), Hordeum (Hordeum spp.) (for example barley (Hordeum vulgare)), sweet potato (Ipomoea batatas), white walnut (Juglans spp.), lettuce ((Lactuca sativa), Lathyrus (Lathyrus spp.), Lens culinaris (Lens culinaris), flax (Linum usitatissimum), lichee (Litchi chinensis), Lotus (Lotusspp.), Guangdong sponge gourd (Luffa acutangula), lupinus (Lupinus spp.), Luzulasylvatica, tomato belongs to (Lycopersicon spp.) (tomato (Lycopersiconesculentum) for example, tomato (Lycopersicon lycopersicum), Lycopersicon pyriforme), sclerderm Macroptilium (Macrotyloma spp.), Malus (Malus spp.), recessed edge Malpighia coccigera (Malpighia emarginata), horse rice apple (Mammea americana), Mango fruit (Mangifera indica), cassava (Manihot spp.), sapota (Manilkara zapota), alfalfa (Medicago sativa), Melilotus sweetclover (Melilotus spp.), Mentha (Menthaspp.), Momordica (Momordica spp.), black mulberry (Morus nigra), Musa (Musaspp.), Nicotiana (Nicotiana spp.), Olea (Olea spp.), Opuntia (Opuntiaspp.), bird foot Macroptilium (Ornithopus spp.), Oryza (Oryza spp.) (rice (Oryzasativa) for example, broad-leaved rice (Oryza latifolia)), millet (Panicum miliaceum), Purple Granadilla (Passiflora edulis), Selinum pastinaca (Pastinaca sativa), Persea (Persea spp.), parsley (Petroselinum crispum), Phaseolus (Phaseolus spp.), thorn certain herbaceous plants with big flowers belongs to ((Phoenixspp.), Physalis (Physalis spp.), Pinus (Pinus spp.), Pistacia vera (Pistaciavera), Pisum (Pisum spp.), Poa L. (Poa spp.), Populus (Populus spp.), Prosopis (Prosopis spp.), Prunus (Prunus spp.), Psidium (Psidium spp.), pomegranate (Punica granatum), Ussurian pear (Pyrus communis), oak belongs to (Quercusspp.), radish (Raphanus sativus), rheum rhabarbarum (Rheum rhabarbarum), currant belongs to (Ribes spp.), castor-oil plant (Ricinus communis), rubus (Rubusspp.), saccharum (Saccharum spp.), Sambucus (Sambucus spp.), rye (Secale cereale), flax belongs to (Sesamum spp.), sinapsis alba belongs to (Sinapis sp.), Solanum (Solanum spp.) (potato (Solanum tuberosum) for example, red eggplant (Solanumintegrifolium) or tomato (Solanum lycopersicum)), Chinese sorghum (Sorghum bicolor), spinach belongs to (Spinacia spp.), Syzygium (Syzygium spp.), Tagetes (Tagetesspp.), tamarind (Tamarindus indica), cocoa (Theobroma cacao), Clover (Trifolium spp.), Triticosecale rimpaui, Triticum (Triticum spp.) (common wheat (Triticum aestivum) for example, durum wheat (Triticum durum), duckbill wheat (Triticum turgidum), Triticum hybernum, Macha wheat (Triticum macha) (Triticummacha), common wheat (Triticum sativum or Triticum vulgare)), little Flower of Chinese Globeflower (Tropaeolum minus), nasturtium (Tropaeolum majus), genus vaccinium (Vacciniumspp.), Vetch (Vicia spp.), Vigna (Vigna spp.), Viola odorata (Violaodorata), Vitis (Vitis spp.), Zea mays (Zea mays), the raw wild rice in natural pond (Zizaniapalustris), zizyphus (Ziziphus spp.), etc.

Preferably, plant is for example soybean, Sunflower Receptacle, Canola, alfalfa, Semen Brassicae campestris, cotton, tomato, potato or tobacco of crop plants.In addition preferred, plant is monocotyledons, for example sugarcane.More preferably plant is cereal, for example rice, corn, wheat, barley, grain (millet), rye, Chinese sorghum or oat.

When method of the present invention relates to the purposes of AT hook transcription factor, monocotyledons is cereal, for example rice, corn, sugarcane, wheat, barley, grain, rye, Chinese sorghum, grass or oat.

Definition

polypeptide

Term " polypeptide " and " protein " are used interchangeably herein, refer to the amino acid that the polymer form with any length exists.Term " polynucleotide ", " nucleotide sequence ", " nucleotide sequence " are used interchangeably herein, refer to the Nucleotide that the polymer form with any length exists, ribonucleotide or deoxyribonucleotide or both combinations.

control plant

The selection of suitable control plant is the conventional part of experimental program, and it can comprise corresponding wild-type plant or the corresponding plant without goal gene.Common and the to be assessed plant of control plant is identical plant species or even identical kind.Control plant can also be the invalid zygote (nullizygote) of plant to be assessed." control plant " used herein not only refers to complete plant, but also refers to plant part, comprises the part of seed and seed.

increase, improve

Term " increase ", " improvement " or " raising " are used interchangeably herein, for representing, compare with corresponding wild-type or other control plants as definition herein, height at least 5%, 6%, 7%, 8%, 9% or 10%, preferably at least 15% or 20%, more preferably 25%, 30%, 35% or 40% output and/or growth.

hybridization

The term " hybridization " of definition is the process of the nucleotide sequence of homologous complementary annealing each other substantially wherein herein.Can be completely in solution (two complementary nucleic acids are all in solution) carry out crossover process.Can also be fixed to matrix at one of complementary nucleic acid for example hybridizes magnetic bead, sepharose 4B or any other resin in the situation that.Crossover process can also be in the situation that a nucleic acid in complementary nucleic acid be fixed to solid support for example Nitrocellulose or nylon membrane or be fixed to for example siliceous glass support (the latter is called nucleic acid array or microarray or nucleic acid chip) by for example light version typography and occur.In order to allow hybridization to occur, conventionally nucleic acid molecule is carried out to thermally denature or chemical modification, thereby two strands is unwind and is 2 strands and/or eliminates hairpin structure or from other secondary structures of single-chain nucleic acid.The stringency of hybridization is subject to the condition impact that for example temperature, salt concn, ionic strength and hybridization buffer form.

Nucleic acid hybridization experimental example as the situation of Southern and Northern hybridization in, " tight hybridization conditions " and " tight hybridization wash conditions " be sequence-dependent and under varying environment parameter difference.Those skilled in the art will know that can in hybridization and washing process, change and will keep or the various parameters of change stringency condition.

T _munder definite ionic strength and pH, the temperature of 50% target sequence during with the probe hybridization mating completely.T _mthe based composition and the length that depend on solution condition and probe.For example, longer sequence specific hybrid at higher temperature.Lower than T _mabout 16 ℃ to 32 ℃ obtain maximum hybridization speed.In hybridization solution, the existence of monovalent cation has reduced the Coulomb repulsion between 2 nucleic acid chains, thereby promotes crossbred to form; This effect is visible for the na concn that reaches 0.4M.Methane amide reduces the melting temperature(Tm) of DNA-DNA and DNA-RNA duplex, and every 1% methane amide reduces by 0.6 to 0.7 ℃, and adding of 50% methane amide allows to hybridize at 30 to 45 ℃, although hybridization speed will reduce.Base-pair mismatch reduces the thermostability of hybridization speed and duplex.Fifty-fifty with for large probe, every 1% base mispairing, T _mreduce about 1 ℃.The type that depends on crossbred, can be used following formula to calculate T _m:

DNA-DNA crossbred (Meinkoth and Wahl, Anal.Biochem., 138:267-284,1984):

T _m=81.5 ℃+16.6xlog[Na ⁺] ^a+ 0.41x%[G/C ^b]-500x[L ^c] ^-1-0.61x% methane amide

DNA-RNA or RNA-RNA crossbred:

T _m＝79.8+18.5(log ₁₀[Na ⁺] ^a)+0.58(％G/C ^b)+11.8(％G/C ^b) ²－820/L ^c

Few DNA or few RNA ^dcrossbred:

For 20 Nucleotide: T of < _m=2 (l _n)

For 20-35 Nucleotide: T _m=22+1.46 (l _n)

^aor for other monovalent cations, but within the scope of 0.01-0.4M, be only accurately.

^bto the %GC in the scope 30% to 75%, be only accurately.

^cthe length of the duplex in L=base pair

^doligo, oligonucleotide; l _n, the useful length of primer=(number of G/C)+(number of A/T).

Attention: for every 1% methane amide, T _mreduce about 0.6 to 0.7 ℃, yet the existence of 6M urea reduces T _mabout 30 ℃.

The specificity of hybridization is the function of post-hybridization washing normally.For eliminating the background being caused by non-specific hybridization, by the salts solution washing sample of dilution.The key factor of such washing comprises ionic strength and the temperature of whole washing soln: salt concn is lower and wash temperature is higher, and the stringency of washing is higher.Be generally equal to or implement wash conditions lower than hybridization stringency.Conventionally, as implied above for the suitable stringent condition of nucleic acid hybridization test or gene amplification detection method.Also can select more tight or not too tight condition.Usually, low stringency condition is chosen as under definite ionic strength and pH than the pyrolysis chain point (T of particular sequence _m) low about 50 ℃.Medium stringency condition is that temperature compares T _mlow 20 ℃, high stringency condition is that temperature compares T _mlow 10 ℃.For example, stringency condition is at least equally tight with condition A-L for example stringent condition; The stringency condition reducing is at least equally tight with condition M-R for example stringency condition.Can use the arbitrary technology in many known technology (for example, with wrapping proteinaceous solution closing membrane, adding allos RNA, DNA and SDS and process with RNA enzyme in hybridization buffer) to control non-specific binding.

The example of hybridization and wash conditions is listed in table 1:

Table 1:

" crossbred length " is the expection length that the nucleic acid of hybridization occurs.When making the nucleic acid hybridization of known array, can determine crossbred length by aligned sequences and evaluation conserved regions described herein.

(1 * SSPE is 0.15M NaCl, 10mM NaH to SSPE ₂pO ₄, and 1.25mM EDTA, pH7.4) SSC (1 * SSC is 0.15M NaCl and 15mM Trisodium Citrate) in alternative hybridization and lavation buffer solution; After completing, hybridization washs 15 minutes.Hybridization and washing can comprise extraly 5 * Denhardt ' s reagent, 0.5-1.0%SDS, 100 μ g/ml salmon sperm DNA sex change, fragmentation, 0.5% trisodium phosphate and be no more than 50% methane amide.

^*tb-Tr: should be than the melting temperature(Tm) T of crossbred for expecting that length is less than the hybridization temperature of the crossbred of 50 base pairs _mlow 5-10 ℃; According to above-mentioned formula, determine T _m.

^±the present invention also comprises with any one or more DNA of replacement nucleic acid of PNA or modification or RNA hybridization mating partner.

In order to define the level of stringency, can be easily with reference to the people such as Sambrook (2001) Molecular Cloning:a laboratory manual, the 3rd edition, Cold Spring HarborLaboratory Press, CSH, New York or with reference to Current Protocols in MolecularBiology, Joh n Wiley & Sons, N.Y. (1989).

t-DNA activates label (Activation Tagging)

T-DNA activates label people Science (1992) 1350-1353 such as () Hayashi and relates to and T-DNA (conventionally comprising promotor (can be also translational enhancer or intron)) being inserted with such configuration in the upstream or downstream 10kb of the genome area of goal gene or the coding region of gene, and described configuration makes promotor can instruct this by the expression of the gene of target.Conventionally, interrupt the regulation and control to its expression by the natural promoter of the gene of target, gene is attributed under the control of promotor of new importing.Conventionally promotor is embedded to T-DNA.This T-DN is for example infected and inserted Plant Genome by Agrobacterium (Agrobacterium) at random, thus near the gene overexpression T-DNA that causes inserting.The transgenic plant of gained are because the expression of crossing of the gene of the promotor near importing shows dominant phenotype.The promotor being imported into can be any promotor that can instruct gene to express in the biology (being plant in this situation) of expectation.For example, composing type, organize preference type promotor, cell type preference type and inducible promoter to be all suitable for T-DNA to activate.

the local mutating technology (TILLING) of directional induction genome

TILLING (directional induction genome local mutating technology) be for generation of and/or the induced-mutation technique of the variant nucleic acid of evaluation and/or final separated mutagenesis.TILING also allows to select the plant with this mutation variants.The variant of these sudden changes even can show the activity higher than the gene of its natural form.TILLING combines high-density mutagenesis and high-throughput screening method.The step of conventionally carrying out in TILLING is: (a) EMS mutagenesis (Redei GP and Koncz C (1992) InMethods in Arabidopsis Research, Koncz C, Chua NH, Schell J, eds.Singapore, World Scientific Publishing Co, pp.16-82; The people such as Feldmann, (1994) In Meyerowitz EM, Somerville CR, eds, Arabidopsis.Cold SpringHarbor Laboratory Press, Cold Spring Harbor, NY, pp137-172; LightnerJ and Caspar T (1998) In J Martinez-Zapater, J Salinas, eds, Methods onMolecular Biology, the 82nd volume .Humana Press, Totowa, NJ, pp 91-104); (b) individual DNA preparation and merging (pooling); (c) pcr amplification in object region; (d) sex change and annealing so that heteroduplex can form; (e) DHPLC, wherein in consolidated material, the existence of heteroduplex detects as extra peak in color atlas; (f) evaluation of mutated individual; (g) order-checking of sudden change PCR product.For the method for TILLING, in this area, be well-known (people such as McCallum, (2000) Nat Biotechnol 18:455-457; By Stemple (2004) Nat Rev Genet 5 (2): 145-50 summarizes).

directed mutagenesis

Can use directed mutagenesis to produce the variant of SYR nucleic acid.Can obtain several method and carry out directed mutagenesis; That the most frequently used is method (the Current Protocols in Molecular Biology.Wiley Eds. of PCR-based http:// www.4ulr.com/products/currentprotocols/index.html).

transposon mutagenesis

Transposon mutagenesis is the induced-mutation technique of the insertion in gene based on transposon, and this mutagenesis often causes gene knockout.This technology is for several plant species, comprise rice (people such as Greco, PlantPhysiol, 125,1175-1177,2001), corn (people such as McCarty, Plant J.44,52-61,2005) and Arabidopsis (Parinov and Sundaresan, Curr.Opin.Biotechnol.11,157-161,2000).

orthogenesis

Orthogenesis or gene shuffling (gene shuffling) (thereby produce variant nucleic acid or its part by DNA reorganization repeatedly with then suitable screening and/or selection, or there is polypeptide or its homologue of the biologic activity of change) form (people such as Castle, (2004) Science 304 (5674): 1151-4; United States Patent (USP) 5,811,238 and 6,395,547).

Homologous recombination

Homologous recombination allows at definite select location selected nucleic acid quiding gene group.Homologous recombination is conventional for the unicellular lower eukaryote standard technique of yeast or liver moss sword-like leave Rhodobryum (Physcomitrella) for example in bio-science.Not only for model plant (people (1990) the EMBO J 9 (10) such as Offringa: 3077-84) but also for crop plants such as rice (people (2002) Nat Biotech 20 (10): the 1030-4 such as Terada; Iida and Terada (2004) Curr Opin Biotech15 (2): 132-8) described for carry out the method for homologous recombination plant.Target nucleic acid (it can be any nucleic acid or the variant herein defining) needs the directed specific locus that arrives.Target nucleic acid can be can be maybe the extra importing outside native gene for replacing the allelotrope of the improvement of native gene.

homologue

" homologue " of protein comprise compare with the protein of described unmodified there is amino-acid substitution, disappearance and/or insertion and there is the similar biologic activity of the protein of the unmodified of originating to them and peptide, oligopeptides, polypeptide, protein and the enzyme of functionally active.In order to produce such homologue, the available amino acid for example, with other amino-acid substitution protein of similar quality (tendency of similar hydrophobicity, wetting ability, antigenicity, formation or destruction αhelix or β-pleated sheet structure structure).Preservative replacement table in this area, be well-known (referring to for example Creighton (1984) Proteins.W.H.Freeman and Company and below table 2).

ortholog thing and paralog thing

Term " homologue " comprises direct line (orthologous) homologous sequence and collateral line (paralogous) homologous sequence, that is, comprise for describing the homologue of two kinds of special shapes of evolution concept of the ancestral relationship of gene.

The gene that term " paralog thing " relates in the species gene group that causes paralog gene doubles.Can carry out BLAST analysis by one group of sequence of the species for from identical with search sequence, easily identify paralog thing.

Term " ortholog thing " relates to because species form the homologous gene in the difference biology causing.Can easily find the ortholog thing in dicotyledons species for example by carrying out so-called mutual blast research.This can for example, be undertaken by a blast (BLAST that comprises the obtainable ncbi database enforcement search sequence of the public (, SEQ ID NO:1 or SEQ ID NO:2) that for example can find at http://www.ncbi.nlm.nih.gov. for any sequence library analyzes).When starting from nucleotide sequence, can use BLASTN or TBLASTX (use standard default), when starting from protein sequence, can use BLASTP or TBLASTN (use standard default).Optionally filter BLAST result.Then the full length sequence of the result of filtration or unfiltered result is returned to BLAST for the biological sequence deriving from from search sequence and analyze (the 2nd BLAST) (when search sequence is SEQ ID NO:1 or SEQ ID NO:2, the 2nd blast will carry out for rice sequence).Then compare the result of the first and second BLAST.If from the high-level hit event of the 2nd blast with search sequence from identical species, be accredited as so paralog thing; If high-level hit event from different species, is accredited as ortholog thing from search sequence so.High-level hit event is the hit event with low E value.E value is lower, mark more remarkable (or in other words, the probability that chances on this hit event is lower).The calculating of E value is known in this area.The in the situation that of extended familys, can use ClustalW, then build in abutting connection with tree (neighbourjoining tree), to help to show cluster and evaluation ortholog thing and the paralog thing of genes involved.

Homologue can be the form of " the displacement variant " of protein, and wherein at least one residue of aminoacid sequence has been removed and has inserted different residues in its position.The normally single residue form of amino-acid substitution, but depend on that the limit of functions being placed on polypeptide also can occur by cluster; Insert the rank of normally about 1 to 10 amino-acid residue.Preferably, amino-acid substitution comprises conservative amino acid replacement.Can not the displacement of more not guarding in very vital situation in above-mentioned amino acid character.Conservative substitution table can easily obtain in this area.Following table has provided the example of conservative amino acid replacement.

Table 2: the example of conservative amino acid replacement

Residue	Conservative substitution	Residue	Conservative substitution
				Ala	Ser	Leu	Ile；Val
Arg	Lys	Lys	Arg；Gln
				Asn	Gln；His	Met	Leu；Ile
Asp	Glu	Phe	Met；Leu；Tyr
				Gln	Asn	Ser	Thr；Gly
Cys	Ser	Thr	Ser；Val
				Glu	Asp	TPR	Tyr
Gly	Pro	Tyr	TPR；Phe
				His	Asn；Gln	Val	Ile；Leu
Ile	Leu，Val

Homologue can also be the form of " the insertion variant " of protein, wherein one or more amino-acid residues is imported to predetermined position in protein.Insertion can comprise in N end and/or C end fusions and single or multiple amino acid whose sequence inserts.Conventionally, the insertion in aminoacid sequence will be less than N or the fusion of C end, be the rank of about 1 to 10 residue.The example of N or C end fusion rotein or peptide comprises for the binding domains of the activating transcription factor of yeast two-hybrid system or activation structure territory, bacteriophage coat protein, (Histidine)-6-label, glutathione S-transferring enzyme-label, A albumen, maltose binding protein, Tetrahydrofolate dehydrogenase, Tag.100 epi-position, c-myc epi-position, FLAG

-peptide, lacZ, CMP (calmodulin binding peptide), HA epi-position, C albumen epi-position and VSV epi-position.

For the homologue of " disappearance variant " form of protein is characterised in that, one or more amino acid is removed from protein.

Can use peptide synthetic technology such as the solid-phase peptide known in this area synthetic wait or by recombinant DNA processing ease prepare the amino acid variant of protein.For operating DNA sequence dna, to produce the method for protedogenous displacement, insertion or disappearance variant, in this area, know.For example, for produce the technology of replacement mutation on the predetermined position of DNA, know to those skilled in the art, it comprises M13 mutagenesis, T7-Gen vitro mutagenesis (USB, Cleveland, OH), QuickChange directed mutagenesis (Stratagene, San Diego, CA), directed mutagenesis or other directed mutagenesis schemes of PCR mediation.

derivative

" derivative " is for example, to compare and can comprise polypeptide or protein that modify natively and/or the amino-acid residue that non-natural is modified with the aminoacid sequence of the form (not experiencing posttranslational modification) of the natural generation of protein (, the protein as shown in SEQ ID NO:2)." derivative " of protein comprises compares polypeptide or the protein change, glycosylated, acidylate, prenylation or the amino-acid residue that non-natural occurs that can comprise natural generation with the aminoacid sequence of the form of the natural generation of polypeptide.The aminoacid sequence that derivative is originated with it is compared also can comprise one or more non-aminoacid replacement bases, for example be bonded to reporter molecules or other parts of aminoacid sequence covalency or non-valency, for example, in conjunction with to help the reporter molecules of the detection of aminoacid sequence, and the amino-acid residue occurring with respect to the non-natural of the aminoacid sequence of the protein of natural generation.

alternative splicing variant

Term used herein " alternative splicing variant " comprises wherein and excises, replaces or add selected intron and/or exon or wherein shortened or increased the variant of the nucleotide sequence of intron.This type of variant is that the biologic activity of wherein protein obtains the variant retaining, and can obtain by the function fragment of selective retention protein such variant.Can find or can manually prepare this type of splice variant at occurring in nature.Method for generation of this type of splice variant is known in this area.

allele variant

The natural existence of allele variant, method of the present invention comprises this type of natural allelic application.Allele variant comprises single nucleotide polymorphism (SNP) and little insertion/deletion (SmallInsertion/Deletion Polymorphism) (INDEL).The size of INDEL is less than 100bp conventionally.SNP and INDEL have formed one group of maximum sequence variants in the polymorphism strain of the natural generation of most of biologies.

promotor

Term " controlling element ", " control sequence " and " promotor " are all used interchangeably at this, and it broadly refers to realize the regulation and control nucleotide sequence of the expression of the sequence being connected with them.Above-mentioned term comprises that the transcription regulating nucleotide sequence that derives from classical eukaryotic gene group gene (comprises the necessary TATA box of transcription initiation accurately, there is or do not have CCAAT box sequence) and response growth and/or outside stimulus or change the extra controlling element (that is, upstream activating sequence, enhanser and silencer) of genetic expression in tissue-specific mode.This term also comprises the transcription regulating nucleotide sequence of classical prokaryotic gene, and it can comprise-35 box sequences and/or-10 box transcription regulating nucleotide sequences in this case.Term " controlling element " also comprises synthetic fusion molecule or the derivative of giving, activating or strengthen the expression of nucleic acid molecule in cell, tissue or organ.Term used herein " effectively connect " refers to the functional connection between promoter sequence and goal gene, and what promoter sequence just can initial goal gene like this transcribes.

Promotor can be inducible promoter, i.e. response is grown, chemistry, environment or physical stimulation and induce or increase transcription initiation.

Tissue preference Xing Huo tissue-specific promoter be can be preferentially in some such as leaf, root, seed tissue etc. of tissue or initial promotor of transcribing in specific cell even.

The term " composing type " of definition refers to main at least one tissue or organ and the promotor of mainly expressing at any life stage of plant herein.Preferred described promotor is mainly expressed in whole plant.

The example of other constitutive promoters is shown in table 3 below.

Table 3: the example of constitutive promoter

Gene source	Reference
		Actin muscle	McElroy etc., Plant Cell, 2:163-171,1990
CAMV?35S	Odell etc., Nature, 313:810-812,1985
		CaMV?19S	Nilsson etc., Physiol.Plant.100:456-462,1997
GOS2	De Pater etc., Plant J Nov; 2 (6): 837-44,1992, WO 2004/065596
		Ubiquitin	Christensen etc., Plant Mol.Biol.18:675-689,1992
Rice cyclophilin	Buchholz etc., Plant Mol Biol.25 (5): 837-43,1994
		Corn H3 histone	Lepetit etc., Mol.Gen.Genet.231:276-285,1992
Clover H3 histone	The Plant Mol.Biol.11:641-649 such as Wu, 1988
		Actin muscle 2	An etc., Plant is (1) J.10; 107-121,1996
34S?FMV	Sanger?et?al.，Plant.Mol.Biol.，14，1990：433-443
		Rubisco small subunit	US?4,962,028
OCS	Leisner(1988)Proc?Natl?Acad?Sci?USA?85(5)：2553
		SAD1	Jain etc., Crop Science, 39 (6), 1999:1696
SAD2	Jain etc., Crop Science, 39 (6), 1999:1696
		Nos	Shaw etc. (1984) Nucleic Acids Res.12 (20): 7831-7846
V-ATPase	WO?01/14572
		Super promotor	WO?95/14098
G box protein matter	WO?94/12015

Table 4: the example of non-constitutive promoter

Gene source and title	Expression pattern	Reference
			Rice RP6	Endosperm-specific	The people such as Wen (1993) Plant Physiol 101 (3): 1115-6
The kafirin of Chinese sorghum	Endosperm-specific	The people such as DeRose (1996) Plant Molec Biol 32:1029-35
			The zein of corn	Endosperm-specific	The people such as Matzke (1990) Plant Mol Biol 14 (3): 323-32
Rice oleosin 18kDa	Embryo (and aleuron) is specific	The people such as Chuang (1996) J Biochem 120 (1): 74-81
			Rice oleosin 16kDa	Embryo (and aleuron) is specific	The people such as Chuang (1996) J Biochem 120 (1): 74-81
Soybean β-conglycinin	Embryo	The people such as Chiera (2005) Plant Molec Biol 56 (6): 895-904
			Rice Wsi18	Whole seed	The people such as Joshee (1998) Plant Cell Physiol 39 (1): 64-72.
Rice	Whole seed	The people such as Sasaki (2002) NCBI accession number BAA85411
			Rice OSH1	Early stage shoot apical meristem	The people such as Sato (1996) Proc Natl Acad Sci 93 (15): 8117-8122
Rice Rcc2	Root-specific	The people such as Xu (1995) Plant Mol Biol 27 (2): 237-48
			Rice Rcc3	Root-specific	The people such as Xu (1995) Plant Mol Biol 27 (2): 237-48
Arabidopsis Pyk10	Root-specific	The people such as Nitz (2001) Plant Sci 161 (2): 337-346

Table 5: the example of early stage shoot apical meristem promotor

Gene source	Gene family	Plant origin	Reference
				OSH1	KNOX family	1 class homeobox	Rice	The people such as-Matsuoka, the people such as (1993) Plant Cell 5:1039-1048-Sato, (1996) PNAS 93:8117-8122
Knotted?1	KNOX family 1 class homeobox	Corn	The people such as Hake, (1989) EMBO Journal 8:15-22
				KNAT1	KNOX family	1 class homeobox	Arabidopis thaliana	The people such as Lincoln, (1994) Plant Cell 6:1859-1876

Oskn2	KNOX family	1 class homeobox	Rice	The people such as Postma-Haarsma, (1999) Plant Mol Biol 39 (2): 257-71
					Oskn3	KNOX family	1 class homeobox	Rice	The people such as Postma-Haarsma, (1999) Plant Mol Biol 39 (2): 257-71

Table 6: for the example of endosperm specificity promoter of the present invention

Gene source	Expression pattern	Reference
			Wheat LMW and HMW glutenin 1	Endosperm	Mol?Gen?Genet?216：81-90，1989； NAR?17：461-2，1989.
Wheat α, beta, gamma-gliadine	Endosperm	EMBO?3：1409-15，1984.
			Barley Itr1 promotor	Endosperm
Barley B1, C, D, hordein	Endosperm	Theor?Appl?Gen?98：1253-62，1999； Plant?J?4：343-55，1993；Mol?Gen Genet?250：750-60，1996.
			Barley DOF	Endosperm	The people such as Mena, The Plant Journal, 116 (1): 53-62,1998.
?blz2	Endosperm	EP99106056.7
			Synthetic promotor	Endosperm	The people such as Vicente-Carbajosa, Plant J.13:629-640,1998.
Paddy prolamine NRP33	Endosperm	The people such as Wu, Plant Cell Physiology 39 (8) 885-889,1998.
			Rice alpha-globulin Glb-1	Endosperm	The people such as Wu, Plant Cell Physiology 39 (8) 885-889,1998.
Rice alpha-globulin REB/OHP-1	Endosperm	The people such as Nakase, Plant Mol.Biol.33:513-522,1997.
			Rice ADP-glucose PP	Endosperm	Trans?Res?6：157-68，1997.
Corn ESR gene family	Endosperm	Plant?J?12：235-46，1997.
			Chinese sorghum γ-kafirin	Endosperm	PMB?32：1029-35，1996.

Table 7: for the example of seed specific promoters of the present invention

Gene source	Expression pattern	Reference
			Seed-specific gene	Seed	Simon, waits people, Plant Mol.Biol.5:191,1985; Scofield, waits people, J.Biol.Chem. 262:12202,1987; Baszczynski, waits people, Plant Mol.Biol.14:633,1990.

Bertholletia excelsa albumin	Seed	Pearson, waits people, Plant Mol.Biol.18:235-245,1992.
			Legumin	Seed	Ellis, waits people, Plant Mol.Biol.10:203-214,1988.
Gluten (rice)	Seed	Takaiwa, waits people, Mol.Gen.Genet.208:15-22,1986; Takaiwa, waits people, FEBS Letts.221:43-47,1987.
			Zein	Seed	The people such as Matzke, Plant Mol Biol, 14 (3): 323-32,1990.
napA	Seed	Stalberg, waits people, Planta 199:515-519,1996.
			Wheat LMW and HMW glutenin-1	Endosperm	?Mol?Gen?Genet?216：81－90，1989；?NAR?17：461-2，1989.
Wheat SPA	Seed	The people such as Albani, Plant Cell, 9:171-184,1997.
			Wheat α, beta, gamma-gliadine	Endosperm	?EMBO?3：1409-15，1984.
Barley Itr1 promotor	Endosperm
			Barley B1, C, D, hordein	Endosperm	?Theor?Appl?Gen?98：1253-62，1999；?Plant?J?4：343-55，1993；Mol?Gen?Genet?250：750-60，1996.
Barley DOF	Endosperm	The people such as Mena, The Plant Journal, 116 (1): 53-62,1998.
			blz2	Endosperm	?EP99106056.7
Synthetic promotor	Endosperm	The people such as Vicente-Carbajosa, Plant J.13:629-640,1998.
			Paddy prolamine NRP33	Endosperm	The people such as Wu, Plant Cell Physiology 39 (8) 885-889,1998.
Rice alpha-globulin Glb-1	Endosperm	The people such as Wu, Plant Cell Physiology 39 (8) 885-889,1998.
			Rice OSH1	Embryo	The people such as Sato, Proc.Natl.Acad.Sci. USA, 93:8117-8122,1996.
Rice alpha-globulin REB/OHP-1	Endosperm	The people such as Nakase, Plant Mol.Biol.33:513-522,1997.
			Rice ADP-glucose PP	Endosperm	?Trans?Res?6：157-68，1997.
Corn ESR gene family	Endosperm	?Plant?J?12：235-46，1997.
			Chinese sorghum γ-kafirin	Endosperm	?PMB?32：1029-35，1996.

KNOX	Embryo	The people such as Postma-Haarsma, Plant Mol. Biol.39:257-71,1999.
			Rice oleosin	Embryo and aleuron	The people such as Wu, J.Biochem., 123:386,1998.
Sunflower Receptacle oil albumen	Seed (embryo and dry seeds)	The people such as Cummins, Plant Mol.Biol.19:873-876,1992.

terminator sequence

Term " terminator " comprises control sequence, and the 3 ' processing that the end of described control sequence Shi transcription unit is primary transcript and polyadenylation and the termination of transcribing provide the DNA sequence dna of signal.Other controlling element can comprise transcriptional enhancer and translational enhancer.Those skilled in the art will know that and can be suitable for carrying out terminator of the present invention and enhancer sequence.This type of sequence is known or can easily by those skilled in the art, obtains.

selective marker

The term of herein mentioning " selectable marker gene " comprises any following gene, and described gene pairs is expressed its cell and given phenotype, thereby helps to identify and/or select the cell with nucleic acid construct transfection of the present invention or conversion.Suitable mark can be selected from gives microbiotic or Herbicid resistant, the mark that imports new metabolism proterties or allow range estimation to select.The example of selectable marker gene comprises giving for example, (for example to be provided Basta microbiotic (hpt of the nptII of phosphorylation Liu Suanyan NEOMYCIN SULPHATE and kantlex, or phosphorylation Totomycin), weedicide ^tMthe bar of resistance; AroA or the gox of the resistance of resistance glyphosate are provided) resistance gene or the gene (for example allowing plant to use seminose as the manA of sole carbon source) of metabolism proterties is provided.Visual marking gene cause color (β-glucuronidase for example, GUS), the formation of luminous (for example luciferase) or fluorescence (green fluorescent protein, GFP and its derivative).

transform

The term of herein mentioning " conversion " comprises exogenous polynucleotide is transferred to host cell, and regardless of the method for shifting.Available genetic constructs of the present invention transforms the plant tissue that can carry out subsequently clonal propagation (occurring or embryo occurs by organ), then from its complete plant that regenerates.The specific tissue of selecting can change, this depend on can obtain for be best suited for the clonal propagation system of the specific species that are converted.Example organization target (for example comprises leaf dish, pollen, embryo, cotyledon, hypocotyl, megagametophyte (megagametophyte), callus, existing meristematic tissue, apical meristem, axillalry bud and root meristematic tissue) and induction meristematic tissue (for example, cotyledon meristematic tissue and hypocotyl meristematic tissue).Can be by polynucleotide instantaneous or stably import host cell, it can keep nonconformity state for example as plasmid.Selectively, can be integrated into host genome.Then with method known to those skilled in the art, the vegetable cell of the conversion of gained is used for to the plant that regenerates and transform.

The conversion of plant species is quite conventional technology now.Advantageously, can use the either method in several method for transformation that goal gene is imported to suitable ancester cell.Method for transformation comprises use, the electroporation of liposome, the chemical substance of increase dissociative DNA picked-up, DNA to direct injection, the particle gun bombardment (particle gun bombardment) of plant, use conversion and the microinjection of virus or pollen.Method is optional from calcium/polyoxyethylene glycol method (Krens, the people such as F.A., (1982) Nature 296,72-74 for protoplastis; The people such as Negrutiu I (1987) Plant Mol Biol 8:363-373), the electroporation of protoplastis (people (1985) Bio/Technol 3 such as Shillito R.D., 1099-1102), to the microinjection (people such as Crossway A, (1986) Mol.GenGenet 202:179-185) in vegetable material; The microparticle bombardment (people such as Klein TM, (1987) Nature 327:70) that DNA or RNA are coated; Use the infection of (nonconformable) virus etc.Preferably by agriculture bacillus mediated conversion, use any method transforming for rice of knowing, the method of for example describing in one of following documents and materials: disclosed European patent application EP 1198985A1, Aldemita and Hodges (Planta 199:612-617,1996); The people such as Chan (Plant Mol Biol 22 (3): 491-506,1993), the people such as Hiei (Plant J 6 (2): 271-282,1994) (its disclosure is intactly incorporated herein by reference), produce transgenosis rice plant.In the situation that corn transforms, preferred method is that (Nat.Biotechnol 14 (6): 745-50 as people such as Ishida, 1996) or the method for describing in people's (PlantPhysiol 129 (1): 13-22,2002) (its disclosure is intactly incorporated herein by reference) such as Frame.

Conventionally after conversion, just, by the existence of one or more marks of the expressive gene of plant coding moving with goal gene corotation, select vegetable cell or cell cohort, afterwards the material regeneration of conversion is become to complete plant.

After DNA shifts and regenerates, can for example use Southern to analyze the conversion of plant of existence, copy number and/or genomic tissue assessment supposition with regard to goal gene.Selectively or in addition, can use Northern and/or Western to analyze the expression level of the new DNA importing of (two kinds of technology are known to those skilled in the art) monitoring.

Can be by several different methods for example by clonal propagation or classical breeding technique, the plant of the conversion that breeding produces.For example, the plant selfing that can make the first-generation (or T1) transform, the s-generation (or T2) transformant that then selection is isozygotied, then can further breed T2 plant by classical breeding technique.

The inverting biological producing can be taked various ways.For example, they can be the mosaics of transformant and no transformed cells; Clone's property transformant (for example, all cells comprises expression cassette through being converted); That transform and grafting unconverted tissue (for example,, in plant, grafting is to the stock of the conversion in unconverted scion).

the detailed description of seed production conditioning agent (SYR)

Can increase by increasing the level of SYR polypeptide the activity of SYR albumen.Selectively, when the level of SYR does not change, or even when the level of SYR albumen reduces, activity also can increase.This can occur in when for example when producing mutant or selecting to have more activated variant and change the inwardness of polypeptide than wild-type.

The term " SYR albumen or its homologue " of definition refers to that about 65 to about 200 amino acid whose polypeptide herein, this polypeptide (i) is held and in half part, is comprised the be rich in leucic structural domain similar to leucine zipper at the C of protein, (ii) this (guards primitive 1a for having sequence YFS before being rich in leucic structural domain, SEQ ID NO:6) or YFT (conservative primitive 1b, SEQ ID NO:7) or YFG (conservative primitive 1c, SEQ ID NO:8) or YLG (conservative primitive 1d, SEQ ID NO:9) tripeptides, (iii) this is conservative primitive 2 ((V/A/I) LAFMP (T/S) after being rich in leucic structural domain, SEQID NO:10).Preferably, conservative primitive 2 is (A/V) LAFMP (T/S), and most preferably this conservative primitive is VLAFMPT." SYR albumen or its homologue " preferably also has the conservative C-terminal peptide of the primitive of guarding 3 (SYL or PYL, SEQ ID NO:11) ending.The length that is rich in leucic structural domain of SYR albumen or its homologue is about 38 to 48 amino acid (after just in time starting from conservative primitive 1 and before just ending at conservative primitive 2), and it comprises at least 30% leucine.The structural domain that is rich in Leu preferably has and leucine zipper primitive (L-X ₆-L-X ₆-L-X ₆-L, wherein X ₆the sequence of 6 continuous amino acids) similar primitive.The preferred embodiment of SYR albumen is represented by SEQ ID NO:2, has provided the general introduction of its structural domain in Fig. 1.It should be pointed out that term " SYR albumen or its homologue " does not comprise the ARGOS albumen (SEQ ID NO:26) from Arabidopis thaliana.

More preferably, SYR albumen has 2 membrane spaning domains, and wherein the N end of albumen is divided with C end and divided and be positioned at inside, and the part between two membrane spaning domains is positioned at outside.

Selectively, the homologue of SYR albumen has and the amino acid at least 27% shown in SEQ ID NO:2 by the preferred sequence increasing progressively, 28%, 29%, 30%, 31%, 32%, 33%, 34%, 35%, 36%, 37%, 38%, 39%, 40%, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% complete sequence identity, condition is that homologous protein comprises above-mentioned conservative primitive 1 (a, b, c or d), 2 and 3 and be rich in leucic structural domain.Use for example Needleman Wunsch algorithm (preferably using default parameter) in program GAP (GCG WisconsinPackage, Accelrys) of overall comparison algorithm, can determine complete sequence identity.

Can use special database to identify the various structural domains in SYR albumen, described database is such as SMART (people (1998) Proc.Natl.Acad.Sci.USA 95 such as Schultz, 5857-5864; The people such as Letunic (2002) Nucleic Acids Res 30,242-244; Http:// smart.embl-heidelberg.de/), InterPro (people such as Mulder, (2003) Nucl.Acids.Res.31,315-318; Http:// www.ebi.ac.uk/interpro/), Prosite (Bucher and Bairoch (1994), A generalized profile syntax for biomolecular sequences motifs and itsfunction in automatic sequence interpretation. (In) ISMB-94; The 2nd international conference minutes Altman R. of molecular biology intelligent system, Brutlag D., Karp P., Lathrop R., Searls D., Eds., pp53-61, AAAIPress, Menlo Park; The people such as Hulo, Nucl.Acids.Res.32:D134-D137, (2004), http://www.expasy.org/prosite/) or the Pfam (people such as Bateman, Nucleic Acids Research 30 (1): 276-280 (2002), http://www.sanger.ac.uk/Software/Pfam/).

Be used for the search of SYR homologue and the method for evaluation completely within those skilled in the art's limit of power.These class methods comprise uses the algorithm for sequence alignment or comparison of knowing in this area, the sequences that the SEQ ID NO:1 of computer-reader form or 2 is represented with can public database for example MIPS (http://mips.gsf.de/), GenBank really in good (http://www.ncbi.nlm.nih.gov/Genbank/index.html) or EMBL nucleotide sequence database (http://www.ebi.ac.uk/embl/index.html) sequence of acquisition compare, described algorithm is GAP (Needleman and Wunsch, J.Mol.Biol.48 for example; 443-453 (1970)), BESTFIT (is used local homology's algorithm (Advances inApplied Mathematics 2 of Smith and Waterman; 482-489 (1981))), BLAST (Altschul, S.F., Gish, W., Miller, W., Myers, E.W. & Lipman, D.J., J.Mol.Biol.215:403-410 (1990)), FASTA and TFASTA (W.R.Pearson and D.J.Lipman Proc.Natl.Acad.Sci.USA 85:2444-2448 (1988)).For carrying out the software of BLAST analysis, can pass through the public acquisition of American National biotechnology information center (NCBI).

Membrane spaning domain length is about 15 to 30 amino acid, and conventionally the hydrophobic residue that forms α spiral, consists of.Conventionally based on hydrophobicity predict they (such as people such as Klein, Biochim.Biophys.Acta 815,468,1985; Or the people such as Sonnhammer, J.Glasgow, T.Littlejohn, F.Major, R.Lathrop, D.Sankoff, and C.Sensen volume, Proceedingsof the Sixth International Conference on Intelligent Systems for MolecularBiology, 175-182 page, Menlo Park, CA, 1998.AAAI Press.).

Drop on the example of the protein under the definition of " SYR polypeptide or its homologue " and list in the Table A of embodiment 1, it comprises from different monocotyledonss for example rice (SEQ ID NO:2, SEQ ID NO:12 and SEQ ID NO:13), corn (SEQ ID NO:14 and SEQ ID NO:44), wheat (SEQID NO:15), barley (SEQ ID NO:16), sugarcane (SEQ ID NO:17 and SEQ ID NO:18), Chinese sorghum SEQ ID NO:19) sequence; With from the dicotyledons sequence of Arabidopsis (SEQID NO:20 and SEQ ID NO:21), grape (SEQ ID NO:22), oranges and tangerines (SEQ ID NO:23) or tomato (SEQ ID NO:24 and SEQ ID NO:25) for example.Can predict, the structural domain that is rich in Leu is very important for the function of protein, therefore has and is rich in the structural domain of Leu but can be used for equally method of the present invention without the albumen of conservative primitive 1 or 2; The example of such protein is shown in SEQ ID NO:34 and 35.

Be appreciated that term " SYR polypeptide or its homologue " is not limited to sequence or the listed homologue of SEQ ID NO:12 to SEQ ID NO:25 that SEQ ID NO:2 represents, but meet, comprise the standard that is rich in as defined above leucic structural domain; Or have and all can be suitable for method of the present invention to any about 65 of the sequence identity of the sequence at least 38% of SEQ ID NO:2 to about 200 amino acid whose polypeptide, before wherein said structural domain, being conservative tripeptides primitive 1 (a, b, c or d), is to guard primitive 2 and preferably also have conservative primitive 3 afterwards.

In another embodiment, the invention provides and be selected from following separated SYR albumen:

(a) polypeptide representing in SEQ ID NO 44,

(b) there is the polypeptide of following aminoacid sequence, described aminoacid sequence by the preferred sequence increasing progressively have with SEQ ID NO 44 in the aminoacid sequence at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% sequence identity that represent

(c) (a) or (b) in the derivative of albumen of definition.

The sequence being represented by SEQ ID NO:43 is still unknown so far as the gene of coding SYR.Therefore the invention provides separated nucleotide sequence, this sequence comprises

(i) nucleotide sequence being represented by SEQ ID NO:43, or its complementary strand;

(ii) nucleotide sequence of the aminoacid sequence that coding SEQ ID NO:44 represents;

(iii) can (preferably under stringent condition) with above (i) or the nucleotide sequence of nucleic acid array hybridizing (ii), this hybridization sequences optimized encoding SYR albumen;

(iv) nucleic acid of the allele variant of conduct (i) or nucleotide sequence (ii);

(v) nucleic acid of the splice variant of conduct (i) or nucleotide sequence (ii);

(vi) have (i) or the nucleotide sequence of the sequence identity of the sequence 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98% of definition (ii) or 99%.

The activity that can measure SYR albumen or its homologue by express SYR albumen under GOS2 promotor is controlled or its homologue in rice, this causes when comparing with corresponding wild-type plant, has the seed production of increase and the plant that postpones without flowering time.Can measure in several ways the increase of this seed production, for example, with the form of the increase of seed gross weight, full seed number or harvest index.

SYR albumen or its homologue are by SYR nucleic acid/genes encoding.Therefore the term " SYR nucleic acid/gene " of definition is any nucleic acid/gene of SYR albumen as defined above or its homologue of encoding herein.

The example of SYR nucleic acid includes but not limited to the nucleic acid of any expression in SEQ ID NO:1, SEQ ID NO:27 to SEQ ID NO:32, SEQ ID NO:36 to 42 and SEQ ID NO:44.Also the list of mentioned nucleic acid in the Table A referring to embodiment 1.

SYR nucleic acid/gene and its variant can be suitable for putting into practice method of the present invention.Variant SYR nucleic acid/gene comprise SYR nucleic acid/gene part and/or can with the nucleic acid of SYR nucleic acid/gene recombination.

The term " part " of definition refers to the fragment of coding about 65 DNA to about 200 amino acid whose polypeptide herein, wherein said polypeptide comprises and is rich in as defined above leucic structural domain, before this structural domain, being conservative tripeptides primitive 1 (a, b, c or d), is to guard primitive 2 and preferably also have conservative primitive 3 afterwards.Preferably, part comprises one or more conservative primitives as defined above.Can for example by produce one or more disappearances in SYR nucleic acid, prepare this part.Can use this part maybe they can be merged to other coding (or non-coding) sequences for example to produce the albumen of several activity of combination with separated form.When merging to other encoding sequences, the polypeptide that the translation of gained produces afterwards can be larger than the size of predicting for this SYR fragment.Preferably, part is the part of the nucleic acid of any expression in SEQ IDNO:1, SEQ ID NO:27 to SEQ ID NO:32, SEQ ID NO:36 to SEQ ID NO:42 and SEQ ID NO:44.Most preferably the part of nucleic acid is as shown in SEQ ID NO:1.

The another kind of variant of SYR nucleic acid/gene be can be under the stringency condition reducing (preferably under stringent condition) and the nucleic acid of the SYR nucleic acid/gene recombination of definition above, this hybridization sequences encodes about 65 to about 200 amino acid whose polypeptide, this polypeptide comprises and is rich in as defined above leucic structural domain or has the sequence identity to the sequence at least 38% of SEQ ID NO:2, before wherein said structural domain, be conservative primitive 1 (a, b, c or d), and be to guard primitive 2 and preferably also have conservative primitive 3 afterwards.

Preferably, hybridization sequences be can with the nucleic acid being represented by SEQ ID NO:1, SEQ ID NO:27 to SEQ IDNO:32, SEQ ID NO:36 to SEQ ID NO:42 and SEQ ID NO:44 or with the sequence of the part hybridization of arbitrary sequence of above-mentioned sequence.Most preferably hybridization sequences can be hybridized SEQID NO:1.Term " hybridization " is hybridization defined herein.

SYR nucleic acid or its variant can derive from any natural or artificial source.Can be from microbe-derived for example yeast or fungi or from plant, algae or animal (comprising people) source isolating nucleic acid/gene or its variant.Can in composition and/or genome environment, from its natural form, modify this nucleic acid by the manual operation of having a mind to.Nucleic acid is plant origin preferably, and it can derive from identical plant species (for example the plant to be imported from it is identical) or from different plant species.Can be from unifacial leaf species, preferably from Gramineae (Poaceae), more preferably from rice isolating nucleic acid.More preferably, SYR separate nucleic acid represents from rice and by SEQ ID NO:1, and SYR aminoacid sequence is represented by SEQ ID NO:2.

Can regulate by importing genetic modification (preferably in the locus of SYR gene) expression of the nucleic acid of coding SYR polypeptide or its homologue.The locus of the gene of definition is used for representing genome area herein, and this region comprises 10kb upstream or the downstream of goal gene and coding region.

Can for example by any (or a plurality of) method in following method or by import and express the nucleic acid of coding SYR polypeptide or its homologue in plant, import genetic modification, described method is: T-DNA activation, TILLING, directed mutagenesis,, transposon mutagenesis, orthogenesis and homologous recombination.In the part that is " definition " at title, defined aforesaid method herein.After importing genetic modification, the expression of the nucleic acid of just encode SYR polypeptide or its homologue changes, and selects step, and wherein the change in this expression causes having the plant of the seed production of increase.

T-DNA activation, TILLING, directed mutagenesis, transposon mutagenesis and orthogenesis are the examples that can produce the technology of new allelotrope and SYR variant.

A preferred method that is used for importing genetic modification (described modification does not need to be arranged in the locus of SYR gene in this case) is to import and express the coding SYR polypeptide of definition herein or the nucleic acid of its homologue plant.The nucleic acid of plant to be imported can be total length nucleic acid can be maybe as defined above part or hybridization sequences.

The part that is " definition " at title has in this manual defined " homologue " of protein.SYR polypeptide or its homologue can be derivatives.About the definition of term " derivative ", referring to the acceptance of the bid of this specification sheets, be entitled as the part of " definition ".

SYR polypeptide or its homologue can be encoded by the alternative splicing variant of SYR nucleic acid/gene.In " definition " part, defined term " alternative splicing variant ".Preferably splice variant is the splice variant of coding about 65 nucleic acid to about 200 amino acid whose polypeptide, described polypeptide comprises and is rich in as defined above leucic structural domain or has the sequence identity to the sequence at least 38% of SEQ ID NO:2, before wherein said structural domain, be conservative tripeptides primitive 1 (a, b, c or d), and be to guard primitive 2 and preferably also have conservative primitive 3 afterwards.The splice variant being represented by SEQ ID NO:1, SEQ ID NO:27 to SEQ ID NO:32, SEQ ID NO:36 to SEQ ID NO:42 and SEQ ID NO:44 is further preferred.The splice variant that SEQ ID NO:1 represents is most preferred.

Homologue also can be by the allele variant of the nucleic acid of coding SYR polypeptide or its homologue, the allele variant coding of optimized encoding about 65 nucleic acid to about 200 amino acid whose polypeptide, described polypeptide comprises and is rich in as defined above leucic structural domain or has the sequence identity to the sequence at least 38% of SEQ ID NO:2, before wherein said structural domain, be conservative tripeptides primitive 1 (a, b, c or d), and be to guard primitive 2 and preferably also have conservative primitive 3 afterwards.More preferably, the allele variant of the coding SYR polypeptide of any expression in SEQ IDNO:1 or SEQ ID NO:12 to SEQ ID NO:25.Most preferably, the allele variant of coding SYR polypeptide is the variant being represented by SEQ IDNO:1.In " definition " part, defined term " allele variant ".

According to a preferred aspect of the present invention, can expect the expression of the increase of SYR nucleic acid or its variant.Method existing lot of documents instruction in this area for increasing the expression of gene or gene product.It comprises, for example, by the use of crossing expression, transcriptional enhancer or translational enhancer of suitable promoters driven.Can import in the suitable position (conventionally in upstream) of the polynucleotide of non-allos form separated nucleic acid as promotor or enhancer element to raise the expression of SYR nucleic acid or its variant.For example, can by sudden change, disappearance and/or displacement change in vivo endogenesis promoter (referring to, Kmiec, United States Patent (USP) 5,565,350; The people such as Zarling, PCT/US93/03868), or can import vegetable cell with distance (with respect to gene of the present invention) by separated promotor with appropriate direction, with the expression of controlling gene.For reducing the method for the expression of gene or gene product, in this area, know.

If expectation expression of polypeptides, the 3 ' end that is conventionally desirably in polynucleotide encoding district comprises polyadenylation region.Polyadenylation region can derive from natural gene, from multiple other plant gene or from T-DNA.3 ' the end sequence adding for example can derive from nopaline synthase or octopine synthase gene or selectively from another plant gene, or more preferably from any other eukaryotic gene.

Also can in the encoding sequence of 5 ' non-translational region or part encoding sequence, add intron sequences to be increased in the ripe courier's who accumulates in cytosol amount.Be presented in the transcription unit of plant and animal expression construct and comprised and can make the expression of gene on mRNA and protein level, increase nearly 1000 times by montage intron, Buchman and Berg, Mol.Cell biol.8:4395-4405 (1988); The people such as Callis, Genes Dev.1:1183-1200 (1987).When near the 5 ' end that is placed in transcription unit, this intron enhancement of genetic expression is conventionally maximum.The purposes of corn intron A dh1-

S introne

1,2 and 6, Bronze-1 intron is known in this area.Conventionally referring to, The MaizeHandbook, 116 chapters, Freeling and Walbot, Eds., Springer, N.Y. (1994).

The present invention also provides the importing of nucleotide sequence and/or the genetic constructs of expression and the carrier contributing to for the inventive method.

Therefore, provide gene construct, it comprises:

(i) the SYR nucleic acid or its variant that define hereinbefore;

(ii) can drive one or more control sequences of the nucleotide sequence expression of (i); Optionally

(iii) transcription termination sequence;

Condition is the nucleic acid sequences to proteins that gene construct does not comprise coding SEQ ID NO:26.

Can use recombinant DNA technology well known to those skilled in the art to build the construct for method of the present invention.Gene construct can be inserted to the carrier that is suitable for being transformed into plant and is suitable for expressing goal gene in transformant, the commercially available acquisition of this carrier.

The carrier conversion of plant that use comprises aim sequence (that is, the nucleic acid of coding SYR polypeptide or its homologue).Aim sequence is effectively connected with one or more control sequences (at least with promotor).Term " controlling element ", " control sequence " and " promotor " are all used interchangeably in this article, and the part that title is " definition " is in this manual defined.

Advantageously, can use the expression of the promoters driven nucleotide sequence of any type.Preferably, SYR nucleic acid or its functional variant are effectively connected with constitutive promoter.Preferably, can be preferentially in whole plant the constitutive promoter of express nucleic acid there is the express spectra suitable with GOS2 promotor.More preferably, constitutive promoter has the express spectra identical with rice GOS2 promotor, most preferably, can be preferentially in whole plant the promotor of express nucleic acid be the GOS2 promotor (SEQ IDNO:5) from rice.

It should be understood that the scope of application of the present invention is not limited to the SYR nucleic acid being represented by SEQ ID NO:1, the scope of application of the present invention is also not limited to the expression by the SYR nucleic acid of GOS2 promoters driven.Selectable constitutive promoter for method of the present invention is high mobility group protein (high mobility group protein, HMGP) promotor (SEQ ID NO:33).Also can be used for driving the example of other constitutive promoters of SYR expression of nucleic acid to be shown in the table 3 of the part that title is " definition ".

Optionally, also one or more terminator sequences can be used for to the construct of plant to be imported.In " definition " part, defined term " terminator ".

Genetic constructs of the present invention also can comprise in order to maintain and/or copy necessary replication orgin sequence in specific cell type.An example is need to be in bacterial cell for example, with in additive type genetic elements (plasmid or clay molecule) maintenance genetic constructs.Preferred replication orgin includes but not limited to f1-ori and colE1.

Genetic constructs optionally comprises selectable marker gene, as the selectable marker gene in the definition of " definition " part.

The present invention also comprises the plant that can obtain by method of the present invention.Therefore the invention provides the plant that can obtain by method of the present invention, described plant has imported SYR nucleic acid or its variant as defined above therein.

The present invention also provides for generation of the method for transgenic plant with the seed production of increase, and the method is included in and in plant, imports and express SYR nucleic acid or its variant as defined above.

More particularly, the invention provides for generation of the method for transgenic plant with the seed production of increase, the method comprises:

(i) in plant or vegetable cell, import and express SYR nucleic acid or its variant, and

(ii) culturing plants cell under the condition of Promoting plant growth and growth;

Condition is that SYR nucleic acid or its variant are not the nucleotide sequences of the albumen of coding SEQ ID NO:26.

Nucleic acid directly can be imported to vegetable cell or import plant itself (comprising the tissue, organ or any other part that import plant).According to a preferred feature of the present invention, preferably by transforming, nucleic acid is imported to plant.In " definition " part, defined term " conversion ".

The present invention clearly extends to any vegetable cell or the plant producing by any method described herein, and its all plant parts and propagulum.The present invention further extends to the offspring who comprises by the primary conversion of any method generation in aforesaid method or cell, tissue, organ or the whole plant of transfection, and unique requirement is genotype and/or identical genotype and/or the phenotypic characteristic of phenotypic characteristic that this offspring shows with parent produces in the method for the invention.The present invention also comprises and comprises separated SYR nucleic acid or the host cell of its variant.Preferred host cell of the present invention is vegetable cell.The present invention also extends to the part gathered in the crops of plant such as, but not limited to seed, leaf, fruit, flower, stem culture, rhizome, stem tuber and bulb.The invention still further relates to the product of the part gathered in the crops that is directed to such plant, for example dry granulated feed (pellet) or dry powder, oil, fat and lipid acid, starch or protein.

The present invention also comprises the purposes of SYR nucleic acid or its variant and the purposes of SYR polypeptide or its homologue.

Such purposes relates to the growth characteristics of improveing plant, particularly aspect raising seed production.Seed production can comprise one or more following aspects: the harvest index of the seed gross weight of increase, the full seed number of increase, full rate and increase.

SYR nucleic acid or its variant, or SYR polypeptide or its homologue can be used for the procedure of breeding, in the described procedure of breeding, identify can with the DNA marker of SYR gene or its variant genetic linkage (genetically link).SYR nucleic acid/gene or its variant, or SYR polypeptide or its homologue can be used for defining molecule marker.Then this DNA or protein labeling can be had to the plant of the seed production of increase with selection for the procedure of breeding.SYR gene or its variant can be for example the nucleic acid of any expression in SEQ ID NO:1, SEQ ID NO:27 to SEQ ID NO:32, SEQ ID NO:36 to SEQ ID NO:42 and SEQ ID NO:44.

The allele variant of SYR nucleic acid/gene also can be used for the auxiliary procedure of breeding of mark.This type of procedure of breeding needs to use for example EMS mutagenesis sometimes, by plant is carried out to mutagenic treatment, imports allelic variation; Selectively, this program can start from the set of the allele variant in non-so-called " natural " source producing intentionally.Then by for example PCR, carry out the evaluation of allele variant.Carry out afterwards the selection of the good allele variant of aim sequence, described good allele variant causes the seed production increasing.The growth performance of the plant of the different allele variants that conventionally comprise aim sequence by monitoring (for example different allele variants of any in SEQ ID NO:1, SEQ ID NO:27 to SEQ ID NO:32, SEQ ID NO:36 to SEQID NO:42 and SEQ ID NO:44) is selected.Can be in greenhouse or monitor on field growth performance.Other optional step comprise and will wherein identify plant and other plant hybridization of good allele variant.This can be used for for example producing the combination of significant phenotypic characteristic.

SYR nucleic acid or its variant also can be used as gene (described SYR nucleic acid or its variant are the parts of described gene) to carry out heredity and the probe of physical mapping, and the mark of conduct and the proterties of these gene linkages.This Information Availability has the strain of the phenotype of expectation with generation in plant breeding.It is the nucleotide sequence of at least 15 Nucleotide that this purposes of SYR nucleic acid or its variant only needs length.SYR nucleic acid or its variant can be used as restriction fragment length polymorphism (RFLP) mark.Available SYR nucleic acid or its variant are surveyed the Southern trace (Sambrook J, Fritsch EF and Maniatis T (1989) Molecular Cloning, A LaboratoryManual) of the plant genome DNA of restricted enzymic digestion.Then use computer program such as MapMaker people (1987) Genomics 1:174-181 such as () Lander that the banding pattern of gained is carried out to genetic analysis to build genetic map.In addition, can use the Southern trace of the genomic dna that nuclei acid probe comprises one group of individuality that restriction endonuclease processes, wherein this group individuality represents parent and the offspring of definite genetic cross.Record the separation of DNA polymorphism, use it for and calculate position in the genetic map that uses before this colony to obtain of SYR nucleic acid or its variant people (1980) Am.J.Hum.Genet.32:314-331 such as () Botstein.

Generation and the application of the probe of originating for the plant gene of genetic mapping have been described in Bernatzky and Tanksley (GENETICS 112 (4): 887-898,1986).Many publications have been described and have been used the genetic mapping that aforesaid method is learned or its modification is carried out specific cDNA clone.For example, F2 hybrid Population, backcross population, panmictic population, near isogenic line (near isogenic line) and other group of individuals can be used for mapping.These class methods are known to those skilled in the art.

Nucleic acid probe also can be used for physical mapping (that is, the placement of sequence on physical map; Referring to people In:Non-mammalian Genomic Analysis:A Practical Guide such as Hoheisel, Academic press 1996, pp.319-346, and the reference of wherein quoting).

In another embodiment, nucleic acid probe can be used for direct fluorescence in situ hybridization (FISH) mapping (Trask (1991) Trends Genet.7:149-154).Although the existing method of FISH mapping is conducive to large clone, (number kb is to hundreds of kb; Referring to the people such as Laan (1995) Genome Res.5:13-20) use, but the raising of sensitivity can allow to use shorter probe to carry out FISH mapping.

Can use nucleic acid to carry out the multiple method based on nucleic acid amplification for heredity and physical mapping.Example comprises the polymorphism (CAPS of the fragment of allele specific amplification (Kazazian (1989) J.Lab.Clin.Med 11:95-96), pcr amplification; The people such as Sheffield (1993) Genomics16:325-332), allele-specific connects people (1988) Science241:1077-1080 such as () Landegren, Nucleotide extension (Sokolov (1990) Nucleic Acid Res.18:3671), radioactivity hybridization mapping people (1997) Nat.Genet.7:22-28 such as () Walter and Happy map (Dear and Cook (1989) Nucleic Acid Res.17:6795-6807).For these methods, the sequence of nucleic acid is used for designing and producing the primer pair for amplified reaction or primer extension reaction.The design of such primer is known to those skilled in the art.In the method for genetic mapping of using PCR-based, may must in the region corresponding to this nucleotide sequence, identify that mapping hybridizes the DNA sequence dna difference between two parents of (mapping cross).Yet this is conventionally optional for drawing method.

As described in the text, method of the present invention causes producing the plant of the seed production with increase.Also can by these favourable growth characteristics and other economic favourable proterties for example other volume increase proterties, abiotic stress resistance and other to various resistances of coercing, change various constitutional featuress (architectural feature) and/or the proterties of biological chemistry and/or physiologic character combined.

the detailed description of FG-GAP

Can be by regulating the level of FG-GAP polypeptide to regulate the activity of FG-GAP albumen.Selectively, also adjustable activity when the level of FG-GAP does not change.This for example can occur in when producing mutant or selection higher or active lower variant changes the inwardness of polypeptide with wild-type phase specific activity.

The term " FG-GAP albumen or its homologue " of definition refers to and comprises (i) N end secreting signal peptide, (ii) one or more FG-GAP structural domains herein, and the C of (iii) protein afterwards holds the polypeptide of the membrane spaning domain in half part.In Fig. 6, provided example.

Signal peptide is generally used for being directed to the albumen of Secretory Pathway.Use computerized algorithm (as SignalP 3.0, the people such as Bendtsen, J.Mol.Biol., 340:783-795,2004) easily to predict the existence of secretion signal.Common secretion signal is comprised of positively charged n-district, ensuing hydrophobicity n-district and neutrality, polarity c-district.In addition, with respect to cleavage site the amino-acid residue on position-3 and-1 normally little with neutral amino-acid residue.

Membrane spaning domain length is about 15 to 30 amino acid and conventionally the hydrophobic residue that forms α spiral, consists of.Conventionally based on hydrophobicity prediction they (such as people such as Klein, Biochim.Biophys.Acta 815,468,1985; Or the people such as Sonnhammer, In J.Glasgow, T.Littlejohn, F.Major, R.Lathrop, D.Sankoff, compile Proceedings of the SixthInternational Conference on Intelligent Systems for Molecular Biology.175-182 page, Menlo Park with C.Sensen, CA, 1998.AAAI Press.).

FG-GAP structural domain (Pfam accession number PF01839, INTERPRO entry IPR000413) is present in integrin conventionally, this its, to repeat (nearly 7 copies) form, is present in the extracellular part of this protein.Up to the present, only at large characterized the integrin from animal-origin.In SEQ ID NO:53, provided the consensus sequence of FG-GAP structural domain:

fgssvaagDlnGDGrpDlvvgaPgadggtdgsvyll，

The amino acid whose single-letter amino acid code that wherein large letter is high conservative, other letters are the amino acid whose single-letter amino acid code that conservative property is lower.This structural domain comprises Phe-Gly-X conventionally _n-Gly-Ala-Pro primitive, wherein X _nthe amino acid that represents variable number.Because this consensus sequence derives from animal proteinum, itself and plant FG-GAP structural domain sequence Incomplete matching.For example, six peptides " Pgadgg " may not be present in plant FG-GAP structural domain.Therefore, term used herein " FG-GAP structural domain " comprises SEQ ID NO:53 and has the sequence of the sequence similarity of SEQ ID NO:53 at least 40% (based on using Needleman & Wunsch algorithm (the open point penalty in room be 10 and to extend point penalty be 0.5 in room) the SEQ ID NO:53 carrying out and the comparison of corresponding matching sequence).

FG-GAP structural domain also can comprise Ca ²⁺binding site.

Preferably, FG-GAP albumen also comprises FDGYLYLI (D/E) G primitive 1 (SEQ ID NO:50).More preferably, conservative primitive 1 is FDGYLYLIDG.

Additionally and/or selectively, FG-GAP albumen can comprise one or more DGXX (D/E) primitive (conservative primitive 2, SEQ ID NO:51), and wherein X can be any amino acid.This conservative primitive can be the part of larger primitive DXDXDGXX (D/E) (conservative primitive 3, SEQ ID NO:52), and wherein X can be any amino acid.Therefore, FG-GAP albumen preferably comprises the conservative primitive 3 of one or more copies.

Selectively, the homologue of FG-GAP albumen has the amino acid 50% representing with SEQ IDNO:46 by the preferred sequence increasing progressively, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% complete sequence identity, condition is that homologous protein comprises signal peptide sequence, one or more FG-GAP structural domains, with the membrane spaning domain in C-terminal half part of protein, and preferably also comprise conservative primitive 1, one or more in 2 or 3.Use overall comparison algorithm for example the Needleman Wunsch algorithm (preferably using default parameter and full length protein sequence) in program GAP (GCG Wisconsin Package, Accelrys) determine complete sequence identity.

Can use special database such as SMART (people (1998) Proc.Natl.Acad.Sci.USA 95 such as Schultz, 5857-5864; The people such as Letunic (2002) Nucleic Acids Res 30,242-244; ), InterPro (people such as Mulder, (2003) Nucl.Acids.Res.31,315-318; ), Prosite (Bucher and Bairoch (1994), A generalized profile syntax forbiomolecular sequences motifs and its function in automatic sequenceinterpretation. (In) ISMB-94; Proceedings 2nd International Conferenceon Intelligent Systems for Molecular Biology.Altman R., Brutlag D., KarpP., Lathrop R., Searls D., Eds., pp53-61, AAAIPress, Menlo Park; The people such as Hulo, Nucl.Acids.Res.32:D134-D137, (2004),) or the Pfam (people such as Bateman, Nucleic Acids Research 30 (1): 276-280 (2002)), identify the various structural domains in FG-GAP albumen.

For search for and the method for identifying FG-GAP homologue completely in those skilled in the art's limit of power.Described method comprises the algorithm that uses comparison and comparison for sequence well known to those skilled in the art, for example GAP (Needleman and Wunsch, J.Mol.Biol.48; 443-453 (1970)), BESTFIT (is used local homology's algorithm (Advancesin Applied Mathematics 2 of Smith and Waterman; 482-489 (1981))), BLAST (Altschul, S.F., Gish, W., Miller, W., Myers, E.W. & Lipman, D.J., J.Mol.Biol.215:403-410 (1990)), FASTA and TFASTA (W.R.Pearson and D.J.LipmanProc.Natl.Acad.Sci.USA 85:2444-2448 (1988)), will be compared by SEQ ID NO:45 or 46 sequences (form that can read with computer) that represent and the sequence that can for example obtain in MIPS, GenBank or EMBL nucleotide sequence database at public database.For carrying out the software of BLAST analysis, can pass through the public acquisition of American National biotechnology information center (NCBI).

The example that drops on the protein under the definition of " FG-GAP polypeptide or its homologue " comprises Arabidopsis albumen (SEQ ID NO:55) and two rice albumen (SEQ ID NO:57 and 59).Also in other plant species (comprising common wheat, Zea mays, potato, aquilegia (Aquilegia sp.), colea, sweet orange (Citrus sinensis), officinalis, Populus, Euphorbia esula L (Euphorbia the csula)) neutralization of Magnoliophyta (Magnoliophyta), also in other plant taxonomical group, for example proved the existence of FG-GAP albumen in fern (Ceratopteris richardii) or orchid at the age of one hundred years old (Welwitschia mirabilis).In table 8, provided the non-limiting example list of the EST of coding FG-GAP albumen:

Table 8:

Species	GenBank accession number	?SEQ?ID?NO：
			Common wheat	?CK207217	?16
Zea mays	?AY111316	?17
			Potato	?BG598275	?18
Aquilegia	?DT735817	?19
			Colea	?CX192752	?20
Sweet orange	?CX674859	?21

The protein of the genes encoding of being originated by these EST is also for implementing method of the present invention and falling within the scope of the invention.Those skilled in the art can use the complete encoding sequence of separated these genes of standard method.

In addition the present invention also provides and has been selected from following separated FG-GAP albumen:

(a) by the albumen of the nucleic acid encoding of SEQ ID NO:72;

(b) albumen of membrane spaning domain that comprises signal sequence, one or more FG-GAP structural domain and be positioned at C end half part of protein, wherein said albumen comprises at least one in SEQ ID NO:73 to SEQID NO:72;

(c) (a) or (b) in the active fragments of aminoacid sequence of definition, the membrane spaning domain that this active fragments comprises signal sequence, one or more FG-GAP structural domain and is positioned at C end half part of protein.

Be appreciated that, term " FG-GAP polypeptide or its homologue " is not limited to the sequence being represented by SEQ ID NO:46 or classifies SEQ ID NO:55,57 and 59 homologue as, but meets the demands: comprise signal peptide, one or more FG-GAP structural domain and be arranged in the membrane spaning domain of C end half part of protein and the one or more primitives that preferably also comprise the conservative primitive of SEQ ID NO:50 to 52: or have and can be suitable for method of the present invention to any polypeptide of the sequence identity of the sequence at least 50% of SEQ ID NO:46.

Plant FG-GAP albumen work in pollen development process (people 2001 such as Paxson-Sowders).In dex1 mutant plant, prototheca deposition postpones and significantly reduces.In mutant, there is not the generation of the normal ripple formation (rippling) and gap (spacer) of the plasma membrane of observing in wild-type plant yet.FG-GAP albumen can make up this sudden change and recover normal phenotype.

Selectively, the activity that can measure FG-GAP albumen or its homologue by express FG-GAP albumen under constitutive promoter is controlled or its homologue in rice, this expression causes producing compares the plant with the ground biomass of increase and/or the seed production of increase with corresponding wild-type plant.Can measure in several ways the increase of this seed production, for example, with the form of the increase of seed gross weight, full seed number or seed overall number.

FG-GAP albumen or its homologue are by FG-GAP nucleic acid/genes encoding.Therefore the term " FG-GAP nucleic acid/gene " of definition is any nucleic acid/gene of FG-GAP albumen as defined above or its homologue of encoding herein.

The example of FG-GAP nucleic acid includes but not limited to the nucleic acid of any one expression in SEQ ID NO:45, SEQ ID NO:54, SEQ ID NO:56 or SEQ ID NO:58.In table 8, listed the example of part FG-GAP nucleic acid.

The present invention also provides the separated nucleic acid of coding FG-GAP albumen, and described nucleic acid is selected from:

(i) nucleic acid representing in SEQ ID NO:72;

(ii) nucleic acid of the albumen defining in (a) to (c) above coding;

(iii) can be with above the nucleotide sequence of (i) or nucleic acid array hybridizing (ii) (preferably under stringent condition), this hybridization sequences optimized encoding albumen, the C that described albumen comprises signal peptide, one or more FG-GAP structural domain and is arranged in albumen holds the membrane spaning domain of half part;

(iv) nucleic acid to the allele variant of the nucleotide sequence of (iii) as (i);

(v) nucleic acid to the alternative splicing variant of the nucleotide sequence of (iii) as (i);

(vi) part of the nucleotide sequence of any one in (i) to (v) above, this part optimized encoding albumen, the C that described albumen comprises signal peptide, one or more FG-GAP structural domain and is arranged in albumen holds the membrane spaning domain of half part.

FG-GAP nucleic acid/gene and its variant can be suitable for implementing method of the present invention.Variant FG-GAP nucleic acid/gene comprise FG-GAP nucleic acid/gene part, allele variant, splice variant and/or can with the nucleic acid of FG-GAP nucleic acid/gene recombination.

The term of definition partly refers to that the fragment of the DNA of coded polypeptide, described polypeptide comprise signal peptide, one or more FG-GAP structural domain and be arranged in the membrane spaning domain of C end half part of protein and conservative primitive one or more that preferably also comprise SEQ ID NO:50 to 52 herein.Preferably, this part comprises one or more conservative primitives as defined above.Can for example by being carried out to one or more disappearances, FG-GAP nucleic acid prepare part.Can use part with separated form, maybe they and other coding (or non-coding) sequences can be merged to for example produce the albumen of several activity of combination.When merging with other encoding sequences, the gained polypeptide producing after translation can be larger than the size of the FG-GAP fragment of prediction.Preferably, part is the part of the nucleic acid that represents of the arbitrary sequence in SEQ ID NO:45, SEQ ID NO:54, SEQ ID NO:56, SEQ ID NO:58 or SEQ ID NO:72.Part can also be the part of the sequence of table 8 encoding sequence of originating.Most preferably the part of nucleic acid is as shown in SEQ ID NO:45.

The another kind of variant of FG-GAP nucleic acid/gene is can be under the stringent condition reducing, preferably under stringent condition with the nucleic acid of FG-GAP nucleic acid/gene recombination of definition above, this hybridization sequences coded polypeptide, described polypeptide comprises signal peptide, one or more FG-GAP structural domain and is arranged in the membrane spaning domain of C end half part of protein and conservative primitive one or more that preferably also comprise SEQ ID NO:50 to 52.

Preferably, hybridization sequences be the nucleic acid that can represent with SEQ ID NO:45, SEQ ID NO:54, SEQ IDNO:56, SEQ ID NO:58 or SEQ ID NO:72 or with above-mentioned sequence in the sequence of part (comprising EST listed in table 8) hybridization of any sequence.Most preferably hybridization sequences can be hybridized SEQ ID NO:45.Term " hybridization " is that title is the hybridization defining in the part of " definition ".

FG-GAP nucleic acid or its variant can derive from any natural or artificial source.Can be from microbe-derived for example yeast or fungi or from plant, algae or animal (comprising people) source isolating nucleic acid/gene or its variant.Can in composition and/or genome environment, by the manual operation of having a mind to, from its natural form, modify this nucleic acid.Nucleic acid is plant origin preferably, and it can for example, from identical plant species (plant to be imported from it is identical) or can be from different plant species.Can be from dicotyledonous species, preferably from cress, more preferably from Arabidopis thaliana isolating nucleic acid.More preferably, from the separated FG-GAP nucleic acid of Arabidopis thaliana, and FG-GAP nucleic acid represents by SEQ ID NO:45, and FG-GAP aminoacid sequence is the sequence being represented by SEQ ID NO:46.

Can regulate by importing genetic modification (preferably in the locus of FG-GAP gene) expression of the nucleic acid of coding FG-GAP polypeptide or its homologue.The locus of the gene of definition is used for representing genome area herein, and this region comprises 10kb upstream or the downstream of goal gene and coding region.

Can be for example by any (or multiple) method of following method or import genetic modification by import and express the nucleic acid of coding FG-GAP polypeptide or its homologue in plant, described method is: T-DNA activation, TILLING, directed mutagenesis, transposon mutagenesis, orthogenesis and homologous recombination.In the part that is " definition " at title, this class methods have been defined.After importing genetic modification, the modified expression of the nucleic acid of just encode FG-GAP polypeptide or its homologue, selects step, and wherein the modification of this expression causes having the plant of the output of increase.

T-DNA activation, TILLING, directed mutagenesis, transposon mutagenesis and orthogenesis are the examples that can produce the technology of neomorph and FG-GAP variant.

The preferred method that is used for importing genetic modification (its in this situation needn't at the locus of FG-GAP gene) is in plant, to import and express the nucleic acid of FG-GAP polypeptide as defined above or its homologue of encoding.The nucleic acid of plant to be imported can be that total length nucleic acid can be maybe part or the hybridization sequences defining hereinbefore.Preferably, the plant of genetic modification to be imported is not dex1 mutant plant, and in this mutant plant, DEX1 gene does not have function (people 2001 such as Paxson-Sowders).

The part that is " definition " at title has defined " homologue " of protein.FG-GAP polypeptide or its homologue can be the derivatives defining in " definition " part.

FG-GAP polypeptide or its homologue can be encoded by the alternative splicing variant of FG-GAP nucleic acid/gene.Term " alternative splicing variant " as defined herein.The splice variant of nucleic acid of following polypeptide of encoding is preferred, and described polypeptide comprises signal peptide, one or more FG-GAP structural domain and is arranged in the membrane spaning domain of C end half part of protein and conservative primitive one or more that preferably also comprise SEQ ID NO:50 to 52.The splice variant of the arbitrary gene in the splice variant of the splice variant more preferably being represented by SEQ ID NO:45, SEQ ID NO:54, SEQ ID NO:56 or SEQ ID NO:58 or the nucleic acid being represented by SEQ ID NO:72 or the gene that the sequence in table 8 is originated.The splice variant shown in SEQ ID NO:45 most preferably.

Homologue also can be by the allele variant of the nucleic acid of coding FG-GAP polypeptide or its homologue, the allele variant coding of the nucleic acid of optimized encoding polypeptide (one or more of conservative primitive that the C that described polypeptide comprises signal peptide, one or more FG-GAP structural domains and is arranged in albumen holds the membrane spaning domain of half part and preferably also comprises SEQ ID NO:50 to 52).More preferably, the allele variant of coding FG-GAP polypeptide any expression in SEQ ID NO:45, SEQ ID NO:54, SEQ IDNO:56 or SEQ ID NO:58.Most preferably, the allele variant of coding FG-GAP polypeptide is represented by SEQ ID NO:45.In " definition " part, defined allele variant.

According to a preferred aspect of the present invention, can expect the modulated expression of FG-GAP nucleic acid or its variant.Preferably, modulated expression was expression.The method of expressing for crossing of gene or gene product is existing lot of documents report in this area, for example comprises the use of crossing expression, transcriptional enhancer or translational enhancer by suitable promoters driven.Can import the separated nucleic acid as promotor or enhancer element in the suitable position (conventionally in upstream) of the polynucleotide of non-allos form, to raise the expression of FG-GAP nucleic acid or its variant.For example, can by change in sudden change, disappearance and/or replacement endogenesis promoter (referring to Kmiec, United States Patent (USP) 5,565,350; The people such as Zarling, PCT/US93/03868), maybe can import vegetable cell with the expression of controlling gene with suitable direction and distance (with respect to gene of the present invention) by separated promotor.For reducing the method for the expression of gene or gene product, in this area, also know.

If expression of polypeptides expects, the 3 ' end that is conventionally desirably in polynucleotide encoding district comprises polyadenylation region.Polyadenylation region can derive from natural gene, from multiple other plant gene, or from T-DNA.3 ' the end sequence adding for example can derive from nopaline synthase or octopine synthase gene or selectively from another plant gene or more preferably from any other eukaryotic gene.

Also can to the encoding sequence of 5 ' non-translational region or part encoding sequence, add intron sequences to be increased in the ripe courier's who accumulates in cytosol amount.Be presented in the transcription unit of plant and animal expression construct, comprise can montage intron can make genetic expression on mRNA and protein level, increase nearly 1000 times, Buchman and Berg, Mol.Cell biol.8:4395-4405 (1988); The people such as Callis, Genes Dev.1:1183-1200 (1987).When near the 5 ' end that is placed in transcription unit, this type of intron enhancement of genetic expression is conventionally maximum.The purposes of corn intron A dh1-

S introne

1,2 and 6, Bronze-1 intron is known in this area.Referring to, The Maize Handbook, Chapter 116, Freeling and Walbot, Eds., Springer, N.Y. (1994) in general manner.

The present invention also provides genetic constructs and carrier to contribute to importing and/or the expression for the nucleotide sequence of method of the present invention.

Therefore, the invention provides gene construct, this construct comprises:

(i) the FG-GAP nucleic acid or its variant that above define;

(iii) transcription termination sequence;

Condition is that gene construct is not the pPZP type gene construct of being described by the people such as Hajdukiewicz (Plant Mol.Biol.25,989-994) and Paxson-Sowders (2001).

Can use recombinant DNA technology well known to those skilled in the art to build the construct for method of the present invention.Gene construct can be inserted to the carrier that is suitable for being transformed into plant and is suitable for expressing goal gene in transformant, the commercially available acquisition of described carrier.

With the carrier conversion of plant that comprises aim sequence (that is, the nucleic acid of coding FG-GAP polypeptide or its homologue).Aim sequence is effectively connected with one or more control sequences (at least with promotor).Term " controlling element ", " control sequence " and " promotor " are all used interchangeably herein, and the part that is " definition " at title is defined.

Advantageously, can use the expression of the promoters driven nucleotide sequence of any type.Preferably, FG-GAP nucleic acid or its functional variant are effectively connected with constitutive promoter.Term " composing type " is as definition herein.Preferably, can be preferentially in whole plant the constitutive promoter of express nucleic acid there is the express spectra suitable with GOS2 promotor.More preferably, constitutive promoter has the express spectra identical with rice GOS2 promotor, most preferably, can be preferentially in whole plant the promotor of express nucleic acid be the GOS2 promotor (Nucleotide 1 to 2193 of the sequence representing in SEQ ID NO:49) from rice.Should be understood that, suitability of the present invention is not limited to the FG-GAP nucleic acid being represented by SEQ ID NO:45, and suitability of the present invention is not limited to the expression by the FG-GAP nucleic acid of GOS2 promoters driven yet.Also can be used for driving the example of other constitutive promoters of FG-GAP expression of nucleic acid to be shown in table 3 of " definition " part.

Gene construct of the present invention also can be included in and in specific cell type, maintain and/or copy necessary replication orgin sequence.Example is need to be for example, with the form of additive type genetic elements (plasmid or clay molecule) in bacterial cell in maintainer gene construct.Preferred replication orgin includes but not limited to f1-ori and colE1.

Gene construct is optionally included in the selectable marker gene of this specification sheets " definition " part definition.

The present invention also comprises the plant that can obtain by method of the present invention.Therefore the invention provides the plant obtaining by method of the present invention, this plant has imported FG-GAP nucleic acid or its variant as defined above therein.

The present invention also provides for generation of the method for transgenic plant with the output of increase, and the method is included in and in plant, imports and express FG-GAP nucleic acid or its variant as defined above.

More particularly, the invention provides the method for the transgenic plant that produce the output with increase, the method comprises:

(i) in plant or vegetable cell, import and express FG-GAP nucleic acid or its variant; With

(ii) culturing plants cell under the condition of Promoting plant growth and growth.

Nucleic acid directly can be imported to vegetable cell or import plant itself (comprising the tissue, organ or any other part that import plant).According to preferred feature of the present invention, preferably by transforming, nucleic acid is imported to plant.

Term " conversion " is the defined conversion of " definition " part.

The present invention clearly extends to any vegetable cell or the plant producing by any method described herein, with and all plant parts and propagulum.The present invention further extends to the offspring who comprises by the primary conversion of any method generation in aforesaid method or cell, tissue, organ or the whole plant of transfection, and unique requirement is that this offspring shows genotype and/or the phenotypic characteristic identical with the genotype being produced by parent in the method for the invention and/or phenotypic characteristic.The present invention also comprises and comprises separated FG-GAP nucleic acid or the host cell of its variant.Preferred host cell of the present invention is vegetable cell.The present invention also extends to the part gathered in the crops of plant such as but not limited to seed, leaf, fruit, flower, stem culture, rhizome, stem tuber and bulb.The invention still further relates to and derive from, be preferably directed to the product of the part gathered in the crops of this type of plant, for example dry granulated feed or dry powder, oil, fat and lipid acid, starch and protein.

The present invention also comprises the purposes of FG-GAP nucleic acid or its variant and the purposes of FG-GAP polypeptide or its homologue.

Such purposes relates to the growth characteristics of improveing plant, improves especially output, particularly seed production.Seed production can comprise: one or more in the seed overall number of the seed gross weight of increase, the full seed number of increase and increase.

FG-GAP nucleic acid or its variant or FG-GAP polypeptide or its homologue can be used for the procedure of breeding, in the described procedure of breeding, identify can with the DNA marker of FG-GAP gene or its variant genetic linkage.FG-GAP nucleic acid/gene or its variant, or FG-GAP polypeptide or its homologue can be used for defining molecule marker.Then this DNA or protein labeling can be had to the plant of the output of increase with selection for the procedure of breeding.FG-GAP gene or its variant can be for example the genes that in the nucleic acid of any expression in SEQ ID NO:45, SEQID NO:54, SEQ ID NO:56, SEQ ID NO:58 and SEQ ID NO:72 or table 8, listed sequence is originated.

The allele variant of FG-GAP nucleic acid/gene also can be used for marker-assisted breeding program.This type of procedure of breeding needs the mutagenic treatment by plant sometimes, uses for example EMS mutagenesis to import allelic variation; Selectively, this program can start from the set of the allele variant in non-what is called " natural " source producing intentionally.Then for example by PCR, carry out the evaluation of allele variant.Carry out afterwards causing the selection of good allele variant of the aim sequence of the output that increases.Conventionally by monitoring the growth performance of following plant, select, the different allele variants that described plant comprises aim sequence, the different allele variants of for example, a sequence in the encoding sequence that in any or the table 8 of SEQ ID NO:45, SEQ ID NO:54, SEQ ID NO:56, SEQ ID NO:58 and SEQ ID NO:72, listed sequence is originated.Can be in greenhouse or monitor on field growth performance.Other optional step comprise and will wherein identify plant and other plant hybridization of good allele variant.This can be used for for example producing the combination of significant phenotypic characteristic.

FG-GAP nucleic acid or its variant also can be used as gene (described FG-GAP nucleic acid or its variant are the parts of described gene) to carry out heredity and the probe of physical mapping, and are used as the mark with the proterties of these gene linkages.This Information Availability has the strain of the phenotype of expectation with generation in plant breeding.It is the nucleotide sequence of at least 15 Nucleotide that this purposes of FG-GAP nucleic acid or its variant only needs length.FG-GAP nucleic acid or its variant can be used as restriction fragment length polymorphism (RFLP) mark.Available FG-GAP nucleic acid or its variant are surveyed the Southern trace (Sambrook J, Fritsch EF and Maniatis T (1989) Molecular Cloning, ALaboratory Manual) of the plant genome DNA of restrictive diges-tion.Then use computer program such as MapMaker people (1987) Genomics 1:174-181 such as () Lander that the banding pattern of gained is carried out to genetic analysis to build genetic map.In addition, can use the Southern trace of the genomic dna that nuclei acid probe comprises one group of individuality that restriction endonuclease processes, wherein this group individuality represents parent and the offspring of definite genetic cross.Record the separation of DNA polymorphism, use it for and calculate position in the genetic map that uses before this colony to obtain of FG-GAP nucleic acid or its variant people (1980) Am.J.Hum.Genet.32:314-331 such as () Botstein.

Generation and the application of the probe of originating for the plant gene of genetic mapping have been described in Bernatzky and Tanksley (Plant Mol.Biol.Reporter 4:37-41,1986).Many publications have been described the genetic mapping that uses aforesaid method or its modification to carry out specific cDNA clone.For example, F2 hybrid Population, backcross population, panmictic population, near isogenic line and other group of individuals can be used for mapping.These class methods are known to those skilled in the art.

Can use nucleic acid to carry out the multiple method based on nucleic acid amplification for heredity and physical mapping.Example comprises the polymorphism (CAPS of allele specific amplification (Kazazian (1989) J.Lab.Clin.Med 11:95-96), pcr amplified fragment; The people such as Sheffield (1993) Genomics16:325-332), allele-specific connects people (1988) Science241:1077-1080 such as () Landegren, Nucleotide extension (Sokolov (1990) Nucleic Acid Res.18:3671), radioactivity hybridization mapping people (1997) Nat.Genet.7:22-28 such as () Walter and Happy map (Dear and Cook (1989) Nucleic Acid Res.17:6795-6807).For these methods, the sequence of nucleic acid is used for designing and producing the primer pair for amplified reaction or primer extension reaction.The design of this type of primer is known to those skilled in the art.In the method for genetic mapping of using PCR-based, may must in the region corresponding to this nucleotide sequence, identify the DNA sequence dna difference of mapping between the parent of hybridizing.Yet this is conventionally optional for drawing method.

As described above, method of the present invention causes producing the plant of the output with increase.Also can by these favourable growth characteristics and other economic favourable proterties for example other increase output proterties, to the resistance of Different stress, change various constitutional featuress (architectural feature) and/or the proterties of biological chemistry and/or physiologic character combined.

the detailed description of CYP90B

The term " CYP90B polypeptide or its homologue " of definition refers to and comprises following polypeptide herein: (a) CYP structural domain A to D; (b) N holds hydrophobic anchor structure territory; (c) translocation domain; (d), in A structural domain, allow, in any position, the consensus sequence Phe-Ala-Gly-His-Glu-Thr-Ser-Ser that an amino acid changes occurs.

In addition, CYP90B polypeptide or its homologue can also comprise (i) and have SEQ ID NO:78 is surpassed to the sequence of 50% identity and (ii) steroid 22-α hydroxylase enzymatic activity.

In the table 9a of this specification sheets, provided the above example of the CYP90B polypeptide of definition.

CYP90B polypeptide or its homologue are by CYP90B nucleic acid/genes encoding.Therefore the term " CYP90B nucleic acid/gene " of definition is encode the CYP90B polypeptide of above definition or any nucleic acid/gene of its homologue herein.

In CYP superfamily protein, be included in CYP90B polypeptide of the present invention, the various structural domains that exist are known in this area, and can use general database such as SMART (people (1998) Proc.Natl.Acad.Sci.USA 95 such as Schultz, 5857-5864; The people such as Letunic (2002) Nucleic Acids Res 30,242-244; Http:// smart.embl-heidelberg.de/), InterPro (people such as Mulder, (2003) Nucl.Acids.Res.31,315-318; Http:// www.ebi.ac.uk/interpro/), Prosite (Bucher and Bairoch (1994), A generalized profilesyntax for biomolecular sequences motifs and its function in automaticsequence interpretation, in ISMB-94; The 2nd international conference of molecular biology intelligent system recorded Altman R., Brutlag D., Karp P., Lathrop R., Searls D., Eds., pp53-61, AAAI Press, Menlo Park; The people such as Hulo, Nucl.Acids.Res.32:D134-D137, (2004), http://www.expasy.org/prosite/) or the Pfam (people such as Bateman, NucleicAcids Research 30 (1): 276-280 (2002), http://www.sanger.ac.uk/Software/Pfam/) identify.

Also can be at http://arabidopsis-P450.biotec.uiuc.edu/cgi-bin/p450.pl or more commonly on CYP homepage http://drnelson.utmem.edu/CytochromeP450.html., search for special database for Arabidopis thaliana.The typical structure territory of finding in CYP can be four structural domains by the initial A to D describing of Kalb & Loper ((1988) Proc Natl Acad Sci 85:7221-7225).A structural domain (also referred to as spiral I) comprises consensus sequence Ala/Gly-Gly-X-Asp/Glu-Thr-Thr/Ser, and thinks and be combined with dioxygen.B structural domain is steroid binding domains.D structural domain is corresponding to protoheme binding domains and comprise the most distinctive CYP amino acid consensus sequences (Phe-X-X-Gly-X-Arg-X-Cys-X-Gly) (Figure 10 and 13).

Can use the existence of identifying as mentioned above consensus sequence for sequence alignment method relatively.In some cases, capable of regulating default parameter is to change the severity of search.For example, by using BLAST, can increase for reporting the statistical significance threshold value for the coupling of database sequence (being called " expectation " value), with the coupling that shows that severity is lower.By the method, can identify short coupling almost completely.As those skilled in the art will fully recognize, the consensus sequence Phe-Ala-Gly-His-Glu-Thr-Ser-Ser (comprising consensus sequence Ala/Gly-Gly-X-Asp/Glu-Thr-Thr/Ser as defined above) in the A structural domain of the CYP90B polypeptide that can herein define with which evaluation.

At CYP P450 albumen, another structural domain of particularly identifying in CYP90B polypeptide of the present invention can be albumen n end for film target, be rich in hydrophobic residue for example the anchor structure territory of Leu, Ile, Val, Phe and Ala (anchor domain).N end anchor structure length of field is generally 20 to 40 amino acid, but can shorter (down to 10 amino acid) or longer (upper to 100 amino acid).Pass through translocation domain, N end anchor structure territory separates with the rest part (globular domain) of albumen, described translocation domain comprised (at least 2 of cluster alkaline residues before proline(Pro) bunch, Lys or Arg, be called halt-transfer signal), it forms hinge between above-mentioned anchor structure territory and the globular domain of albumen.The typical consensus sequence of translocation domain is Lys/Arg-Lys/Arg-(X) _3-9-Pro-Pro-Gly (Figure 10 and 13).Can identify as mentioned above this consensus sequence.

Can easily identify that N holds the existence in hydrophobic anchor structure territory.Can use the software program from ExPASy server, particularly ProtParam instrument people (2003) ExPASy:theproteomics server for in-depth protein knowledge and analysis.NucleicAcids Res 31:3784-3788 such as () Gasteiger E first order calculation amino acid forms (with %, representing), to determine whether polypeptide structure territory is rich in specific amino acid.Then the average amino acid in the composition of target protein and Swiss-Prot protein sequence database can be formed to (with %, representing) relatively.In this database, the adding and be 34.04% of the mean value of Leu (L), Ile (I), Val (V), Phe (F) and Ala (A).For example, the N of SEQ ID NO:78 holds hydrophobic anchor structure territory to comprise these identical hydrophobic residues of 62.5%.As defined here, N holds hydrophobic anchor structure territory to have with the average amino acid composition (representing with %) of protein in Swiss-Prot protein sequence database and compares higher hydrophobic amino acid content (representing with %).

Specific software such as ProtScale (people (2005) the ProteinIdentification and Analysis Tools on the ExPASy Server.In John M.Walker such as Gasteiger, ed:The Proteomics Protocols Handbook, Humana Press pp.571-607) can calculate and be presented on the spectrum producing by any amino acid scale (aminoacid scale) on selected protein.Amino acid scale is determined by giving all kinds of amino acid whose numerical value.The scale of the most often using is hydrophobicity or wetting ability scale and secondary structure conformation parameter scale.One of hydrophobic amino acid scale of the most often using is produced by Kyte & Doolittle ((1982) J.Mol.Biol.157:105-132), wherein gives hydrophobic amino acid positive number, gives hydrophilic amino acid negative.For example, for the hydrophobicity of CYP90B polypeptide of the present invention, ProtScale output spectra clearly illustrates that approximately front 34 N terminal amino acids are hydrophobic domains, because these amino acid are positioned at 0 top (Figure 12) that demarcates.This region is corresponding to N end anchor structure territory.Those skilled in the art will very clear this analysis.

The routine techniques of knowing in this area be can use, for example, by sequence alignment, CYP90B polypeptide or its homologue easily identified.For the sequence alignment method comparing, in this area, know, these class methods comprise GAP, BESTFIT, BLAST, FASTA and TFASTA.GAP is used the algorithm ((1970) J Mol Biol 48:443-453) of Needleman and Wunsch, with the comparison of finding to make the number maximization of coupling and making minimized two complete sequences of number in room.BLAST algorithm people (1990) J Mol Biol 215:403-10 such as () Altschul calculates per-cent sequence identity and carries out the statistical analysis of two similaritys between sequence.For carrying out the software of BLAST analysis, can obtain publicly by American National biotechnology information center.Can use the ClustalW Multiple Sequence Alignment algorithm (version 1.83) that for example can obtain at http://clustalw.genome.jp/sit-bin/nph-ClustalW, the methods of marking that uses default paired comparison parameter and represent with per-cent, easily identifies to comprise to have the CYP90B homologue that SEQ ID NO:78 is surpassed to the sequence of 50% identity.Can carry out a small amount of human-edited to optimize the comparison between conservative primitive, this it will be apparent to those skilled in the art that.

Table 9a provides the example of CYP90B polypeptide or its homologue (the polynucleotide sequence accession number in bracket is encoded).Table 9b provides the part CYP90B sequence of encoding part CYP90B open reading-frame (ORF) (ORF).

Table 9:a) example of CYP90B homologue

Title

NCB or TIGR Nucleotide accession number

Nucleotide SEQ ID NO

The polypeptide SEQ ID NO of translation

Insertion state

Source

Orysa_CYP90B

AB206579.1

77

78

Total length ORF

Rice

Arath_CYP90B

1

NM_114926. 2

79

80

Total length ORF

Arabidopis thaliana

Sacof_CYP90B ^＊＊

CA092707.1 CF574030.1 CA217329.1

81

82

Total length ORF

Sugarcane (saccharum officinarum)

Allce_CYP90B

TC2113

83

84

Total length ORF

Onion (Allium cepa)

Zinel_CYP90B

AB231155

85

86

Total length ORF

Youth-and-old-age (Zimnia elegans)

Medtr_CYP90 B ^＊	AC147964.1 0	87	88	Total length ORF	Puncture vine clover (Medicago trunculata)
						Poptr_CYP90B ¨ ^＊＊	CK090847.1 CV280598.1 DT503533.1	89	90	Total length ORF	Comospore poplar (Populus trichocarpa)

Table 9:b) there is the example of the CYP90B of part open reading-frame (ORF) (ORF)

Title	NCBI or TIGR Nucleotide accession number	Nucleotide SEQ ID NO	The polypeptide SEQ ID NO of translation	Insertion state	Source
						Aqufo_CYP90 B ^＊＊	DR940523. 1 DR940522. 1	91	92	Part ORF	Aquilegia Formosa?x Aquilegia pubescens
Triae_CYP90 B 5 ' end	BQ620306. 1	93	94	Part ORF	Common wheat
						Triae_CYP90 B 3 ' end ^＊＊	BQ619714. 1 CA715360. 1	95	96	Part ORF	Common wheat
Eupes_CYP90 B	DV141872. 1	97	98	Part ORF	Serum setose thistle
						Goshi_CYP90 B5 ' end ^＊＊	CO125422 DT568185. 1	99	100	Part ORF	Upland cotton
Lyces_CYP90 B5 ' end ^＊＊	BF050501 AW221826. 1 BM409833	101	102	Part ORF	Tomato
						Soltu_CYP90 B 5 ' end ^＊＊	BQ045917 BQ114367	103	104	Part ORF	Potato
Soltu_CYP90 B 3 ' end ^＊＊	BQ114368	105	106	Part ORF	Potato

^*the artificial montage of carrying out from genomic clone

^*contig (contig) from several EST accession number (showing main EST accession number) compilation; EST sequencing quality is conventionally lower, can expect minority replacement nucleic acid.

Should understand, the sequence dropping under the definition of " CYP90B polypeptide or its homologue " is not limited to the sequence being represented by SEQ ID NO:78, SEQ ID NO:80, SEQ ID NO:82, SEQ ID NO:84, SEQID NO:86, SEQ ID NO:88 or SEQ ID NO:90, but comprises: (a) CYP structural domain A to D; (b) N holds hydrophobic anchor structure territory; (c) translocation domain; (d) any polypeptide of the consensus sequence Phe-Ala-Gly-His-Glu-Thr-Ser-Ser allowing in A structural domain in an amino acid variation of any position generation all can be suitable for carrying out the present invention.

Dropping on sequence under the definition of " CYP90B polypeptide or its homologue " can also comprise (i) and have SEQ ID NO:78 is surpassed to the sequence of 50% identity and (ii) steroid 22-α hydroxylase enzymatic activity.

CYP90B polypeptide or its homologue have 22-α hydroxylase enzymatic activity, can use the plant in DWF4 with sudden change, by complementary assay, determine this hydroxylase activity.By people such as the people such as Choe ((1998) Plant Cell 10:231-243), in Arabidopis thaliana (dwf4 mutant) neutralization, by the people such as Tanaka (US2004/0060079), in rice (Tos2091 mutant), this type of mutant plant has been described.The size of these mutant plants is than the little several times of the size of their corresponding wild-types, that is, mutant plant is super dwarfing.In being suitable for the recombinant DNA carrier of Plant Transformation, isolated polypeptide is placed in and can expresses under the control of promotor of this polypeptide plant.Then use the technology of knowing in this area to transform mutant plant with this carrier.If the plant transforming is no longer shown the super phenotype of downgrading, show that isolated polypeptide can show 22-α hydroxylase enzymatic activity.Such polypeptide can be suitable for implementing method of the present invention.

The example of CYP90B nucleic acid includes but not limited to the nucleic acid of any expression in SEQ ID NO:77, SEQ IDNO:79, SEQ ID NO:81, SEQ ID NO:83, SEQ ID NO:85, SEQ ID NO:87 and SEQ ID NO:89.CYP90B nucleic acid/gene and its variant can be suitable for implementing method of the present invention.The variant of CYP90B nucleic acid/gene comprise CYP90B nucleic acid/gene part and/or can with the nucleic acid of CYP90B nucleic acid/gene recombination.

The term " part " of definition refers to the fragment of the DNA of coded polypeptide herein, and described polypeptide comprises following: (a) CYP P450 structural domain A to D; (b) N holds hydrophobic anchor structure territory; (c) translocation domain; (d), in A structural domain, allow, in any position, the consensus sequence Phe-Ala-Gly-His-Glu-Thr-Ser-Ser that an amino acid changes occurs.Can for example by being produced to one or more disappearances, CYP90B nucleic acid prepare part.Can use part maybe they and other coding (or non-coding) sequences can be merged to for example produce the albumen of several activity of combination with separated form.When merging to other encoding sequences, the polypeptide that the translation of gained produces afterwards can be larger than the size of partly predicting for this CYP90B.Preferably, part is the part of the nucleic acid of any expression in SEQ ID NO:77, SEQ ID NO:79, SEQ ID NO:81, SEQ ID NO:83, SEQ ID NO:85, SEQ ID NO:87 and SEQ ID NO:89.Most preferably part is the part of the nucleic acid that represented by SEQ ID NO:77.

The another kind of variant of CYP90B nucleic acid/gene is under the stringent condition reducing, preferably under stringent condition can with the nucleic acid of the CYP90B nucleic acid/gene recombination of definition above, this hybridization sequences encoded packets is containing following: (a) CYP structural domain A to D; (b) N holds hydrophobic anchor structure territory; (c) translocation domain; (d), in A structural domain, allow to occur in any position the polypeptide of the consensus sequence Phe-Ala-Gly-His-Glu-Thr-Ser-Ser of an amino acid variation.Preferably, hybridization sequences be can with the nucleic acid of any expression in SEQID NO:77, SEQ ID NO:79, SEQ ID NO:81, SEQ ID NO:83, SEQ ID NO:85, SEQ ID NO:87 and SEQ ID NO:89 or with the above-mentioned sequence of above definition in the sequence of part hybridization of arbitrary sequence.Most preferably hybridization sequences be can with the sequence of the nucleic acid hybridization being represented by SEQ ID NO:77.Term " hybridization " is the hybridization of " definition " part definition in this specification sheets.

CYP90B nucleic acid or its variant can derive from any natural or artificial source.Can be from microbe-derived for example yeast or fungi or from plant, algae or animal (comprising people) source isolating nucleic acid/gene or its variant.Can in composition and/or genome environment, from its natural form, modify this nucleic acid by the manual operation of having a mind to.This nucleic acid is plant origin preferably, or for example, from identical plant species (plant to be imported from it is identical) or can be from different plant species.This nucleic acid can be separated from monocotyledons species, and preferable separation is from Gramineae, more preferably separated from Oryza (Oryza), more preferably separated from rice.More preferably, from the CYP90B nucleic acid of rice separation, as shown in SEQ ID NO:77, and CYP90B aminoacid sequence is as shown in SEQ ID NO:78.

The present invention also provides separated CYP90B albumen, and it is selected from:

(a) by the protein of the nucleic acid encoding of SEQ ID NO:117;

(b) comprise: (i) CYP structural domain A to D; (ii) N holds hydrophobic anchor structure territory; (iii) translocation domain; (iv) in A structural domain, permission produces the consensus sequence Phe-Ala-Gly-His-Glu-Thr-Ser-Ser that an amino acid changes in any position, and has the protein with the aminoacid sequence at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% of SEQID NO:118,99% identity by the preferred sequence increasing progressively.

The present invention also provides the separated nucleic acid of coding CYP90B albumen, and it is selected from:

(i) nucleic acid that SEQ ID NO:117 represents;

(ii) above coding (a) and (b) in the nucleic acid of the albumen that defines;

(iii) by the preferred sequence increasing progressively, there is the nucleic acid at least 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% that represents with SEQ ID NO:117,99% or the nucleic acid of larger identity;

(iv) can be under stringent condition with above (i) to the nucleotide sequence of the nucleic acid array hybridizing of (iii), this hybridization sequences proteins encoded, described albumen comprises (a) CYP structural domain A to D; (b) N holds hydrophobic anchor structure territory; (c) translocation domain; (d) in A structural domain, there is the consensus sequence Phe-Ala-Gly-His-Glu-Thr-Ser-Ser that an amino acid changes in permission, and has and the aminoacid sequence at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% of SEQ ID NO:118,99% or larger identity by the preferred sequence increasing progressively in any position;

(v) conduct (i) is to the allele variant of the nucleotide sequence of (iv) or the nucleic acid of splice variant;

(vi) above (i) to the part of the nucleotide sequence of any one of (v), this part proteins encoded, and described albumen comprises (i) CYP structural domain A to D; (ii) N holds hydrophobic anchor structure territory; (iii) translocation domain; (iv) in A structural domain, there is in any position the consensus sequence Phe-Ala-Gly-His-Glu-Thr-Ser-Ser that an amino acid changes in permission, and has and the aminoacid sequence at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% of SEQ IDNO:118,99% identity by the preferred sequence increasing progressively.

Can be by importing genetic modification (preferably in the locus of CYP90B gene), non-composing type ground increases the expression of the nucleic acid of coding CYP90B polypeptide or its homologue.The locus of the gene of definition is used for representing genome area herein, and this genome area comprises 10kb upstream or the downstream of goal gene and coding region.

Can for example pass through: any (or multiple) method or import genetic modification by import and express the nucleic acid of coding CYP90B polypeptide or its homologue in plant in T-DNA activation, TILLING, directed mutagenesis, orthogenesis and homologous recombination.In " definition " part, defined aforesaid method.After importing genetic modification, the non-constitutive expression of the increase of the nucleic acid of just encode CYP90B polypeptide or its homologue, selects step, and wherein the increase of this non-constitutive expression causes having the plant of the output of increase.

T-DNA activation, TILLING, directed mutagenesis and orthogenesis are the examples that makes it possible to produce the technology of neomorph and CYP90B variant.

The preferred method that is used for importing genetic modification (its in this situation needn't at the locus of CYP90B gene) is in plant, to import and express the nucleic acid of coding CYP90B polypeptide or its homologue.CYP90B polypeptide or its homologue are defined as comprising: (a) CYP structural domain A to D; (b) N holds hydrophobic anchor structure territory; (c) translocation domain; (d), in A structural domain, allow to produce in any position the polypeptide of the consensus sequence Phe-Ala-Gly-His-Glu-Thr-Ser-Ser of an amino acid variation.The nucleic acid of plant to be imported can be total length nucleic acid can be maybe as defined above part or hybridization sequences.In addition, the nucleic acid of coding CYP90B polypeptide or its homologue can also comprise (i) and has SEQ ID NO:78 is surpassed to the sequence of 50% identity and (ii) steroid 22-α hydroxylase enzymatic activity.

In " definition " part of this specification sheets, defined " homologue " of protein.CYP90B polypeptide or its homologue can be the derivatives of " definition " part definition.

CYP90B polypeptide or its homologue can be encoded by the alternative splicing variant of CYP90B nucleic acid/gene.In " definition " part, defined term " alternative splicing variant ".Preferably splice variant is the splice variant of the nucleic acid of coded polypeptide, and described polypeptide comprises following: (a) CYP structural domain A to D; (b) N holds hydrophobic anchor structure territory; (c) translocation domain; (d), in A structural domain, allow, in any position, the consensus sequence Phe-Ala-Gly-His-Glu-Thr-Ser-Ser that an amino acid changes occurs.In addition, CYP90B polypeptide or its homologue can also comprise (i) and have SEQ ID NO:78 is surpassed to the sequence of 50% identity and (ii) steroid 22-α hydroxylase enzymatic activity.The splice variant of the nucleic acid being represented by SEQ ID NO:77, SEQID NO:79, SEQ ID NO:81, SEQ ID NO:83, SEQ ID NO:85, SEQ IDNO:87 and SEQ ID NO:89 is preferred.The splice variant of the nucleotide sequence being represented by SEQ IDNO:77 is most preferred.

Homologue also can be by the allele variant of the nucleic acid of coding CYP90B polypeptide or its homologue, the allele variant coding of the nucleic acid of the following polypeptide of particularly encoding, and described polypeptide comprises following: (a) CYP structural domain A to D; (b) N holds hydrophobic anchor structure territory; (c) translocation domain; (d), in A structural domain, allow, in any position, the consensus sequence Phe-Ala-Gly-His-Glu-Thr-Ser-Ser that an amino acid changes occurs.In addition, CYP90B polypeptide or its homologue can also comprise (i) and have SEQ ID NO:78 is surpassed to the sequence of 50% identity and (ii) steroid 22-α hydroxylase enzymatic activity.The allele variant of the nucleotide sequence being represented by SEQ ID NO:77, SEQ ID NO:79, SEQ ID NO:81, SEQ ID NO:83, SEQ ID NO:85, SEQ ID NO:87 and SEQ ID NO:89 is preferred.The allele variant of the nucleotide sequence being represented by SEQ ID NO:77 is most preferred.Also in " definition " part, defined allele variant.

According to a preferred aspect of the present invention, can expect the non-constitutive expression of the increase of CYP90 nucleic acid or its variant.Method for increasing the expression of gene or gene product is known in this area, and it for example comprises the use of crossing expression, transcriptional enhancer or translational enhancer by suitable promoters driven.Can import at the correct position (conventionally in upstream) of the polynucleotide of non-allos form separated nucleic acid as promotor or enhancer element to raise the expression of CYP90B nucleic acid or its variant.For example, can by sudden change, disappearance and/or displacement change in vivo endogenesis promoter (referring to, Kmiec, United States Patent (USP) 5,565,350; The people such as Zarling, PCT/US93/03868), or can import vegetable cell with the expression of controlling gene with distance (with respect to gene of the present invention) by separated promotor with suitable direction.For reducing the method for the expression of gene or gene product, in this area, know.

If expectation expression of polypeptides, the 3 ' end that is conventionally desirably in polynucleotide encoding district comprises polyadenylation region.Polyadenylation region can derive from natural gene, derives from multiple other plant gene or derives from T-DNA.3 ' the end sequence being added into can derive from for example nopaline synthase or octopine synthase gene, or selectively derives from other plant gene, or does not more preferably derive from any other eukaryotic gene.

Also can in the encoding sequence of 5 ' non-translational region or part encoding sequence, add intron sequences to be increased in the ripe courier's who accumulates in cytosol amount.Be presented in the transcription unit of plant and animal expression construct and comprised and can make the expression of gene on mRNA and protein level, increase nearly 1000 times of (Buchman and Berg (1988) Mol.Cell biol.8:4395-4405 by montage intron; The people such as Callis (1987) Genes Dev.1:1183-1200).When near the 5 ' end that is placed in transcription unit, this intron enhancement of genetic expression is conventionally maximum.The purposes of corn intron A dh1-

S introne

1,2 and 6, Bronze-1 intron is known in this area.Conventionally referring to, TheMaize Handbook, Chapter 116, Freeling and Walbot, Eds., Springer, N.Y. (1994).

The present invention also provides the importing of nucleotide sequence and/or the genetic constructs of expression and the carrier contributing to for method of the present invention.

Therefore, provide gene construct, it comprises:

(i) the CYP30B nucleic acid or its variant that above define;

(ii) can drive one or more control sequences of non-constitutive expression of the nucleotide sequence of (i); Optionally

(iii) transcription termination sequence.

Can use recombinant DNA technology well known to those skilled in the art to build the construct for method of the present invention.Gene construct can be inserted to the carrier that is suitable for being transformed into plant and is suitable for expressing goal gene in transformant, the commercially available acquisition of this carrier.Therefore the invention provides gene construct purposes in the method for the invention as defined above.

The carrier conversion of plant that use comprises aim sequence (that is, the nucleic acid of coding CYP90B polypeptide or its homologue).Aim sequence is effectively connected with one or more control sequences (at least with promotor).Term " controlling element ", " control sequence " and " promotor " are all used interchangeably herein, and are defined in " definition " part.

Advantageously, can use any non-constitutive promoter to drive the expression of nucleotide sequence.Non-group of type promotor can be inducible promoter, i.e. response is grown, chemistry, environment or physical stimulation and have the promotor of transcription initiation induction or that increase.The example of inducible promoter is stress induced promoter, the promotor being activated when plant is exposed to various stress conditions.Non-constitutive promoter can be to organize preference type promotor, can be preferentially some tissue such as leaf, root, seed tissue etc. in initial promotor of transcribing.Be merely able to initial promotor of transcribing in some tissue and be called " tissue-specific " herein.

The method according to this invention, is effectively connected CYP90B nucleic acid or its variant with non-constitutive promoter.Non-constitutive promoter only has transcriptional activity and not expresses ubiquitously in some periods of plant-growth and growth.Non-constitutive promoter can be for example seed specific promoters or root-specific promoter.Seed specific promoters can be endosperm-specific and/or embryo/aleuron specificity promoter, in seed endosperm and/or seed embryo and aleuron, has transcriptional activity respectively.Endosperm specificity promoter is seed storage protein promotor preferably, more preferably endosperm specificity promoter is prolamine promotor, more preferably endosperm specificity promoter is rice RP6 prolamine promotor, more preferably endosperm specificity promoter by SEQ ID NO:109 substantially similar nucleotide sequence represent, most preferably endosperm specificity promoter is the promotor being represented by SEQ ID NO:109.Embryo/aleuron specificity promoter is seed storage protein promotor preferably, more preferably embryo/aleuron specificity promoter is oleosin promotor, more preferably embryo/aleuron specificity promoter is rice oleosin 18kDa promotor, more preferably embryo/aleuron specificity promoter is represented by substantially similar to SEQ ID NO:110 nucleotide sequence, and most preferably embryo/aleuron specificity promoter is represented by SEQ ID NO:110.Root-specific promoter is Rcc3 promotor preferably, and root-specific promoter is rice Rcc3 promotor (people (1995) the Plant Mol Biol 27 (2) such as Xu: 237-48) preferably.

Should be understood that, suitability of the present invention is not limited to the CYP90B nucleic acid being represented by SEQ ID NO:77, and suitability of the present invention is not limited to the expression by the CYP90B nucleic acid of RP6 prolamine or 18kDa oleosin promoters driven yet.The example that also can be used for implementing other non-constitutive promoters of the inventive method is shown in table 4 of " definition " part.

Contrary with above-mentioned promotor, constitutive promoter had transcriptional activity and substantially in plant, expresses ubiquitously in most of periods of plant-growth and growth.This type of constitutive promoter will be not used in the method for the present invention of implementing.The example of this type of promotor also sees " definition " partly (referring to table 3).

Optionally, one or more terminator sequences also can be used in the construct of plant to be imported.In " definition " part, defined term " terminator ".

Gene construct of the present invention also can comprise in order to maintain and/or copy necessary replication orgin sequence in specific cell type.An example is when gene construct need to for example, maintain in bacterial cell with additive type genetic elements (plasmid or clay molecule).Preferred replication orgin includes but not limited to f1-ori or colE1.

Gene construct optionally comprises the selectable marker gene of " definition " part definition.

In preferred embodiments, provide gene construct, this construct comprises:

(i) CYP90B nucleic acid or its variant as defined above;

(ii) can drive the promotor of the non-constitutive expression of nucleotide sequence of (i); Optionally

(iii) transcription termination sequence.

Non-constitutive promoter is seed specific promoters preferably.Seed specific promoters can be endosperm-specific and/or embryo/aleuron specificity promoter, in seed endosperm and/or seed embryo and aleuron, has transcriptional activity respectively.Endosperm specificity promoter is seed storage protein promotor preferably, more preferably endosperm specificity promoter is prolamine promotor, more preferably endosperm specificity promoter is rice RP6 prolamine promotor, more preferably endosperm specificity promoter by SEQ ID NO:109 substantially similar nucleotide sequence represent, most preferably endosperm specificity promoter is the promotor being represented by SEQ ID NO:109.Embryo/aleuron specificity promoter is seed storage protein promotor preferably, more preferably embryo/aleuron specificity promoter is oleosin promotor, more preferably embryo/aleuron specificity promoter is rice oleosin 18kDa promotor, more preferably embryo/aleuron specificity promoter is represented by substantially similar to SEQID NO:110 nucleotide sequence, and most preferably embryo/aleuron specificity promoter is the promotor being represented by SEQID NO:110.The construct that the present invention also provides above definition purposes in the method for the invention.

The present invention also comprises the plant that can obtain by method of the present invention.Therefore the invention provides plant, its plant part or the vegetable cell that can obtain by method of the present invention, described plant or its part or cell comprise transgenosis CYP90B nucleic acid or its variant.

The present invention also provides for generation of compare the method for the transgenic plant of the output with increase with suitable control plant, and described method is included in plant and imports and non-constitutive expression CYP90B nucleic acid or its variant.

More preferably, the invention provides for generation of the method for transgenic plant with the output of increase, described method comprises:

(i) in plant, plant part or vegetable cell, import and non-constitutive expression CYP90B nucleic acid or its variant; With

Nucleic acid directly can be imported to vegetable cell or import plant itself (comprising the tissue, organ or any other part that import plant).According to a preferred aspect of the present invention, preferably by transforming, nucleic acid is imported to plant.

Term " conversion " is the conversion defining in " definition " part.

The present invention clearly extends to any vegetable cell or the plant producing by any method described herein, extends to its all plant parts and its propagulum.The present invention extends further to the offspring of the cell, tissue, organ or the complete plant that comprise the primary conversion that produces by any aforesaid method or transfection, and unique requirement is that this offspring shows genotype and/or the phenotypic characteristic identical with the genotype being produced by parent in the method for the invention and/or phenotypic characteristic.

The present invention also comprises and comprises the separated CYP90B nucleic acid of non-constitutive expression or the host cell of its variant.Preferred host cell of the present invention is vegetable cell.

The present invention also extends to the part gathered in the crops of plant, such as but not limited to seed, leaf, fruit, flower, stem, rhizome, stem tuber and bulb.The invention still further relates to the product of the part gathered in the crops that is directed to such plant, for example dry particle is raised grain or dry powder, oil, fat and lipid acid, starch or protein.

The present invention also comprises the purposes of CYP90B nucleic acid or its variant and the purposes of CYP90B polypeptide or its homologue.This purposes relates to increases plant biomass as defined above in the method for the invention.

CYP90B nucleic acid or its variant, or CYP90B polypeptide or its homologue can be used for the procedure of breeding, in the described procedure of breeding, identify can with the DNA marker of CYP90B gene or its variant genetic linkage.CYP90B nucleic acid/gene or its variant, or CYP90B polypeptide or its homologue can be used for defining molecule marker.Then this DNA or protein labeling can be used for to the procedure of breeding to select in the method for the invention to have the plant of the output increasing as defined above.CYP90B gene or its variant can be for example the nucleic acid of any expression in SEQ ID NO:77, SEQ ID NO:79, SEQ ID NO:81, SEQ ID NO:83, SEQ ID NO:85, SEQ ID NO:87 and SEQ ID NO:89.

The allele variant of CYP90B nucleic acid/gene also can be used for marker-assisted breeding program.This type of procedure of breeding needs sometimes by plant is carried out to mutagenic treatment, uses for example EMS mutagenesis to import allelic variation; Selectively, this program can start from the set of the allele variant in non-so-called " natural " source producing intentionally.Then by for example PCR, carry out the evaluation of allele variant.Select afterwards step, to select to cause good allele variant output, aim sequence of increase.The growth performance of the plant of the different allele variants that conventionally comprise aim sequence by monitoring (for example different allele variants of any in SEQ IDNO:77, SEQ ID NO:79, SEQ ID NO:81, SEQ ID NO:83, SEQ ID NO:85, SEQ ID NO:87 and SEQ ID NO:89) is selected.Can be in greenhouse or monitor on field growth performance.Other optional step comprises and will wherein identify plant and other plant hybridization of good allele variant.This can be used for for example producing the combination of significant phenotypic characteristic.

CYP90B nucleic acid or its variant also can be used as gene to carry out heredity and the probe of physical mapping, and the mark of conduct and the proterties of these gene linkages, and wherein CYP90B nucleic acid or its variant are the parts of described gene.This Information Availability has the strain of the phenotype of expectation with generation in plant breeding.It is the nucleotide sequence of at least 15 Nucleotide that this purposes of CYP90B nucleic acid or its variant only needs length.CYP90B nucleic acid or its variant can be used as restriction fragment length polymorphism (RFLP) mark.Available CYP90B nucleic acid or its variant are surveyed the Southern trace (Sambrook J, Fritsch EF and Maniatis T (1989) Molecular Cloning, ALaboratory Manual) of the plant genome DNA of restrictive diges-tion.Then use computer program such as MapMaker people (1987) Genomics 1:174-181 such as () Lander that the banding pattern of gained is carried out to genetic analysis to build genetic map.In addition, can use the Southern trace of the genomic dna that nuclei acid probe comprises one group of individuality that restriction endonuclease processes, wherein this group individuality represents parental generation and the offspring of definite genetic cross.Record the separation of DNA polymorphism, use it for and calculate position in the genetic map that uses before this colony to obtain of CYP90B nucleic acid or its variant people (1980) Am.J.Hum.Genet.32:314-331 such as () Botstein.

At Bernatzky and Tanksley (1986), (GENETICS 112 (4): 887-898), described generation and application for the probe in the plant gene source of genetic mapping.Many publications have been described the genetic mapping that uses aforesaid method or its modification to carry out specific cDNA clone.For example, the individuality of F2 hybrid Population, backcross population, panmictic population, near isogenic line and other groups can be used for mapping.These class methods are known to those skilled in the art.

Method of the present invention causes producing the plant of the output as described above with increase.Also can by the output of this increase and other economic favourable proterties for example other increase output proterties, to other abiotic and biological resistances of coercing, modify different structure feature and/or biological chemistry and/or physiological characteristic proterties combined.

the detailed description of CDC27

CDC27 polypeptide in this area, be know and can be by conservative NH ₂(at least one TPR structural domain is at NH for end regions (referring to Figure 16) and at least 5 TPR structural domains ₂in end regions) existence easily identify.In addition, CDC27 polypeptide can also comprise and has the sequence that SEQ ID NO:130 is surpassed to 30% identity.

In yeast and higher eucaryote, in mitotic division (comprising APC protein ingredient CDC16, CDC23 and CDC27), transcribe, the input of montage, protein and neural (Goebl and the Yanagida1991 of occurring, Trends Biochem Sci 16, there is TPR primitive in the multiple protein working in 173-177).The minimum consensus sequence of the suggestion of TPR primitive is: X ₃-W-X ₂-L-G-X ₂-Y-X ₈-A-X ₃-F-X ₂-A-X ₄-P-X ₂, wherein any amino acid of X=(people 1994 such as Lamb, EMBO J 13,4321-4328).Total residue can be shown significant degeneracy, and non-total residue is shown minimum homology or without homology.The hydrophobicity of important seemingly total residue and size but not its identity.In natural CDC27 albumen, TPR forms αhelix; Its tandem repetitive sequence be organized into the superhelix that is ideally suited as the interface of protein identification (Groves and Barford 1999, Curr Opin Struct Biol 9,383-389).In α spiral, conventionally there are two amphipathic structural domains, one is positioned at NH ₂end regions, near COOH end regions, (people 1990 such as Sikorski, Cell 60,307-317) for another.In addition, single TPR primitive also dispersibles in whole protein sequence.

The natural CDC27 of total length comprises at least 5 TPR conventionally, preferred 6 TPR, and more preferably 7 TPR, the major part of these TPR is positioned at COOH end regions.As shown in Figure 16, conventionally at the NH of natural CDC27 polypeptide ₂there is 1 TPR structural domain in end regions, although can exist maybe, can be created in NH ₂the variant CDC27 sequence that end regions comprises a plurality of TPR.

Any CDC27 polypeptide all can be by making the NH of polypeptide ₂at least one TPR structural domain inactivation in end regions, and can be used in method of the present invention.For the method for inactivation in this area, be know and comprise: amino acid whose elimination or displacement, in this situation, NH ₂amino acid whose elimination or the displacement of at least one TPR structural domain in end regions; Or mutating technology, for example for example, with L-Ala displacement conserved amino acid or amino acid (Serine, Threonine or tyrosine) that can phosphorylation with amino-acid substitution that can not phosphorylation or vice versa (depend on phosphorylated protein be activity or non-activity); Or for any other method of inactivation.

For the application's object, by the NH of CDC27 albumen ₂end regions is considered as total length CDC27 sequence (from NH ₂hold to COOH end) the first two/mono-(referring to Figure 16); Preferably by the NH of CDC27 albumen ₂end regions is considered as total length CDC27 sequence (from NH ₂hold to COOH end) first three/mono-; With another preferred feature according to the present invention, the N end regions of CDC27 albumen is considered as to total length CDC27 sequence (from NH ₂hold to COOH end) front 166 amino acid.

At NH ₂the example of CDC27 polypeptide that end regions has the TPR structural domain of at least one inactivation is the polypeptide being represented by SEQ ID NO:130, and its nucleic acid sequence encoding is represented by SEQ ID NO:129.

Table 10 has below provided some examples of CDC27 sequence; Can be by for example using any method for deactivating discussed above by the NH of polypeptide ₂at least one TPR structural domain inactivation in end regions, makes these sequences can be used for method of the present invention.

The example of table 10:CDC27 polypeptide

Title	NCBI Nucleotide accession number	Nucleotide SEQ ID NO	The polypeptide SEQ ID NO of translation	Source
					CDC27B	AC006081
	129	130	Arabidopis thaliana
				CDC27B/Hobbi t	AJ487669	131	132	Arabidopis thaliana
CDC27a	NM_112503.2\|	133	134						Arabidopis thaliana
				CDC27	AP003539.3	135	136	Rice
CDC27	BG887406.1 ^＊ BG590616.1 DN939130.1 CV470643.1	137	139						Potato
				CDC27/nuc2+	NM_001020032.1	139	140	Schizosaccharomyces pombe (Schizosaccharo myces pombe)
CDC27/BimA	X59269.1	141	142						Aspergillus niger (Aspergillus niger)
				CDC27	NM_001256.2	143	144	The mankind (Homo sapiens)
CDC275’	CA102186.1 ^＊ CA279358.1	145	146						Sugarcane

CDC273’

CA197669.1 ^＊ CA197670.1 CA203636.1 CA232307.1

147

148

Sugarcane

^*contig (showing main EST accession number) from several EST accession number compilations; EST sequencing quality is conventionally lower, can expect minority replacement nucleic acid.

Only with illustrational form, provide the sequence of describing in table 10.Other examples of coding total length or part of polypeptide (can use it to obtain full length sequence by using ordinary method) are provided in Figure 19.The NH should be understood that at polypeptide ₂any CDC27 peptide sequence of TPR structural domain or the nucleic acid/gene of such polypeptide of encoding in end regions with at least one inactivation all can be suitable for implementing method of the present invention.

Can use the routine techniques of knowing in this area for example by sequence alignment, easily to identify other CDC27 polypeptide.Subsequently can be for example by using any method for deactivating discussed above, by the NH of polypeptide ₂at least one TPR structural domain inactivation in end regions makes identified sequence can be used for method of the present invention.For the sequence alignment method comparing, in this area, know, these class methods comprise GAP, BESTFIT, BLAST, FASTA and TFASTA.GAP is used the algorithm ((1970) J Mol Biol 48:443-453) of Needleman and Wunsch to find to make the number maximization of mating and the comparison that makes minimized two complete sequences of number in room.BLAST algorithm people (1990) J Mol Biol 215:403-10 such as () Altschul calculates per-cent sequence identity and carries out the statistical analysis of two similaritys between sequence.Can obtain publicly for carrying out the software of BLAST analysis by American National biotechnology information center.Can use the ClustalW multiple sequence alignment algorithm (version 1.83) that for example can obtain at http://clustalw.genome.jp/sit-bin/nph-ClustalW, the methods of marking that uses default paired comparison parameter and represent with per-cent, easily identifies the homologue of CDC27.Can carry out a small amount of human-edited to optimize the comparison between conservative primitive, this it will be apparent to those skilled in the art that.

Can use special database such as SMART (people (1998) Proc.Natl.Acad.Sci.USA 95 such as Schultz, 5857-5864, the people such as Letunic (2002) Nucleic Acids Res 30,242-244, http://smart.embl-heidelberg.de/), InterPro (people such as Mulder, (2003) Nucl.Acids.Res.31,315-318, http://www.ebi.ac.uk/interpro/), Prosite (Bucher and Bairoch (1994), A generalized profile syntax for biomolecularsequences motifs and its function in automatic sequence interpretation. (In) ISMB-94, the 2nd international conference of molecular biology intelligent system recorded Altman R., Brutlag D., Karp P., Lathrop R., Searls D., Eds., pp53-61, AAAIPress, Menlo Park, the people such as Hulo, Nucl.Acids.Res.32:D134-D137, (2004), http://www.expasy.org/prosite/), Pfam (the people such as Bateman, Nucleic Acids Research 30 (1): 276-280 (2002), http://www.sanger.ac.uk/Software/Pfam/) or ProDom (Servant F, Bru C, Carrere S, Courcelle E, Gouzy J, Peyruc D, Kahn D (2002) ProDom:Automated clustering of homologous domains.Briefings in Bioinformatics. the 3rd volume, no 3:246-251), various structural domains in evaluation CDC27 albumen are TPR structural domain for example.

The sequence of mentioning in table 10 and Figure 19 can be thought the homologue of CDC27 polypeptide.In " definition " part of this specification sheets, defined " homologue " of protein.Preferably homologue is to have and the total length CDC27 albumen at least 30%, 40%, 50%, 60%, 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98% being represented by SEQ ID NO:132 or 99% or the aminoacid sequence of larger sequence identity by the preferred sequence increasing progressively.

Can be by for example using any method for deactivating discussed above, by the NH of polypeptide ₂at least one TPR structural domain inactivation in end regions makes homologue, ortholog thing and paralog thing can be used for method of the present invention.

By yeast two-hybrid, analyze in vivo and by co-immunoprecipitation (people (1994) EMBO J 13 (18): the 4321-4328 such as Lam in vitro; Ollendorf & Donoghue (1997) J BiolChem 272 (51): 32011-32018), shown that two other PROTEIN C DC16 of people and yeast CDC27 polypeptide and APC mixture and CDC23 interact.Such interaction can be used for identifying CDC27 polypeptide, so that by for example using any method for deactivating discussed above by the NH of described polypeptide ₂at least one TPR structural domain inactivation in end regions and can be for method of the present invention.

NH at polypeptide ₂in end regions, there is the CDC27 polypeptide of TPR structural domain of at least one inactivation by so-called modified CDC27 nucleic acid/genes encoding.Therefore, the term " modified CDC27 nucleic acid/gene " of definition is the NH that is coded in polypeptide herein ₂any nucleic acid/gene of CDC27 polypeptide in end regions with the TPR structural domain of at least one inactivation.

CDC27 nucleic acid or modified CDC27 nucleic acid/gene can derive from any natural or artificial source.Can be from microbe-derived, for example yeast or fungi or from plant, algae or animal-origin isolating nucleic acid/gene.Can in composition and/or genome environment, by the manual operation of having a mind to, from its natural form, modify this nucleic acid.Nucleic acid is plant origin preferably, and it can for example, from identical plant species (plant to be imported from it is identical) or can be from different plant species.Can be from dicotyledonous species, preferably from Cruciferae, more preferably from Arabidopis thaliana isolating nucleic acid.More preferably, from the modified CDC27 nucleic acid of Arabidopis thaliana separation, by SEQ ID NO:129, represented, at amino acid whose NH ₂the CDC27 in end regions with the TPR of at least one inactivation is the polypeptide being represented by SEQ ID NO:130.

CDC27 nucleic acid/gene can be can be under the stringent condition reducing, preferably the nucleic acid of the CDC27 nucleic acid/gene recombination of any expression under stringent condition and in SEQ ID NO:129, SEQ ID NO:131, SEQ ID NO:133, SEQ ID NO:135, SEQ ID NO:137 or SEQ ID NO:141.Most preferably hybridization sequences be can be to the nucleic acid hybridization being represented by SEQ ID NO:129 or SEQ IDNO:131 sequence.This hybridization sequences can be by for example being used any method for deactivating discussed above by the NH of its coded polypeptide ₂at least one TPR structural domain inactivation in end regions and can be used for method of the present invention.

Term " hybridization " is the hybridization of this specification sheets " definition " part definition.

CDC27 nucleic acid or modified CDC27 nucleic acid/gene can be the form of alternative splicing variant.In " definition " part, defined alternative splicing variant.The splice variant of the arbitrary sequence in above-mentioned CDC27 nucleotide sequence (being SEQ ID NO:129, SEQ ID NO:131, SEQ ID NO:133, SEQ IDNO:135, SEQ ID NO:137 or SEQ ID NO:141) is preferred.The splice variant of the nucleotide sequence being represented by SEQ ID NO:129 or SEQ ID NO:131 is most preferred.Can be by for example using any method for deactivating discussed above by the NH of the CDC27 polypeptide of coding ₂at least one TPR structural domain inactivation in end regions, and make this type of splice variant can be for method of the present invention.

CDC27 nucleic acid or modified CDC27 nucleic acid/gene can be the allele variant forms of the nucleic acid of the CDC27 polypeptide (the TPR structural domain that comprises at least one inactivation at NH2 end regions) that blocks of coding.The allele variant of the nucleotide sequence being represented by SEQ ID NO:129, SEQ ID NO:131, SEQ ID NO:133, SEQ ID NO:135, SEQ ID NO:137 or SEQ ID NO:141 is preferred.The allele variant of the nucleotide sequence being represented by SEQ ID NO:129 or SEQ ID NO:131 is most preferred.The natural existence of allele variant, within these natural allelic application are included in method of the present invention.Allele variant comprises single nucleotide polymorphism (SNP) and little insertion/deletion (INDEL).The size of INDEL is less than 100bp conventionally.In the natural polymorphism strain of most of biologies, SNP and INDEL form one group of maximum sequence variants.Can be by for example using any method for deactivating discussed above by the NH of the CDC27 polypeptide of coding ₂at least one TPR structural domain inactivation in end regions makes this allele variant can be used for method of the present invention.

Can produce CDC27 nucleic acid or modified CDC27 nucleic acid/gene by directed mutagenesis.Can obtain several method and realize directed mutagenesis, the most frequently used method is the method for PCR-based (Current Protocols in Molecular Biology, Wiley Eds http:// www.4ulr.com/ products/currentprotocols/index.html).

Also can produce CDC27 nucleic acid or modified CDC27 nucleic acid/gene by orthogenesis (about detailed content more referring to " definition " part).

Can be by for example using any method for deactivating discussed above by the NH of the CDC27 polypeptide of coding ₂at least one TPR structural domain inactivation in end regions makes the variant producing by directed mutagenesis or orthogenesis can be used for method of the present invention.

Can increase the expression of the modified CDC27 nucleic acid/gene of the following CDC27 polypeptide of coding by importing genetic modification (preferably in the locus of CDC27 gene), described CDC27 polypeptide is at the NH of polypeptide ₂end regions has the TPR structural domain of at least one inactivation.The locus of the gene of definition is used for representing genome area herein, and this region comprises 10KB upstream or the downstream of goal gene and coding region.

Preferably by import and express the nucleic acid of the following CDC27 polypeptide of coding in plant, import genetic modification, described CDC27 polypeptide is at the NH of polypeptide ₂end regions has the TPR structural domain of at least one inactivation.After importing genetic modification, be just coded in the NH of polypeptide ₂the expression of modified nucleic acid of CDC27 polypeptide that end regions has the TPR structural domain of at least one inactivation increases (in shoot apical meristem), carries out optional selection step, and the increase of described expression causes having the plant of the output of increase.

According to a preferred aspect of the present invention, can expect the expression of the increase of CDC27 nucleic acid or its variant.Method for increasing the expression of gene or gene product is known in this area, and it for example comprises the use of crossing expression, transcriptional enhancer or translational enhancer by suitable promoters driven.Can import at the correct position (conventionally in upstream) of the polynucleotide of non-allos form separated nucleic acid as promotor or enhancer element to raise the expression of CDC27 nucleic acid.For example, can by sudden change, disappearance and/or displacement change in vivo endogenesis promoter (referring to, Kmiec, United States Patent (USP) 5,565,350; The people such as Zarling, PCT/US93/03868), or can import vegetable cell with the expression of controlling gene with distance (with respect to gene of the present invention) by separated promotor with suitable direction.

If expectation expression of polypeptides, the 3 ' end that is conventionally desirably in polynucleotide encoding district comprises polyadenylation region.Polyadenylation region can derive from natural gene, derives from multiple other plant gene or derives from T-DNA.3 ' end sequence to be added can derive from for example nopaline synthase or octopine synthase gene, or selectively derives from other plant gene, or does not more preferably derive from any other eukaryotic gene.

Also can in the encoding sequence of 5 ' non-translational region or part encoding sequence, add intron sequences to be increased in the ripe courier's who accumulates in cytosol amount.Be presented in the transcription unit of expression construct of plant and animal and comprised and can make the expression of gene on mRNA and protein level, increase nearly 1000 times of (Buchman and Berg (1988) Mol.Cell biol.8:4395-4405 by montage intron; The people such as Callis (1987) Genes Dev.1:1183-1200).When near the 5 ' end that is placed in transcription unit, this intron enhancement of genetic expression is conventionally maximum.The purposes of corn intron A dh1-

S introne

Therefore, provide gene construct, it comprises:

(i) be coded in the NH of polypeptide ₂end regions has the CDC27 nucleic acid of CDC27 polypeptide of the TPR structural domain of at least one inactivation;

(ii) can preferentially in shoot apical meristem, drive one or more control sequences of the nucleotide sequence expression of (i); Optionally

(iii) transcription termination sequence.

Can use recombinant DNA technology well known to those skilled in the art to build this type of gene construct.Gene construct can be inserted to the carrier that is suitable for being transformed into plant and is suitable for expressing goal gene in transformant, the commercially available acquisition of this carrier.Therefore the gene construct that the invention provides above definition purposes in the method for the invention.

Use comprises aim sequence and (that is, is coded in the NH of polypeptide ₂end regions has the nucleic acid of CDC27 polypeptide of the TPR structural domain of at least one inactivation) carrier conversion of plant.Aim sequence is effectively connected with can be preferentially drive one or more control sequences (at least with promotor) of expressing in plant shoot apical meristem.Term " controlling element ", " control sequence " and " promotor " are all used interchangeably herein, and are defined in the part of " definition ".

The NH of polypeptide will be coded in ₂end regions has CDC27 nucleic acid or variant and the shoot apical meristem promotor of CDC27 polypeptide of the TPR structural domain of at least one inactivation, is preferably effectively connected with early stage shoot apical meristem promotor." early stage shoot apical meristem promotor " of definition is to Seedling Stage, in shoot apical meristem, to have the promotor of transcriptional activity in embryo globular stage herein, and know these periods to those skilled in the art.That mentions preferentially increase to express herein in shoot apical meristem, and mean mainly increases and express in shoot apical meristem, and except due to the former of seepage promotor thereby any residual expression that causes, gets rid of the expression at the elsewhere of plant.Preferably, early stage shoot apical meristem promotor is that OSH1 promotor is (from rice; SEQ ID NO:151 (people such as Matsuoka, (1993) Plant Cell 5:1039-1048; The people such as Sato, (1996) ProcNatl Acad Sci U S A 93 (15): 8117-22).It should be understood that suitability of the present invention is not limited to the modified CDC27 nucleic acid being represented by SEQ ID NO:129, suitability of the present invention is not limited to the expression by the modified CDC27 nucleic acid of OSH1 promoters driven yet.The example of other early stage shoot apical meristem promotors is shown in the table 5 of " definition " part.These are the members from the KNOX family 1 class homoeosis frame of paralog or ortholog gene.Be to be understood that list is below non-exhaustive.

Optionally, also one or more terminator sequences can be used for to the construct of plant to be imported.In " definition " part, defined term " terminator " in this manual.

Gene construct of the present invention also can comprise in order to maintain and/or copy necessary replication orgin sequence in specific cell type.An example is need to be in bacterial cell in for example, form maintainer gene construct with additive type genetic elements (plasmid or clay molecule).Preferred replication orgin includes but not limited to f1-ori and colE1.

The present invention also comprises the plant that can obtain by method of the present invention.Therefore the invention provides plant or its part that can obtain by method of the present invention, comprise vegetable cell, described plant or plant part comprise the NH that is coded in polypeptide ₂end regions has the CDC27 nucleic acid of CDC27 polypeptide of the TPR structural domain of at least one inactivation, and wherein this nucleic acid is effectively connected with shoot apical meristem promotor.

The present invention also provides for generation of compare the method for the transgenic plant of the number seeds with increase with suitable control plant, and the method is included in plant and imports and to express the NH that is coded in polypeptide ₂end regions has the CDC27 nucleic acid of CDC27 polypeptide of the TPR structural domain of at least one inactivation, and this CDC27 nucleic acid is under the control of shoot apical meristem promotor.

More particularly, the invention provides for generation of compare the method for the transgenic plant of the number seeds with increase with suitable control plant, the method comprises:

(i) in plant, plant part or vegetable cell, import and express the CDC27 nucleic acid of coding CDC27 polypeptide, described CDC27 polypeptide is at the NH of polypeptide ₂end regions has the TPR structural domain of at least one inactivation, and described nucleic acid is under the control of shoot apical meristem promotor; With

In " definition " part, defined term " conversion ".

The present invention clearly extends to any vegetable cell or the plant producing by any method described herein, and extends to its all plant parts and its propagulum.The present invention extends further to the offspring who comprises by the primary conversion of any method generation in aforesaid method or cell, tissue, organ or the complete plant of transfection, and unique requirement is genotype and/or identical genotype and/or the phenotypic characteristic of phenotypic characteristic that this offspring shows with parent produces in the method for the invention.

The present invention also comprises the host cell of the separated CDC27 nucleic acid that comprises coding CDC27 polypeptide, and described CDC27 polypeptide is at the NH of polypeptide ₂end regions has the TPR structural domain of at least one inactivation, and this nucleic acid is under the control of shoot apical meristem promotor.Preferred host cell of the present invention is vegetable cell.

The present invention also extends to the part gathered in the crops of plant such as, but not limited to seed, leaf, fruit, flower, stem, rhizome, stem tuber and bulb.The invention still further relates to and derive from, be preferably directed to the product of the part gathered in the crops of such plant, for example dry granulated feed or powder, oil, fat and lipid acid, starch or protein.

The present invention also comprises the purposes of the separated CDC27 nucleic acid of coding CDC27 polypeptide, and described CDC27 polypeptide is at the NH of polypeptide ₂end regions has the TPR structural domain of at least one inactivation, and described nucleic acid is under the control of shoot apical meristem promotor.This purposes relates to increases plant biomass as defined above in the method for the invention.

The enforcement of the inventive method causes producing compares the plant of the number seeds with increase with suitable control plant.Also can be by the increase of this number seeds and other economic favourable proterties, for example other increase output proterties, to other abiotic and biological resistances of coercing, modify various constitutional featuress and/or biological chemistry and/or physiological characteristic proterties combined.

the detailed description of AT hook

AT hook structure territory is in the polypeptide of knowing and be conventionally present in the transcription factor family that belongs to relevant to Chromatin Remodeling in this area.AT hook primitive is comprised of about 13 left and right (about 9 sometimes) amino acid, and these amino acid participate in DNA combination and have being rich in the preference in the region of A/T.In Arabidopsis, there are at least 34 albumen that comprise AT hook structure territory.These albumen are along the total homology of most of sequence, and wherein AT hook structure territory is special high conservative region.In Figure 23 and following table 11 illustrated AT hook structure territories; Also referring to the suitable annotation of SEQ ID NO:153, SEQ ID NO:155, SEQ ID NO:157, SEQ ID NO:159, SEQ ID NO:161, SEQ ID NO:163, SEQ ID NO:165, SEQ ID NO:167, SEQ ID NO:169 and SEQ ID NO:171 (wherein the position in AT hook structure territory explicitly points out).As shown in the comparison of Figure 23, some variations in AT hook structure territory allow.Conventionally, before one or two AT hook structure territories are positioned at DUF296 structural domain.The AT hook structure territory of herein mentioning refers to by the preferred sequence increasing progressively to have the peptide sequence with the identity of the AT hook structure territory at least 70%, 75%, 80%, 85%, 90% of SEQ ID NO:153 or 95%, for convenience's sake, the AT hook structure territory of this SEQ ID NO:153 is repeated in this: RRPRGRPAGSKNK (the AT hook structure territory of SEQ ID NO:153).

DUF296 structural domain (being called IPR005175 in Interpro) is also known in this area.At Figure 23 and following table 11 illustrated DUF296 structural domains; Also referring to the suitable annotation of SEQ ID NO:153, SEQ ID NO:155, SEQ ID NO:157, SEQ ID NO:159, SEQ ID NO:161, SEQ ID NO:163, SEQ ID NO:165, SEQ ID NO:167, SEQ ID NO:169 and SEQ ID NO:171, wherein the position of DUF296 structural domain is explicitly pointed out.As shown in the comparison of Figure 23, the variation in DUF296 structural domain is admissible, and the while, it still can be easily accredited as DUF296 structural domain due to the existence of the amino-acid residue of some high conservatives.Conventionally, before DUF296 structural domain, there are one or two AT hook structure territories.

According to a preferred aspect of the present invention, the polypeptide that comprises AT hook structure territory and DUF296 structural domain comprises 1 primitive in following primitive extraly:

Primitive 1 (SEQ ID NO:190): QGQ V/I GG; Or

Primitive 2 (SEQ ID NO:191): ILSLSGSFLPPPAPP; Or

Primitive 3 (SEQ ID NO:192): NATYERLP; Or

Primitive 4 (SEQ ID NO:193): there is the SFTNVAYERLPL that 0 or 1 amino acid in any position changes; Or

Primitive 5 (SEQ ID NO:194): there is the GRFEILSLTGSFLPGPAPPGSTGLTIYLAGGQGQVVGGSVVG that 0,1 or 2 amino acid in any position changes.

According to preferred feature of the present invention, the sequence that is suitable for method of the present invention is to comprise AT hook structure territory (as hereinbefore defined) and DUF296 structural domain (as hereinbefore defined) and the polypeptide of primitive 2 (as hereinbefore defined) or the nucleic acid of this polypeptide of encoding.

Be appreciated that, the sequence of describing in table 1 and the sequence showing in the comparison of Figure 23 be just for the example of the sequence of method of the present invention, has any polypeptide of AT hook structure territory and DUF296 structural domain or any nucleic acid of coding said polypeptide all can be suitable for implementing method of the present invention.

Table 11: the description of the example of aminoacid sequence that comprises AT hook structure territory and DUF296 structural domain and the sequence of these structural domains and their corresponding position

SEQ?ID?NO

Species

Position, AT hook structure territory

Sequence A T hook structure territory

Duf296 structural domain position

Sequence D UF296 structural domain

1

SEQIDNO：153 CDS3129

ORYSA

97-109

rrprgrpagsknk

124-241

lrthvmevaggcdisesitt farrrqrgvcvlsgagtvtn vtlrqpasqgavvalhgrfe ilslsgsflpppappeatgl tvylaggqgqvvggsvvgal taagpvvimaasfanavy

2

SEQIDNO：155 CDS3128

ORYSA

97-109

RRPRGRPPGSKNK

109-227

lrahilevgsgcdvfecvst yarrrqrgvcvlsgsgvvtn vtlrqpsapagavvslhgrf eilslsgsflpppappgats ltiflaggqgqvvggnvvga lyaagpviviaasfanvay

3

SEQIDNO：157 LOTCO- AP006863.1 (gi68264919)

LOTUS

81-93

rrprgrpagsknk

108-225

lkthvmevadgcdivdsvsn farrrqrgvcimsgtgtvtn vtlrqpassgavvtlhgrfe ilslagsflpppappaasgl tiylaggqgqvvggsvvgal iasgpvvimaasfsnaay

4

SEQIDNO：159 NP_192942

ARATH

119-131

RRPRGRPAGSKNK

145-263

lrthvmeigdgcdivdcmat farrrqrgvcvmsgtgsvtn vtirqpgsppgsvvslhgrf eilslsgsflpppappaatg lsvylaggqgqvvggsvvgp llcsgpvvvmaasfsnaay

5

SEQIDNO：161 NP_194012

ARATH

105-117

rrprgrpagsknk

132-252

farrrqrgvcvmsgtgnvtn vtirqpgshpspgsvvslhg rfeilslsgsflpppappta tglsvylaggqgqvvggsvv gpllcagpvvvmaasfsna

6

SEQIDNO：163 NP_182067

ARATH

89-101

rrprgrpagsknk

116-237

lkshvmevangcdvmesvtv farrrqrgicvlsgngavtn vtirqpasvpgggssvvnlh grfeilslsgsflpppappa asgltiylaggqgqvvggsv vgplmasgpvvimaasfgna ay

7	SEQIDNO：165 At3g60870/At _NP_191646	ARATH	59-71	rrprgrpagsknk	86-201	frchvmeitnacdvmeslav farrrqrgvcvltgngavtn vtvrqpgggvvslhgrfeil slsgsflpppappaasglkv ylaggqgqviggsvvgplta sspvvvmaasfgnasy
							8	SEQIDNO：167 CDS0185	ARATH	88-100	rrprgrppgsknk	115-233	lqshvleiatgadvaeslna farrrgrgvsvlsgsglvtn vtlrqpaasggvvslrgqfe ilsmcgaflptsgspaaaag ltiylagaqgqvvgggvagp liasgpviviaatfcnaty
9	SEQIDNO：169 PROT?encoded by?AK107405	ORYSA	111-123	rrprgrpagsknk	138-256	lrahvlevasgcdlvdsvat farrrqvgvcvlsatgavtn vsvrqpgagpgavvnltgrf dilslsgsflpppappsatg ltvyvsggqgqvvggtvagp liavgpvvimaasfgnaay
							10	SEQIDNO：171 NP_912386.1	ORYSA	45-57	rrprgrppgsknk	72-190	mrshvleiasgadiveaiag fsrrrqrgvsvlsgsgavtn vtlrqpagtgaaavalrgrf eilsmsgaflpapappgatg lavylaggqgqvvggsvmge liasgpvmviaatfgnaty
11	SEQIDNO：173 Le_BT013387	LYCES	54-66	rrprgrpagsknk	81-198	lrahilevssghdvfesvat yarkrqrgicilsgsgtvnn vtirqpqaagsvvtlhgrfe ilslsgsflpppappgatsl tiylaggqgqvvggnvvgal iasgpviviassftnvay
							12	SEQIDNO：175 CDS3125	ARATH	34-46	rrprgrpagsknk	61-180	lrshvlevtsgsdiseavst yatrrgcgvciisgtgavtn vtirqpaapagggvitlhgr fdilsltgtalpppappgag gltvylaggqgqvvggnvag sliasgpvvlmaasfanavy
13	SEQIDNO：177 CDS3399	ARATH	80-92	rrprgrpagsknk	107-232	lkshvmeiasgtdvietlat farrrqrgicilsgngtvan vtlrqpstaavaaapggaav lalqgrfeilsltgsflpgp

						appgstgltiylaggqgqvv ggsvvgplmaagpvmliaat fsnaty
							14	SEQIDNO：179 PRO?AK110263	ORYSA	35-47	rrprgrppgsknk	62-179	lrshvmevaggadvaesiah farrrqrgvcvlsgagtvtd valrqpaapsavvalrgrfe ilsltgtflpgpappgstgl tvylaggqgqvvggsvvgtl taagpvmv
15	SEQIDNO：181 At4g14465/NP _567432	ARATH	67-79	rrprgrppgsknk	94-211	lrshvleisdgsdvadtiah fsrrrqrgvcvlsgtgsvan vtlrqaaapggvvslqgrfe ilsltgaflpgpsppgstgl tvylagvqgqvvggsvvgpl laigsvmviaatfsnaty
							16	SEQIDNO：183 CDS4145	ARATH	82-94	rrprgrppgsknk	109-226	lrahilevtngcdvfdcvat yarrrqrgicvlsgsgtvtn vsirqpsaagavvtlqgtfe ilslsgsflpppappgatsl tiflaggqgqvvggsvvgel taagpviviaasftnvay
17	SEQIDNO：185 XP_473716	ORYSA	82-94	rrprgrppgsknk	109-227	lrahilevgsgcdvfecvst yarrrqrgvcvlsgsgvvtn vtlrqpsapagavvslhgrf eilslsgsflpppappgats ltiflaggqgqvvggnvvga lyaagpviviaasfanvay
							18	SEQIDNO：187 NP_181070	ARATH	78-90	rrprgrpagsknk	105-222	lrahilevgsgcdvfecist yarrrqrgicvlsgtgtvtn vsirqptaagavvtlrgtfe ilslsgsflpppappgatsl tiflagaqgqvvggnvvgel maagpvmvmaasftnvay
19	SEQIDNO：189 TC102931	TC102931	86-98	rrprgrpagsknk	113-230	lrshvmevangcdimesvtv farrrqrgvcilsgsgtvtn vtlrqpaspgavvtlhgrfe ilslsgsflpppappaasgl aiylaggqgqvvggsvvgpl lasgpvvimaasfgnaay

Those skilled in the art are by using technology and the instrument known in this area can easily identify the polypeptide that comprises AT hook structure territory and DUF296 structural domain.Can be by carry out carrying out this evaluation for the sequence alignment of sequence comparison with GAP, BESTFIT, BLAST, FASTA and TFASTA.GAP is used the algorithm ((1970) J Mol Biol 48:443-453) of Needleman and Wunsch to find to make the number maximization of mating and the comparison that makes minimized two complete sequences of number in room.BLAST algorithm people (1990) J Mol Biol 215:403-10 such as () Altschul calculates per-cent sequence identity and carries out the statistical analysis of two similaritys between sequence.Can obtain publicly for carrying out the software of BLAST analysis by American National biotechnology information center.Can use the ClustalW Multiple Sequence Alignment algorithm (version 1.83) that for example can obtain at http://clustalw.genome.jp/sit-bin/nph-ClustalW, the methods of marking that uses default paired comparison parameter and represent with per-cent, easily identifies the polypeptide that comprises AT hook structure territory and DUF296 structural domain.Can carry out a small amount of human-edited to optimize the comparison between conservative primitive, this it will be apparent to those skilled in the art that.

Can use specialized database such as SMART (people (1998) Proc.Natl.Acad.Sci.USA 95 such as Schultz, 5857-5864; The people such as Letunic (2002) Nucleic Acids Res 30,242-244; Http:// smart.embl-heidelberg.de/), InterPro (people such as Mulder, (2003) Nucl.Acids.Res.31,315-318; Http:// www.ebi.ac.uk/interpro/), Prosite (Bucher and Bairoch (1994), A generalized profile syntax for biomolecularsequences motifs and its function in automatic sequence interpretation, ISMB-94; The 2nd international conference of molecular biology intelligent system recorded Altman R., Brutlag D., Karp P., Lathrop R., Searls D., Eds., pp53-61, AAAI Press, Menlo Park; The people such as Hulo, Nucl.Acids.Res.32:D134-D137, (2004), http://www.expasy.org/prosite/) or the Pfam (people such as Bateman, Nucleic AcidsResearch 30 (1): 276-280 (2002), http://www.sanger.ac.uk/Software/Pfam/), identify AT hook structure territory and DUF296 structural domain.

The sequence of mentioning in table 11 or use the homologue of the polypeptide that sequence that above-mentioned technology (for example sequence alignment) is identified can think to comprise AT hook structure territory and DUF296 structural domain, described homologue also comprises AT hook structure territory and DUF structural domain, but this homologue can change at the elsewhere of sequence." definition " part has in this manual defined " homologue " of protein.Preferably homologue is that the aminoacid sequence that SEQ ID NO:153 represented by the preferred sequence increasing progressively has at least 30%, 40%, 50%, 60%, 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% or the aminoacid sequence of larger sequence identity, and this homologue comprises AT hook structure territory and DUF296 structural domain and more preferably also comprises primitive 2.

Comprising AT hook structure territory and the polypeptide of DUF296 structural domain or the homologue of this polypeptide can be the derivative of " definition " part definition in this specification sheets.

Encoded packets can be suitable for method of the present invention containing any nucleic acid of the polypeptide of AT hook structure territory and DUF296 structural domain.The example of such sequence comprises the nucleotide sequence being represented by SEQ ID NO:152, SEQ IDNO:154, SEQ ID NO:156, SEQ ID NO:158, SEQ ID NO:160, SEQ IDNO:162, SEQ ID NO:164, SEQ ID NO:166, SEQ ID NO:168 and SEQ IDNO:170..

Encoded packets also can be suitable for implementing method of the present invention containing the variant of the nucleic acid of the polypeptide of AT hook structure territory and DUF296 structural domain, and condition is that variant encoded packets is containing the polypeptide of AT hook structure territory and DUF296 structural domain.This type of nucleic acid variant can be the encoded packets polypeptide that contains AT hook structure territory and DUF296 structural domain nucleic acid part and/or can with the nucleic acid of encoded packets containing the nucleic acid hybridization of the polypeptide of AT hook structure territory and DUF296 structural domain.

Can be for example by being produced to one or more containing the nucleic acid of the polypeptide of AT hook structure territory and DUF296 structural domain, encoded packets lacks to prepare part.Can use part maybe they and other coding (or non-coding) sequences can be merged to for example produce the albumen of several activity of combination with separated form.When merging to other encoding sequences, the polypeptide that the translation of gained produces afterwards can be than large for the size of this part prediction.Preferably, part is the part of the nucleic acid of any expression in SEQ ID NO:152, SEQ ID NO:154, SEQ IDNO:156, SEQ ID NO:158, SEQ ID NO:160, SEQ ID NO:162, SEQ IDNO:164, SEQ ID NO:166, SEQ ID NO:168 and SEQ ID NO:170.Most preferably part is the part of the nucleic acid that represented by SEQ ID NO:152, and this part encoded packets is containing AT hook structure territory and DUF296 structural domain and more preferably also comprise the polypeptide of primitive 2.

Another kind of nucleic acid variant is can be under the stringent condition reducing, preferably under stringent condition with the nucleic acid of encoded packets containing the nucleic acid hybridization of the polypeptide of AT hook structure territory and DUF296 structural domain.Preferably, hybridization sequences be can with the nucleic acid of any expression in SEQ ID NO:152, SEQ ID NO:154, SEQ ID NO:156, SEQ ID NO:158, SEQ ID NO:160, SEQ ID NO:162, SEQ ID NO:164, SEQ ID NO:166, SEQ ID NO:168 and SEQ ID NO:170 or with the above-mentioned sequence of above definition in the sequence of part hybridization of arbitrary sequence.Most preferably, hybridization sequences is the sequence of the nucleic acid hybridization that can represent with SEQ ID NO:152, and this hybridization sequences encoded packets is containing AT hook structure territory and DUF296 structural domain and more preferably comprise the polypeptide of primitive 2.

Term " hybridization " is as the definition in this specification sheets " definition " part.

Another kind of nucleic acid variant is the alternative splicing variant in the definition of " definition " part.The splice variant of the nucleotide sequence being represented by SEQ IDNO:152, SEQ ID NO:154, SEQ ID NO:156, SEQ ID NO:158, SEQ IDNO:160, SEQ ID NO:162, SEQ ID NO:164, SEQ ID NO:166, SEQ IDNO:168 and SEQ ID NO:170 is preferred.The splice variant of the nucleotide sequence being represented by SEQID NO:152 is most preferred, and this splice variant encoded packets contains AT hook structure territory and DUF296 structural domain and more preferably comprises the polypeptide of primitive 2.

Another kind of nucleic acid variant is the allele variant in the definition of " definition " part.The allele variant of the nucleotide sequence being represented by SEQ IDNO:152, SEQ ID NO:154, SEQ ID NO:156, SEQ ID NO:158, SEQ IDNO:160, SEQ ID NO:162, SEQ ID NO:164, SEQ ID NO:166, SEQ IDNO:168 and SEQ ID NO:170 is preferred.The allele variant of the nucleotide sequence being represented by SEQ ID NO:152 is most preferred, and this allele variant encoded packets contains AT hook structure territory and DUF296 structural domain and more preferably comprises the polypeptide of primitive 2.

Also can pass through orthogenesis (referring to " definition " part) and obtain nucleic acid variant.

Also can use directed mutagenesis to produce encoded packets containing the variant of the nucleic acid of the polypeptide of AT hook structure territory and DUF296 structural domain.Referring to " definition " part.

Encoded packets can derive from any natural or artificial source containing the nucleic acid of the polypeptide of AT hook structure territory and DUF296 structural domain.Can be from microbe-derived for example yeast or fungi or from plant, algae or animal-origin isolating nucleic acid/gene or its variant.Can in composition and/or genome environment, from its natural form, modify this nucleic acid by the manual operation of having a mind to.Nucleic acid is plant origin preferably, can for example, from identical plant species (plant species to be imported from it is identical) or can be from different plant species.Can be from dicotyledons species, preferably from monocotyledons species separated this nucleic acid of rice for example.More preferably, encoded packets represents by SEQID NO:152 containing the rice nucleic acid of the polypeptide of AT hook structure territory and DUF296 structural domain, and the polypeptide being encoded is the polypeptide being represented by SEQ ID NO:153.

Can, by importing genetic modification (preferably in encoded packets in the locus containing the gene of the polypeptide of AT hook structure territory and DUF296 structural domain), regulate the expression of the nucleic acid of coding AT hook.The locus of the gene of definition is used for representing genome area herein, and this region comprises 10kb upstream or the downstream of goal gene and coding region.

Can be for example by following method: any (or multiple) method and import genetic modification containing the nucleic acid of the polypeptide of AT hook structure territory and DUF296 structural domain by import and express encoded packets in monocotyledons in T-DNA activation, TILLING and homologous recombination.About the details of T-DNA activation, TILLING and homologous recombination referring to " definition " part.After importing genetic modification, can select step with regard to the expression of encoded packets increase in endosperm tissue containing the nucleic acid of the polypeptide of AT hook structure territory and DUF296 structural domain, the expression of this orientation causes having the plant of the seed production of increase.

The selection that activates the promotor of label for T-DNA in situation of the present invention can be preferentially at monocotyledonous endosperm tissue, to instruct any promotor of expressing.

T-DNA activates and TILLING makes it possible to produce encoded packets containing the neomorph of nucleic acid of polypeptide and the example of the technology of variant of AT hook structure territory and DUF296 structural domain.

The preferred method that is used for importing genetic modification (its in this situation needn't in encoded packets the locus containing the nucleic acid/gene of the polypeptide of AT hook structure territory and DUF296 structural domain) is in plant, to import and express encoded packets containing the nucleic acid of the polypeptide of AT hook structure territory and DUF296 structural domain.The nucleic acid of plant to be imported can be that total length nucleic acid can be maybe part or any other variant nucleic acid, and condition is the polypeptide that variant nucleic acid encoding comprises AT hook structure territory and DUF296 structural domain.

Method of the present invention depends on preferentially increases encoded packets containing the expression of the nucleic acid of the polypeptide of AT hook structure territory and DUF296 structural domain in monocotyledonous endosperm tissue.This can be by the promoters driven by suitable cross the making for realizing of expression, transcriptional enhancer or translational enhancer.Can import the separated nucleic acid as promotor or enhancer element, the above tone coded gene/nucleic acid of polypeptide that comprises AT hook structure territory and DUF296 structural domain or the expression of its variant at the correct position (conventionally in upstream) of the polynucleotide of non-allos form.For example, can by sudden change, disappearance and/or displacement change in vivo endogenesis promoter (referring to, Kmiec, United States Patent (USP) 5,565,350; The people such as Zarling, PCT/US93/03868), or can import vegetable cell with the expression of controlling gene with distance (with respect to gene of the present invention) by separated promotor with suitable direction.

If expectation express polypeptide, the 3 ' end that is conventionally desirably in polynucleotide encoding district comprises polyadenylation region.Polyadenylation region can derive from natural gene, derives from multiple other plant gene or derives from T-DNA.3 ' the end sequence being added into can derive from for example nopaline synthase or octopine synthase gene, or selectively derives from another kind of plant gene, or does not more preferably derive from any other eukaryotic gene.

S introne

Therefore, provide gene construct, it comprises:

(i) encoded packets is containing the nucleic acid of the polypeptide of AT hook structure territory and DUF296 structural domain;

(ii) can in monocotyledonous endosperm tissue, drive one or more control sequences of the nucleotide sequence expression of (i); Optionally

(iii) transcription termination sequence.

The purposes of the construct that the present invention also provides above definition in the method for increasing monocotyledonous seed production.

Can use recombinant DNA technology well known to those skilled in the art to build the construct for method of the present invention.Gene construct can be inserted to the carrier that is suitable for being transformed into plant and is suitable for expressing goal gene in transformant, the commercially available acquisition of this carrier.The construct that the present invention also provides above definition is for increasing the purposes in the method for seed production in monocotyledons.

The carrier transforming monocots that use comprises aim sequence (that is, encoded packets is containing the nucleic acid of the polypeptide of AT hook structure territory and DUF296 structural domain).Aim sequence is effectively connected with one or more control sequences (at least with promotor) that can preferentially increase expression in monocotyledonous endosperm tissue.Term " controlling element ", " control sequence " and " promotor " are all used interchangeably herein, and are defined in " definition " part.

Endosperm specificity promoter refers to any promotor that can preferentially drive destination gene expression in endosperm tissue.That mentions preferentially increase to express herein in endosperm tissue, refers to mainly and increases and express in endosperm tissue, and except due to the former of seepage promotor thereby any residual expression that causes, get rid of the expression of elsewhere in plant.For example, prolamine promotor shows strongly expressed in endosperm, at meristematic tissue, more particularly in the discriminationcentre in stem meristematic tissue and/or meristematic tissue, has leakage expression.

Preferably, endosperm specificity promoter is the promotor from prolamine gene isolation, such as the paddy prolamine RP6 being represented by SEQ ID NO:195 (people such as Wen, (1993) Plant Physiol101 (3): the 1115-6) promotor of promotor or similar intensity and/or there is the promotor of the expression pattern similar to paddy Prolamin promoter.Can be for example by promotor be analyzed to similar intensity and/or similar expression pattern to reporter gene coupling with the function of examining report gene in the tissue of plant.A well-known reporter gene is β-glucuronidase and dyes for manifesting the colorimetric GUS of the β-glucuronidase activity of plant tissue.Should be understood that, suitability of the present invention is not limited to the nucleic acid being represented by SEQ ID NO:152, and suitability of the present invention is not limited to the expression by the coding AT hook structure territory of prolamine promoters driven and the nucleic acid of DUF296 structural domain yet.The example that also can be used for implementing other endosperm specificity promoters of method of the present invention is shown in table 6 of " definition " part.

Gene construct optionally comprises selectable marker gene defined herein.

In preferred embodiments, provide gene construct, it comprises:

(ii) can preferentially in monocotyledonous endosperm tissue, drive the prolamine promotor of the nucleotide sequence expression of (i); Optionally

(iii) transcription termination sequence.

The present invention also comprises the monocotyledons that can obtain by method of the present invention.Therefore the invention provides monocotyledons, its plant part (comprising vegetable cell) that can obtain by method of the present invention, described plant or its part comprise the transgenosis of polypeptide that coding contains AT hook structure territory and DUF296 structural domain, described transgenosis and endosperm specificity promoter, preferably prolamine promotor effectively connects.

The present invention also provides for generation of the monocotyledonous method of transgenosis of comparing the seed production with increase with suitable control plant, described method is included in monocotyledons and imports and express encoded packets containing the nucleic acid of the polypeptide of AT hook structure territory and DUF296 structural domain, and wherein said expression is preferentially increased in monocotyledonous endosperm tissue.

More particularly, the invention provides for generation of the monocotyledonous method of transgenosis with the seed production of increase, described method comprises:

(i) in monocotyledonous endosperm tissue, import and preferentially increase therein encoded packets containing the expression of the nucleic acid of the polypeptide of AT hook structure territory and DUF296 structural domain; With

Nucleic acid directly can be imported to monocotyledonous vegetable cell or import plant itself (comprising the tissue, organ or any other part that import plant).According to a preferred aspect of the present invention, preferably by transforming, nucleic acid is imported to plant.

" definition " part at this specification sheets has defined term " conversion ".

The present invention clearly extends to any vegetable cell or the plant producing by any method described herein, and extends to its all plant parts and its propagulum.The present invention extends further to the offspring of the cell, tissue, organ or the complete plant that comprise the primary conversion that produces by any aforesaid method or transfection, and unique requirement is genotype and/or identical genotype and/or the phenotypic characteristic of phenotypic characteristic that this offspring shows with parent produces in the method for the invention.

The present invention also comprises the host cell of the nucleic acid of the polypeptide that comprising encodes contains AT hook structure territory and DUF296 structural domain, and wherein this nucleic acid is effectively connected with endosperm specificity promoter.Preferred host cell of the present invention is monocot plant cell.

The present invention also extends to the monocotyledonous part of gathering in the crops such as but not limited to seed, leaf, fruit, flower, stem, rhizome, stem tuber and bulb.The invention still further relates to and derive from, be preferably directed to the product of the part gathered in the crops of such plant, for example granulated feed grain or dry powder, oil, fat and lipid acid, starch or protein.

The present invention also comprises that the nucleic acid that encoded packets contains the polypeptide of AT hook structure territory and DUF296 structural domain is being used method of the present invention to increase the purposes in monocotyledonous seed production.

the detailed description of DOF transcription factor

The term " DOF transcription factor polypeptide " of definition refers to and comprises following feature (i) and as follows feature (ii) or any polypeptide (iii) extraly herein:

(i) by the preferred sequence increasing progressively, the DOF structural domain being represented by SEQ ID NO:200 or SEQ ID NO:228 is had at least 60%, 65%, 70%, 75%, 80%, 85%, 90% or 95% sequence identity; With

(ii) by the preferred sequence increasing progressively, the DOF structural domain being represented by SEQ ID NO:200 there is at least 70%, 75%, 80%, 85%, 90% or 95% sequence identity; Or

(iii) primitive I: unconverted or have that one or more conservative propertys in any position change or there are, two or three KALKKPDKILP (SEQ ID NO:229) that the non-conservation in any position changes; And/or

Primitive II: unconverted or have that one or more conservative propertys in any position change or there are one, two or three DDPGIKLFGKTIPF (SEQ ID NO:230) that the non-conservation in any position changes.

In addition the polypeptide that, comprises above-mentioned feature (i) and feature (iii) can comprise any one in following primitive, any two or all three primitives:

-primitive III: unconverted or have that one or more conservative propertys in any position change or there are one, two or three SPTLGKHSRDE in the non-conservative variation of any position (SEQ ID NO:231); And/or

-primitive IV: unconverted or have that one or more conservative propertys in any position change or there are one, two or three LQANPAALSRSQNFQE (SEQ ID NO:232) that the non-conservation in any position changes; And/or

-primitive V: unconverted or have that one or more conservative propertys in any position change or there are one, two, three, four or five KGEGCLWVPKTLRIDDPDEAAKSSIWTTLGIK (SEQ ID NO:233) that the non-conservation in any position changes.

A preferred polypeptide that comprises above-mentioned feature (i) and feature (iii) comprises primitive I and II simultaneously.

In addition, DOF transcription factor polypeptide (at least with its natural form) conventionally has DNA binding activity and has activation structure territory.Can use routine techniques and method easily to determine the existence of activation structure territory and DNA binding activity by those skilled in the art.

SEQ ID NO:199 (being encoded by SEQ ID NO:198) comprises above the feature (i) of definition and the example of DOF transcription factor polypeptide (ii), that is, there is at least 60% sequence identity with the DOF structural domain being represented by SEQ ID NO:200 or SEQ IDNO:228; There is at least 70% sequence identity with the DOF structural domain with being represented by SEQ IDNO:200.SEQ ID NO:202 (being encoded by SEQ ID NO:201), SEQ ID NO:204 (being encoded by SEQ ID NO:203), SEQ ID NO:206 (being encoded by SEQ ID NO:205), SEQ ID NO:208 (being encoded by SEQID NO:207), SEQ ID NO:210 (being encoded by SEQ ID NO:209), SEQ ID NO:212 (being encoded by SEQ ID NO:211), SEQ ID NO:214 (being encoded by SEQ ID NO:213), SEQ ID NO:216 (being encoded by SEQ ID NO:215), SEQ ID NO:218 (being encoded by SEQID NO:217), SEQ ID NO:220 (being encoded by SEQ ID NO:219), in SEQ ID NO:222 (being encoded by SEQ ID NO:221), provided and comprised above the feature (i) of definition and other examples of DOF transcription factor polypeptide (ii)..

SEQ ID NO:227 (being encoded by SEQ ID NO:226) comprises above the feature (i) of definition and (iii) (that is, has at least 60% sequence identity with the DOF structural domain being represented by SEQ ID NO:200 or SEQ ID NO:228; Above primitive I and/or the primitive II of definition) the example of DOF transcription factor polypeptide.SEQ ID NO:235 (being encoded by SEQ ID NO:234), SEQ ID NO:237 (being encoded by SEQ ID NO:236), SEQ ID NO:239 (being encoded by SEQ IDNO:238), SEQ ID NO:241 (being encoded by SEQ ID NO:240), SEQ ID NO:243 (being encoded by SEQ ID NO:242), SEQ ID NO:245 (being encoded by SEQ ID NO:244), SEQ ID NO:247 (being encoded by SEQ ID NO:246), SEQ ID NO:249 (being encoded by SEQID NO:248), SEQ ID NO:251 (being encoded by SEQ ID NO:250), SEQ ID NO:253 (being encoded by SEQ ID NO:252), in SEQ ID NO:255 (being encoded by SEQ ID NO:254), provided and comprised above the feature (i) of definition and other examples of DOF transcription factor polypeptide (iii).

Other examples that represented by SEQ ID NO:202, SEQ ID NO:204, SEQ ID NO:206, SEQ ID NO:208, SEQ ID NO:210, SEQ ID NO:212, SEQ ID NO:214, SEQ ID NO:216, SEQ ID NO:218, SEQ ID NO:220, SEQ ID NO:222 are the examples of " homologue " of the DOF transcription factor polypeptide that represented by SEQ ID NO:199.

Other examples that represented by SEQ ID NO:235, SEQ ID NO:237, SEQ ID NO:239, SEQ ID NO:241, SEQ ID NO:243, SEQ ID NO:245, SEQ ID NO:247, SEQ ID NO:249, SEQ ID NO:251, SEQ ID NO:253, SEQ ID NO:255 are the examples of " homologue " of the DOF transcription factor polypeptide that represented by SEQ ID NO:227..

" definition " part has in this manual defined " homologue " of protein.

DOF transcription factor polypeptide or its homologue can be derivatives.In " definition " part, defined " derivative " in this manual.

Can use special database such as SMART (people (1998) Proc.Natl.Acad.Sci.USA 95 such as Schultz, 5857-5864; The people such as Letunic (2002) Nucleic Acids Res 30,242-244; Http:// smart.embl-heidelberg.de/), InterPro (people such as Mulder, (2003) Nucl.Acids.Res.31,315-318; Http:// WWW.ebi.ac.uk/interpro/), Prosite (Bucher and Bairoch (1994), A generalized profile syntax for biomolecularsequences motifs and its function in automatic sequence interpretation. (In) ISMB-94; The 2nd international conference of molecular biology intelligent system recorded Altman R., Brutlag D., Karp P., Lathrop R., Searls D., Eds., pp53-61, AAAIPress, Menlo Park; The people such as Hulo, Nucl.Acids.Res.32:D134-D137, (2004), http://www.expasy.org/prosite/) or the Pfam (people such as Bateman, Nucleic Acids Research 30 (1): 276-280 (2002), http://www.sanger.ac.uk/Software/Pfam/), identify for example DOF structural domain of various structural domains in DOF transcription factor protein.

The example of the nucleic acid of encoding D OF transcription factor polypeptide (with its homologue) comprises by SEQ IDNO:198, SEQ ID NO:201, SEQ ID NO:203, SEQ ID NO:205, SEQ IDNO:207, SEQ ID NO:209, SEQ ID NO:211, SEQ ID NO:213, SEQ IDNO:215, SEQ ID NO:217, SEQ ID NO:219, SEQ ID NO:221, SEQ IDNO:226, SEQ ID NO:234, SEQ ID NO:236, SEQ ID NO:238, SEQ IDNO:240, SEQ ID NO:242, SEQ ID NO:244, SEQ ID NO:246, SEQ IDNO:248, SEQ ID NO:250, the nucleic acid of any expression in SEQ ID NO:252 and SEQ ID NO:254.The variant of the nucleic acid of encoding D OF transcription factor polypeptide can be suitable for method of the present invention.Suitable variant comprise encoding D OF transcription factor polypeptide nucleic acid part and/or can with the nucleic acid of the nucleic acid/gene recombination of encoding D OF transcription factor polypeptide.Other variants comprise splice variant and the allele variant of the nucleic acid of encoding D OF transcription factor polypeptide (with its homologue).

The term " part " of definition refers to that encoded packets contains following feature (i) and the following fragment of the DNA of feature (ii) or polypeptide (iii) extraly herein:

In addition, above-mentioned feature (iii) can comprise any one in following primitive, any two or all three primitives:

Can for example by being produced to one or more disappearances, the nucleic acid of encoding D OF transcription factor polypeptide prepare part.Can use part maybe they and other coding (or non-coding) sequences can be merged to for example produce the albumen of several activity of combination with separated form.When merging to other encoding sequences, the polypeptide that the translation of gained produces afterwards can be larger than the size of partly predicting for this DOF transcription factor.

Encoded packets containing the above feature (i) of definition and the part of the nucleic acid of DOF transcription factor polypeptide (ii) preferably by the part of the nucleic acid of any one expression in SEQ ID NO:198, SEQ ID NO:201, SEQ ID NO:203, SEQID NO:205, SEQ ID NO:207, SEQ ID NO:209, SEQ ID NO:211, SEQID NO:213, SEQ ID NO:215, SEQ ID NO:217, SEQ ID NO:219 and SEQID NO:221.

Encoded packets containing the above feature (i) of definition and the part of the nucleic acid of DOF transcription factor polypeptide (iii) preferably by the part of the nucleic acid of any one expression in SEQ ID NO:226, SEQ ID NO:234, SEQ ID NO:236, SEQID NO:238, SEQ ID NO:240, SEQ ID NO:242, SEQ ID NO:244, SEQID NO:246, SEQ ID NO:248, SEQ ID NO:250, SEQ ID NO:252 and SEQID NO:254.

The another kind of variant of DOF transcription factor nucleic acid/gene is can be under the stringent condition reducing, preferably under stringent condition with the nucleic acid of the DOF transcription factor nucleic acid/gene recombination of definition above, this hybridization sequences encoded packets is containing following feature (i) and feature (ii) or polypeptide (iii) as follows extraly:

Preferably, encoded packets containing the feature (i) of above definition and the hybridization sequences of DOF transcription factor polypeptide (ii) be can with by the sequence of the nucleic acid hybridization of any expression in SEQ ID NO:201, SEQ ID NO:203, SEQ ID NO:205, SEQ ID NO:207, SEQ ID NO:209, SEQ ID NO:211, SEQ ID NO:213, SEQ ID NO:215, SEQ ID NO:217, SEQ ID NO:219 and SEQ ID NO:221.

Preferably, encoded packets containing the feature (i) of above definition and the hybridization sequences of DOF transcription factor polypeptide (iii) be can with by the sequence of the nucleic acid hybridization of any expression in SEQ ID NO:234, SEQ ID NO:236, SEQ ID NO:238, SEQ ID NO:240, SEQ ID NO:242, SEQ ID NO:244, SEQ ID NO:246, SEQ ID NO:248, SEQ ID NO:250, SEQ ID NO:252 and SEQ ID NO:254.

DOF transcription factor polypeptide can be encoded by alternative splicing variant.Term " alternative splicing variant " is " the alternative splicing variant " defining in " definition " part in this specification sheets.

Preferably splice variant is that encoded packets contains following feature (i) and the splice variant of the nucleic acid of feature (ii) or polypeptide (iii) as follows extraly:

Encoded packets is by the splice variant of the nucleic acid of any one expression in SEQ ID NO:201, SEQ ID NO:203, SEQ ID NO:205, SEQ ID NO:207, SEQ ID NO:209, SEQ ID NO:211, SEQ ID NO:213, SEQ ID NO:215, SEQ ID NO:217, SEQ ID NO:219 and SEQ ID NO:221 containing the above feature (i) of definition and the preferred splice variant of the nucleic acid of DOF transcription factor polypeptide (ii).

Encoded packets containing the above feature (i) of definition and the preferred splice variant of the nucleic acid of DOF transcription factor polypeptide (iii) preferably by the splice variant of the nucleic acid of any one expression in SEQ ID NO:234, SEQ ID NO:236, SEQ ID NO:238, SEQ ID NO:240, SEQ ID NO:242, SEQ ID NO:244, SEQ ID NO:246, SEQ ID NO:248, SEQ ID NO:250, SEQ ID NO:252 and SEQ ID NO:254.

DOF transcription factor polypeptide also can be encoded by allele variant, and described allelotrope body is also defined in " definition " part of this specification sheets.

Preferably allele variant is that encoded packets contains following feature (i) and the allele variant of the nucleic acid of feature (ii) or polypeptide (iii) as follows extraly:

Encoded packets is by the splice variant of the nucleic acid of any one expression in SEQ ID NO:201, SEQ ID NO:203, SEQ ID NO:205, SEQ ID NO:207, SEQ ID NO:209, SEQ ID NO:211, SEQ ID NO:213, SEQ ID NO:215, SEQ ID NO:217, SEQ ID NO:219 and SEQ ID NO:221 containing the above feature (i) of definition and the preferred allele variant of the nucleic acid of DOF transcription factor polypeptide (ii).

Encoded packets containing the above feature (i) of definition and the preferred allele variant of the nucleic acid of DOF transcription factor polypeptide (iii) preferably by the part of the nucleic acid of any one expression in SEQ ID NO:234, SEQ ID NO:236, SEQ ID NO:238, SEQ ID NO:240, SEQ ID NO:242, SEQ ID NO:244, SEQ ID NO:246, SEQ ID NO:248, SEQ ID NO:250, SEQ ID NO:252 and SEQ ID NO:254.

Can use the directed mutagenesis defining in this specification sheets " definition " part for example, produce above other variants of the nucleic acid of the DOF transcription factor polypeptide of definition of coding.

Also can use orthogenesis (or gene shuffling) to produce the variant of the nucleic acid of encoding D OF transcription factor polypeptide.Referring to " definition " part.

DOF transcription factor polypeptide is that plant is specific.The nucleic acid of coding said polypeptide can derive from any natural or artificial source.Can in composition and/or genome environment, from its natural form, modify this nucleic acid by the manual operation of having a mind to.Preferably DOF transcription factor nucleic acid or its variant are from dicotyledons, and more preferably from Cruciferae, more preferably nucleic acid is from Arabidopis thaliana.

Can increase by importing genetic modification (preferably in the locus of DOF transcription factor gene) expression of the nucleic acid of encoding D OF transcription factor polypeptide.The locus of the gene of definition is used for representing genome area herein, and this genome area comprises 10kb upstream or the downstream of goal gene and coding region.

Can be for example by following method: any (or multiple) method or import genetic modification by import and express the nucleic acid of encoding D OF transcription factor polypeptide in plant in T-DNA activation, TILLING and homologous recombination.The method of T-DNA activation, TILLING and homologous recombination is as the definition in " definition " part of this specification sheets.After importing genetic modification, with regard to the expression of the increase of the nucleic acid of encoding D OF transcription factor polypeptide, carry out optional selection step, wherein the expression of this increase causes having the plant of the output of increase.

T-DNA activates and TILLING is the example that makes it possible to produce the technology of neomorph and DOF transcription factor variant.

The preferred method that is used for importing genetic modification (its in this situation needn't at the locus of DOF transcription factor gene) is in plant, to import and express the above nucleic acid of the DOF transcription factor polypeptide of definition of coding.The nucleic acid of plant to be imported can be total length nucleic acid can be maybe as defined above part or hybridization sequences or other nucleic acid variant.

Method of the present invention depends on the expression of increase of the nucleic acid of encoding D OF transcription factor polypeptide.Method existing lot of documents report in this area for increasing the expression of gene or gene product, for example comprises, uses the use of crossing expression, transcriptional enhancer or translational enhancer of suitable promoters driven.Can import the separated nucleic acid as promotor or enhancer element, the expression of the nucleic acid of above tone coded DOF transcription factor polypeptide at the correct position (conventionally in upstream) of the polynucleotide of non-allos form.For example, can by sudden change, disappearance and/or displacement change in vivo endogenesis promoter (referring to, Kmiec, United States Patent (USP) 5,565,350; The people such as Zarling, PCT/US93/03868), or can import vegetable cell with the expression of controlling gene with distance (with respect to gene of the present invention) by separated promotor with suitable direction.

S introne

1,2 and 6, Bronze-1 intron is known in this area.About general information, referring to, The Maize Handbook, Chapter 116, Freeling and Walbot, Eds., Springer, N.Y. (1994).

Therefore, provide gene construct, it comprises:

(i) nucleic acid or its variant of the DOF transcription factor polypeptide that coding above defines;

(iii) transcription termination sequence.

Can use recombinant DNA technology well known to those skilled in the art to build the construct for method of the present invention.Can be by gene construct insertion vector, the commercially available acquisition of this carrier, be suitable for being transformed into plant and be suitable for expressing goal gene in transformant.Therefore the gene construct that the invention provides above definition purposes in the method for the invention.

The carrier conversion of plant that use comprises aim sequence (that is, the nucleic acid of encoding D OF transcription factor polypeptide).Aim sequence is effectively connected with one or more control sequences (at least with promotor).Term " controlling element ", " control sequence " and " promotor " are all used interchangeably herein, and are defined in " definition " part of this specification sheets.

Advantageously, can use the expression of promotor (no matter being natural or synthetic) the driving nucleotide sequence of any type.

According to a preferred feature of the present invention, the constitutive promoter defining in " definition " part of DOF transcription factor nucleic acid or its variant and this specification sheets is effectively connected.Constitutive promoter is GOS2 promotor preferably, more preferably constitutive promoter is rice GOS2 promotor, more preferably constitutive promoter by SEQ ID NO:225 substantially similar nucleotide sequence represent, most preferably constitutive promoter is the promotor being represented by SEQ ID NO:225.Preferably constitutive promoter is for driving the expression of nucleic acid, described nucleic acid encoding comprises above the feature (i) of definition and (ii) (that is, the DOF structural domain being represented by SEQ IDNO:200 or SEQ ID NO:228 is had at least 60% sequence identity; With the sequence identity DOF structural domain being represented by SEQ ID NO:200 to at least 70%) DOF transcription factor polypeptide.

Should be understood that, suitability of the present invention is not limited to the DOF transcription factor nucleic acid being represented by SEQ ID NO:198, and suitability of the present invention is not limited to the expression by the DOF transcription factor nucleic acid of GOS2 promoters driven yet.The example that also can be used for implementing other constitutive promoters of method of the present invention is shown in the table 3 of " definition " part of this specification sheets.

According to another preferred aspect of the present invention, by the nucleic acid of encoding D OF transcription factor polypeptide and seed specific promoters (, mainly in seed tissue, express, but can thereby at other positions of plant, there is the promotor of residual expression due to the former of seepage promoter expression) effectively connect.More preferably, from coding seed storage protein gene isolation seed specific promoters, particularly endosperm specificity promoter.Most preferably, from prolamine gene isolation endosperm specificity promoter, such as the paddy prolamine RP6 being represented by the SEQID NO:258 (people such as Wen, (1993) Plant Physiol101 (3): 1115-6) promotor, or have to the promotor of the similar intensity of this paddy Prolamin promoter and/or there is the promotor of the expression pattern similar to this paddy Prolamin promoter.Can be for example by promotor be analyzed to similar intensity and/or similar expression pattern to reporter gene coupling with the function of examining report gene in the tissue of plant.A well-known reporter gene is β-glucuronidase and dyes for manifesting the colorimetric GUS of the β-glucuronidase activity of plant tissue.Prolamine promotor shows strongly expressed in endosperm, in meristematic tissue, more particularly in stem meristematic tissue and/or merismatic discrimination centre, shows leakage expression.

According to the present invention, preferably use seed specific promoters, particularly endosperm specificity promoter, drives encoded packets (the DOF structural domain being represented by SEQ ID NO:200 or SEQID NO:228 to be had at least 60% sequence identity containing the feature (i) of above definition with (iii); With primitive I and primitive II) the expression of nucleic acid of DOF transcription factor polypeptide.

Should be understood that, suitability of the present invention is not limited to the DOF transcription factor nucleic acid being represented by SEQ ID NO:226, and suitability of the present invention is not limited to the expression by the DOF transcription factor nucleic acid of prolamine promoters driven yet.

The example of seed specific promoters is shown in the table 7 of this specification sheets " definition " part, and described promotor or derivatives thereof can be used for implementing method of the present invention.

Optionally, can also be by one or more terminator sequences for importing the construct of plant." definition " part at this specification sheets has defined term " terminator ".

Gene construct of the present invention also can comprise in order to maintain and/or copy necessary replication orgin sequence in specific cell type.Example is that gene construct is when need to for example, remain in bacterial cell as additive type genetic elements (plasmid or clay molecule).Preferred replication orgin includes but not limited to f1-ori or colE1.

Gene construct optionally comprises the selectable marker gene of this specification sheets " definition " part definition.

The present invention also comprises the plant that can obtain by method of the present invention.Therefore the invention provides plant, its plant part or the vegetable cell that can obtain by method of the present invention, the nucleic acid transgenosis that described plant or its part or cell comprise encoding D OF transcription factor polypeptide (or as defined above its variant).

The present invention also provides for generation of compare the method for the transgenic plant of the output with increase with suitable control plant, and described method is included in nucleic acid or its variant that imports and express encoding D OF transcription factor polypeptide in plant.

(i) in plant, plant part or vegetable cell, import and express nucleic acid or its variant of DOF transcription factor polypeptide; With

Term " conversion " is the conversion of " definition " part definition in this specification sheets.

The present invention also comprises the separated nucleic acid that comprises encoding D OF transcription factor polypeptide or the host cell of its variant.Preferred host cell of the present invention is vegetable cell.

The present invention also extends to the part gathered in the crops of plant such as but not limited to seed, leaf, fruit, flower, stem, rhizome, stem tuber and bulb.The invention still further relates to and derive from, be preferably directed to the product of the part gathered in the crops of such plant, for example dry granulated feed or dry powder, oil, fat and lipid acid, starch or protein.

The present invention also comprises that the nucleic acid of encoding D OF transcription factor polypeptide or its variant and DOF transcription factor polypeptide increase the above purposes of the plant biomass of definition in the method for the invention.

The nucleic acid of encoding D OF transcription factor polypeptide or its variant, or DOF transcription factor polypeptide can be used for the procedure of breeding, in the described procedure of breeding, identify can with the DNA marker of DOF transcription factor gene or its variant genetic linkage.This nucleic acid/gene or its variant, or DOF transcription factor polypeptide can be used for defining molecule marker.Then this DNA or protein labeling can be used for to the procedure of breeding to select in the method for the invention to have the plant of the output increasing as defined above.

The allele variant of DOF transcription factor nucleic acid/gene also can be used for marker-assisted breeding program.This type of procedure of breeding needs sometimes by plant is carried out to mutagenic treatment, uses for example EMS mutagenesis to import allelic variation; Selectively, this program can start from the set of the allele variant in non-so-called " natural " source producing intentionally.Then by for example PCR, carry out the evaluation of allele variant.Select afterwards step, to select to cause good allele variant output, goal gene of increase.The growth performance of the plant of the different allele variants that conventionally comprise aim sequence by monitoring is selected.Can be in greenhouse or monitor on field growth performance.Other optional step comprises and will wherein identify plant and other plant hybridization of good allele variant.This can be used for for example producing the combination of significant phenotypic characteristic.

The nucleic acid of encoding D OF transcription factor polypeptide or its variant also can be used as gene (described nucleic acid or its variant are the parts of described gene) to carry out heredity and the probe of physical mapping, and the mark of conduct and the proterties of these gene linkages.This Information Availability has the strain of the phenotype of expectation with generation in plant breeding.It is the nucleotide sequence of at least 15 Nucleotide that this purposes of DOF transcription factor nucleic acid or its variant only needs length.DOF transcription factor nucleic acid or its variant can be used as restriction fragment length polymorphism (RFLP) mark.Available DOF transcription factor nucleic acid or its variant are surveyed Southern trace (the Sambrook J of the plant genome DNA of restrictive diges-tion, Fritsch EF and Maniatis T (1989) Molecular Cloning, A Laboratory Manual).Then use computer program such as MapMaker people (1987) Genomics 1:174-181 such as () Lander that the banding pattern of gained is carried out to genetic analysis to build genetic map.In addition, can use the Southern trace of the genomic dna that nuclei acid probe comprises one group of individuality that restriction endonuclease processes, wherein this group individuality represents parent and the offspring of definite genetic cross.Record the separation of DNA polymorphism, use it for and calculate position in the genetic map that uses before this colony to obtain of DOF transcription factor nucleic acid or its variant people (1980) Am.J.Hum.Genet.32:314-331 such as () Botstein.

Generation and the application of the probe of originating for the plant gene of genetic mapping have been described in Bernatzky and Tanksley (1986) (Plant Mol.Biol.Report 4:37-41).Many publications have been described the genetic mapping that uses aforesaid method or its modification to carry out specific cDNA clone.For example, the individuality of F2 hybrid Population, backcross population, panmictic population, near isogenic line and other groups can be used for mapping.These class methods are known to those skilled in the art.

Can use nucleic acid to carry out the multiple method based on nucleic acid amplification for heredity and physical mapping.Example comprises the polymorphism (CAPS of the fragment of allele specific amplification (Kazazian (1989) J.Lab.Clin.Med 11:95-96), pcr amplification; The people such as Sheffield (1993) Genomics16:325-332), allele-specific connects people (1988) Science241:1077-1080 such as () Landegren, Nucleotide extension (Sokolov (1990) Nucleic Acid Res.18:3671), radioactivity hybridization mapping people (1997) Nat.Genet.7:22-28 such as () Walter and Happy map (Dear and Cook (1989) Nucleic Acid Res.17:6795-6807).For these methods, the sequence of nucleic acid is used for designing and producing the primer pair for amplified reaction or primer extension reaction.The design of this type of primer is known to those skilled in the art.In the method for genetic mapping of using PCR-based, may must in the region corresponding to this nucleotide sequence, identify the DNA sequence dna difference of mapping between the parent of hybridizing.Yet this is conventionally optional for drawing method.

Method of the present invention causes producing the plant of the above described output with increase.Also can be by the output of this increase and other economic favourable proterties, for example other increase output proterties, to other abiotic and biological resistances of coercing, modify different structure feature and/or biological chemistry and/or physiological characteristic proterties combined.

the detailed description of CKI

The preferentially expression of " minimizing " endogenous CKI gene in albumen tissue of herein mentioning, be used in reference to the endogenous CKI gene expression dose of finding in the endosperm tissue of wild-type plant and compare, reduce or substantially eliminate the expression of endogenous CKI gene (in endosperm tissue).This minimizing of endogenous CKI genetic expression or basically eliminate can cause CKI protein level and/or active minimizing or elimination substantially in albumen tissue.

" endogenous " CKI gene of herein mentioning not only refers to the CKI gene of finding in plant with its natural form (that is, without any artificial intervention), but also refers to import subsequently the separated CKI gene of plant.For example, comprise minimizing or the basically eliminate (in endosperm tissue) that the genetically modified transgenic plant of CKI may run into the genetically modified minimizing of CKI or basically eliminate and/or endogenous CKI gene.

Can use one or more methods in several gene silencing methods of knowing, realize this minimizing (or basically eliminate) of endogenous CKI genetic expression." gene silencing " or expression " downward ", as used herein, refer to minimizing or the basically eliminate of CKI genetic expression and/or CKI polypeptide level and/or CKI polypeptide active.

For reducing or such method of the endogenous CKI genetic expression of basically eliminate is the downward (RNA is reticent) of the genetic expression of RNA mediation.In this case by substantially triggering reticent in plant with the double stranded rna molecule (dsRNA) of target CKI DNA homolog.This dsRNA can by plant be further processed into be called short interfering rna (siRAN) about 21 to about 26 Nucleotide.SiRNA is integrated into the silencing complex (RISC) of RNA induction, the mRNA of this complex body cutting CKI target gene, thus reduce or substantially eliminate the number of the CKI mRNA that needs to be translated into CKI albumen.

An example of RNA silencing methods relates to sense orientation encoding sequence or its part importing plant." sense orientation " refers to the DNA with its mRNA transcript homology.Import the DNA of plant thereby will be at least one additional copy (completely or partially) that has been present in the CKI gene in host plant.This extra gene or its part will cause the silence of endogenous CKI gene, produce the phenomenon that is called co-suppression.If several additional copies are imported to plant, the minimizing of CKI genetic expression will be more obvious, and this is because there is positive correlation between high transcriptional level and the triggering of co-suppression.

Another example of RNA silencing methods relates to use antisense CKI nucleotide sequence." antisense " and nucleic acid comprises with " having justice " nucleic acid of proteins encoded complementary, for example complementary or complementary with mRNA sequence with the coding strand of double-stranded cDNA molecule, nucleotide sequence.Therefore, antisense nucleic acid can form hydrogen bond with there being phosphorothioate odn.Antisense nucleic acid can with whole CKI coding strand or only complementary with its part.Antisense nucleic acid molecule can be to the nucleotide sequence of coding CKI " ”Huo“ non-coding region, coding region " antisense of coding strand.Term " coding region " refers to the region of the nucleotide sequence that comprises the codon of translating into amino-acid residue.Term " non-coding region " refer to be positioned at not translating into of coding region flank amino acid whose 5 ' and 3 ' sequence (that is, also referred to as 5 ' and 3 ' non-translational region).

Can be according to Watson and Crick base pairing rules design antisense nucleic acid.Antisense nucleic acid molecule can be complementary with the whole coding region of CKI mRNA, but its oligonucleotide to a part of antisense of the coding of CKI mRNA or non-coding region only preferably.For example, antisense oligonucleotide can with the regional complementarity of translation initiation position around CKImRNA.The length of suitable antisense oligonucleotide is known and can starts from the length of about 20 Nucleotide or shorter in this area.Can use chemosynthesis and use the method known in the art to carry out enzyme ligation, build antisense nucleic acid of the present invention.For example, chemosynthesis antisense nucleic acid (for example can to use the Nucleotide of natural generation or various modified Nucleotide (described modified Nucleotide through design can in order to increase the biological stability of molecule or to increase antisense and have the physical stability of the duplex forming between phosphorothioate odn), antisense oligonucleotide), the Nucleotide that for example, can use phosphorothioate derivative and acridine to replace.The example that can be used for producing the modified Nucleotide of antisense nucleic acid is known in this area.

Other known nucleotide modifications comprise methylate, cyclisation and ' adding cap ' and with for example displacement of inosine to the Nucleotide of one or more natural generations of analogue.Other modifications of Nucleotide are known to those skilled in the art.

Selectively, can use with antisense orientation (that is, be antisense orientation from the RNA of the transcribed nucleic acid that inserts for object target nucleic acid, further describe in trifle below) subclone the expression vector of nucleic acid, by biological method, produce antisense nucleic acid.Preferably, the transgenosis by stable integration (described transgenosis comprises effective promotor, antisense oligonucleotide and terminator for the expression in the endosperm tissue of plant preferentially) produces antisense nucleic acid in plant.

For the preferred method reducing by RNA silence or substantially eliminate endogenous CKI genetic expression, be to use expression vector, in this carrier, the form with the inverted repeats (partially or completely) separated by transcribed spacer (noncoding DNA) has been cloned CKI gene or its fragment.After inverted repeats is transcribed, form the chimeric CKI RNA that (partially or completely) has self complementary structure.This double-stranded RNA structure is called hairpin RNA (hpRNA).HpRNA is processed into the siRNA that is integrated into RISC by plant.RISC further cuts the mRNA of CKI target gene, thereby reduces or substantially eliminate the number of the CKI mRNA of one-tenth CKI albumen to be translated.Referring to for example, the people such as Grierson (1998) WO 98/53083; The people such as Waterhouse (1999) WO 99/53050).

In the method for the invention for reticent nucleic acid molecule (be no matter import plant or original position produces) can with cell mRNA and/or genomic dna hybridization or the combination of coding CKI albumen, thereby for example by inhibition, transcribe and/or translate to suppress this protein expression.Can form stable duplex and realize described hybridization by conventional Nucleotide is complementary, or for example, in the situation that in conjunction with the antisense nucleic acid of DNA duplex, interact and hybridize by the specificity in double-helical major groove.Can import antisense nucleic acid molecule by transforming the direct injection at Huo particular organization position.Selectively, can modify antisense nucleic acid molecule with the selected cell of target, then carry out systemic administration.For example, for systemic administration, can modify antisense molecule so that acceptor or the antigen that they can specific binding express on selected cell surface, for example by by antisense nucleic acid molecule with can be connected to realize described modification in conjunction with peptide or the antibody of cell surface receptor or antigen.Also can use carrier described herein that antisense nucleic acid molecule is delivered to cell.

According to more on the one hand, antisense nucleic acid is α-different nucleic acid molecule.α-different nucleic acid molecule and complementary RNA form special double-stranded crossbred, in described crossbred, different from common β unit, the trend of chain is parallel (people (1987) the Nucleic Acids.Res.15:6625-6641 such as Gaultier) each other.Antisense nucleic acid molecule also can comprise 2 '-o-methyl ribonucleotides (people (1987) the Nucleic Acids Res.15:6131-6148 such as Inoue) or mosaic type RNA-DNA analogue (people (1987) the FEBS Lett.215:327-330 such as Inoue).

In another embodiment, antisense nucleic acid of the present invention is ribozyme.Ribozyme is the catalysis RNA molecule for example, with the ribonuclease activity that can cut the single-chain nucleic acid (mRNA) with it with complementary district.Therefore, ribozyme (for example, hammerhead ribozyme (being described in Haselhoff and Gerlach (1988) Nature 334:585-591)) can be used for catalyze cleavage CKI mRNA transcript, thereby suppresses the translation of CKImRNA.Can the nucleotide sequence design based on CKI cDNA there is specific ribozyme to the nucleic acid of coding CKI.For example, can build the derivative of thermophilas (Tetrahymena) L-19IVS RNA, wherein nucleotide sequence complementation to be cut in the mRNA of the nucleotide sequence of avtive spot and coding CKI.Referring to, such as people's United States Patent (USP)s such as Cech 4,987,071; With people's United States Patent (USP)s 5,116,742 such as Cech.Selectively, can use CKI mRNA from RNA library of molecules, to select to have the catalysis RNA of specific rna enzymic activity.Referring to, for example, Bartel, D. and Szostak, J.W. (1993) Science 261:1411-1418.Ribozyme is known (for example, people (1994) WO 94/00012 such as Atkins for the purposes of carrying out gene silencing plant in this area; The people such as Lenne (1995) WO 95/03404; The people such as Lutziger (2000) WO 00/00619; People (1997) WO 97/38116 such as the people such as Prinsen (1997) WO 97/13865 and Scott).

Also can be for example, by insertion mutagenesis (, T-DNA inserts or transposon inserts) or by Angell and Baulcombe 1998 (Amplicon VIGS WO 98/36083); The gene silencing strategy that the people such as Baulcombe (WO99/15682) describe obtains gene silencing.

If there is sudden change and/or importing subsequently existence sudden change on the separated CKI gene of plant on endogenous CKI gene, so also can producer silence.Minimizing or the basically eliminate that can cause CKI to express by non-functional CKI.CKI is in conjunction with CDK and cyclin (people such as Verkest, (2005) Plant Cell 17:1723-1736).For example the sudden change of the cyclin binding site in CKI can be in conjunction with CDK but can not suppress the CKI of active CDK-cyclin mixture by providing still.

Another gene silencing methods is to use the nucleotide sequence for example, with the control region (, CKI promotor and/or enhanser) of CKI complementary to practice shooting, and to form, stops CKI gene at the triple-helix structure of target cell transcription.Referring to Helene, C. (1991) Anticancer Drug Des.6 (6): 569-84; Helene, the people such as C. (1992) Ann.N.Y.Acad.Sci.660:27-36; And Maher, L.J. (1992) Bioassays 14 (12): 807-15.

Example for the different methods of gene silencing (to reduce or the endogenous CKI genetic expression of basically eliminate) has been described above.Method of the present invention depends on the preferentially minimizing of the expression in the endosperm tissue of plant of endogenous CKI gene.Those skilled in the art are by easily for example above-mentioned for reticent method by the suitable promoter engineering of use, to obtain preferential gene silencing in endosperm tissue.

Should be understood that, key point of the present invention is the favourable and astonishing result that is reduced or finds during basically eliminate when the expression of endogenous CKI gene in albumen tissue, and is not limited to for this minimizing of endogenous CKI genetic expression or any ad hoc approach of basically eliminate.Other these class methods are known to those skilled in the art.

For optimum operation, for reduce or the gene silent technology of the endogenous CKI genetic expression of basically eliminate require will be from monocotyledonous CKI nucleotide sequence for transforming monocots.Preferably, the CKI nucleic acid from any given plant species is imported to identical species.For example, the CKI nucleic acid from rice (no matter it is total length CKI sequence or fragment) is transformed into rice plant.Will not import identical plant variety by CKI nucleic acid.

" the CKI gene " herein mentioned or " CKI nucleic acid " are for representing deoxyribonucleotide polymkeric substance or ribonucleoside acid polymer any length, two strands or strand, or its analogue, wherein said analogue has the essential characteristic of natural ribonucleotide, because mode and nucleic acid hybridization that they can be similar with the polynucleotide to natural generation." CKI gene " or " CKI nucleic acid " refers to that length is enough to carry out the continuous Nucleotide substantially in the CKI encoding gene of gene silencing; This length may be as few as 20 or Nucleotide still less.The gene of coding (functional) albumen for above-mentioned for reduce or the whole bag of tricks of the expression of the endogenous CKI gene of basically eliminate optional.

(it can be comprised of 20 or Nucleotide still less can to use the continuous Nucleotide substantially of sufficient length in CKI gene/nucleic acid, it can be from any part of CKI gene/nucleic acid, for example 3 ' end of very conservative coding region in CKI gene family) implement the inventive method.

CKI gene is known in this area, continuous Nucleotide substantially at open International Patent Application WO 2005/007829 under one's name of Monsanto Technology LLC and any plant CKI gene/nucleic acid of describing in disclosed International Patent Application WO 02/28893 under one's name of CropDesign N.V and WO 99/14331 all can be used for method of the present invention, during these CKI gene/nucleotide sequences are intactly incorporated herein.

Other CKI gene/nucleotide sequences also can be used for method of the present invention, and can easily be identified by those skilled in the art.Can identify CKI polypeptide by the one or more existence in several features of knowing (referring to below).After identifying CKI polypeptide, those skilled in the art can use routine techniques easily to obtain corresponding nucleic acid sequence encoding, and use the continuous nucleotide of the sufficient length of described sequence to carry out any one or more said gene silencing methods (with the expression of minimizing or the endogenous CKI gene of basically eliminate in endosperm).

A unique feature of CKI polypeptide is to comprise the about 40 amino acid whose C end regions to about 55 high conservatives.As guiding, by the preferred sequence increasing progressively, comprise the C end regions at least 50% with the CKI being represented by SEQ ID NO:262, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, the polypeptide of 99% identity can be considered the homologue of CKI.Those skilled in the art can easily derive the corresponding nucleic of the described homologue of coding, and use the continuous nucleotide of the sufficient length of described nucleic acid to carry out any one or more said gene silencing methods (to reduce or the expression of the endogenous CKI gene of basically eliminate).

Those skilled in the art are by the implication of " the C end " of very clear protein; For the application's object, the C end regions of CKI can be considered as total length CKI polypeptide (holding to C end from N) 1/2nd.

Can use the routine techniques known in this area for example by sequence alignment, easily identify homologue as defined above, comprise the polypeptide with C end regions at least 50% identity of the CKI being represented by SEQ ID NO:262.For carrying out the sequence alignment method of sequence comparison, in this area, know, these class methods comprise GAP, BESTFIT, BLAST, FASTA and TFASTA.GAP is used the algorithm ((1970) J Mol Biol 48:443-453) of Needleman and Wunsch to find to make the number maximization of mating and the comparison that makes minimized two complete sequences of number in room.BLAST algorithm people (1990) J Mol Biol 215:403-10 such as () Altschul calculates per-cent sequence identity and carries out the statistical analysis of two similaritys between sequence.For carrying out the software of BLAST analysis, can obtain publicly by American National biotechnology information center.Can use the ClustalW Multiple Sequence Alignment algorithm (version 1.83) that for example can obtain at http://clustalw.genome.jp/sit-bin/nph-ClustalW, the methods of marking that uses default paired comparison parameter and represent with per-cent, easily identifies homologous sequence.Can carry out a small amount of human-edited to optimize the comparison between conservative primitive (referring to below), this it will be apparent to those skilled in the art that.

Also can carry out plant identification CKI polypeptide by the existence of some conservative primitive (referring to table 12 below).Can use as described above for the comparison method of sequence comparison, identify the existence of these conservative primitives.In some cases, capable of regulating default parameter is to change the severity of search.For example, when using BLAST, can increase for reporting that the statistical significance threshold value (being called " expectation " value) for the coupling of database sequence shows the coupling that severity is lower.By the method, can identify short coupling almost completely.According to the existence of these primitives, identifying after CKI polypeptide, those skilled in the art can easily derive encoded packets containing the corresponding nucleic of the polypeptide of relevant primitive, and use the continuous nucleotide of the sufficient length of described nucleic acid to carry out above-mentioned any or several genes silencing methods (to reduce or the expression of the endogenous CKI gene of basically eliminate).

Conventionally, in primitive 1 to 5, exist (for example primitive 2 is especially very conservative) of at least one should be enough to any search sequence to be accredited as CKI, yet in order to increase determinacy, at least primitive 1,2 and 3 existence are preferred.The sequence of the consensus sequence providing based on showing in table 12 below.Those skilled in the art will be very clear, if use other or different sequences to compare, consensus sequence may slightly change.

Primitive 1:FXXKYNFD (SEQ ID NO:261), wherein X is any amino acid

Primitive 2:[P/L] LXGRYEW (SEQ ID NO:262), wherein X is any amino acid, position shown in [P/L] expression proline(Pro) or leucine appear at.

Primitive 3:EXE[D/E] FFXXXE (SEQ ID NO:263), wherein X is any amino acid, and [D/E] represent aspartic acid or L-glutamic acid appear at shown in position.

Primitive 4:YXQLRSRR (SEQ ID NO:264), wherein X is any amino acid,

Primitive 5:MGKY[M/I] [K/R] KX[K/R] (SEQ ID NO:265), wherein X is any amino acid, position shown in [M/I] expression methionine(Met) or Isoleucine appear at, position shown in [K/R] expression Methionin or arginine appear at.

Primitive 6:SXGVRTRA (SEQ ID NO:266), wherein X is any amino acid.

Conventionally at the carboxyl terminal area discover primitive 1,2 and 3 of plant CKI albumen.This region it is believed that interaction (people (1996) the Mol.Cell Biol 16 such as Chen that participates in CKI and CDK and cyclin, 4673-4682, the people such as Matsuoka (1995) Genes Dev.9,650-662, with Nakayama and Nakayama (1998) Bioessays 20,1020-1029).Conventionally at the aminoterminal area discover primitive 4,5 and 6 of the CKI of plant albumen.

From the CKI of monocotyledonous CKI albumen, particularly rice, it is characterized in that the extensively α spiral fragment of existence, particularly between primitive 5 and 6 and between primitive 6 and 4.

Conservative primitive in table 12. plant CKI albumen.CKI1 to CKI7 represents Arabidopis thaliana CKI.Os: rice, Zm: corn, Sb: Chinese sorghum.

Except above-mentioned feature, CKI albumen also can comprise with lower any one or more: Cy frame (Cy-box), nuclear localization sequence and PEST sequence.

Term " Cy frame " refers to that the length with consensus sequence RXHuF is the aminoacid sequence of about 5 amino-acid residues, and wherein X is any amino acid, and Hu is the uncharged amino acid of hydrophobicity, for example M, I, L or V.Cy frame participates in the interaction of CKI and cyclin conventionally.

" nuclear localization sequence " refers to that length is the aminoacid sequence of about 4 to 20 amino-acid residues, and this sequence is used for instructing protein to arrive nucleus.Conventionally, nuclear localization sequence is rich in basic aminoacids, for example arginine (R) and Methionin (K).For example in Gorlich D. (1998) EMBO 5.17:2721-7, nuclear localization sequence is being described.Os CKI4 albumen comprises a plurality of nuclear localization sequences.

" PEST sequence " refers to and is rich in amino-acid residue proline(Pro) (P), L-glutamic acid (E), Serine (S) and Threonine (T) and is present in the aminoacid sequence in the protein with high protein hydrolysis turnover rate.Such as the people such as Rogers (1986) Science 234, PEST sequence is disclosed in 364-368.

Can use special database such as SMART (people (1998) Proc.Natl.Acad.Sci.USA 95 such as Schultz, 5857-5864; The people such as Letunic (2002) Nucleic Acids Res 30,242-244; http:// smart.embl-heidelberg.de/), InterPro (people such as Mulder, (2003) Nucl.Acids.Res.31,315-318; http:// www.ebi.ac.uk/interpro/), Prosite (Bucher and Bairoch (1994), A generalized profile syntax for biomolecularsequences motifs and its function in automatic sequence interpretation. (In) ISMB-94; The 2nd international conference of molecular biology intelligent system recorded Altman R., Brutlag D., Karp P., Lathrop R., Searls D., Eds., pp53-61, AAAIPress, Menlo Park; The people such as Hulo, Nucl.Acids.Res.32:D134-D137, (2004), http://www.expasy.org/prosite/) or Pfam (people such as Bateman, Nucleic AcidsResearch 30 (1): 276-280 (2002), http:// www.sanger.ac.uk/Software/Pfam/), identify the various structural domains in CKI albumen.

In addition, also can by suppress cell cycle protein dependent kinase (CDK) for example the active ability of plant CDK identify CKI albumen.CDK regulates for example one group of serine/threonine kinase of cell cycle progression in plant of eukaryote.CDK is common and cyclin is compound, thereby forms enzyme complex, and wherein CDK is catalytic subunit, and cyclin is adjusting subunit (Wang, H. (1997) the The Plant Journal 15 (4): 501-510) of enzyme complex.

Therefore after using one or several above-mentioned characterized CKI polypeptide, those skilled in the art can easily derive the corresponding nucleic of this polypeptide of coding, and use the continuous Nucleotide substantially of the sufficient length of described nucleic acid to carry out any or multiple said gene silencing methods (to reduce or the expression of the endogenous CKI gene of basically eliminate).

For method of the present invention, preferably use the continuous Nucleotide substantially of the sufficient length of SEQ ID NO:267 (OsCKI4), or use the sufficiently long continuous nucleotide substantially of the ortholog thing of coding OsCKI4 (SEQ ID NO:267) or the nucleotide sequence of paralog thing.Below table 13 this type of ortholog thing of OsCKI4 and the example of paralog thing are provided.

Ortholog thing and paralog thing are to comprise for describing the homologue of evolution concept of the ancestral relationship of gene.Paralog thing be in same species by the gene that doubles to originate from of ancestral gene, ortholog thing is biological by species, to form the gene originating from from different.

Can study by carrying out so-called mutual blast, easily find the ortholog thing in monocotyledons species for example.This can by a blast (relate to for any sequence library, for example can be the public obtainable NCBI that http://www.ncbi.nlm.nih.gov. findsdatabase, for example, carries out blast analysis to search sequence (, SEQ ID NO:267 or SEQ ID NO:268)) carry out.When starting from nucleotide sequence, can use BLASTN or TBLASTX (use standard default), when starting from protein sequence, can use BLASTP or TBLASTN (use standard default).Optionally filter BLAST result.Then the full length sequence in the result of filtration or unfiltered result is carried out to reverse BLAST analysis (the 2nd BLAST) (when search sequence is SEQ ID NO:267 or SEQ ID NO:268, therefore the 2nd blast will carry out for rice sequence) to the biological sequence of originating from search sequence.Then compare the result of the first and second BLAST.If the high-level hit event from the 2nd blast comes from identical species with search sequence, be accredited as so paralog thing; If high-level hit event comes from not identical species with search sequence and is accredited as so ortholog thing.High-level hit event is the hit event with low E value.E value is lower, score more remarkable (or in other words, the probability that chances on this hit event is lower).The calculating of E value is known in this area.The in the situation that of extended familys, can use ClustalW, then build in abutting connection with tree, to help to manifest cluster and evaluation ortholog thing and the paralog thing of genes involved.

Ortholog thing and the paralog thing (SEQ ID NO:267 and 268) of table 13:OsCKI4

Title	NCBI	SEQ ID nucleotide sequence	SEQ ID peptide sequence	Source
					Zeama_CKI4 sample	AY986792	269	270	Corn
Triae_CKI4 sample	The contig of BG908519.1 and CA640135.1	271	272	Common wheat
					Orysa_CKI3	AK064723.1	273	274	Rice
Zeama_CKI3 sample	DV174570.1	275	276	Corn
					Sorbi_CKI3 sample	The contig of CN152732.1 and CD224882.1	277	278	Chinese sorghum
Sacof_CKi4 sample	CO373621.1	279	280	Sugarcane

The source of the continuous nucleotide substantially of CKI gene/nucleic acid can be any plant origin or artificial source.For optimum operation, for reducing or the gene silent technology of the endogenous CKI genetic expression of basically eliminate need to be used from monocotyledonous CKI sequence to be transformed into monocotyledons.Preferably, will be transformed into plant gramineous from CKI sequence gramineous.More preferably, the CKI nucleic acid from rice (no matter it is total length CKI sequence or fragment) is transformed into rice plant.Will not import identical plant variety by CKI nucleic acid.More preferably, the CKI nucleic acid from rice is the continuous nucleotide substantially of sufficient length of SEQ ID NO:267 (OsCKI4) or the continuous nucleotide substantially of the sufficient length of the ortholog thing of coding OsCKI4 (SEQ ID NO:267) or the nucleotide sequence of paralog thing.As mentioned above, those skilled in the art will be very clear, in order to carry out above-mentioned any gene silencing methods, what will form the continuous Nucleotide substantially of sufficient length, and this sequence can be little of 20 or continuous Nucleotide substantially still less in some cases.

Therefore, gene construct is provided, described gene construct comprises one or more control sequences and transcription termination sequence optionally, and described control sequence can preferentially drive and have the expression of justice and/or antisense CKI nucleotide sequence with reticent endogenous CKI gene in the endosperm tissue of plant in albumen tissue.

For an inverted repeats that preferred construct comprises CKI gene or its fragment of gene silencing, preferably can form the inverted repeats of hairpin structure, this inverted repeats is under the control of endosperm specificity promoter.

Aim sequence is effectively connected with one or more control sequences (at least with promotor) that can preferentially increase expression in the endosperm tissue of plant.Term " controlling element ", " control sequence " and " promotor " are all used interchangeably herein, and are defined in " definition " part.

Endosperm specificity promoter refers to any promotor that can preferentially drive destination gene expression in endosperm tissue." preferentially " herein mentioned drives expression in endosperm tissue, for representing the expression with its any sequence being effectively connected in endosperm tissue driving substantially, and except any residual expression causing due to seepage promoter expression, the elsewhere of getting rid of plant drives expression.For example, prolamine promotor shows strongly expressed in endosperm, and at meristematic tissue, more preferably in stem meristematic tissue and/or merismatic discrimination centre, has leakage expression.

Preferably, endosperm specificity promoter is the promotor from prolamine gene isolation, such as the paddy prolamine RP6 being represented by SEQ ID NO:281 (people such as Wen, (1993) Plant Physiol101 (3): 1115-6) promotor or there is the promotor to the similar intensity of this paddy Prolamin promoter and/or similar expression pattern.Can for example pass through promotor and reporter gene coupling, then in the tissue of plant, the function of examining report gene is analyzed similar intensity and/or similar expression pattern.A well-known reporter gene is β-glucuronidase and dyes for manifesting the colorimetric GUS of the β-glucuronidase activity of plant tissue.The example that also can be used for implementing other endosperm specificity promoters of method of the present invention is shown in table 6 of " definition " part.

Optionally, also one or more terminator sequences can be used for to the construct of plant to be imported.Term " terminator " is as the definition of " definition " part in this specification sheets.

Gene construct of the present invention also can comprise in order to maintain and/or copy necessary replication orgin sequence in specific cell type.An example is need to be in bacterial cell for example, with in additive type genetic elements (plasmid or clay molecule) maintainer gene construct.Preferred replication orgin includes but not limited to f1-ori and colE1.

Gene construct can optionally comprise the selectable marker gene of " definition " part definition in this specification sheets.

The present invention also comprises the plant that can obtain by method of the present invention, comprise plant part, described plant is compared the expression that has the seed production of increase and have endogenous CKI gene minimizing or that substantially eliminate in albumen tissue with suitable control plant.

The present invention also provides for generation of compare the transgenic plant of the seed production with increase with suitable control plant, and described transgenic plant have the expression of the endogenous CKI gene that reduces or substantially eliminate in albumen tissue.

(i) in plant, plant part or vegetable cell, import and express the gene construct that comprises one or more control sequences, described control sequence can be preferentially drives in albumen tissue has justice and/or antisense CKI nucleotide sequence to express, thus in the endosperm tissue of plant reticent endogenous CKI gene; With

(ii) under the condition of Promoting plant growth and development of plants, cultivate this plant, plant part or vegetable cell.

Preferably, import the inverted repeats (partially or completely) that the construct of plant comprises CKI gene or its fragment, preferably can form the inverted repeats of hairpin structure.

According to preferred feature of the present invention, by transforming, construct is imported to plant.

Term " conversion " is the conversion defining in " definitional part " of this specification sheets.

The present invention clearly extends to any vegetable cell or the plant producing by any method in method described herein, and extends to its all plant parts and its propagulum.The present invention extends further to the offspring of the cell, tissue, organ or the complete plant that comprise the primary conversion that produces by any method in aforesaid method or transfection, and unique requirement is genotype and/or identical genotype and/or the phenotypic characteristic of phenotypic characteristic that this offspring shows with parent produces in the method for the invention.

The part gathered in the crops that the present invention also extends to plant is seed for example, and derives from, and is preferably directed to the product of the part gathered in the crops of such plant, for example dry granulated feed or dry powder, oil, fat and lipid acid, starch or protein.

The present invention also comprise CKI nucleic acid for reduce or the endogenous CKI gene of basically eliminate in the expression of albumen tissue to increase the above purposes of the plant seed output of definition.

Accompanying drawing is described

With reference to following accompanying drawing, the present invention is described, wherein:

Fig. 1 provides the general introduction that is present in the conservative primitive on SEQ ID NO:2.Be rich in leucic structural domain and indicate with underscore, conservative primitive 1,2 and 3 shows with runic, the protein kinase C phosphorylation site that the sequence representative representing with italic is inferred and the N glycosylation site of inferring.

Fig. 2 shows the multiple ratio pair of multiple SYR albumen.Asterisk represents identical amino-acid residue, and colon represents the displacement of high conservative, and point represents displacement not too cautious.According to the information from Fig. 1, can easily in other SYR albumen, identify various structural domains and the conservative primitive in SEQ ID NO:2.

Fig. 3 shows for transform and express the binary vector of rice SYR nucleic acid rice.In pGOS2::SYR, SYR encoding sequence is under the control of rice GOS2 promotor.

Fig. 4 shows for transform and express the binary vector of rice SYR nucleic acid rice.In pHMGP::SYR, SYR encoding sequence is under the control of rice HMGP promotor (the SEQ ID NO:18 of WO 2004/070039, this SEQ ID NO:18 in WO 2004/070039 is intactly incorporated to herein).

Fig. 5 has described the example of the sequence that can be used for implementing method of the present invention.SEQ ID NO:1 and SEQ ID NO:2 represent Nucleotide and the protein sequence for the SYR of embodiment.Initial sum terminator codon in SEQ IDNO:1 shows with runic.SEQ ID NO:3 and SEQ ID NO:4 are the primer sequences for separating of this SYR nucleic acid.SEQ ID NO:5 is the sequence of GOS2 promotor, and SEQ ID NO:33 is the sequence of the PRO0170 promotor used in embodiment, and SEQ IDNO:6 to SEQ ID NO:11 represents the consensus sequence of conservative part in SYR albumen.SEQ IDNO:12 to 25,27 to 32 and 36 to 42 is Nucleotide (total length or part) and protein sequences of the homologue of the SYR gene that provides in SEQ ID NO:1 and SEQ ID NO:2 and protein.SEQ ID NO:26 represents ARGOS protein sequence (GenBank accession number AY305869).

Fig. 6 has provided the general introduction of FG-GAP protein structure domain.The albumen of SEQ ID NO:46 comprises secretion signal (the N end showing by collimation mark is divided), start from P73 and terminate in the FG-GAP structural domain and the membrane spaning domain (showing with runic and collimation mark) that with runic and underscore, indicate of L98.Conservative primitive DXDXDGXX (D/E) indicates with frame and underscore, and wherein primitive DGXX (D/E) indicates with italic.Conservative FDGYLYLID structural domain indicates with underscore.

Fig. 7 shows the multiple ratio pair of total length FG-GAP albumen (SEQ ID NO:46, SEQ ID NO:55, SEQ IDNO:57 and SEQ ID NO:59), asterisk represents identical amino acid, colon represents the displacement of high conservative, and point represents displacement not too cautious.The partial sequence of listing in embodiment 12 table G can be for this multiple ratio to identify other primitive.

Fig. 8 shows for transform and express the binary vector of the nucleic acid of the coding Arabidopis thaliana FG-GAP under rice GOS2 promotor is controlled rice.

Fig. 9 describes the example of the sequence can be used for implementing method of the present invention.SEQ ID NO:45 and SEQ ID NO:46 represent Nucleotide and the protein sequence for the FG-GAP of embodiment; Initial sum terminator codon in SEQ IDNO:45 indicates with runic.SEQ ID NO:47 and SEQ ID NO:48 are the primer sequences for separating of FG-GAP nucleic acid.SEQ ID NO:49 is the sequence for promotor-assortment of genes of embodiment, and SEQ ID NO:50 to SEQ ID NO:53 represents the consensus sequence of the conservative part in FG-GAP protein.SEQ ID NO:54 to 71 is Nucleotide (total length or part) and protein sequences of the homologue of the FG-GAP gene that provides in SEQ ID NO:45 and SEQ ID NO:46 and protein.SEQ ID NO:72 is the genome sequence of coding alfalfa (Medicagosativa) FG-GAP albumen, and this albumen comprises the peptide sequence by SEQ ID NO:72 to 76 expression.

Figure 10 is presented at the key character of finding in CYP90B polypeptide or its homologue: N end hydrophobic domains, translocation domain (having K/R-K/R-X3-9-P-G-G), A to D structural domain.In A structural domain, identified consensus sequence Ala/Gly-Gly-X-Asp/Glu-Thr-Thr/Ser.The consensus sequence Phe-Ala-Gly-His-Glu-Thr-Ser-Ser of CYP90B polypeptide comprises this consensus sequence Ala/Gly-Gly-X-Asp/Glu-Thr-Thr/Ser.

Figure 11 shows the biosynthetic pathway of the rape sterol of branch.In Arabidopsis, CYP90B1/DWF4 polypeptide comprises steroid 22-α hydroxylase enzymatic activity.

Figure 12 shows the hydrophobicity ProtScale output spectra of CYP90B polypeptide of the present invention.Front 34 N terminal amino acids (collimation mark of take is shown) are hydrophobic domains, because these amino acid are positioned on 0 boundary line.This region is corresponding to N end anchor structure territory.

Figure 13 show use based on improved ClustalW algorithm (InforMax, Bethesda, MD, http:// www.informaxinc.com) VNTI AlignX multiple ratio to program (use default setting: the open point penalty in room be 10 and to extend point penalty be 0.05 in room), the multiple ratio pair that several plant CYP90B polypeptide is carried out.Having indicated N holds hydrophobic domains, translocation domain (to have K/R-K/R-X _3-9-P-G-G) and A to D structural domain.In A structural domain, by collimation mark, show consensus sequence Phe-Ala-Gly-His-Glu-Thr-Ser-Ser.The accession number of CYP90B polypeptide is found in table 9a and 9b.Arabidopis thaliana Arath_CYP90A1_CPD (At5g05690), Arath_CYP90C1_ROT3 (At4g36380) and Arath_CYP90D1 (At3g13730) are shown as non-CYP90B polypeptide.

Figure 14 shows that described plant promoter can be non-constitutive promoter (for example endosperm or embryo/aleuron are specific) or constitutive promoter (for example GOS2 and HMGB1) for express the plant conversion carrier of the rice CYP90B nucleic acid under plant promoter is controlled rice.

Figure 15 has described for implementing the example of the sequence of method of the present invention.Several sequence generations splice (EST assembly) (referring to table 9a) from public EST, and it has low-qualityer sequencing.Therefore, can expect and have minority replacement nucleic acid.When sequence is total length, initial (ATG) and terminator codon define this nucleotide sequence.

Figure 16 represents the schematic diagram of total length CDC27 polypeptide (more specifically Arabidopis thaliana CDC27B hobbit polypeptide).34Tai repeating unit (TPR) shows by the collimation mark of black.The NH of polypeptide ₂end regions indicates with black bar.

Figure 17 show based on improved ClustalW algorithm (InforMax, Bethesda, MD, http:// www.informaxinc.com) use VNTI AlignX multiple ratio to program (use default setting: the open point penalty in room be 10 and to extend point penalty be 0.05 in room) multiple ratio pair of the CDC27 polypeptide from different sources that carries out.Across this, compare region with collimation mark Shi34 peptide repeating unit (TPR).Conservative NH ₂structural domain PD011373 (as at ProDom, http:// ribosome.toulouse.inra.fr/ prodom/current/cgi-bin/ProDomBlast3.plmiddle definition) with double underline, indicate.

Figure 18 shows for express the binary vector pOSH1::CDC27 of the modified Arabidopis thaliana CDC27 nucleic acid under plant promoter (described promotor is shoot apical meristem promotor) is controlled rice.

Figure 19 shows by the part from different sources of TIGR (Institute for Genomic Research at http://www.tigr.org) generation and the list of total length CDC27 ortholog thing and paralog thing.TC895803 is found in http: // www.tigr.org/tigr-scripts/tgi/ ego/ego report.pl? ego=895803.

Figure 20 describes the example that can be used for implementing the sequence of method of the present invention or can be used for the sequence of separated this sequence.Several sequence generations splice (referring to table 10) from public EST, and described sequence has low-qualityer sequencing.Therefore, can expect and have minority replacement nucleic acid.When sequence encoding total length CDC27 polypeptide, initiator codon (ATG) and terminator codon define this nucleotide sequence.

Figure 21 shows the genealogical tree of the different peptide sequences that comprise AT hook structure territory and DUF296 structural domain.Based on improved ClustalW algorithm (InforMax, Bethesda, MD, http://www.informaxinc.com) use VNTI AlignX multiple ratio to program (use default setting: the open point penalty in room be 10 and to extend point penalty be 0.05 in room) produce genealogical tree.

Figure 22 shows for expressing encoded packets under prolamine promotor is controlled rice containing the binary vector pPROLAMIN::AT hook of the rice nucleic acid of the polypeptide of AT hook structure territory and DUF296 structural domain and primitive 2.

Figure 23 show based on improved ClustalW algorithm (InforMax, Bethesda, MD, http:// www.informaxinc.com) use VNTI AlignX multiple ratio to program (use default setting: the open point penalty in room be 10 and to extend point penalty be 0.05 in room) multiple ratio pair of the polypeptide that comprises AT hook structure territory and DUF296 structural domain that carries out.In comparison with runic, italic and underscoreshow AT hook structure territory and DUF296 structural domain and primitive 2.

Figure 24 has described for implementing the example of the sequence of method of the present invention.

Figure 25 shows the genealogical tree of DOF transcription factor.The frame at close top shows with SEQ IDNO:227 to have homology (the sequence identity of the DOF structural domain at least 60% with the feature (i) that comprises above definition and (iii), SEQ ID NO:200 or SEQ ID NO:228 being represented; Above primitive I and/or the primitive II of definition) the main cluster (major clustering) of sequence.The frame of close bottom shows with SEQ ID NO:199 to have homology (the sequence identity of the DOF structural domain at least 60% with the feature (i) that comprises above definition and (ii), SEQ ID NO:200 or SEQ ID NO:228 being represented; The main cluster of the sequence sequence identity with the DOF structural domain at least 70% that SEQ ID NO:200 is represented).

Figure 26 shows for express the binary vector pGOS2::DOF of the Arabidopis thaliana DOF transcription factor under the control of GOS2 promotor rice.

Figure 27 shows for express the binary vector pPROLAMIN::DOF of the Arabidopis thaliana DOF transcription factor under prolamine promotor is controlled rice.

Figure 28 has described for implementing the example of the sequence of method of the present invention.

Figure 29 is the schematic diagram of total length plant CKI polypeptide.For the identification of the typical primitive 1 to 5 (SEQ ID NO:261 to SEQ ID NO:265) of CKI, by collimation mark, show and be correspondingly numbered (primitive 6 does not show).

Figure 30 shows from the multiple ratio of the CKI polypeptide of different sources with use can be the ClustalW that http://clustalw.genome.ip obtainscommon software (use default setting) produce in abutting connection with tree.The subclass of braces identifying sheet list cotyledon and dicotyledons CKI4.In this subclass, unifacial leaf CKI gathers together, as bracket indicates.Round bracket identifying sheet list cotyledon plant CKI4 branch.

Figure 31 be based on improved ClustalW algorithm (InforMax, Bethesda, MD, http:// www.informaxinc.com) use VNTI AlignX multiple ratio to program (use default setting: the open point penalty in room be 10 and to extend point penalty be 0.05 in room) multiple ratio pair of the CKI polypeptide from different plant origins that produces.The conservative C end end of CKI and show (primitive 6 does not show) with collimation mark for the identification of the primitive 1 to 5 (SEQ ID NO:261 to SEQ ID NO:265) of plant CKI.

Figure 32 is presented at the binary vector that carries out CKI RNA silence in rice, wherein uses the hair clip construct under endosperm specificity promoter is controlled and under stem specificity promoter is controlled.

Figure 33 has described for implementing the sequence of method of the present invention or for separating of the example of the sequence of described sequence.Several sequences are produced by public EST splicing, and it has low-qualityer sequencing.Therefore, can expect and have minority replacement nucleic acid.When nucleic acid sequence encoding total length CKI polypeptide, initial (ATG) and terminator codon define this nucleotide sequence.Yet 5 ' and 3 ' UTR also can be used for implementing method of the present invention.

Embodiment

Only refer now to and describe the present invention for illustrating object the following example.The following example is not intended to determine completely or otherwise limit scope of the present invention.

DNA operation

Unless otherwise noted, according to (Sambrook (2001) Molecular Cloning:alaboratory manual, the 3rd edition, Cold Spring Harbor Laboratory Press, CSH, New York) or the people (1994) such as Ausubel, Current Protocols in Molecular Biology, Current Protocols ( http:// www.4ulr.com/products/currentprotocols / index.html) the 1st and 2recombinant DNA technology is carried out in the standard method of describing in volume.In the Plant Molecular Biology Labfax (1993) writing at the R.D.D.Croy being published by BIOSScientific Publications Ltd (UK) and Blackwell Scientific Publications (UK), standard material and the method for plant molecular operation described.

Statistical analysis

The two-way ANOVA (variance analysis) of proofreading and correct with regard to imbalance design is as the statistical models of net assessment plant phenotype feature.The parameter of all measurements of all plants of all events with this gene transformation is carried out to F check.Carry out F check to check the effect of all transformation events of gene pairs and the population effect of checking gene (herein also referred to as " overall genetic effect (global gene effect) ").If the value display data of F check is significant, draw the conclusion that has " gene " effect, that is, mean to be not only that existence or the position of gene causes effect.For this F check, the significance threshold setting of real overall genetic effect is on 5% probability level.

For the genetic effect in inspection event, that is, strain specificity effect, is used the data set from transgenic plant and corresponding invalid plant (null plant), carries out t check in each event." invalid plant " or " invalid segregant " or " invalid zygote " are the plants of processing in the mode identical with transgenic plant, but transgenosis is separated from this plant.The negative conversion of plant that invalid plant also can be described to isozygoty.The significance threshold setting of T check is on 10% probability level.The result of some events can be higher or lower than this threshold value.This is based on hypothesis: gene may only have effect on genomic some position, and this position dependence effect is not rare.The genetic effect of the type is herein also referred to as " the strain effect of gene ".By by t value and t-distribution compares or selectively by F value and F-distribution are compared, obtain p value.Then to provide null hypothesis (not having genetically modified effect) be correct probability to p value.

Embodiment A: SYR

Embodiment 1: the evaluation of the sequence relevant with SEQ ID NO:2 to SEQ ID NO:1

Usage data library searching instrument such as basic Local Alignment instrument (Basic Local AlignmentTool) is (people (1990) J.Mol.Biol.215:403-410 such as Altschul (BLAST); With people (1997) Nucleic Acids Res.25:3389-3402 such as Altschul), in the sequence of safeguarding at the Entrez of American National biotechnology information center (NCBI) RiboaptDB, identify the sequence (full-length cDNA, EST or genome sequence) relevant to SEQ IDNO:1 and/or the protein sequence relevant with SEQ ID NO:2.Conventionally blast program is by nucleic acid or peptide sequence and sequence library are compared, and the significance,statistical mating by calculating, for finding the region between sequence with local similarity.The polypeptide coded to nucleic acid SEQ ID NO:1 uses TBLASTN algorithm, uses default setting, and opening filter, to ignore Sequences of Low Complexity.The output form of analyzing is for comparing between two, and according to probability score (E value) sequence, wherein score value reflects the occurrent probability of specific comparison (E value is lower, and the significance of hit event is higher).Except E value, also to relatively carrying out identity per-cent, score.Identity per-cent refers to that two compare the number of the identical Nucleotide (or amino acid) on length-specific between nucleic acid (or polypeptide) sequence.In some cases, can adjust default parameter with the stringency of change search.

Except the public obtainable nucleotide sequence that can obtain, also can search for other sequence libraries according to method same as the above-mentioned method on NCBI.

Relevant nucleic acid and the protein sequence of protein sequence that Table A provides the nucleotide sequence that represents to SEQ ID NO:1 and represented with SEQ ID NO:2..

Table A: can be used for nucleotide sequence the inventive method, relevant to nucleotide sequence (SEQ ID NO:1), and the corresponding polypeptide of deriving.

Title

Source is biological

Nucleic acid SEQ ID NO:

Polypeptide SEQ ID NO:

Database login number

State

?OsSYR

Rice

1

?2

/

Total length or part

Rice SYR homologue 1

Rice

12

?27

XP_472637

Total length

Rice SYR homologue 2

Rice

13

AP008218

Total length

Corn SYR homologue

Zea mays

14

?28

AY110705

Part

Wheat SYR homologue

Common wheat

15

/

Total length

Barley SYR homologue

Barley

16

?36

CB871444

Total length

Sugarcane SYR homologue 1

Sugarcane

17

?37

CA165713

Part

Sugarcane SYR homologue 2

Sugarcane

18

?38

CA242805

Total length

Chinese sorghum SYR homologue

Chinese sorghum

19

?39

CX611532

Total length

AtSYR homologue 1	Arabidopis thaliana	20	40	NM_115853	Total length
						AtSYR homologue
2	Arabidopis thaliana	21	41	NM_180078	Total length
						Grape SYR homologue	Grape (Vitis vinifera)	22	29	CF404276	Total length
Oranges and tangerines SYR homologue	Tangerine (Citrus reticulata)	23	30	CF830612	Part
						Tomato SYR homologue 1	Tomato	24	32	AI774560	Total length
Tomato SYR homologue 2	Tomato	25	31	BG125370	Total length

Embodiment 2: the comparison of related polypeptide sequence

The clustering algorithm (Clustal algorithm) of the progressive comparison from the AlignX of Vector NTI (Invitrogen) based on generally using (people (1997) the Nucleic Acids Res25:4876-4882 such as Thompson; The people such as Chenna (2003) .Nucleic Acids Res 31.3497-3500).Can use in abutting connection with clustering algorithm constructing system and set.The default value of the open point penalty in room is 10, and the default value that point penalty is extended in room is 0.1, and the weight matrix of selection is Blosum 62 (if comparison polypeptide).

In evaluation, can be used for implementing in the polypeptide of the inventive method, the Multiple Sequence Alignment that uses related polypeptide to obtain the results are shown in table 2.Can in these different sequences, easily pick out and be rich in leucic tumor-necrosis factor glycoproteins and conservative primitive.

Embodiment 3: calculate the overall per-cent identity (global percentage identity) between the peptide sequence can be used for implementing the inventive method

A method MatGAT in the method that use can obtain in this area (matrix overall comparison instrument (Matrix Global Alignment Tool)) software (BMC Bioinformatics.20034:29.MatGAT:an application that generates similarity/identity matricesusing protein or DNA sequences.Campanella JJ, Bitincka L, Smalley J; Software by Ledion Bitincka trustship), determining can be for implementing overall similarity and the identity per-cent between the full-length polypeptide sequence of method of the present invention.MatGAT software, without data are compared in advance, can produce similarity/identity matrix of DNA or protein sequence.This program is utilized Myers and Miller overall comparison algorithm, and (the open point penalty in room is 12, and to extend point penalty be 2 in room) carry out a series of comparison between two, utilize for example Blosum 62 (for polypeptide) to calculate similarity and identity, then result is arranged in to distance matrix.Sequence similarity is shown in diagonal lines Lower Half, and sequence identity is shown in the diagonal lines first half.

Parameter more used has:

Matrix: Blosum 62 scores

First room: 12

Extend room: 2

The overall similarity of peptide sequence length range (part of polypeptide sequence is foreclosed) and the software analysis of identity the results are shown in table B.Diagonal lines top provides identity per-cent, and diagonal lines below provides similarity per-cent.

Compare with SEQ ID NO:2, the per-cent identity that can be used for implementing between the peptide sequence of the inventive method can be for being low to moderate 27% amino acid identity.

Embodiment 4: the Topological Prognostics that can be used for implementing the peptide sequence of the inventive method

Utilize the Subcellular Localization of TargetP 1.1 prediction eukaryotic proteins.According to this program, the predictability based on following arbitrary N-end presequence exists, and positions definite: chloroplast transit peptides (cTP), Mitochondrially targeted peptide (mTP) or Secretory Pathway signal peptide (SP).Final prediction institute based on score value be not real probability, and to add up also needn't be 1.But, according to TargetP, the location that score is the highest is most probable, and the relation between score value (reliability class) can be used as the index of described forecasting reliability.Reliability class (RC) scope from 1 to 5, wherein 1 represents the strongest prediction.TargetP is by the server maintenance of Technical University Of Denmark (Technical University of Denmark).

, also may there is potential cleavage site in the sequence for containing N-end presequence through prediction.

Selected many kinds of parameters, the prediction and calculation of biological example body type (non-plant or plant), cutoff value setting (without, the cutoff value setting predetermined or the cutoff value setting of user's appointment) and cleavage site (be or no).

TargetP 1.1 analytical resultss of peptide sequence shown in SEQ ID NO:2 are shown in following table C.What select is " plant " organism type, does not stipulate cutoff value, and requires the prediction length of transit peptides.According to this result, shown in SEQ ID NO:2, the Subcellular Localization of peptide sequence may be plastosome; Yet should consider 5 reliability class (that is, minimum reliability class).

Shown in table C:SEQ ID NO:2, the TargetP 1.1 of peptide sequence analyzes

Length (AA)	105
		Chloroplast transit peptides	0.025
Mitochondrial transport peptide	0.552
		Secretory Pathway signal peptide	0.009
Other ubcellular targets	0.416
		The location of prediction	Plastosome
Reliability class
		5

TMHMM program by trustship on the server at Technical University Of Denmark's biological sequence analysis center identifies two membrane spaning domains.Result below shows that it is 0.997 that N holds the probability inside being positioned at.In table D below, provided further describing about this orientation.

The result of table D:TMHMM 2.0

Orientation	Initial-termination residue
		Inner side	1 42
Transbilayer helix (TMhelix)	43 65
		Outside	66 74
Transbilayer helix	75 92
		Inner side	93 105

Can utilize many other algorithms to carry out such analysis, comprise:

● the trust server of ChloroP 1.1，You Technical University Of Denmark;

● protein is sought Subcellular Localization forecasting software (Protein Prowler SubcellularLocalisation Predictor), 1.2 version, by (the Institute for Molecular Bioscience of molecular biosciences institute of Brisbane ,Australia University of Queensland, University ofQueensland, Brisbane, Australia) trust server;

● PENCE Proteome Analyst PA-GOSUB 2.5, by the trust server of Canada large Alberta Edmonton Alberta university (University of Alberta, Edmonton, Alberta, Canada);

Embodiment 5: gene clone

Use rice seedling cDNA library (Invitrogen, Paisley, UK) to pass through pcr amplification rice SYR gene as template.The RNA extracting from seedling in reverse transcription, cDNA is cloned into pCMVSport 6.0.The average inset size in library is 1.5kb, and clone's original number is approximately 1.59 * 10 ⁷cfu.6 * 10 ¹¹after the amplification for the first time of cfu/ml, initial titer is confirmed as 9.6 * 10 ⁵cfu/ml.After plasmid extraction, 200ng template is used for to 50 μ l PCR mixtures.By primer prm08170 (the SEQ ID NO:3 comprising for the AttB site of Gateway restructuring; Have justice, initiator codon indicates with runic, and AttB1 site indicates with italic:

) and prm08171 (SEQ ID NO:4; Oppositely, complementation; AttB2 site indicates with italic: 5 '-

caaaaacaaaaataaattcccc-3 ') for pcr amplification.Under standard conditions, use Hifi Taq archaeal dna polymerase to carry out PCR.Also use the PCR fragment of the correct size of standard method amplification and purifying.Then carry out the first step BP reaction of Gateway method, during this step, PCR fragment and pDONR201 plasmid carry out restructuring in body, thereby produce, according to Gateway nomenclature, and " entry clones (entry clone) " pSYR.Plasmid pDONR201 is as Gateway a part for technology is purchased from Invitrogen.

Embodiment 6: the structure of carrier

Subsequently entry clones pSYR being used to LR with the object carrier (destination vector) transforming for rice reacts.This carrier form with functional element in T-DNA border comprises: plant selectable marker, the marker expression box that can screen and be intended to carry out the Gateway box of recombinating in LR body for the aim sequence with being cloned in entry clones.For the rice GOS2 promotor (SEQ ID NO:5) of constitutive expression, be positioned at the upstream of this Gateway box.Prepare similar but there is high mobility group protein promotor (HMGP, SEQ ID NO:33) but not the vector construction body of GOS promotor.

After LR reconstitution steps, the expression vector pGOS2::SYR of gained (having GOS2 promotor) and pHMGP::SYR (having HMGP promotor) (both expressing (Fig. 2) for composing type SYR) are transformed into Agrobacterium (Agrobacterium) strain LBA4044, are then transformed into rice plant.

Embodiment 7: the conversion of rice

The Agrobacterium-mediated Transformation rice plant that use comprises expression vector.Make the ripe dry seeds shelling of rice growing kind Japan fine (ricejaponica cultivar Nipponbare).By hatching in 70% ethanol 1 minute, then at 0.2%HgCl ₂in hatch 30 minutes, with sterile distilled water washing 6 times, within each 15 minutes, carry out disinfection afterwards.Then in comprising the substratum of 2,4-D (callus inducing medium), sprout aseptic seed.Incubation, after 4 weeks, cuts the embryo generation callus in scutellum source in the dark, then on identical substratum, breeds.After 2 weeks, by upload culture at identical substratum, within other 2 weeks, breed or breed again callus.In common cultivation, within first 3 days, at fresh culture, upload culture embryo generation callus lines (to strengthen cell fission activity).

The Agrobacterium strain LBA4404 that comprises expression vector is for common cultivation.Agrobacterium is seeded in and is had on suitable antibiotic AB substratum, at 28 ℃, cultivate 3 days.Then collect bacterium, be suspended in liquid and be total in culture medium until be approximately 1 density (OD ₆₀₀).Then suspension is transferred to culture dish (Petri dish), callus is immersed in suspension to 15 minutes.Then callus is blotted on filter paper, be transferred to afterwards curing common culture medium, incubation 3 days in the dark at 25 ℃.Then in the situation that selective agent exists at 28 ℃ in the dark, comprising on the substratum of 2,4-D the callus 4 weeks that growth cultivates altogether.During this period, produced the resistant calli island of Fast Growth.After this substance transfer is hatched to regeneration culture medium with under illumination, embryo generation potentiality are released, and in ensuing 4 to 5 weeks, grow and sprout.Bud is cut from callus, then in the cultivation that comprises growth hormone, hatches 2 to 3 weeks, then by they from described media transfer to soil.In greenhouse, under high humidity and short day, grow the bud of hardening.

For a construct, produce about 35 T0 rice transformant independently.Primary transformant is transferred to greenhouse from tissue culture room.After the quantitative PCR analysis of copy number of confirming T-DNA inset, only retain and show the results for T1 seed to single copy transgenic plant of selective agent tool resistance.Then within 3 to 5 months after transplanting, gather in the crops seed.The method produces single locus transformant (Aldemita and Hodges1996, the people such as Chan 1993, the people such as Hiei 1994) with more than 50% ratio.

About the conversions of other farm crop referring to embodiment 40.

Embodiment 8: the appraisal procedure of using the plant of the SYR conversion under rice GOS2 promotor or the control of HMGP promotor

assessment arranges

Produced about 15-20 independently T0 rice transformant.Primary transformant is transferred to greenhouse by tissue culture room and is grown and gather in the crops T1 seed.8 events are retained, and wherein T1 is for the separation in 3: 1 that transgenosis existence/shortage occurs.By the expression of monitoring visable indicia, in these events, respectively select about 10 T1 seedling containing transgenosis (heterozygote and homozygote), and about 10 T1 seedling that lack transgenosis (invalid zygote).The T1 plant of selection is transferred to greenhouse.Each strain plant is all accepted unique bar code label to make clearly phenotypic data associated with corresponding plant.The T1 plant of selection is grown in the soil of flowerpot that diameter is 10cm under following environment arranges, and described environment setting is: photoperiod=11.5h, intensity of illumination=30,000lux or stronger, daytime temperature=28 ℃ or higher, nocturnal temperature=22 ℃, relative humidity=60-70%.Transgenic plant and corresponding invalid zygote be growth side by side on random site.From sowing time to ripening stage, plant Multiple through then out digital image-forming case.On each time point, every strain plant is obtained to digital image (2048 * 1536 pixels, 1,000 6 hundred ten thousand pigments) from least 6 different angles.

Salt stress screening

In the matrix of being made by coconut fiber and argex (3 to 1 ratios), cultivate the plant from 4 events (T2 seed).Sprigging to first two weeks behind greenhouse is being used to normal nutritive medium.After first two weeks, in nutritive medium, add the salt (NaCl) of 25mM, until gather in the crops plant.

Arid screening

In flowerpot soil, cultivate under normal operation the plant from 5 events (T2 seed), until enter heading stage.Then transferred to " being dried " region, stop irrigating.In the flowerpot of random selection, insert humidity detection instrument, to monitor Soil Water Content (SWC).When SWC is during lower than certain threshold value, from trend plant, continue moisturizing, until again reach normal level.Then plant is transferred under normal condition again again.Remaining cultivation (plant maturation, seed results) is identical with the plant of not cultivating under abiotic stress condition.With the T2 seed of the plant results of cultivating under normal condition, and the T2 seed that need not gather in the crops from the plant of arid screening first repeats this and screens to carry out taking turns checking.

the parameter of measuring

The plant sum that on the ground area (Leaf biomass in other words) is different from the pixel of background on the digital image of plant part on the ground by counting is determined.This value is got same time point from the mean value of the photo of different angle shots, and is converted to by calibration the physical surface value (physical surface value) representing with square millimeter.The biomass that the ground plant area that experiment shows to measure by this method divides to plant shoot is relevant.Areamax is the ground area when plant reaches its maximum Leaf biomass.

Results, packed, with the main panicle of bar code label maturation, then at 37 ℃, in baking oven, be dried 3 days.Then to panicle threshing, collect all seeds.Use gas blower (air-blowing device) that full husk is separated with empty husk.After separation, then use commercially available counter all to count two batches of seeds.Discard sky husk.On analytical balance, take the weight of full husk, use digital picture to measure the cross-sectional area of seed.The method produces with next group seed relevant parameter set.

Every paniculiform flower is estimated the average number (coming divided by the first paniculiform number derivation from total number seeds) of every paniculiform little Hua on plant.The highest panicle with when vertical when comparison, be regarded as the first panicle and count by craft with the overlapping all panicles of the highest panicle.By the number of counting remaining full husk after separating step, determine the number of full seed.By taking the weight of all full husks of gathering in the crops from plant, measure total seed production (seed gross weight).By counting, from the number of the husk of plant results, measure total number seeds of every plant, it is corresponding to the number of every strain plant little Hua.From the number of full seed and its gross weight of counting, calculate thousand seed weight (TKW).Harvest index is defined as seed gross weight and ground area (mm ²) between ratio be multiplied by the factor 10 ⁶.Parameter EmerVigor indication growth of seedling gesture.According to the area being covered by Leaf biomass in imaging for the first time (with mm ²represent) calculate.The plumpness of the full rate of seed (fillrate) indication seed.Its number that is expressed as full seed accounts for the ratio (representing with %) of little Hua number (seed sum).

Use image analysis software from digital picture, to derive these parameters in the mode of automatization, then these parameters are carried out to statistical analysis.Use the parameter (comprising width, length, area, weight) of measuring single seed with the customizing device (by two primary clusterings, weigh and imaging device, form) of image analysis software coupling.

Embodiment 9: the measurement of the output correlation parameter of the pGOS2::SYR transformant of growing under normal growth condition:

Seed analysis based on above-mentioned, present inventor finds to compare and have higher seed production (being expressed as the number of full seed, the gross weight of seed and harvest index) with the genetically modified plant of shortage SYR with the plant of PGOS2::SYR gene construct conversion.P value shows that this increase is significant.For the method for statistical study, it is the method that the Introductory part at embodiment provides.

The result that plant for T1 in generation obtains is summarized in table E, the mean value that described result is all tested strains:

Table E:

	% difference	P value
			The number of full seed	+47	0.0000
Seed gross weight	+52	0.0000
			Harvest index	+54	0.0000

The data that obtain for SYR in the first experiment in the second experiment of using T2 plant, have been confirmed.4 strains that selection has correction pattern are further analyzed.By the expression of monitoring mark, screening is from the seed lot (Seed batch) of the sun plant in T1 (heterozygote and homozygote).For the event of each selection, then retain heterozygote seed lot to carry out T2 assessment.In every batch of seed, the positive of the equal amts of growing in greenhouse and heliophobous plant are to assess.Compare with lacking the genetically modified plant of SYR, the measurement of seed production parameter shows the increase of number, seed gross weight and the harvest index of full seed again.

Embodiment 10: the measurement of the output correlation parameter of the pGOS2::SYR transformant of growing under stress conditions:

The analysis of the seed based on above-mentioned, the inventor finds to compare with lacking the genetically modified plant of SYR, with the conversion of pGOS2::SYR gene construct and under salt stress growing plants there is higher seed production (being expressed as the number of full seed, the gross weight of seed, full rate and harvest index).In addition, these are compared with control plant by the plant of salt stress to have higher growth of seedling gesture.When growing plant under drought stress, transgenic plant are compared and have higher seed gross weight and the harvest index of increase with the genetically modified plant of shortage SYR.These differences are significant, and the P value of checking from F is lower than 0.05.

The measurement of the output correlation parameter of embodiment 11:pHMGP::SYR transformant:

The plant transforming in pGOS2::SYR gene construct similarly, present inventor finds to compare and have higher seed production (being expressed as the number of full seed, the gross weight of seed and harvest index) with the genetically modified plant of shortage SYR with the plant of pHMGP::SYR gene construct conversion.P value shows that this increase is significant.

The T1 obtaining is summarized in table F, the mean value that described result is all tested strains for the result of plant:

Table F:

	% difference	P value
			The number of full seed	+34	0.0000
Seed gross weight	+33	0.0000
			Harvest index	+37	0.0000

Embodiment B: FG-GAP

Embodiment 12: the evaluation of the sequence relevant with SEQ ID NO:46 to SEQ ID NO:45

Usage data storehouse sequence search instrument, such as basic Local Alignment instrument (BLAST) (people (1990) J.Mol.Biol.215:403-410 such as Altschul; With people (1997) NucleicAcids Res.25:3389-3402 such as Altschul), in the sequence of safeguarding at the Entrez of American National biotechnology information center (NCBI) RiboaptDB, identify the sequence (full-length cDNA, EST or genome sequence) relevant to SEQ ID NO:45 and/or the protein sequence relevant with SEQ ID NO:46.Use blast program, by nucleic acid or peptide sequence and sequence library are compared, and the significance,statistical mating by calculating, to find the region between sequence with local similarity.The polypeptide coded to SEQID NO:45 uses TBLASTN algorithm, uses default setting, and opening filter, to ignore Sequences of Low Complexity.The output form of analyzing is for comparing between two, and according to probability score (E value) sequence, wherein score value reflects the occurrent probability of specific comparison (E value is lower, and the significance of hit event is higher).Except E value, also to relatively carrying out identity per-cent, score.Identity per-cent refers to the number of the identical Nucleotide (or amino acid) on length-specific between two nucleic acid (or polypeptide) sequences that compare.In some cases, can adjust default parameter with the stringency of change search.

Except the public obtainable nucleotide sequence that can obtain, also can search for other sequence libraries according to the method identical with aforesaid method on NCBI.

The nucleic acid that table G provides the nucleotide sequence that represents to SEQ ID NO:45 and the protein sequence that represents with SEQ ID NO:46 is relevant and the list of protein sequence.

Table G: can be used for nucleotide sequence the inventive method, relevant to nucleotide sequence (SEQ ID NO:45), and the corresponding polypeptide of deriving.

Title	Source is biological	Nucleic acid SEQ ID NO:	Polypeptide SEQ ID NO:	Database login number	State
						AtFG-GAP	Arabidopis thaliana	?45	?46		Total length
AtFG-GAP homologue	Arabidopis thaliana	?54	?55	NM_114965	Total length
						OsFG-GAP homologue 1	Rice	?56	?57	NM_185137	Total length
OsFG-GAP homologue 2	Rice	?58	?59	AK068943	Total length
						TaFG-GAP homologue	Common wheat	?60	?/	CK207217	Part
ZmFG-GAP homologue	Zea mays	?61	?/	AY111316	Part
						StFG-GAP homologue	Potato	?62	?/	BG598275	Part
AFG-GAP homologue	Aquilegia	?63	?/	DT735817	Part
						BnFG-GAP homologue	Colea	?64	?/	CX192752	Part
CsFG-GAP homologue	Sweet orange	?65	?/	CX674859	Part
						AoFG-GAP homologue	Officinalis	?66	?/	CV288972	Part
PFG-GAP homologue 1	Populus	?67	?/	CN520999	Part
						PFG-GAP homologue 2	Populus	?68	?/	CX176799	Part

EeFG-GAP homologue	The breast oar root of Beijing euphorbia	?69	?/	DV130386	Part
						CrFG-GAP homologue	Ceratopteris richardii	?70	?/	CV736049	Part
WmFG-GAP homologue	Orchid at the age of one hundred years old	?71	?/	DT601669	Part
						MsFG-GAP homologue	Alfalfa	?72	SEQ ID NO:73 to SEQ ID NO:76		Part

Embodiment 13: the comparison of related polypeptide sequence

The clustering algorithm of the progressive comparison from the AlignX of Vector NTI (Invitrogen) based on generally using (people (1997) the Nucleic Acids Res 25:4876-4882 such as Thompson; The people such as Chenna (2003) .Nucleic Acids Res 31:3497-3500).Can use in abutting connection with clustering algorithm constructing system and set.The default value of the open point penalty in room is 10, and the default value that point penalty is extended in room is 0.1, and the weight matrix of selection is Blosum 62 (if comparison polypeptide).

In evaluation, can be used for implementing in the polypeptide of the inventive method, what the multiple sequence that use related polypeptide carries out was compared the results are shown in Fig. 7.Can be clear that, although there are some rooms in comparison, in the major part of protein sequence, have sequence conservation.

Embodiment 14: can be used for implementing the calculating of the overall per-cent identity between the peptide sequence of the inventive method

A method MatGAT in the method that use can obtain in this area (matrix overall comparison instrument) software (BMC Bioinformatics.20034:29.MatGAT:an application thatgenerates similarity/identity matrices using protein or DNA sequences.Campanella JJ, Bitincka L, Smalley J; Software by Ledion Bitincka trustship), determining can be for implementing overall similarity and the identity per-cent between the full-length polypeptide sequence of method of the present invention.MatGAT software, without data are compared in advance, can produce similarity/identity matrix of DNA or protein sequence.This program is utilized Myers and Miller overall comparison algorithm, and (the open point penalty in room is 12, and to extend point penalty be 2 in room) carry out a series of comparison between two, utilize for example Blosum 62 (for polypeptide) to calculate similarity and identity, then result is arranged in to distance matrix.Sequence similarity is shown in diagonal lines Lower Half, and sequence identity is shown in the diagonal lines first half.

Parameter more used has:

Matrix: Blosum 62 scores

First room: 12

Extend room: 2

The overall similarity of peptide sequence length range (part of polypeptide sequence is foreclosed) and the software analysis of identity the results are shown in table H.Diagonal lines top provides identity per-cent, and diagonal lines below provides similarity per-cent.

Compare with SEQ ID NO:46, the per-cent identity that can be used for implementing between the peptide sequence of the inventive method can be for being low to moderate 17% amino acid identity.

Table H: the overall similarity within the scope of full-length polypeptide sequence and the MatGAT result of identity.

	1	2	3	4
					1.AtFGAP1		18.1	65.5	17.4
2.AtFGGAP2	31.4		17.9	67.7
					3.OsFGGAP1	76.7	33.5		16.9
4.OsFGGAP2	32.8	83.6	33

Embodiment 15: can be used for implementing the evaluation of the structural domain that comprises in the peptide sequence of the inventive method

Protein families, structural domain and site (Integrated Resource of ProteinFamilies, Domains and Sites (the InterPro)) database of reallocating resources is the integrated interface that carries out the conventional tag database of search based on text and sequence.InterPro database gets up these database combination, and they utilize diverse ways to learn and the relevant fully bioinformation in various degree of the protein of sign, to obtain protein tag.Cooperation database comprises SWISS-PROT, PROSITE, TrEMBL, PRINTS, ProDom and Pfam, Smart and TIGRFAMs.Interpro is by European information biology institute (the European Bioinformatics Institute) trustship that is positioned at Britain.

Shown in SEQ ID NO:46, the InterPro scanning result of peptide sequence is shown in Table I.

Table I: the InterPro scanning result of peptide sequence shown in SEQ ID NO:46

Database	Accession number	Logon name
			Pfam	PF01839	FG-GAP
INTERPRO	IPR013517	FG-GAP
			INTERPRO	IPR000413	Beta	2 integrin alpha chain

Embodiment 16: for implementing the Topological Prognostics of the peptide sequence of method of the present invention

TargetP 1.1 can predict the Subcellular Localization of eukaryotic protein.According to this program, the predictability based on following arbitrary N-end presequence exists, and positions definite: chloroplast transit peptides (cTP), Mitochondrially targeted peptide (mTP) or Secretory Pathway signal peptide (SP).Final prediction institute based on score value be not real probability, and to add up also needn't be 1.But, according to TargetP, the location that score is the highest is most probable, and the relation between score value (reliability class) can be used as the index of described forecasting reliability.Reliability class (RC) scope from 1 to 5, wherein 1 represents the strongest prediction.TargetP is by the server maintenance of Technical University Of Denmark.

For the sequence that contains N-end presequence through prediction, also can predict potential cleavage site.

TargetP 1.1 analytical resultss of peptide sequence shown in SEQ ID NO:46 are shown in following table J.What select is " plant " organism type, does not stipulate cutoff value, and requires the prediction length of transit peptides.Shown in SEQ ID NO:46, the Subcellular Localization of peptide sequence may be in cell, existence is to the slight deflection of Secretory Pathway (although having 5 reliability score value), the prediction length of the transit peptides of inferring is 24 amino acid (reliable not as Subcellular Localization prediction itself, may to have several amino acid whose length variations) that start from N-terminal.

Shown in table J:SEQ ID NO:46, the TargetP 1.1 of peptide sequence analyzes

Length (AA)	896
		Chloroplast transit peptides	0.010
Mitochondrial transport peptide	0.546
		Secretory Pathway signal peptide	0.643
Other ubcellular targets	0.038
		The location of prediction	Secretion
Reliability class
		5
The transit peptides length of prediction			24

When using SignalP people such as (, J.Mol.Biol., 340:783-795,2004) Bendtsen to analyze, (0.998 probability) positive identification is to existing the N with 24 amino acid lengths to hold secreting signal peptide reliably.In addition, when using THMM algorithm (Center for Biological SequenceAnalysis, Technical University of Denmark) time, predict that this protein is positioned at the outside of cell, only have C end afterbody to be present in tenuigenin: residue 1-859: outside; Residue 860-879: membrane spaning domain, residue 880-896: inner side.

Can utilize many other algorithms to carry out such analysis, comprise:

● the trust server of ChloroP 1.1，You Technical University Of Denmark;

● protein is sought the trust server of molecular biosciences institute of Subcellular Localization forecasting software 1.2Ban，You Brisbane ,Australia University of Queensland;

● PENCE Proteome Analyst PA-GOSUB 2.5, by the trust server of Canada large Alberta Edmonton Alberta university;

Embodiment 17: gene clone

Use Arabidopsis thaliana Seedlings cDNA library (Invitrogen, Paisley, UK) to pass through pcr amplification Arabidopis thaliana FG-GAP gene as template.The RNA extracting from seedling in reverse transcription, cDNA is cloned into pCMV Sport 6.0.The average inset size in library is 1.5kb, and clone's original number is about 1.59 * 10 ⁷cfu.6 * 10 ¹¹after the amplification for the first time of cfu/ml, initial titer is confirmed as 9.6 * 10 ⁵cfu/ml.After plasmid extraction, 200ng template is used for to 50 μ lPCR mixtures.By primer prm06643 (the SEQID NO:47 comprising for the AttB site of Gateway restructuring; Have justice, initiator codon indicates with runic, and AttB1 site indicates with italics:

aaatctcgagcgagg-3 ') and prm06644 (SEQ ID NO:48; Oppositely, complementation; AttB2 site indicates with italics:

ctg tttacagatggtacctagt-3 ') for pcr amplification.Under standard conditions, use Hifi Taq archaeal dna polymerase to carry out PCR.Also use standard method amplification and the purifying 3.2kb PCR fragment of (comprising attB site).Then carry out the first step BP reaction of Gateway method, during this step, PCR fragment and pDONR201 plasmid carry out restructuring in body, thereby produce, according to Gateway nomenclature, and " entry clones " pFG-GAP.Plasmid pDONR201 is as Gateway

a part for technology is purchased from Invitrogen.

Embodiment 18: the structure of carrier

Subsequently entry clones FG-GAP being used to LR with pGOS2 (the object carrier transforming for rice) reacts.This carrier form with functional element in T-DNA border comprises: plant selectable marker, the marker expression box that can screen and be intended to carry out the Gateway box of recombinating in LR body with the aim sequence that is cloned into entry clones.For the rice GOS2 promotor (Nucleotide 1 to 2193 of SEQ IDNO:49, promotor-assortment of genes) of constitutive expression, be positioned at the upstream of this Gateway box.

After LR reconstitution steps, the expression vector pGOS2::FG-GAP (Fig. 7) for FG-GAP of gained is transformed into Agrobacterium strain LBA4044, and then is transformed into rice plant.Make the rice plant's growth transforming, then with regard to the parameter of describing in embodiment 19, it is checked.

About the information of other farm crop referring to embodiment 40.

Embodiment 19: the appraisal procedure of the plant that the FG-GAP using under rice GOS2 promotor is controlled is transformed

Produce about 15 to 20 T0 rice transformant independently.Primary transformant is transferred to and greenhouse, carries out Growth and yield T1 seed from tissue culture room.With regard to genetically modified presence/absence, in T1 offspring, there are 7 events of separation in 3: 1 in reservation.For each event in these events, by the expression of monitoring witness marking, the T1 seedling of selecting T1 seedling that about 10 strains comprise transgenosis (heterozygote and homozygote) and about 10 strains to lack transgenosiss (invalid zygote).The T1 plant of selection is transferred to greenhouse.Every strain plant is accepted the unique bar code mark that makes clearly phenotypic data associated with corresponding plant.The T1 plant of selection is grown in the soil of flowerpot that diameter is 10cm under following environment arranges, and described environment setting is: photoperiod=11.5h, intensity of illumination=30,000lux or stronger, daytime temperature=28 ℃ or higher, nocturnal temperature=22 ℃, relative humidity=60-70%.Transgenic plant and corresponding invalid zygote are grown in to random position side by side.From sowing time to the ripening stage, plant is passed through to digital imagery chamber for several times.On each time point, to every strain plant from least 6 different angle shot digital pictures (2048 * 1536 pixels, 1,000 6 hundred ten thousand pigments).

The sum that is different from the pixel of background by counting in the digital picture of plant part is on the ground determined plant area (or Leaf biomass) on the ground.With regard to the image of taking from different perspectives on same time point, this value is averaged, then by calibration, convert described value to represent with square millimeter physical surface value.Experiment shows that the ground plant area of measuring by the method is associated with the biomass of ground plant part.Areamax is the ground area when plant reaches its maximum Leaf biomass.

The main panicle that results are ripe, packed, with barcode, it is carried out to mark, then at 37 ℃, in baking oven, be dried 3 days.Then to panicle threshing, collect all seeds.Use gas blower that full husk is separated with empty husk.After separation, then use commercially available counter all to count two batches of seeds.Discard sky husk.On analytical balance, take the weight of full husk, use digital picture to measure the cross-sectional area of seed.The method produces one group of following seed correlation parameter:

Every paniculiform number of spending is for estimating the parameter of the average number of every paniculiform little Hua on plant, and it can get divided by the first paniculiform number from seed overall number.The highest panicle with when vertical when comparison, be regarded as the first panicle and count by craft with the overlapping all panicles of the highest panicle.By count the number of the full husk staying after separating step, determine the number of full seed.By taking the weight of all full husks of gathering in the crops from plant, measure total seed production (seed gross weight).By counting, from the number of the husk of plant results, measure total number seeds of every strain plant, it is corresponding to the number of the little Hua of every strain plant.According to the number of the full seed of counting and its gross weight, calculate thousand seed weight (TKW).Harvest index is defined as seed gross weight and ground area (mm ²) between ratio be multiplied by the factor 10 ⁶.Can use image analysis software from digital picture, to derive these parameters in the mode of automatization, then these parameters be carried out to statistical analysis.Use the customizing device (by 2 primary clusterings, weigh and imaging device, form) with image analysis software coupling, measure the parameter (comprising width, length, area, weight) of single seed.

The two-way ANOVA (variance analysis) of proofreading and correct with regard to imbalance design is as the statistical models of net assessment plant phenotype feature.All measuring parameters to all events of all plants with this gene transformation carry out F check.Carry out F check to check the impact of all transformation events of gene pairs and the population effect of checking gene, herein also referred to as " overall genetic effect ".If the value display data of F check is significant, reach a conclusion---there is " gene " effect, this means that what cause this effect is not only existence or the position of gene.For this F check, the significance threshold setting of real overall genetic effect is on 5% probability level.

For the intragentic effect of inspection event, check strain specificity effect, use the data set from transgenic plant and corresponding invalid plant, in each event, implement t check." invalid plant " or " invalid segregant " or " invalid zygote " refer to the plant of processing in the mode identical with transgenic plant, but transgenosis is separated from this plant.The negative conversion of plant that invalid plant also can be described to isozygoty.The significance threshold setting that T is checked is on 10% probability level.The possibility of result of some events is higher or lower than this threshold value.This is based on hypothesis: gene may only have effect on genomic some position, and this position dependence effect is not rare.The genetic effect of the type is herein also referred to as " the strain effect of gene ".By by t value and t-distribution compares or selectively by F value and F-distribution are compared, obtain p value.Then to provide null hypothesis (not having transgenosis effect) be correct probability to p value.

The data that obtain for FG-GAP in the first experiment in the second experiment of using T2 plant, have been confirmed.Select 4 strains further to analyze.By the expression of monitoring mark, screening is from the seed lot of the sun plant in T1 (heterozygote and homozygote).Then for the event of each selection, retain heterozygote seed lot to carry out T2 assessment.In every batch of seed, the positive of the equal amts of growing in greenhouse and heliophobous plant are to assess.

In T2 generation, assessed the FG-GAP conversion of plant that adds up to 120 strains, i.e. every event 30 strain plants, wherein 15 strains are transgenosis because of the positive, 15 strains are transgenosis feminine gender.

Because two experiments carrying out have overlapping events, therefore carry out combinatory analysis.This can be used for checking the consistence of effect in two experiments, and if situation if this is really true, thereby it can be used for collecting evidence from two experiments and increases the credibility of conclusion.The method of using is to consider the method with mixed model of the multilevel hierarchy of data (i.e. experiment-event-segregant).By card side is distributed and compared with likelihood ratio test, obtain p value.

The assessment of embodiment 20:FG-GAP transformant: the measurement of output correlation parameter

The analysis of the seed based on above-mentioned, present inventor finds to compare and have higher seed production with the genetically modified plant of shortage FG-GAP with the plant of FG-GAP gene construct conversion, and described seed production shows as number and the seed gross weight of full seed.P value shows that this increase is significant.In addition harvest index also increases (+9%).

The T1 obtaining is summarized in table K for the result of plant:

Table K:

	% difference	The p value of F check
			The number of full seed	+19	0.0051
Seed gross weight	+17	0.0199

Again at T2, in generation, obtain these positive findingses.In table L, the overall percentage of data presentation full seed, seed gross weight and harvest index increases (according to the data of each single line in T2 generation, calculating) and P value accordingly.The result of combining T1 generation in combinatory analysis these T2 data of reappraising, the P value of acquisition shows that the effect of observing is highly significant.

Table L:

Embodiment C: CYP90B

Embodiment 21: the gene clone of rice CYP90B cDNA

Use rice seedling cDNA library (Invitrogen, Paisley, UK) to pass through pcr amplification rice CYP90B cDNA as template.The RNA extracting from seedling in reverse transcription, cDNA is cloned into pCMV Sport 6.0.The average inset size in library is 1.6kb, and clone's original number is about 1.67 * 10 ⁶cfu.6 * 10 ¹⁰after the amplification for the first time of cfu/ml, initial titer is defined as 3.34 * 10 ⁶cfu/ml.After plasmid extraction, 200ng template is used for to 50 μ lPCR mixtures.By primer (the SEQ ID NO:107 comprising for the AttB site of Gateway restructuring; Have justice, initiator codon indicates with runic, and AttB1 site indicates with italic: 5 '

cTTAAACA

gCCGCCATGATGGC 3 ') and (SEQ ID NO:108; Oppositely, complementation; AttB2 site indicates with italic: 5 '

tTACTCCTGCTCATCATCC3 ') for pcr amplification.Under standard conditions, use Hifi Taq archaeal dna polymerase to carry out PCR.Also use standard method amplification and purifying 1585bp (to comprise attB site; From initial to stopping 1521bp) PCR fragment.Then carry out the first step BP reaction of Gateway method, during this step, PCR fragment and pDONR201 plasmid carry out restructuring in body, thereby produce, according to Gateway nomenclature, " entry clones ".Plasmid pDONR201 is as Gateway a part for technology is purchased from Invitrogen.

Embodiment 22: the structure of carrier

Subsequently entry clones being used to LR with the object carrier one transforming for rice reacts.These carriers form with functional element in T-DNA border comprises: plant selectable marker, the marker expression box that can screen and be intended to carry out the Gateway box of recombinating in LR body for the aim sequence with being cloned into entry clones.Use is positioned at 4 different rice promoters of this Gateway box upstream and expresses rice CYP90B: prolamine RP6, oleosin 18kDa, GOS2 and HMGB1.

After LR reconstitution steps, the expression vector of gained (prolamine RP6 promotor, oleosin 18kDa, GOS2 and HMGB1-are referring to Figure 14) is transformed into Agrobacterium strain LBA4044, be then transformed into rice plant.Make the rice plant's growth transforming, then with regard to the parameter of describing in example below, it is checked.About the conversions of other farm crop referring to example example 40.

Embodiment 23: the description of phenotype appraisal procedure

Every construct produces about 15 to 20 T0 rice transformant independently.Primary transformant is transferred to greenhouse to carry out Growth and yield T1 seed from tissue culture room.Reservation T1 offspring with regard to genetically modified presence/absence presents 4 events in 5 events of separation in 3: 1.For each event in these events, by the expression of monitoring witness marking, the T1 seedling of selecting T1 seedling that about 10 strains comprise transgenosis (heterozygote and homozygote) and about 10 strains to lack transgenosiss (invalid zygote).Transgenic plant and suitable control plant are grown in to random position side by side.From sowing time to the ripening stage, plant is passed through to digital imagery chamber for several times.On each time point, to each strain plant from least 6 different angle shot digital pictures (2048 * 1536 pixels, 1,000 6 hundred ten thousand pigments).

According to the appraisal procedure identical with T1 generation (but the assessment of every event is more individual) in T2 further 3 T1 events of assessment in generation.

The measurement of seed correlation parameter

The main panicle that results are ripe, counting, packed, use bar code label are then dried 3 days at 37 ℃ in baking oven.Then to panicle threshing, collect all seeds and count.Use gas blower that full husk is separated with empty husk.Discard sky husk, then residue fraction is counted again.On analytical balance, take the weight of full husk.The number of the full husk staying after separating step by counting is determined the number of full seed.By taking the weight of all full husks of gathering in the crops from plant, measure total seed production.By counting, from the number of the husk of plant results, measure total number seeds of every strain plant.According to the number of the full seed of counting and its gross weight, calculate thousand seed weight (TKW).Harvest index in the present invention (HI) is defined as seed ultimate production and ground area (mm ²) between ratio be multiplied by the factor 106.The sum of the every paniculiform flower defining in the present invention is the ratio between the total and ripe paniculiform number of master of seed.The full rate of seed defining in the present invention is the total ratio (representing with %) that the number of full seed accounts for seed (or little Hua).Use the parameter (width, length and area) of measuring single seed with the customizing device of image analysis software coupling, described device is comprised of 2 primary clusterings (weighing and imaging device).With shell with shelling seed all for these measurements.

Statistical analysis: F check

Statistical models by two-way ANOVA (variance analysis) as net assessment plant phenotype feature.All measuring parameters to all events of all plant with gene transformation of the present invention carry out F check.Carry out F check to check the effect of all transformation events of gene pairs, and check the population effect of gene, be also called " overall genetic effect ".The significance threshold value setting of real overall genetic effect is 5% probability level of F check.If significance F test value points to certain genetic effect, this means to be not only that existence or the position of gene causes the difference in phenotype.

Embodiment 24: the result of the rice CYP90B under non-constitutive promoter is controlled

24.1 express the transgenic plant of CYP90B under endosperm specificity promoter is controlled

Seed production and the HI measuring result of under endosperm-specific (prolamine RP6) promotor is controlled, expressing the transgenic plant of CYP90B are shown in table M and N.Shown the number of the event with increase and from the p value of the F check in T1 and T2 generation.

Table M: the seed production measuring result of expressing the transgenic plant of CYP90B under endosperm specificity promoter is controlled.

	The number that shows the event increasing	% difference	The P value of F check
				T1 generation	In 43	11	0.1572
T2 generation	In 33	13	0.0103

Table N: the HI measuring result of expressing the transgenic plant of CYP90B under endosperm specificity promoter is controlled.

	The number that shows the event increasing	% difference	The P value of F check
				T1 generation	In 44	11	0.047
T2 generation	In 33	10	0.0392

When comparing with control plant, although phytomass remains unchanged (data do not show) on the ground, but due to the increase of seed production, the transgenosis rice plant of expressing CYP90B under endosperm-specific (prolamine RP6) promotor is controlled presents the results of increase.

24.2 express the transgenic plant of CYP90B under embryo/aleuron specificity promoter is controlled

The TKW measuring result of expressing the transgenic plant of CYP90B under embryo/aleuron (oleosin 18kDa) promotor is controlled is shown in table O.Shown the number of the event with increase and from the p value of the F check in T1 and T2 generation.

Table O: the TKW measuring result of expressing the transgenic plant of CYP90B under embryo/aleuron promotor is controlled.

	The number that shows the event increasing	% difference	The P value of F check
				T1 generation	In 55	4	0.0002
T2 generation	In 32	1	0.2428

The average seed area measurement of expressing the transgenic plant of CYP90B under oleosin 18kDa promotor is controlled the results are shown in table P.Shown the number of the event with increase and from the p value of the F check in T1 and T2 generation.

Table P: the average seed area measurement result of expressing the transgenic plant of CYP90B under embryo/aleuron promotor is controlled.

	The number that shows the event increasing	% difference	The P value of F check
				T1 generation	In 55	3	＜0.0001
T2 generation	In 33	2	0.0272

The average seed length measuring result of expressing the transgenic plant of CYP90B under oleosin 18kDa promotor is controlled is shown in table Q.Shown the number of the event with increase and from the p value of the F check in T1 and T2 generation.

Table Q: the average seed length measuring result of expressing the transgenic plant of CYP90B under embryo/aleuron promotor is controlled.

	The number that shows the event increasing	% difference	The P value of F check
				T1 generation	In 55	3	＜0.0001
T2 generation	In 33	1	0.0086

The transgenosis rice plant of expressing CYP90B under embryo/aleuron (oleosin 18kDa) promotor is controlled has TKW, seed area and seed length the seed increasing occurs.Do not observe the remarkable increase of seed production.

Embodiment 25: assessment and the result of the rice CYP90B under constitutive promoter is controlled

25.1 express the transgenic plant of CYP90B under GOS2 constitutive promoter is controlled

The assessment of the measurement result of expressing the transgenic plant of CYP90B under GOS2 constitutive promoter is controlled is shown in table R.Shown the number of the event with increase and from the p value of the F check in T1 and T2 generation.When T1 obtains negative findings in generation, do not carry out the T2 assessment in generation.

Table R: the assessment of the measurement result of expressing the transgenic plant of CYP90B under GOS2 constitutive promoter is controlled

	The number that shows the event increasing	% difference	The P value of F check
				Ground biomass	In 55	-13	＜0.0001
Highly	In 55	-7	＜0.0001
				The number of full seed	In 55	-53	＜0.0001
The number of seed	In 55	-32	＜0.0001
				Seed production	In 55	-53	＜0.0001
HI	In 55	-46	＜0.0001

25.2 express the transgenic plant of CYP90B under HMBG1 constitutive promoter is controlled

The assessment of the measurement result of expressing the transgenic plant of CYP90B under HMGB1 constitutive promoter is controlled is shown in table S.Shown the number of the event with increase and from the p value of the F check in T1 generation.When T1 obtains negative findings in generation, do not carry out the T2 assessment in generation.

Table S: the assessment of the measurement result of expressing the transgenic plant of CYP90B under HMGB1 constitutive promoter is controlled.

	The number that shows the event increasing	% difference	The P value of F check
				Ground biomass	In 55	-18	＜0.0001
Highly	In 55	-6	＜0.0001
				The number of full seed	In 55	-56	＜0.0001
The number of seed	In 55	-33	＜0.0001
				Seed production	In 55	-56	＜0.0001
HI	In 55	-46	＜0.0001

Compare with control plant, the transgenic plant of expressing CYP90B under 2 kinds of different constitutive promoters are controlled demonstrate number, seed production and the HI of the ground phytomass of strong minimizing, plant height, full seed.

Embodiment D:CDC27

Embodiment 26: the NH that is coded in polypeptide ₂end regions has the clone of arabidopsis gene of CDC27 polypeptide of the TPR structural domain of at least one inactivation

Use Arabidopsis thaliana Seedlings cDNA library (Invitrogen, Paisley, UK) as template, by the encode arabidopsis gene of CDC27 polypeptide of pcr amplification, described CDC27 polypeptide (CDS0171_2) is at the NH of polypeptide ₂end regions has the TPR structural domain of at least one inactivation.The RNA extracting from seedling in reverse transcription, cDNA is cloned into pCMV Sport 6.0.The average inset size in library is 1.5kb, and clone's original number is about 1.59 * 10 ⁷cfu.10 ¹⁰after the amplification for the first time of cfu/ml, initial titer is defined as 9.6 * 10 ⁵cfu/ml.After plasmid extraction, 200ng template is used for to 50 μ l PCR mixtures.By primer (the SEQ ID NO:149 comprising for the AttB site of Gateway restructuring; Have justice, initiator codon indicates with runic, and AttB1 site indicates with italics: 5 '- cTTCACA

cAACAACTGTCAACTTC 3 ') and (SEQ ID NO:150; Oppositely, complementation; AttB2 site indicates with italics: 5 '

tTGGAGTAGCTATGGTTTCAC-3 ') for pcr amplification.Under standard conditions, use Hifi TaqDNA polysaccharase to carry out PCR.Also use standard method amplification and purifying 1816bp (to comprise attB site; From initial to stopping 1737bp) PCR fragment.Then carry out the first step BP reaction of Gateway method, during this step, PCR fragment and pDONR201 plasmid carry out restructuring in body, thereby produce, according to Gateway nomenclature, " entry clones ".Plasmid pDONR201 is as Gateway a part for technology is purchased from Invitrogen.

Embodiment 27: the structure of carrier

Subsequently entry clones being used to LR with the object carrier one transforming for rice reacts.This carrier form with functional element in T-DNA border comprises: plant selectable marker, the marker expression box that can screen and be intended to carry out the Gateway box of recombinating in LR body for the aim sequence with being cloned into entry clones.The rice OSH1 promotor (SEQ ID NO:151) of expressing for shoot apical meristem is positioned at the upstream of this Gateway box.

After LR reconstitution steps, the expression vector of the gained shown in Figure 18 is transformed into Agrobacterium strain LBA4044, and then is transformed into rice plant.Make the rice plant's growth transforming, then with regard to the parameter of describing in embodiment 28 and 29, it is checked.About the conversions of other farm crop referring to embodiment 40.

Embodiment 28: the description of phenotype appraisal procedure

Produce about 15 to 20 T0 rice transformant independently.Primary transformant is transferred to greenhouse to carry out Growth and yield T1 seed from tissue culture room.Retain 5 events that T1 offspring presents separation in 3: 1 with regard to genetically modified presence/absence.For each event in these events, by the expression of monitoring witness marking, the T1 seedling of selecting T1 seedling that about 10 strains comprise transgenosis (heterozygote and homozygote) and about 10 strains to lack transgenosiss (invalid zygote).Transgenic plant and suitable control plant are grown in to random position side by side.From sowing time to the ripening stage, plant is passed through to digital imagery chamber for several times.On each time point, to every strain plant from least 6 different angle shot digital pictures (2048 * 1536 pixels, 1,000 6 hundred ten thousand pigments).

According to the appraisal procedure identical with T1 generation (but the assessment of every event is more individual) in T2 further 3 events of assessing in T1 of assessment in generation.

The measurement of seed correlation parameter

The main panicle that results are ripe, counting, packed, use bar code label are then dried 3 days at 37 ℃ in baking oven.Then to panicle threshing, collect all seeds and count.Use gas blower that full husk is separated with empty husk.Discard sky husk, then residue fraction is counted again.On analytical balance, take the weight of full husk.The number of the full husk staying after separating step by counting is determined the number of full seed.By taking the weight of all full husks of gathering in the crops from plant, measure total seed production.By counting, from the number of the husk of plant results, measure total number seeds of every strain plant.According to the number of the full seed of counting and its gross weight, calculate thousand seed weight (TKW).Harvest index of the present invention (HI) is defined as seed gross weight and ground area (mm ²) between ratio be multiplied by the factor 10 ⁶.The sum of the every paniculiform flower defining in the present invention is the ratio between the total and ripe paniculiform number of master of seed.The full rate of seed defining in the present invention is the ratio (representing with %) that the number of full seed accounts for seed (or little Hua) sum.

Statistical analysis: F check

Embodiment 29: the assessment result of expressing the transgenosis rice plant of modified Arabidopis thaliana CDC27 nucleic acid under shoot apical meristem promotor is controlled

The assessment of the measurement result (number of seed production, full seed and HI) of expressing the transgenic plant of modified CDC27 nucleic acid under shoot apical meristem promotor (OSH1) is controlled is shown in table T to V.Shown the number of the event with increase, with the % difference of suitable control plant and from the p value T of the F check in T1 and T2 generation.

Table T: the seed production measuring result of expressing the transgenic plant of modified CDC27 nucleic acid under shoot apical meristem promotor is controlled.

	The number that shows the event increasing	% difference	The P value of F check
				T1 generation	In 53	35	0.0113
T2 generation	In 32	11	0.0083

Table U: the measuring result of full seed number of expressing the transgenic plant of modified CDC27 nucleic acid under shoot apical meristem promotor is controlled.

	The number that shows the event increasing	% difference	The P value of F check
				T1 generation	In 53	36	0.0083
T2 generation	In 32	10	0.0099

Table V: the measuring result of harvest index of expressing the transgenic plant of modified CDC27 nucleic acid under shoot apical meristem promotor is controlled.

	The number that shows the event increasing	% difference	The P value of F check
				T1 generation	In 53	34	0.0053
T2 generation	In 32	6	0.0188

The transgenosis rice plant of expressing modified CDC27 nucleic acid under shoot apical meristem promotor is controlled has the seed production of remarkable increase, the full seed number of increase and the harvest index of increase.

Embodiment E: AT hook

Embodiment 30: the gene clone of the AT hook coding nucleic acid of rice

Use rice seedling cDNA library (Invitrogen, Paisley, UK) as template, the rice gene (referring to SEQID NO:152) by pcr amplification encoded packets containing the polypeptide of AT hook structure territory and DUF296 structural domain.The RNA extracting from seedling in reverse transcription, cDNA is cloned into pCMVSport 6.0.The average inset size in library is 1.6kb, and clone's original number is about 1.67 * 10 ⁷cfu.6 * 10 ¹⁰after the amplification for the first time of cfu/ml, initial titer is defined as 3.34 * 10 ⁶cfu/ml.After plasmid extraction, 200ng template is used for to 50 μ l PCR mixtures.By primer (the SEQ ID NO:196 comprising for the AttB site of Gateway restructuring; 5 '-ggggacaagtttgtacaaaaaagcaggcttaaacaatggatccggtcacgg-3 ') and (SEQID NO:197 there is justice, AttB1 primer:; Oppositely, complementation; AttB2 primer: 5 '-ggggaccactttgtacaagaaagctgggtggaatcgatccatctcagaa-3 ') for pcr amplification.Under standard conditions, use Hifi Taq archaeal dna polymerase to carry out PCR.Use standard method amplification and purifying PCR fragment (to comprise attB site; From initial to stopping).Then carry out the first step BP reaction of Gateway method, during this step, PCR fragment and pDONR201 plasmid carry out restructuring in body, thereby produce, according to Gateway nomenclature, " entry clones ".Plasmid pDONR201 is as Gateway

a part for technology is purchased from Invitrogen.

Embodiment 31: the structure of carrier

Subsequently entry clones being used to LR with the object carrier one that contains prolamine promotor transforming for rice reacts.This carrier form with functional element in T-DNA border comprises: plant selectable marker, the marker expression box that can screen and be intended to carry out the Gateway box of recombinating in LR body for the aim sequence with being cloned into entry clones.For the paddy Prolamin promoter (SEQ ID NO:195) of endosperm specificity expression, be positioned at the upstream of this Gateway box.

After LR reconstitution steps, the gained expression vector shown in Figure 22 is transformed into Agrobacterium strain LBA4044, and then is transformed into rice plant.Make the rice plant's growth transforming, the parameter then just the following describes checks it.About the conversions of other farm crop referring to embodiment 40.

Embodiment 32: assessment and result

Produce about 15 to 20 T0 rice transformant independently.Primary transformant is transferred to and greenhouse, carries out Growth and yield T1 seed from tissue culture room.Retain 7 events that T1 offspring presents separation in 3: 1 with regard to genetically modified presence/absence.For each event in these events, by the expression of monitoring witness marking, the T1 seedling of selecting T1 seedling that about 10 strains comprise transgenosis (heterozygote and homozygote) and about 10 strains to lack transgenosiss (invalid zygote).

32.1 statistical analysis: F check

The measurement of 32.2 seed correlation parameters

The main panicle that results are ripe, counting, packed, use bar code label are then dried 3 days at 37 ℃ in baking oven.Then to panicle threshing, collect all seeds and count.Use gas blower that full husk is separated with empty husk.Discard sky husk, then residue fraction is counted again.On analytical balance, take the weight of full husk.The number of the full husk staying after separating step by counting is determined the number of full seed.By taking the weight of all full husks of gathering in the crops from plant, measure total seed production.By counting, from the number of the husk of plant results, measure total number seeds of every strain plant.According to the number of the full seed of counting and its gross weight, calculate thousand seed weight (TKW).Harvest index (HI) is expressed as seed ultimate production and ground area (mm ²) between ratio be multiplied by the factor 10 ⁶.The sum of every paniculiform flower is expressed as the ratio between the total and ripe paniculiform number of master of seed.The number that the full rate of seed is expressed as full seed accounts for the total per-cent of seed (or little Hua).

Table W: show and compare with root-specific promoter (RCc3 promotor), the comparative data of the difference of the seed production that use endosperm specificity promoter (prolamine) obtains

This table shows with corresponding control plant (invalid zygote) compares the percentage difference of transgenic plant in various parameters; The p value of the population effect of the demonstration gene of checking from F is also shown in table.As shown in table, be in the plant of endosperm specificity promoter control lower expression AT hook coding nucleic acid (SEQID NO:152), multiple seed production parameter increases, yet in transgenic plant, for being root-specific promoter, control the lower identical genetically modified plant of expressing, acquisition increase (in fact reducing significantly).

Embodiment F: DOF transcription factor

Embodiment 33: the gene clone of Arabidopis thaliana DOF transcription factor (SEQ ID NO:198)

Use Arabidopsis thaliana Seedlings cDNA library (Invitrogen, Paisley, UK) to pass through pcr amplification Arabidopis thaliana DOF transcription factor gene as template.The RNA extracting from seedling in reverse transcription, cDNA is cloned into pCMV Sport 6.0.The average inset size in library is 1.5kb, and clone's original number is 1.59 * 10 ⁷the rank of cfu.6 * 10 ¹¹after the amplification for the first time of cfu/ml, initial titer is defined as 9.6 * 10 ⁵cfu/ml.After plasmid extraction, 200ng template is used for to 50 μ lPCR mixtures.5 ' ggggacaagtttgtacaaaaaagcaggcttaaacaatgggtggatcgatggc 3 ') and (SEQ ID NO:224) (reverse complemental AttB2 primer: 5 ' ggggaccactttgtacaagaaagctgggtcgttaatgatccgacaaaaca 3 ') for pcr amplification by comprising primer (SEQ ID NO:223) for the AttB site of Gateway restructuring, (there is an adopted AttB1 primer:.In standard conditions, use Hifi Taq archaeal dna polymerase to carry out PCR.Also use standard method amplification and purifying PCR fragment (to comprise attB site; From initial to stopping).Then carry out the first step BP reaction of Gateway method, during this step, PCR fragment and pDONR201 plasmid carry out restructuring in body, thereby produce, according to Gateway nomenclature, " entry clones ".Plasmid pDONR201 is as Gateway a part for technology is purchased from Invitrogen.

Embodiment 33a: the structure of carrier

Subsequently entry clones being used to LR with the object carrier one that comprises GOS2 transforming for rice reacts.This carrier form with functional element in T-DNA border comprises: plant selectable marker, the marker expression box that can screen and be intended to carry out the Gateway box of recombinating in LR body for the aim sequence with being cloned into entry clones.For the rice GOS2 promotor (SEQ ID NO:225) of constitutive expression, be positioned at the upstream of this Gateway box.

After LR reconstitution steps, the gained expression vector shown in Figure 26 is transformed into Agrobacterium strain LBA4044, and then is transformed into rice plant.Make the rice plant's growth transforming, the parameter then just the following describes checks it.About the conversions of other farm crop referring to embodiment 40.

Embodiment 34: the gene clone of Arabidopis thaliana DOF transcription factor (SEQ ID NO:226)

Use Arabidopsis thaliana Seedlings cDNA library (Invitrogen, Paisley, UK) to pass through pcr amplification Arabidopis thaliana DOF transcription factor gene as template.The RNA extracting from seedling in reverse transcription, cDNA is cloned into pCMV Sport 6.0.The average inset size in library is 1.5kb, and clone's original number is 1.59 * 10 ⁷cfu.6 * 10 ¹¹after the amplification for the first time of cfu/ml, initial titer is defined as 9.6 * 10 ⁵cfu/ml.After plasmid extraction, 200ng template is used for to 50 μ l PCR mixtures.5 ' ggggacaagtttgtacaaaaaagcaggcttaaacaatgatgatggagactagagat c3 ') and (SEQ ID NO:257) (reverse complemental AttB2 primer: 5 ' ggggaccactttgtacaagaaagctgggtcatatgtaactctaaatctgttca3 ') for pcr amplification by comprising primer (SEQ ID NO:256) for the AttB site of Gateway restructuring, (there is an adopted AttB1 primer:.In standard conditions, use Hifi Taq archaeal dna polymerase to carry out PCR.Also use standard method amplification and purifying PCR fragment (to comprise attB site; From initial to stopping).Then carry out the first step BP reaction of Gateway method, during this step, PCR fragment and pDONR201 plasmid carry out restructuring in body, thereby produce, according to Gateway nomenclature, " entry clones ".Plasmid pDONR201 is as Gateway

a part for technology is purchased from Invitrogen.

Embodiment 34a: the structure of carrier

Subsequently entry clones being used to LR with the object carrier one that comprises prolamine transforming for rice reacts.This carrier form with functional element in T-DNA border comprises: plant selectable marker, the marker expression box that can screen and be intended to carry out the Gateway box of recombinating in LR body for the aim sequence with being cloned into entry clones.For the paddy Prolamin promoter (SEQ ID NO:258) of seed-specific expression, be positioned at the upstream of this Gateway box.

After LR reconstitution steps, the gained expression vector shown in Figure 27 is transformed into Agrobacterium strain LBA4044, and then is transformed into rice plant.Make the rice plant's growth transforming, the parameter then just the following describes checks it.About the conversions of other farm crop referring to embodiment 40.

Embodiment 35: assessment and result

Produce about 15 to 20 T0 rice transformant independently.Primary transformant is transferred to and greenhouse, carries out Growth and yield T1 seed from tissue culture room.Reservation T1 offspring with regard to genetically modified presence/absence presents 7 events of separation in 3: 1.For each event in these events, by the expression of monitoring witness marking, the T1 seedling of selecting T1 seedling that about 10 strains comprise transgenosis (heterozygote and homozygote) and about 10 strains to lack transgenosiss (invalid zygote).According to about 4 the T1 events of the further assessment of appraisal procedure with T1 generation identical (but the assessment of every event is more individual).

Plant from 5 events was grown under normal operation until heading stage.Hygroreceptor continuous monitoring soil humidity in the flowerpot of the non-transgenic control plant of the several random selections of use insertion.In the first period, make flowerpot be saturated to 60% maximum value, thereby reduce the otherness of basin and basin.After flowerpot is saturated, stop irrigating until obtain the soil moisture content lower than 20%.Then plant is watered again until soil humidity reaches 60% highest level again.Then plant is taken a picture to assess following relevant and seed correlation parameter.

Root correlation parameter

Plant-growth is had to clear bottom to allow in the flowerpot of observation root specially designed.In growing process, pass through the bottom digital camera document image of flowerpot.Use suitable software from the image producing, to derive the feature of root, for example total projection area (it can be relevant to total root volume), mean diameter and higher than the length (the slightly length of root or the length of radicula) of the root of certain rugosity threshold value.

The measurement of seed correlation parameter

The main panicle that results are ripe, counting, packed, use bar code label are then dried 3 days at 37 ℃ in baking oven.Then to panicle threshing, collect all seeds, then count.Use gas blower that full husk is separated with empty husk.Discard sky husk, then residue fraction is counted again.On analytical balance, take the weight of full husk.The number of the full husk staying after separating step by counting is determined the number of full seed.By taking the weight of all full husks of gathering in the crops from plant, measure total seed production.By counting, from the number of the husk of plant results, measure total number seeds of every strain plant.According to the number of the full seed of counting and its gross weight, calculate thousand seed weight (TKW).Harvest index in the present invention (HI) is defined as seed ultimate production and ground area (mm ²) between ratio be multiplied by the factor 10 ⁶.In the present invention, the sum of every paniculiform flower is the ratio between the total and ripe paniculiform number of master of seed.The full rate of seed defining in the present invention is the ratio (representing with per-cent) that the number of full seed accounts for seed (or little Hua) sum.

Statistical analysis: F check

Table X be below presented at GOS2 promotor control lower nucleic acid of expressing encoding D OF transcription factor transgenic plant T2 assessment result and under prolamine promotor is controlled, express the T2 assessment result of transgenic plant of the nucleic acid of encoding D OP transcription factor.Although do not show, obtained suitable result on T1 plant.For listed parameter display in table the p value of F check, and transgenic plant are with respect to the percentage difference of invalid zygote.

The result of Table X: T2 assessment

Except above-mentioned seed correlation parameter, compare with invalid zygote, in transgenic plant, following parameter also increases: total root biomass increases by 14%, radicula number (internal threshold) increases by 7%, thick radical order (internal threshold) increase by 36% and the mean diameter of root increase by 8%.

Under the condition of slight drought stress, obtained the above results; Be expected under normal or non-stress condition and will obtain similar result.

Embodiment G:CKI

Embodiment 36: the clone of the rice gene of coding CKI4 polypeptide

According to manufacturers instruction, use HybriZAP-2.1 test kit (Stratagene, the rice cell suspension culture cDNA library of cloning in pAD-Gal4-2.1 carrier La Jolla, California USA) is as template, by the encode rice gene of CKI4 polypeptide of pcr amplification.The average inset size in this library is 1.5kb, and clone's original number is about 2 * 10 ⁶pfu.10 ¹⁰after the amplification for the first time of pfu/ml, initial titer is defined as 4 * 10 ⁶pfu/ml.After plasmid extraction, 200ng template is used for to 50 μ l PCR mixtures.By primer (the SEQ ID NO:284 comprising for the AttB site of Gateway restructuring; Have justice, initiator codon indicates with runic, and AttB1 site indicates with italic: 5 '

cTTCACA gGCAAGTACATGCGCAAGGCC-3 ') and (SEQ ID NO:285; Oppositely, complementation; AttB2 site indicates with italic: 5 '-

tGGAGCAGAGAGGTCCATGGTGCCC-3 ') for pcr amplification.Under standard conditions, use Hifi TaqDNA polysaccharase to carry out PCR.Also use the PCR fragment of standard method amplification and purifying 662bp (to comprise attB site; From initial to stopping 585bp).Then carry out the first step BP reaction of Gateway method, during this step, PCR fragment and pDONR201 plasmid carry out restructuring in body, thereby produce, according to Gateway nomenclature, " entry clones ".Plasmid pDONR201 is as Gateway

a part for technology is purchased from Invitrogen.

Embodiment 37: the structure of carrier

Subsequently entry clones being used to LR with the object carrier one transforming for rice reacts.This carrier form with functional element in T-DNA border comprises: plant selectable marker, the marker expression box that can screen and two Gateway boxes with opposed orientation that are intended to carry out recombinating in LR body for the aim sequence with being cloned into entry clones.These two Gateway boxes (are the 315bp fragment of tobacco matrix attachment regions (MAR) by noncoding DNA in this situation, NCBI referenceU67919, fragment from 774 to 1088bp) separate, thereby after transcribing, promote this mRNA to form hairpin structure.For the rice RP6 prolamine promotor (SEQ IDNO:281) of endosperm specificity expression, be positioned at the upstream of a Gateway box, with this Gateway box opposed orientation.

Also entry clones being used to LR with another object carrier one transforming for rice reacts.Except the rice β expansion protein promoter with SEQ ID NO:282 replaces RP6 prolamine promotor, this carrier is identical with above-described carrier.

After LR reconstitution steps, the expression vector of two gained (about two carriers, referring to Figure 32) is transformed into Agrobacterium strain LBA4044, and then is transformed into rice plant.Make the rice plant's growth transforming, then with regard to the parameter of describing in embodiment 38 and 39, it is checked.About the conversions of other farm crop referring to embodiment 40.

Embodiment 38: the description of phenotype appraisal procedure

Produce about 15 to 20 T0 rice transformant independently.Primary transformant is transferred to greenhouse to carry out Growth and yield T1 seed from tissue culture room.Retain 4 to 5 events that T1 offspring presents separation in 3: 1 with regard to genetically modified presence/absence.For each event in these events, by the expression of monitoring witness marking, the T1 seedling of selecting T1 seedling that about 10 strains comprise transgenosis (heterozygote and homozygote) and about 10 strains to lack transgenosiss (invalid zygote).Transgenic plant and suitable control plant are grown in to random position side by side.From sowing time to the ripening stage, plant is passed through to digital imagery chamber for several times.On each time point, to every strain plant from least 6 different angle shot digital pictures (2048 * 1536 pixels, 1,000 6 hundred ten thousand pigments).

According to the similar events of assessing in T2 is further evaluated at T1 in generation for identical appraisal procedure with T1.

The measurement of seed correlation parameter

Results, counting, packed, with the main panicle of bar code label maturation, then at 37 ℃ in baking oven dry 3 days.Then to panicle threshing, collect all seeds, then count.Use gas blower that full husk is separated with empty husk.Discard sky husk, then residue fraction is counted again.On analytical balance, take the weight of full husk.The number of the full husk staying after separating step by counting is determined the number of full seed.By taking the weight of all full husks of gathering in the crops from plant, measure total seed production.By counting, from the number of the husk of plant results, measure total number seeds of every strain plant.Harvest index in the present invention (HI) is defined as seed ultimate production and ground area (mm ²) between ratio be multiplied by the factor 10 ⁶.The sum of every paniculiform flower is the sum of seed and the ratio between the ripe paniculiform number of master in the present invention.The full rate of seed defining in the present invention is the ratio (representing with per-cent) that the number of full seed accounts for seed (or little Hua) sum.

Statistical analysis: F check

Embodiment 39: the assessment result in endosperm with the transgenosis rice plant that the CKI4 of minimizing expresses

In table Y below the assessment of the measurement result (number of seed production, full seed, seed sum and every paniculiform number of spending) in endosperm with the transgenic plant that the CKI4 of minimizing expresses is shown in.The number, average percent that has shown the plant in parameter with increase increases and the P value in T2 generation, and with by using β to expand protein promoter (preferentially expressing) in root tissue, there is the result obtaining in the transgenic plant of CKI4 expression of minimizing and compare.

Result shows that the CKI4 expression reducing in endosperm causes, express the transgenic plant of (using β expansion protein promoter) with invalid zygote and the CKI4 preferentially in root tissue with minimizing and compare, there is seed weight, full seed number, seed sum and every paniculiform several plant of spending of remarkable increase.

Table Y: the assessment of the measurement result in endosperm with the transgenic plant that the CKI4 of minimizing expresses

Embodiment 40: the conversion of the maize transformation of corn, wheat, soybean, rape (Rapseed) and alfalfa

The improving one's methods of method that use is described by the people such as Ishida (1996) Nature Biotech 14 (6): 745-50 carried out the conversion of corn (Zea mays).In corn, transforming is that genotype is dependent, only has specific genotype to be easy to transform and regenerate.Inbred lines A188 (University ofMinnesota) or the A188 of usining are the good sources of the donor material for transforming as parent's hybrid, but also can successfully use other genotype.After pollination, (DAP) is when within about 11 days, the length when immature embryo is about 1 to 1.2mm, from maize plant results tassel.Immature embryo and the agrobacterium tumefaciens (Agrobacterium tumefaciens) that comprises expression vector are cultivated altogether, by organ, transgenic plant are occurred to recover.The embryo culture cutting off, on callus inducing medium, is for example then cultivated, on the corn regeneration culture medium that comprises selective agent (imidazolone, but can use different selective markers).The in the situation that of illumination, at 25 ℃, hatch culture dish 2 to 3 weeks, or until bud generation.Green bud is transferred to maize rooting substratum from each embryo, at 25 ℃, hatches 2-3 week, until root produces.Then the bud of taking root is migrated in greenhouse soil.From showing the resistance of selective agent and comprising the plant generation T1 seed that list copies T-DNA inset.

Wheat transforms

The method that use is described by the people such as Ishida (1996) Nature Biotech 14 (6): 745-50 is carried out the conversion of wheat.Conventionally by Cultivar Bobwhite (can be from CIMMYT, Mexico obtain) for transforming.Immature embryo and the agrobacterium tumefaciens that comprises expression vector are cultivated altogether, by organ, transgenic plant are occurred to recover.After hatching with Agrobacterium, embryo is carried out on callus inducing medium to vitro culture, then for example, on the regeneration culture medium that comprises selective agent (imidazolone, but can use different selective markers), cultivate.The in the situation that of illumination, at 25 ℃, hatch culture dish 2 to 3 weeks, or until bud generation.Green bud is transferred to root media from each embryo, at 25 ℃, hatches 2-3 week, until root produces.The bud of taking root is migrated in greenhouse soil.From showing the resistance of selective agent and comprising the plant generation T1 seed that list copies T-DNA inset.

Transformation of soybean

According to the soybean transformation of improving one's methods of the method for describing in Texas A & M patent US 5,164,310.Several commercialization soybean varieties are easy to transform by the method.Conventionally by Cultivar Jack (can from Illinois Seed foundation obtain) for transforming.Soybean seeds is sterilized so that external sowing.From 7 age in days seedling, cut hypocotyl, radicle and a slice cotyledon.Allow epicotyl and remaining cotyledon further growth produce armpit joint (axillary node).Cut these armpit joints, by its incubation together with the agrobacterium tumefaciens that comprises expression vector.After common cultivation is processed, washing explant, is then transferred to selection substratum.Cut the bud of regeneration, be placed in bud elongation medium.The bud that length is no more than to 1cm is placed on root media until root generation.The bud of taking root is transferred in the soil in greenhouse.From showing the resistance of selective agent and comprising the plant generation T1 seed that list copies T-DNA inset.

The conversion of rape/Canola

The cotyledon petiole of the seedling of 5-6 age in days and hypocotyl, as the explant of tissue culture, transform it according to the people such as Babic (1998, Plant Cell Rep 17:183-188).Business Cultivar Westar (Agriculture Canada) is the standard variety for transforming, but also can use other kinds.Canola seed is carried out to surface sterilization to carry out external sowing.From external seedling, cut the cotyledon petiole explant with the cotyledon adhering to, then by the otch end of cotyledon petiole explant is immersed in bacterial suspension and inoculates Agrobacterium (comprising expression vector).Then by explant under illumination in 23 ℃, 16 hours, on the MSBAP-3 substratum that comprises 3mg/l BAP, 3% sucrose, 0.7%Phytagar, cultivate 2 days.Cultivating altogether after 2 days with Agrobacterium, cotyledon petiole explant is transferred on the MSBAP-3 substratum that comprises 3mg/l BAP, cefotaxime, Pyocianil or Ticarcillin/Clavulanate Acid (300mg/l) and is cultivated 7 days, then cultivate until shoot regeneration having on the MSBAP-3 substratum of cefotaxime, Pyocianil or Ticarcillin/Clavulanate Acid and selective agent.When the length of bud is 5-10mm, cut off, be then transferred to bud elongation medium (MSBAP-0.5 comprises 0.5mg/l BAP).The bud of the about 2cm of length is transferred to root media (MS0) to carry out root induction.The bud of taking root is migrated in the soil in greenhouse.From showing the resistance of selective agent and comprising the plant generation T1 seed that list copies T-DNA inset.

The conversion of alfalfa

Use the method for people such as (, 1999 Plant Physiol 119:839-847) McKersie to transform the regeneration clone of alfalfa (Medicago sativa).The regeneration of alfalfa and conversion are that genotype is dependent, thereby need the plant of regeneration.Described for obtaining the method for aftergrowth.For example, any other business alfalfa kind that these aftergrowths can be selected from Cultivar Rangelander (Agriculture Canada) or be described by Brown DCW and A Atanassov (1985.Plant Cell Tissue Organ Culture 4:111-112).Selectively, selected RA3 kind (University of Wisconsin) for tissue culture (people such as Walker, 1978 Am J Bot65:654-659).Cotyledon petiole explant and the agrobacterium tumefaciens C58C1 pMP90 that comprises expression vector people such as (, 1999 Plant Physiol 119:839-847) McKersie or the overnight culture of LBA4404 are cultivated altogether.Explant is being comprised to 288mg/L Pro, 53mg/L Thioproline, 4.35g/L K in the dark ₂sO ₄with on the SH inducing culture of 100 μ m Syringylethanones, cultivate altogether 3 days.At the Murashige-Skoog of half strength substratum (Murashige and Skoog, 1962) in washing explant, then by its kind not containing Syringylethanone but there is suitable selective agent and the identical SH inducing culture of suitable microbiotic (to suppress the growth of Agrobacterium) on.After several weeks, somatic embryo is transferred to not containing growth regulator, antibiotic-free but in the BOi2Y Development culture base that contains 50g/L sucrose.On the Murashige-Skoog of half strength substratum, sprout somatic embryo subsequently.The sprigging of taking root is entered to flowerpot and is grown in greenhouse.From showing the resistance of selective agent and comprising the plant generation T1 seed that list copies T-DNA inset.

Sequence table

<110> Cropdesign NV (CropDesign N.V.)

<120> has plant and the production method thereof of the growth characteristics of improvement

<130>PF57958

<150>EP?05111597.0

<151>2005-12-01

<150>US?60/742,352

<151>2005-12-05

<150>EP?05111691.1

<151>2005-12-05

<150>EP?05111786.9

<151>2005-12-07

<150>US?60/748,903

<151>2005-12-08

<150>US?60/749,219

<151>2005-12-09

<150>EP?05111996.4

<151>2005-12-12

<150>US?60/750,143

<151>2005-12-14

<150>EP?05112562.3

<151>2005-12-21

<150>US?60/753,650

<151>2005-12-23

<150>EP?05113110.0

<151>2005-12-30

<150>EP?05113111.8

<151>2005-12-30

<150>US?60/756,086

<151>2006-01-04

<150>US?60/756,042

<151>2006-01-04

<160>285

<170>PatentIn?version?3.3

<210>1

<211>353

<212>DNA

<213> rice (Oryza sativa)

<400>1

atggaaggtg?taggtgctag?gcagaggagg?aaccctctga?tacccagacc?aaacggttca 60

aagaggcatc?tgcagcatca?gcatcagcca?aatgctgccg?agaagaagac?cgccgcgaca 120

tcgaattact?tcagtatcga?ggcgttcctc?gtgctcgtct?tcctcaccat?gtcattgctc 180

atacttccat?tggtgcttcc?cccattgcct?ccgccgccat?cgctgctgct?gctgctgcca 240

gtctgcctgc?tcatcctgct?ggttgtgctg?gccttcatgc?caacggatgt?gcggagcatg 300

gcttcctctt?acttgtaaat?acatctccta?ggggaattta?tttttgtttt?tga 353

<210>2

<211>105

<212>PRT

<213> rice

<400>2

Met?Glu?Gly?Val?Gly?Ala?Arg?Gln?Arg?Arg?Asn?Pro?Leu?Ile?Pro?Arg

1 5 10 15

Pro?Asn?Gly?Ser?Lys?Arg?His?Leu?Gln?His?Gln?His?Gln?Pro?Asn?Ala

20 25 30

Ala?Glu?Lys?Lys?Thr?Ala?Ala?Thr?Ser?Asn?Tyr?Phe?Ser?Ile?Glu?Ala

35 40 45

Phe?Leu?Val?Leu?Val?Phe?Leu?Thr?Met?Ser?Leu?Leu?Ile?Leu?Pro?Leu

50 55 60

Val?Leu?Pro?Pro?Leu?Pro?Pro?Pro?Pro?Ser?Leu?Leu?Leu?Leu?Leu?Pro

65 70 75 80

Val?Cys?Leu?Leu?Ile?Leu?Leu?Val?Val?Leu?Ala?Phe?Met?Pro?Thr?Asp

85 90 95

Val?Arg?Ser?Met?Ala?Ser?Ser?Tyr?Leu

100 105

<210>3

<211>56

<212>DNA

<213> artificial sequence

<220>

<223> primer: prm08170

<400>3

ggggacaagt?ttgtacaaaa?aagcaggctt?aaacaatgga?aggtgtaggt?gctagg 56

<210>4

<211>51

<212>DNA

<213> artificial sequence

<220>

<223> primer: prm08171

<400>4

ggggaccact?ttgtacaaga?aagctgggtc?aaaaacaaaa?ataaattccc?c 51

<210>5

<211>2193

<212>DNA

<213> rice

<400>5

aatccgaaaa?gtttctgcac?cgttttcacc?ccctaactaa?caatataggg?aacgtgtgct 60

aaatataaaa?tgagacctta?tatatgtagc?gctgataact?agaactatgc?aagaaaaact 120

catccaccta?ctttagtggc?aatcgggcta?aataaaaaag?agtcgctaca?ctagtttcgt 180

tttccttagt?aattaagtgg?gaaaatgaaa?tcattattgc?ttagaatata?cgttcacatc 240

tctgtcatga?agttaaatta?ttcgaggtag?ccataattgt?catcaaactc?ttcttgaata 300

aaaaaatctt?tctagctgaa?ctcaatgggt?aaagagagag?atttttttta?aaaaaataga 360

atgaagatat?tctgaacgta?ttggcaaaga?tttaaacata?taattatata?attttatagt 420

ttgtgcattc?gtcatatcgc?acatcattaa?ggacatgtct?tactccatcc?caatttttat 480

ttagtaatta?aagacaattg?acttattttt?attatttatc?ttttttcgat?tagatgcaag 540

gtacttacgc?acacactttg?tgctcatgtg?catgtgtgag?tgcacctcct?caatacacgt 600

tcaactagca?acacatctct?aatatcactc?gcctatttaa?tacatttagg?tagcaatatc 660

tgaattcaag?cactccacca?tcaccagacc?acttttaata?atatctaaaa?tacaaaaaat 720

aattttacag?aatagcatga?aaagtatgaa?acgaactatt?taggtttttc?acatacaaaa 780

aaaaaaagaa?ttttgctcgt?gcgcgagcgc?caatctccca?tattgggcac?acaggcaaca 840

acagagtggc?tgcccacaga?acaacccaca?aaaaacgatg?atctaacgga?ggacagcaag 900

tccgcaacaa?ccttttaaca?gcaggctttg?cggccaggag?agaggaggag?aggcaaagaa 960

aaccaagcat?cctcctcctc?ccatctataa?attcctcccc?ccttttcccc?tctctatata 1020

ggaggcatcc?aagccaagaa?gagggagagc?accaaggaca?cgcgactagc?agaagccgag 1080

cgaccgcctt?cttcgatcca?tatcttccgg?tcgagttctt?ggtcgatctc?ttccctcctc 1140

cacctcctcc?tcacagggta?tgtgcccttc?ggttgttctt?ggatttattg?ttctaggttg 1200

tgtagtacgg?gcgttgatgt?taggaaaggg?gatctgtatc?tgtgatgatt?cctgttcttg 1260

gatttgggat?agaggggttc?ttgatgttgc?atgttatcgg?ttcggtttga?ttagtagtat 1320

ggttttcaat?cgtctggaga?gctctatgga?aatgaaatgg?tttagggtac?ggaatcttgc 1380

gattttgtga?gtaccttttg?tttgaggtaa?aatcagagca?ccggtgattt?tgcttggtgt 1440

aataaaagta?cggttgtttg?gtcctcgatt?ctggtagtga?tgcttctcga?tttgacgaag 1500

ctatcctttg?tttattccct?attgaacaaa?aataatccaa?ctttgaagac?ggtcccgttg 1560

atgagattga?atgattgatt?cttaagcctg?tccaaaattt?cgcagctggc?ttgtttagat 1620

acagtagtcc?ccatcacgaa?attcatggaa?acagttataa?tcctcaggaa?caggggattc 1680

cctgttcttc?cgatttgctt?tagtcccaga?attttttttc?ccaaatatct?taaaaagtca 1740

ctttctggtt?cagttcaatg?aattgattgc?tacaaataat?gcttttatag?cgttatccta 1800

gctgtagttc?agttaatagg?taatacccct?atagtttagt?caggagaaga?acttatccga 1860

tttctgatct?ccatttttaa?ttatatgaaa?tgaactgtag?cataagcagt?attcatttgg 1920

attatttttt?ttattagctc?tcaccccttc?attattctga?gctgaaagtc?tggcatgaac 1980

tgtcctcaat?tttgttttca?aattcacatc?gattatctat?gcattatcct?cttgtatcta 2040

cctgtagaag?tttctttttg?gttattcctt?gactgcttga?ttacagaaag?aaatttatga 2100

agctgtaatc?gggatagtta?tactgcttgt?tcttatgatt?catttccttt?gtgcagttct 2160

tggtgtagct?tgccactttc?accagcaaag?ttc 2193

<210>6

<211>3

<212>PRT

<213> artificial sequence

<220>

<223> guards primitive 1a

<400>6

Tyr?Phe?Ser

1

<210>7

<211>3

<212>PRT

<213> artificial sequence

<220>

<223> guards primitive 1b

<400>7

Tyr?Phe?Thr

1

<210>8

<211>3

<212>PRT

<213> artificial sequence

<220>

<223> guards primitive 1c

<400>8

Tyr?Phe?Gly

1

<210>9

<211>3

<212>PRT

<213> artificial sequence

<220>

<223> guards primitive 1d

<400>9

Tyr?Leu?Gly

1

<210>10

<211>7

<212>PRT

<213> artificial sequence

<220>

<223> guards primitive 2

<220>

<221> variant

<222>(1)..(1)

<223>/ displacement=" Ala "/displacement=" Ile "

<220>

<221> variant

<222>(7)..(7)

<223>/ displacement=" Ser "

<400>10

Val?Leu?Ala?Phe?Met?Pro?Thr

1 5

<210>11

<211>3

<212>PRT

<213> artificial sequence

<220>

<223> guards primitive 3

<220>

<221> variant

<222>(1)..(1)

<223>/ displacement=" Pro "

<400>11

Ser?Tyr?Leu

1

<210>12

<211>178

<212>PRT

<213> rice

<400>12

Met?Tyr?Leu?Leu?Ser?Pro?Arg?Asn?Gly?Asp?Glu?Glu?Asp?Glu?Gln?Glu

1 5 10 15

Glu?Ile?Gln?Glu?Leu?Ile?Ser?Asp?Asp?Glu?Pro?Pro?Asn?Leu?Lys?Leu

20 25 30

Ala?Ser?Cys?Ala?Thr?Ala?Ala?Ser?Ser?Ser?Ser?Ser?Ser?Gly?Ser?Asp

35 40 45

Met?Glu?Lys?Gly?Arg?Gly?Lys?Ala?Cys?Gly?Gly?Gly?Ser?Thr?Ala?Pro

50 55 60

Pro?Pro?Pro?Pro?Pro?Ser?Ser?Ser?Gly?Lys?Ser?Gly?Gly?Gly?Gly?Gly

65 70 75 80

Ser?Asn?Ile?Arg?Glu?Ala?Ala?Ala?Ser?Gly?Gly?Gly?Gly?Gly?Val?Trp

85 90 95

Gly?Lys?Tyr?Phe?Ser?Val?Glu?Ser?Leu?Leu?Leu?Leu?Val?Cys?Val?Thr

100 105 110

Ala?Ser?Leu?Val?Ile?Leu?Pro?Leu?Val?Leu?Pro?Pro?Leu?Pro?Pro?Pro

115 120 125

Pro?Ser?Met?Leu?Met?Leu?Val?Pro?Val?Ala?Met?Leu?Val?Leu?Leu?Leu

130 135 140

Ala?Leu?Ala?Phe?Met?Pro?Thr?Thr?Thr?Ser?Ser?Ser?Ser?Ser?Ala?Gly

145 150 155 160

Gly?Gly?Gly?Gly?Gly?Gly?Arg?Asn?Gly?Ala?Thr?Thr?Gly?His?Ala?Pro

165 170 175

Tyr?Leu

<210>13

<211>126

<212>PRT

<213> rice

<400>13

Met?Leu?Leu?Glu?His?Leu?Met?Ile?Thr?Met?Glu?Glu?Gln?Met?Phe?Arg

1 5 10 15

Glu?Gln?Gln?Met?Gln?Arg?Gly?Gly?Arg?His?His?Gln?His?His?Thr?Thr

20 25 30

Arg?Glu?Gln?Glu?Gln?Gln?Gln?Lys?Gln?Gln?Gln?Arg?Arg?Arg?Leu?Met

35 40 45

Asn?Asn?Ala?Thr?Asn?Gly?Gly?Gly?Gly?Asp?Gly?Gly?Ser?Arg?Cys?Tyr

50 55 60

Phe?Ser?Thr?Glu?Ala?Ile?Leu?Val?Leu?Ala?Cys?Val?Thr?Val?Ser?Leu

65 70 75 80

Leu?Val?Leu?Pro?Leu?Ile?Leu?Pro?Pro?Leu?Pro?Pro?Pro?Pro?Thr?Leu

85 90 95

Leu?Leu?Leu?Leu?Pro?Val?Cys?Leu?Leu?Ala?Leu?Leu?Val?Val?Leu?Ala

100 105 110

Phe?Met?Pro?Thr?Asp?Met?Arg?Thr?Met?Ala?Ser?Ser?Tyr?Leu

115 120 125

<210>14

<211>105

<212>PRT

<213> Zea mays (Zea mays)

<220>

<221> is uncertain

<222>(65)..(75)

<223>Xaa can be any natural amino acid

<400>14

Met?Ala?Ser?Arg?Ser?Ser?Ala?Met?Glu?Gly?Gly?Ala?Ala?Ile?Gln?Arg

1 5 10 15

Arg?Asn?Ala?Val?Lys?Arg?His?Leu?Gln?Gln?Arg?Gln?Gln?Glu?Ala?Asp

20 25 30

Phe?Leu?Asp?Lys?Lys?Val?Ile?Ala?Ser?Thr?Tyr?Phe?Ser?Ile?Gly?Ala

35 40 45

Phe?Leu?Val?Leu?Ala?Cys?Leu?Thr?Val?Ser?Leu?Leu?Ile?Leu?Pro?Leu

50 55 60

Xaa?Xaa?Xaa?Xaa?Xaa?Xaa?Xaa?Xaa?Xaa?Xaa?Xaa?Leu?Leu?Trp?Leu?Pro

65 70 75 80

Val?Cys?Leu?Leu?Val?Leu?Leu?Val?Val?Leu?Ala?Phe?Met?Pro?Thr?Asp

85 90 95

Val?Arg?Ser?Met?Ala?Ser?Ser?Tyr?Leu

100 105

<210>15

<211>110

<212>PRT

<213> common wheat (Triticum aestivum)

<400>15

Met?Asp?Ser?Gln?Phe?Gly?Ala?Leu?Glu?Arg?Gly?Gly?Ser?Arg?Gln?Arg

1 5 10 15

Arg?Ser?Pro?Val?Leu?Ala?Arg?Pro?Asn?Thr?Thr?Lys?Arg?His?Ile?Gln

20 25 30

Gln?Gln?Arg?Ala?Asn?Ala?Ala?Asp?Lys?Lys?Val?Val?Met?Pro?Asn?Tyr

35 40 45

Phe?Ser?Ile?Glu?Ala?Phe?Phe?Val?Leu?Ala?Cys?Leu?Thr?Val?Ser?Leu

50 55 60

Leu?Ile?Leu?Pro?Leu?Val?Leu?Pro?Pro?Leu?Pro?Pro?Pro?Pro?Ser?Leu

65 70 75 80

Leu?Leu?Phe?Val?Pro?Val?Cys?Leu?LeuIle?Leu?Leu?Met?Val?Leu?Ala

85 90 95

Phe?Met?Pro?Thr?Asp?Met?Arg?Ser?Met?Ala?Thr?Ser?Tyr?Leu

100 105 110

<210>16

<211>110

<212>PRT

<213> barley (Hordeum vulgare)

<400>16

Met?Asp?Ser?Gln?Phe?Gly?Ala?Met?Asp?Arg?Gly?Gly?Ser?Arg?Gln?Arg

1 5 10 15

Ser?Ser?Pro?Val?Leu?Ala?Arg?Pro?Asn?Thr?Ala?Lys?Arg?Gln?Met?Gln

20 25 30

Gln?Gln?Arg?Ala?Asn?Ala?Ala?Asp?Lys?Lys?Val?Val?Ile?Pro?Asn?Tyr

35 40 45

Phe?Gly?Val?Glu?Ala?Phe?Phe?Val?Leu?Ala?Cys?Leu?Thr?Val?Ser?Leu

50 55 60

Leu?Ile?Leu?Pro?Leu?Val?Leu?Pro?Pro?Leu?Pro?Pro?Pro?Pro?Ser?Leu

65 70 75 80

Leu?Leu?Leu?Leu?Pro?Val?Cys?Leu?Leu?Ile?Leu?Leu?Met?Val?Leu?Ala

85 90 95

Phe?Met?Pro?Thr?Asp?Val?Arg?Ser?Met?Ala?Thr?Ser?Tyr?Leu

100 105 110

<210>17

<211>99

<212>PRT

<213> sugarcane (Saccharum officinarum)

<220>

<221> is uncertain

<222>(62)..(62)

<223>Xaa can be any natural amino acid

<400>17

Met?Glu?Gly?Gly?Gly?Gln?Ile?Gln?Arg?Arg?Asn?Asn?Ala?Val?Lys?Arg

1 5 10 15

His?Leu?Gln?Gln?Arg?Gln?Gln?Glu?Ala?Asp?Phe?Leu?Asp?Lys?Lys?Val

20 25 30

Ile?Ala?Ser?Thr?Tyr?Phe?Ser?Ile?Glu?Ala?Phe?Leu?Val?Leu?Ala?Cys

35 40 45

Leu?Thr?Val?Ser?Leu?Leu?Ile?Leu?Pro?Leu?Val?Leu?Pro?Xaa?Leu?Pro

50 55 60

Ala?Pro?Ala?Ser?Leu?Leu?Leu?Trp?Leu?Pro?Val?Trp?Leu?Leu?Glu?Leu

65 70 75 80

Leu?Ile?Val?Leu?Ala?Phe?Met?Pro?Thr?Asp?Val?Arg?Ser?Met?Ala?Ser

85 90 95

Ser?Tyr?Leu

<210>18

<211>99

<212>PRT

<213> sugarcane

<400>18

Met?Glu?Gly?Gly?Gly?Gln?Ile?Gln?Arg?Arg?Asn?Asn?Ala?Val?Lys?Arg

1 5 10 15

His?Leu?Gln?Gln?Arg?Gln?Gln?Glu?Ala?Asp?Phe?Leu?Asp?Lys?Lys?Val

20 25 30

Ile?Ala?Ser?Thr?Tyr?Phe?Ser?Ile?Glu?Ala?Phe?Leu?Val?Leu?Ala?Cys

35 40 45

Leu?Thr?Val?Ser?Leu?Leu?Ile?Leu?Pro?Leu?Val?Leu?Pro?Pro?Leu?Pro

50 55 60

Pro?Pro?Pro?Ser?Leu?Leu?Leu?Trp?Leu?Pro?Val?Cys?Leu?Leu?Ile?Leu

65 70 75 80

Leu?Ile?Val?Leu?Ala?Phe?Met?Pro?Thr?Asp?Val?Arg?Ser?Met?Ala?Ser

85 90 95

Ser?Tyr?Leu

<210>19

<211>107

<212>PRT

<213> Chinese sorghum (Sorghum bicolour)

<400>19

Met?Ala?Ser?Arg?Ser?Ser?Ala?Leu?Glu?Gly?Gly?Gly?Ala?Ala?Ile?Gln

1 5 10 15

Arg?Arg?Asn?Asn?Ala?Val?Lys?Arg?His?Leu?Gln?Gln?Arg?Gln?Gln?Glu

20 25 30

Ala?Asp?Phe?His?Asp?Lys?Lys?Val?Ile?Ala?Ser?Thr?Tyr?Phe?Ser?Ile

35 40 45

Gly?Ala?Phe?Leu?Val?Leu?Ala?Cys?Leu?Thr?Phe?Ser?Leu?Leu?Ile?Leu

50 55 60

Pro?Leu?Val?Leu?Pro?Pro?Leu?Pro?Pro?Pro?Pro?Ser?Leu?Leu?Leu?Trp

65 70 75 80

Leu?Pro?Val?Cys?Leu?Leu?Val?Leu?Leu?Val?Val?Leu?Ala?Phe?Met?Pro

85 90 95

Thr?Asp?Val?Arg?Ser?Val?Ala?Ala?Ser?Tyr?Leu

100 105

<210>20

<211>130

<212>PRT

<213> Arabidopis thaliana (Arabidopsis thaliaha)

<400>20

Met?Ile?Arg?Glu?Ile?Ser?Asn?Leu?Gln?Lys?Asp?Ile?Ile?Asn?Ile?Gln

1 5 10 15

Asp?Ser?Tyr?Ser?Asn?Asn?Arg?Val?Met?Asp?Val?Gly?Arg?Asn?Asn?Arg

20 25 30

Lys?Asn?Met?Ser?Phe?Arg?Ser?Ser?Pro?Glu?Lys?Ser?Lys?Gln?Glu?Leu

35 40 45

Arg?Arg?Ser?Phe?Ser?Ala?Gln?Lys?Arg?Met?Met?Ile?Pro?Ala?Asn?Tyr

50 55 60

Phe?Ser?Leu?Glu?Ser?Leu?Phe?Leu?Leu?Val?Gly?Leu?Thr?Ala?Ser?Leu

65 70 75 80

Leu?Ile?Leu?Pro?Leu?Val?Leu?Pro?Pro?Leu?Pro?Pro?Pro?Pro?Phe?Met

85 90 95

Leu?Leu?Leu?Val?Pro?Ile?Gly?Ile?Met?Val?Leu?Leu?Val?Val?Leu?Ala

100 105 110

Phe?Met?Pro?Ser?Ser?His?Ser?Asn?Ala?Asn?Thr?Asp?Val?Thr?Cys?Asn

115 120 125

Phe?Met

130

<210>21

<211>135

<212>PRT

<213> Arabidopis thaliana

<400>21

Met?Ile?Arg?Glu?Phe?Ser?Ser?Leu?Gln?Asn?Asp?Ile?Ile?Asn?Ile?Gln

1 5 10 15

Glu?His?Tyr?Ser?Leu?Asn?Asn?Asn?Met?Asp?Val?Arg?Gly?Asp?His?Asn

20 25 30

Arg?Lys?Asn?Thr?Ser?Phe?Arg?Gly?Ser?Ala?Pro?Ala?Pro?Ile?Met?Gly

35 40 45

Lys?Gln?Glu?Leu?Phe?Arg?Thr?Leu?Ser?Ser?Gln?Asn?Ser?Pro?Arg?Arg

50 55 60

Leu?Ile?Ser?Ala?Ser?Tyr?Phe?Ser?Leu?Glu?Ser?Met?Val?Val?Leu?Val

65 70 75 80

Gly?Leu?Thr?Ala?Ser?Leu?Leu?Ile?Leu?Pro?Leu?Ile?Leu?Pro?Pro?Leu

85 90 95

Pro?Pro?Pro?Pro?Phe?Met?Leu?Leu?Leu?Ile?Pro?Ile?Gly?Ile?Met?Val

100 105 110

Leu?Leu?Met?Val?Leu?Ala?Phe?Met?Pro?Ser?Ser?Asn?Ser?Lys?His?Val

115 120 125

Ser?Ser?Ser?Ser?Thr?Phe?Met

130 135

<210>22

<211>139

<212>PRT

<213> grape (Vitis vinifera)

<400>22

Met?Ser?Ile?Glu?Gln?Pro?Glu?Ala?Asp?Ser?Arg?Leu?Ser?Glu?Gly?Pro

1 5 10 15

Leu?Ile?Asn?Leu?Gln?Asp?Arg?Tyr?Leu?Ser?Gly?Ile?Met?Glu?Ala?Arg

20 25 30

Gly?Arg?Arg?Asn?Ser?Ala?Pro?Leu?Gln?Val?Glu?Arg?Lys?Asn?Pro?Thr

35 40 45

Pro?Pro?Met?Ala?Glu?Gly?Lys?Lys?Met?Glu?Tyr?Asn?Arg?Thr?Pro?Leu

50 55 60

Ser?Arg?Glu?Asn?Ser?Arg?Arg?Leu?Ile?Pro?Ala?Ser?Tyr?Phe?Ser?Leu

65 70 75 80

Glu?Ser?Leu?Leu?Leu?Leu?Ile?Cys?Leu?Thr?Ala?Ser?Leu?Leu?Ile?Leu

85 90 95

Pro?Leu?Ile?Leu?Pro?Pro?Leu?Pro?Pro?Pro?Pro?Phe?Met?Leu?Leu?Leu

100 105 110

Leu?Pro?Ile?Gly?Ile?Leu?Ala?Val?Leu?Met?Ile?Leu?Ala?Phe?Met?Pro

115 120 125

Ser?Asn?Val?Arg?Asp?Leu?Thr?Tyr?Thr?Tyr?Val

130 135

<210>23

<21l>126

<212>PRT

<213> Citrus (Citrus sp.)

<220>

<221> is uncertain

<222>(103)..(103)

<223>Xaa can be any natural amino acid

<400>23

Met?Asn?Ser?Asp?Asn?Ser?Glu?Ser?Arg?Gln?Arg?Leu?Ser?Lys?Gly?Ile

1 5 10 15

Ile?Asn?Leu?Gln?Asp?Arg?Tyr?Pro?Thr?Ser?Ile?Met?Asp?Arg?Gly?Val

20 25 30

Arg?Lys?Ile?Ala?Thr?Pro?Pro?Val?Glu?Lys?Arg?Lys?Val?Glu?Tyr?His

35 40 45

Arg?Ser?Tyr?Ser?Gln?Gly?Ala?Ser?Arg?Lys?Leu?Phe?Ser?Ala?Ser?Tyr

50 55 60

Phe?Thr?Leu?Glu?Ser?Leu?Leu?Leu?Leu?Val?Cys?Leu?Thr?Ala?Ser?Leu

65 70 75 80

Leu?Ile?Leu?Pro?Leu?Val?Leu?Pro?Pro?Leu?Pro?Pro?Pro?Pro?Phe?Leu

85 90 95

Leu?Leu?Leu?Val?Pro?Ile?Xaa?Ile?Leu?Ala?Val?Leu?Leu?Val?Leu?Ala

100 105 110

Phe?Met?Pro?Ser?Asn?Val?Arg?Asp?Ile?Thr?Ser?Thr?Tyr?Val

115 120 125

<210>24

<211>118

<212>PRT

<213> tomato (Lycorpersicon esculentum)

<400>24

Met?Asn?Met?Asp?Met?Glu?Ser?Ser?Glu?Ala?Lys?Leu?Arg?Ser?Ser?Lys

1 5 10 15

Gly?Phe?Ile?Asn?Leu?Glu?Glu?His?Gln?Gln?Tyr?Phe?Asn?Asn?Ile?Met

20 25 30

Glu?Gly?Asn?Lys?Met?Glu?His?Lys?Arg?Ser?Phe?Thr?Gln?Gly?His?Gly

35 40 45

Lys?Lys?Met?Leu?Ser?Met?Asn?Tyr?Phe?Ser?Leu?Glu?Ser?Ile?Ile?Leu

50 55 60

Leu?Leu?Gly?Leu?Thr?Ala?Ser?Leu?Leu?Leu?Leu?Pro?Leu?Met?Leu?Pro

65 70 75 80

Pro?Leu?Pro?Pro?Pro?Pro?Phe?Met?Leu?Leu?Leu?Val?Pro?Ile?Phe?Ile

85 90 95

Leu?Val?Val?Leu?Met?Ile?Leu?Ala?Phe?Met?Pro?Ser?Asn?Val?Arg?Asn

100 105 110

Val?Thr?Cys?Ser?Tyr?Leu

115

<210>25

<211>87

<212>PRT

<213> tomato

<400>25

Met?Glu?Gly?Asn?Lys?Met?Glu?His?Lys?Arg?Ser?Phe?Thr?Gln?Gly?His

1 5 10 15

Gly?Lys?Lys?Met?Leu?Ser?Met?Asn?Tyr?Phe?Ser?Leu?Glu?Ser?Ile?Ile

20 25 30

Leu?Leu?Leu?Gly?Leu?Thr?Ala?Ser?Leu?Leu?Leu?Leu?Pro?Leu?Met?Leu

35 40 45

Pro?Pro?Leu?Pro?Pro?Pro?Pro?Phe?Met?Leu?Leu?Leu?Val?Pro?Ile?Phe

50 55 60

Ile?Leu?Val?Val?Leu?Met?Ile?Leu?Ala?Phe?Met?Pro?Ser?Asn?Val?Arg

65 70 75 80

Asn?Val?Thr?Cys?Ser?Tyr?Leu

85

<210>26

<211>106

<212>PRT

<213> Arabidopis thaliana

<400>26

Met?Asp?Val?Gly?Arg?Asn?Asn?Arg?Lys?Asn?Met?Ser?Phe?Arg?Ser?Ser

1 5 10 15

Pro?Glu?Lys?Ser?Lys?Gln?Glu?Leu?Arg?Arg?Ser?Phe?Ser?Ala?Gln?Lys

20 25 30

Arg?Met?Met?Ile?Pro?Ala?Asn?Tyr?Phe?Ser?Leu?Glu?Ser?Leu?Phe?Leu

35 40 45

Leu?Val?Gly?Leu?Thr?Ala?Ser?Leu?Leu?Ile?Leu?Pro?Leu?Val?Leu?Pro

50 55 60

Pro?Leu?Pro?Pro?Pro?Pro?Phe?Met?Leu?Leu?Leu?Val?Pro?Ile?Gly?Ile

65 70 75 80

Met?Val?Leu?Leu?Val?Val?Leu?Ala?Phe?Met?Pro?Ser?Ser?His?Ser?Asn

85 90 95

Ala?Asn?Thr?Asp?Val?Thr?Cys?Asn?Phe?Met

100 105

<210>27

<211>537

<212>DNA

<213> rice

<400>27

atgtacttgt?tgagcccaag?aaatggcgac?gaggaggacg?aacaggagga?aatccaggag 60

ctgatcagcg?acgacgagcc?gcccaatctc?aagttggcat?cctgcgccac?tgcagccagc 120

agcagcagca?gcagcggcag?cgacatggag?aagggaagag?gtaaagcctg?cggcggcggg 180

agtacggcgc?cgccgccgcc?gccgccgtcg?tcgtcaggta?aatccggcgg?cggcggcggc 240

agcaatatca?gggaggcggc?ggctagcggc?ggcggcggcg?gcgtgtgggg?caagtacttc 300

tcggtggagt?cgctgctcct?gctggtgtgc?gtgacggcgt?cgctggtgat?cctcccgctc 360

gtgctgccgc?cgctgccccc?gccgccgtcg?atgctgatgc?tggtgccggt?ggcgatgctg 420

gtgctgctgc?tggcgctggc?gttcatgccg?acgacgacgt?cgtcgtcgtc?gtccgccggc 480

ggcggcggcg?gcggcggccg?caatggggcg?acgacgggac?atgctcccta?cttgtag 537

<210>28

<211>538

<212>DNA

<213> Zea mays

<220>

<221>misc_feature

<222>(177)..(208)

<223>n is a, c, g, or t

<220>

<221>misc_feature

<222>(493)..(493)

<223>n is a, c, g, or t

<400>28

ttcacattac?actcatgact?cgtcttagga?cgaatcctgc?agctgcaaaa?cacagaaaat 60

ctggccaaga?cctatttatc?tatttacagg?taagaggagg?ccatgctgcg?cacatctgtc 120

ggcatgaagg?ccagtacaac?cagcaagacg?agcaggcaga?ccggcagcca?cagcagnnnn 180

nnnnnnnnnn?nnnnnnnnnn?nnnnnnnncc?agcggcagta?tcagcagcga?gacggtgagg 240

caggcgagca?cgaggaatgc?cccgatgctg?aagtaggtgg?acgcgatgac?cttcttgtcg 300

aggaaatccg?cctcctgctg?acgctgctgc?agatgccgct?tcacggcatt?cctcctttgt 360

attgccgccc?ctccttccat?cgcgctagat?cggcttgcca?tgtgttcttt?ggtgtaggcg 420

gaggtggaga?ccagtcgcag?tgagtggttg?ccaaagtaag?caagaagtga?aaggcggtgt 480

agaaccgcct?tgngttttct?gaacgttttg?taatcagatc?tgagctcggg?tggtcgaa 538

<210>29

<21l>578

<212>DNA

<213> grape

<400>29

tttttttttt?tttttttaat?caagaaataa?aataactgat?tttcatctga?atatcaagac 60

aaataacaaa?aattgtatga?tgagaagagg?tgcacttttg?aacaccacca?tttacacata 120

tgtataagtc?aaatctctga?cattagaagg?catgaaagcc?aagatcataa?gcactgctag 180

aatgccaatg?gggagcagaa?gcagcatgaa?aggagggggt?ggcaatggtg?gtagtatcag 240

gggaaggatc?agcaatgaag?ccgtgagaca?gatgagcaaa?agcaatgact?ccaagctgaa 300

atagcttgct?gggatcagtc?tcctgctgtt?ctctcgtgag?aggggagttc?tattatattc 360

catcttcttt?ccttcggcca?taggaggagt?agggtttttc?ctctcaactt?gcagaggagc 420

agagttcctc?cttcctctcg?cttccatgat?gccactcaaa?tatcgatctt?gcagattgat 480

caaaggtcct?tcagacagtc?ttgaatctgc?ttcaggctgc?tcaatactca?tttaaatttc 540

tcctttaccg?gtcaccaagt?tccaaccggt?tcaaagta 578

<210>30

<21l>704

<212>DNA

<213> tangerine (Citrus reticulate)

<220>

<221>misc_feature

<222>(619)..(619)

<223>n is a, c, g, or t

<400>30

agggtttctt?caaagatagg?tagccatttg?cacatttgaa?tctgcttgtt?ggatattgtc 60

aaggaggctg?ttggaattag?gccacatttc?agaatctggt?ttcatcctgg?atcgctgggc 120

atttgaaggc?attttgtgat?catcgctgtt?taaaatttgg?ccgcatatta?gaatctgggt 180

tctcatcggt?tttccgtaca?tttaccttga?ccacattttg?atatctgggt?tgagctgcat 240

tttagccttc?gtatttaaaa?ggacttgatc?taatctgggg?tcttggtgag?ccggggcaac 300

tgatcatagt?aaatgaattc?tgataattct?gagtcgagac?agagactatc?aaagggcatt 360

ataaacttgc?aagatcgata?tccgaccagc?attatggatc?gtggtgtaag?aaaaattgca 420

actcctccgg?tcgagaagag?gaaagttgag?tatcaccgaa?gttactcgca?aggggcatcc 480

agaaaactgt?tttcggcaag?ctatttcacc?ctggaatcat?tgcttttgct?cgtatgtctg 540

acggcctcat?tgctgatcct?gccattggtg?cttccgccct?tgccgccccc?gccattcctg 600

ctgcttctgg?ttcctatang?tattctagcc?gtgcttttgg?tcttggcatt?catgccttct 660

aatgtaagag?atataacttc?cacgtacgtg?taaatggtgt?tgct 704

<210>31

<211>382

<212>DNA

<213> tomato

<400>31

gaaaaaaatg?tatttaatca?ttatgtaaaa?aacaagtgaa?tctactttga?tattttcttc 60

taaattaaac?cacacaatta?aagatatgag?caagtcacat?tcctaacatt?agaaggcata 120

aaagctaaga?tcataagaac?aacaagaatg?aaaattggga?ctaacaacaa?cataaaaggt 180

ggtggtggca?atggtggaag?catcaatggc?aaaagtaaca?aagatgctgt?aagaccaagt 240

aacaaaataa?ttgactctaa?gctaaaataa?ttcattgaca?acattttctt?gccatgtcct 300

tgtgtaaatg?atctcttatg?ctccatctta?ttgccttcca?taatgttgtt?gaaatattgt 360

tgatgttcct?ccaaattaat?aa 382

<210>32

<211>624

<212>DNA

<213> tomato

<400>32

tttgttaaag?attggcacat?tttcaagttc?agtattcatt?cgatttttga?tatctacata 60

aaaaaaaagt?gtcctggtac?tactcaatat?tcctcagaac?gacttcatat?tcaggtctcg 120

aattcaaaac?ctcacatcaa?gattcttagg?aaatttcaag?attggttgaa?aaactcatat 180

ccttctctaa?gtttcaagat?tggttccaaa?ttaaaactcg?agacttctga?gtaagagcgt 240

acgactagta?atgaacatgg?acatggaatc?atcagaggca?aaattgagat?catcaaaagg 300

gtttattaat?ttggaggaac?atcaacaata?tttcaacaac?attatggaag?gcaataagat 360

ggagcataag?agatcattta?cacaaggaca?tggcaagaaa?atgttgtcaa?tgaattattt 420

tagcttagag?tcaattattt?tgttacttgg?tcttacagca?tctttgttac?ttttgccatt 480

gatgcttcca?ccattgccac?caccaccttt?tatgttgttg?ttagtcccaa?ttttcattct 540

tgttgttctt?atgatcttag?cttttatgcc?ttctaatgtt?aggaatgtga?cttgctcata 600

tctttaattg?tgtggtttaa?ttta 624

<210>33

<211>1130

<212>DNA

<213> rice

<400>33

catgcggcta?atgtagatgc?tcactgcgct?agtagtaagg?tactccagta?cattatggaa 60

tatacaaagc?tgtaatactc?gtatcagcaa?gagagaggca?cacaagttgt?agcagtagca 120

caggattaga?aaaacgggac?gacaaatagt?aatggaaaaa?caaaaaaaaa?caaggaaaca 180

catggcaata?taaatggaga?aatcacaaga?ggaacagaat?ccgggcaata?cgctgcgaaa 240

gtactcgtac?gtaaaaaaaa?gaggcgcatt?catgtgtgga?cagcgtgcag?cagaagcagg 300

gatttgaaac?cactcaaatc?caccactgca?aaccttcaaa?cgaggccatg?gtttgaagca 360

tagaaagcac?aggtaagaag?cacaacgccc?tcgctctcca?ccctcccacc?caatcgcgac 420

gcacctcgcg?gatcggtgac?gtggcctcgc?cccccaaaaa?tatcccgcgg?cgtgaagctg 480

acaccccggg?cccacccacc?tgtcacgttg?gcacatgttg?gttatggttc?ccggccgcac 540

caaaatatca?acgcggcgcg?gcccaaaatt?tccaaaatcc?cgcccaagcc?cctggcgcgt 600

gccgctcttc?cacccaggtc?cctctcgtaa?tccataatgg?cgtgtgtacc?ctcggctggt 660

tgtacgtggg?cgggttaccc?tgggggtgtg?ggtggatgac?gggtgggccc?ggaggaggtc 720

cggccccgcg?cgtcatcgcg?gggcggggtg?tagcgggtgc?gaaaaggagg?cgatcggtac 780

gaaaattcaa?attaggaggt?ggggggcggg?gcccttggag?aataagcgga?atcgcagata 840

tgcccctgac?ttggcttggc?tcctcttctt?cttatccctt?gtcctcgcaa?ccccgcttcc 900

ttctctcctc?tcctcttctc?ttctcttctc?tggtggtgtg?ggtgtgtccc?tgtctcccct 960

ctccttcctc?ctctcctttc?ccctcctctc?ttcccccctc?tcacaagaga?gagagcgcca 1020

gactctcccc?aggtgaggtg?agaccagtct?ttttgctcga?ttcgacgcgc?ctttcacgcc 1080

gcctcgcgcg?gatctgaccg?cttccctcgc?ccttctcgca?ggattcagcc 1130

<210>34

<211>77

<212>PRT

<213> alfalfa (Medicago sativa)

<400>34

Met?Val?Arg?Cys?Phe?Ser?Leu?Gly?Ser?Val?Leu?Ile?Leu?Ile?Ala?Leu

1 5 10 15

Ala?Ala?Ser?Met?Val?Val?Leu?Pro?Leu?Met?Leu?Pro?Pro?Leu?Pro?Pro

20 25 30

Pro?Pro?Leu?Ala?Leu?Leu?Phe?Phe?Pro?Val?Gly?Ile?Met?Ala?Ala?Leu

35 40 45

Val?Val?Leu?Ala?Phe?Ser?Pro?Ser?Glu?Asn?Val?Lys?Asn?Val?Val?Val

50 55 60

Tyr?Ser?Ser?Ser?Ser?Ser?Gly?Ile?Ala?Asn?Ser?Lys?Arg

65 70 75

<210>35

<211>78

<212>PRT

<213> alfalfa

<400>35

Met?Ile?Met?Val?Ala?Ser?Lys?Glu?Lys?Thr?Asn?Ser?Gly?Gly?Cys?Met

1 5 10 15

Phe?Arg?Tyr?Ser?Val?Leu?Ile?Leu?Ser?Leu?Leu?Ala?Leu?Ser?Ile?Leu

20 25 30

Val?Leu?Pro?Leu?Val?Met?Pro?Pro?Leu?Pro?Pro?Pro?Pro?Leu?Leu?Leu

35 40 45

Leu?Leu?Val?Pro?Val?Phe?Ile?Met?Leu?Leu?Leu?Phe?Phe?Ile?Ala?Phe

50 55 60

Ser?Pro?Ser?Lys?Lys?Val?Pro?Asn?Lys?Ala?Ser?Phe?Val?Ser

65 70 75

<210>36

<211>613

<212>DNA

<213> barley

<400>36

cttccgagaa?agatgcttca?tattgcactc?atcttatgcc?aacacacaat?cagaaacaaa 60

aaccacgcag?caagcctatt?tacaagtaag?aggtggccat?gctccgcaca?tcagtcggca 120

tgaaggccag?caccatcaac?aggatgagca?agcagaccgg?caagagcagc?agtagcgatg 180

gcggtggggg?caacggaggc?agcaccaatg?gcagtatgag?caatgaaacg?gtgaggcagg 240

cgagcacgaa?gaacgcttcg?acgccgaagt?agttcggtat?gacaaccttc?ttgtcagcag 300

catttgccct?ctgctgctgc?atttgcctct?ttgcagtatt?tggtctggct?aacacagggc 360

tgctcctctg?cctactaccg?cctctgtcca?ttgcaccgaa?ctggctatcc?atctattctt 420

tggtgagtgc?agatcagcgg?ctatccagga?actgagatga?ataagaactt?gtggaatctg 480

aaggttttta?acagatctga?agtctttgtg?agtccgtgac?tgaactgcag?atcatctgct 540

gtggaagaac?tgcaccgcaa?gtggcaatac?cttcgatcct?gaaacttgca?ttttggtgat 600

gcccgtacca?cgc 613

<210>37

<211>617

<212>DNA

<213> sugarcane

<220>

<221>misc_feature

<222>(451)..(451)

<223>n is a, c, g, or t

<400>37

ggagaacgtg?cttgttcagg?tggttcaaca?gtgcggacca?gagaacaatg?cgaggttcag 60

gattaaaggt?attctggctt?cagaggcagt?tcttccaaag?caagtgacag?gcgattccat 120

caccggagct?aagatcttat?tacaacattc?agaaacacag?gagtcctccc?accgcctttc 180

acttcttgct?tacttctgca?accactcgcc?gtgactgatc?tccacgcaca?ccaaagaaca 240

caacacgtgg?caagccgatc?tagcgcgatg?gaaggagggg?ggcaaataca?gaggaggaat 300

aatgccgtga?agcggcacct?gcagcagcgg?cagcaggagg?cggatttcct?cgacaagaag 360

gtcatcgcgt?ccacctattt?cagcatcgag?gcgttcctcg?tgctcgcctg?cctcaccgtc 420

tcgctgctga?tactgccgct?tgtgctgccg?ncgctgccgg?cgccggcgtc?gctgctgctg 480

tggctgccgg?tctggctgct?cgaactgctg?attgtgcttg?ccttcatgcc?gacagatgtg 540

cgcagcatgg?cctcctctta?cttgtaaaaa?aatagataaa?taggccacct?ttggcaattt 600

tctggggttt?ggaggtg 617

<210>38

<211>638

<212>DNA

<213> sugarcane

<400>38

gattttttcc?aagccagtga?ccggcgattc?atcaaccgga?gctgagatct?tatacaacat 60

tcagaaacac?aggagtcctc?gcaccgcttt?ccactcttgg?ctaattttgc?aaccactcgc 120

cgtgactgat?ctccacgcac?accaaagaac?acaacacgtg?gcaacccgat?ctagcgcgat 180

ggaaggaggg?gggcaaatac?agaggaggaa?taatgccgtg?aagcggcacc?tgcagcagcg 240

gcagcaggag?gcggatttcc?tcgacaagaa?ggtcatcgcg?tccacctatt?tcagcatcga 300

ggcgttcctc?gtgctcgcct?gcctcaccgt?ctcgctgctg?atactgccgc?tggtgctgcc 360

gccgctgccg?ccgccgccgt?cgctgctgct?gtggctgccg?gtctgcctgc?tcatcctgct 420

gattgtgctg?gccttcatgc?cgacagatgt?gcgcagcatg?gcctcctctt?acttgtaata 480

aatagataaa?taggccacct?tggtcaatat?tctgtgattt?ggaggtgatt?cgtcctgaga 540

tgagtctcga?ttgatgtcag?ctactcccaa?ggggaaatgc?atgtaacact?tggtggccga 600

cggtggcaag?ataatcatgc?taccatgtca?gttaaacc 638

<210>39

<211>778

<212>DNA

<213> Chinese sorghum

<400>39

gctgttggtg?ttgttcttga?gatctctttc?ttgatcttgt?gtgggattaa?agagggattc 60

ttgccttcct?acgggagaaa?gagaaaaggg?gaagaacgtg?cttgttccgg?tggttcaaca 120

gtgcggagac?ccggagaaca?atgcgaggtt?caggattaaa?ggtgttctgg?cttcaggtgc 180

agttcttcca?aagcaggtga?caggcgattc?gatcaccgga?gctcagatct?gacgaaaaca 240

aaacacagtc?ctcctcccac?cgcctttcag?ttcttgctta?cttctgcaac?cactcactgc 300

gaccgtacac?caaagaacac?tgcacatggc?aagccgatct?agcgcgctgg?aaggaggggg 360

ggcagcaata?cagcggagga?ataatgccgt?gaagcggcac?ctgcagcagc?ggcagcagga 420

ggcggatttc?cacgacaaga?aggtcatcgc?gtccacctac?ttcagcatcg?gcgcgttcct 480

ggtgctcgcc?tgcctcacct?tctcgctgct?catcctgccg?ctggtgctgc?cgccgctgcc 540

gccgccgccg?tcgctgctgc?tgtggctgcc?ggtctgcctg?ctcgtcctgc?tggttgtgct 600

ggccttcatg?ccgacagatg?tgcgcagcgt?ggcggcctct?tacttgtaaa?tagccagata 660

aataggccac?cacctttggc?cagttttctg?tgttttcggg?ggtgattcgt?cctaagatga 720

gtcatgatcg?agtgtaatgt?gaagcatctt?ttccaggggt?agtagatttc?aatgaagt 778

<210>40

<211>732

<212>DNA

<213> Arabidopis thaliana

<400>40

ttgtcttcct?catttcccta?ctagtacttg?tttcacacag?tttcttgatc?caaccaaaac 60

caatacacaa?agcttctcaa?actccttcac?ctcaaagctt?cttcctttac?atctgaatcg 120

ttgagttaac?tcggatttgt?tctgcatcct?ctgtttctga?atcgtgggcc?atccttattt 180

tgtctcgaat?tcttcaccaa?ttgcttcgat?caagctgcat?tggttaacca?gttgccctaa 240

agatcagatc?tttgagcaaa?attttgtcac?tgatcttcta?aatccaaacc?agacacagca 300

aaacaacctc?tgtagatgat?tcgagaaatc?tcaaacttac?aaaaagatat?tataaacatt 360

caagacagtt?attcgaacaa?ccgagtcatg?gacgtcggaa?gaaacaaccg?gaaaaacatg 420

agctttcgaa?gttcgccgga?gaaaagcaag?caagagttac?ggcggagttt?ctcggcgcag 480

aaaaggatga?tgatcccggc?gaattatttc?agtttagagt?ctctgttcct?attggttggt 540

ctaacggcat?ctctgttaat?acttccgtta?gttttgccgc?cgttacctcc?gcctccgttt 600

atgctgctat?tggttcccat?tgggattatg?gttttactcg?tcgttcttgc?cttcatgcct 660

tcttctcatt?ctaatgctaa?tacagatgta?acttgcaatt?tcatgtaaat?ctgaaattta 720

ttatatgatg?at 732

<210>41

<211>891

<212>DNA

<213> Arabidopis thaliana

<400>41

cccactttat?ttcttcttct?ctggttttct?taccaaaaga?aactttcttc?gtcttcctct 60

gtatttaagc?tttaacaccc?tgtttttggt?ttccaacgtt?caatcttcat?cttcttctcg 120

ctgaaggtgt?gtttggctct?aacggtttaa?agctttcttg?aaacaccaat?tgaatctttt 180

ctctctaccg?gcaaaaaaaa?aagattagtc?cttttaggtc?tggaaacgcc?aagatcactc 240

gttctaaacc?ttagattttg?tctgcatttc?gggataatca?tttcatcgtc?agggttcttc 300

aaccaaacta?catttacaga?agaagaagaa?gaagaaaagt?tcgttacttt?ttatgcgttt 360

ggataaacaa?actcaagttt?cttcttcata?catcgatctg?attttccaga?tcaaacttcg 420

aaaagagaaa?aagccttctt?taaatgattc?gtgagttctc?cagtctacaa?aacgacatca 480

taaacattca?agaacattat?tctctcaaca?acaacatgga?cgtgagagga?gatcataacc 540

ggaaaaacac?gagttttcgt?ggttcagctc?cagctccgat?tatggggaag?caagaattgt 600

ttcggacatt?gtcgtcgcag?aacagtccaa?ggaggctaat?atcagcgagt?tacttcagtt 660

tagaatcaat?ggttgtgctt?gttggtctca?cagcatctct?cttgatctta?ccgttgattc 720

ttccaccatt?gcctcctcct?ccttttatgc?tgcttttgat?tcctattggg?attatggttt 780

tgcttatggt?tcttgctttc?atgccttctt?ctaattccaa?acatgtttct?tcttcttcca 840

cttttatgta?ataaacgttt?ctttaattga?agaaagaaat?ccttaaacaa?a 891

<210>42

<211>732

<212>DNA

<213> Arabidopis thaliana

<400>42

ttgtcttcct?catttcccta?ctagtacttg?tttcacacag?tttcttgatc?caaccaaaac 60

caatacacaa?agcttctcaa?actccttcac?ctcaaagctt?cttcctttac?atctgaatcg 120

ttgagttaac?tcggatttgt?tctgcatcct?ctgtttctga?atcgtgggcc?atccttattt 180

tgtctcgaat?tcttcaccaa?ttgcttcgat?caagctgcat?tggttaacca?gttgccctaa 240

agatcagatc?tttgagcaaa?attttgtcac?tgatcttcta?aatccaaacc?agacacagca 300

aaacaacctc?tgtagatgat?tcgagaaatc?tcaaacttac?aaaaagatat?tataaacatt 360

caagacagtt?attcgaacaa?ccgagtcatg?gacgtcggaa?gaaacaaccg?gaaaaacatg 420

agctttcgaa?gttcgccgga?gaaaagcaag?caagagttac?ggcggagttt?ctcggcgcag 480

aaaaggatga?tgatcccggc?gaattatttc?agtttagagt?ctctgttcct?attggttggt 540

ctaacggcat?ctctgttaat?acttccgtta?gttttgccgc?cgttacctcc?gcctccgttt 600

atgctgctat?tggttcccat?tgggattatg?gttttactcg?tcgttcttgc?cttcatgcct 660

tcttctcatt?ctaatgctaa?tacagatgta?acttgcaatt?tcatgtaaat?ctgaaattta 720

ttatatgatg?at 732

<210>43

<211>519

<212>DNA

<213> Zea mays

<400>43

atgcgaggtt?cgggatttaa?gatgttcggc?tttaggggca?gttcttctga?agcaggggac 60

gggcgattcg?accaccggag?ctcagatctg?attacaaaac?gttcagaaaa?cacaaggcgt 120

tctcacaccg?cctttcactt?cttgcttact?ttggcaacca?ctcactgcga?ctggtctcca 180

cctccaccta?caccaagaac?acatggcaag?ccgatctacg?cgatggaagg?aggggcggca 240

atacaaagga?ggaatgccgt?gaagcggcat?ctgcagcagc?gtcagcagga?ggcggatttc 300

ctcgacaaga?aggtcatcgc?gtccacctac?ttcagcatcg?gggcgttcct?cgtgctcgcc 360

tgcctcaccg?tctcgctgct?gatactgccg?ctggtgctgc?ctcccctgcc?gccgccgccg 420

tcgctgctgt?tgtggctgcc?ggtctgcctg?ctcgtcttgc?tggttgtact?ggccttcatg 480

ccgacagatg?tgcgcagcat?ggcctcctct?tacctgtaa 519

<210>44

<211>98

<212>PRT

<213> Zea mays

<400>44

Met?Glu?Gly?Gly?Ala?Ala?Ile?Gln?Arg?Arg?Asn?Ala?Val?Lys?Arg?His

1 5 10 15

Leu?Gln?Gln?Arg?Gln?Gln?Glu?Ala?Asp?Phe?Leu?Asp?Lys?Lys?Val?Ile

20 25 30

Ala?Ser?Thr?Tyr?Phe?Ser?Ile?Gly?Ala?Phe?Leu?Val?Leu?Ala?Cys?Leu

35 40 45

Thr?Val?Ser?Leu?Leu?Ile?Leu?Pro?Leu?Val?Leu?Pro?Pro?Leu?Pro?Pro

50 55 60

Pro?Pro?Ser?Leu?Leu?Leu?Trp?Leu?Pro?Val?Cys?Leu?Leu?Val?Leu?Leu

65 70 75 80

Val?Val?Leu?Ala?Phe?Met?Pro?Thr?Asp?Val?Arg?Ser?Met?Ala?Ser?Ser

85 90 95

Tyr?Leu

<210>45

<211>2745

<212>DNA

<213> Arabidopis thaliana

<400>45

atgagcaatg?cttttttata?atgccaactt?tgtacaaaaa?agcaggctta?aacaatgaaa 60

tctcgagcga?ggcagtgtct?gctggtttgt?ttgctctgtc?tttccttaac?gaatctctcc 120

tatggagaaa?ataagttcag?agagcgtaaa?gccaccgatg?acgagctggg?ctaccccgat 180

attgatgaag?atgctttatt?gaatactcag?tgcccgaaaa?aattggagct?gcgatggcaa 240

actgaagtca?cttctagcgt?ttatgctaca?cccttgattg?ctgatattaa?cagtgatgga 300

aagcttgaca?ttgttgttcc?atcttttgtt?cattacctcg?aagttcttga?aggagctgat 360

ggagacaaga?tgccaggttg?gcctgctttt?caccagtcaa?atgtgcactc?gagtcctctt 420

ctatttgata?tcgacaaaga?tggtgttaga?gaaattgctc?tggctaccta?caatgccgaa 480

gtgctctttt?tcagggtatc?aggctttttg?atgtcagata?agctagaagt?gccacgtaga 540

aaagtgcaca?agaactggca?tgtgggactt?aatcctgatc?ctgttgaccg?ttcacatcct 600

gatgttcatg?atgatgtgct?tgaggaggaa?gctatggcaa?tgaagtcatc?gaccactcaa 660

acgaatgcaa?ctaccacaac?accaaatgtt?acagtctcga?tgaccaaaga?agttcatggc 720

gctaattcat?atgtgtcaac?tcaagaggat?caaaagagac?cagagaataa?tcaaacagaa 780

gctattgtaa?agcctactcc?agagctacat?aattcctcca?tggatgctgg?agcaaataat 840

ttggcagcaa?atgctactac?agctggctca?agagaaaacc?tcaatagaaa?tgtaaccacc 900

aatgaggtgg?atcaaagcaa?aattagtgga?gataagaatg?aaactgttat?taaattaaat 960

actagtacgg?gtaattcctc?agaaactctg?gggacatctg?gaaacagtag?tacggcagag 1020

acagtaacca?aaagtgggag?gcgacttctg?gaagaggatg?gttcgaaaga?atctgtggac 1080

agccattcgg?acagtaaaga?caacagtgag?ggtgtccgca?tggcgacagt?agaaaatgat 1140

ggaggcttag?aagctgacgc?agattcatcg?tttgagttgt?tgcgtgagaa?tgatgagtta 1200

gctgatgaat?acagttatga?ttatgacgat?tatgttgatg?agaaaatgtg?gggtgatgag 1260

gaatgggttg?aggggcagca?cgagaactca?gaagattatg?tgaatattga?cgcccatata 1320

ctatgcactc?ctgtaattgc?tgacatagac?aaagatggag?tacaggagat?gattgttgct 1380

gtttcctatt?tcttcgaccc?cgagtactat?gataatccag?aacatctgaa?agagcttggt 1440

ggtatcgaca?ttaaaaatta?tattgctagt?tcaattgtgg?ttttcaatct?tgatactaaa 1500

caagtcaagt?ggatcaaaga?gctagatttg?agtacggata?aagcaaactt?ccgtgcttat 1560

atttattctt?caccaacggt?tgttgatttg?gatggcgatg?gttatttgga?tatccttgtc 1620

ggaacttcct?ttggcttatt?ctacgccatg?gatcatcgtg?gaaacatcag?agaaaaattc 1680

ccactggaaa?tggctgaaat?tcaaggagca?gtggttgcgg?ccgacataaa?tgatgatgga 1740

aagattgaac?ttgtaactac?tgattcacac?ggaaatatag?cagcatggac?cacccaagga 1800

gtggaaattt?gggaagcaca?tcttaagagc?cttgttcccc?agggtccttc?tataggcgat 1860

gttgatggtg?acggacacac?ggaggttgtg?gttcctacat?catcaggaaa?catatacgtt 1920

cttagtggca?aggatggttc?tattgtccgt?ccttacccat?acaggactca?tggaagagtg 1980

atgaaccaac?ttcttcttgt?tgatctgaac?aagcgaggtg?agaaaaagaa?gggtctcacc 2040

atcgttacta?catcctttga?cggttacctg?tatctcatag?atggacccac?ctcgtgcact 2100

gacgttgttg?acattggcga?aacttcatac?agcatggtct?tggctgataa?tgttgacggt 2160

ggagatgatc?tcgatcttat?tgtctcaact?atgaatggaa?acgtcttttg?cttctcaacg 2220

ccttcttctc?accatcccct?taaggcttgg?agatctagtg?atcaaggcag?gaacaataag 2280

gccaatcgtt?atgatcgtga?aggcgttttt?gtcacgcatt?cgaccagagg?tttccgtgat 2340

gaggaaggca?aaaacttctg?ggctgagatc?gagatcgttg?ataaatatag?atatccatct 2400

ggttcacaag?caccctacaa?cgttactacg?acgctgttgg?ttccaggcaa?ttaccaggga 2460

gagaggagga?taacgcagag?ccagatctat?gaccgccctg?gaaaataccg?gataaaacta 2520

ccaactgtgg?gagtgagaac?aacaggaact?gtaatggtgg?agatggcaga?taagaatgga 2580

ctccatttct?cagacgaatt?ctcactaact?ttccatatgt?attactacaa?gcttctgaaa 2640

tggcttcttg?ttctcccgat?gctcgggatg?ttcggtctgc?tcgtgatact?acggcctcaa 2700

gaagccgtgc?ctctcccgtc?tttttcccgc?aacacagatt?tatga 2745

<210>46

<211>896

<212>PRT

<213> Arabidopis thaliana

<400>46

Met?Lys?Ser?Arg?Ala?Arg?Gln?Cys?Leu?Leu?Val?Cys?Leu?Leu?Cys?Leu

1 5 10 15

Ser?Leu?Thr?Asn?Leu?Ser?Tyr?Gly?Glu?Asn?Lys?Phe?Arg?Glu?Arg?Lys

20 25 30

Ala?Thr?Asp?Asp?Glu?Leu?Gly?Tyr?Pro?Asp?Ile?Asp?Glu?Asp?Ala?Leu

35 40 45

Leu?Asn?Thr?Gln?Cys?Pro?Lys?Lys?Leu?Glu?Leu?Arg?Trp?Gln?Thr?Glu

50 55 60

Val?Thr?Ser?Ser?Val?Tyr?Ala?Thr?Pro?Leu?Ile?Ala?Asp?Ile?Asn?Ser

65 70 75 80

Asp?Gly?Lys?Leu?Asp?Ile?Val?Val?Pro?Ser?Phe?Val?His?Tyr?Leu?Glu

85 90 95

Val?Leu?Glu?Gly?Ala?Asp?Gly?Asp?Lys?Met?Pro?Gly?Trp?Pro?Ala?Phe

100 105 110

His?Gln?Ser?Asn?Val?His?Ser?Ser?Pro?Leu?Leu?Phe?Asp?Ile?Asp?Lys

115 120 125

Asp?Gly?Val?Arg?Glu?Ile?Ala?Leu?Ala?Thr?Tyr?Asn?Ala?Glu?Val?Leu

130 135 140

Phe?Phe?Arg?Val?Ser?Gly?Phe?Leu?Met?Ser?Asp?Lys?Leu?Glu?Val?Pro

145 150 155 160

Arg?Arg?Lys?Val?His?Lys?Asn?Trp?His?Val?Gly?Leu?Asn?Pro?Asp?Pro

165 170 175

Val?Asp?Arg?Ser?His?Pro?Asp?Val?His?Asp?Asp?Val?Leu?Glu?Glu?Glu

180 185 190

Ala?Met?Ala?Met?Lys?Ser?Ser?Thr?Thr?Gln?Thr?Asn?Ala?Thr?Thr?Thr

195 200 205

Thr?Pro?Asn?Val?Thr?Val?Ser?Met?Thr?Lys?Glu?Val?His?Gly?Ala?Asn

210 215 220

Ser?Tyr?Val?Ser?Thr?Gln?Glu?Asp?Gln?Lys?Arg?Pro?Glu?Asn?Asn?Gln

225 230 235 240

Thr?Glu?Ala?Ile?Val?Lys?Pro?Thr?Pro?Glu?Leu?His?Asn?Ser?Ser?Met

245 250 255

Asp?Ala?Gly?Ala?Asn?Asn?Leu?Ala?Ala?Asn?Ala?Thr?Thr?Ala?Gly?Ser

260 265 270

Arg?Glu?Asn?Leu?Asn?Arg?Asn?Val?Thr?Thr?Asn?Glu?Val?Asp?Gln?Ser

275 280 285

Lys?Ile?Ser?Gly?Asp?Lys?Asn?Glu?Thr?Val?Ile?Lys?Leu?Asn?Thr?Ser

290 295 300

Thr?Gly?Asn?Ser?Ser?Glu?Thr?Leu?Gly?Thr?Ser?Gly?Asn?Ser?Ser?Thr

305 310 315 320

Ala?Glu?Thr?Val?Thr?Lys?Ser?Gly?Arg?Arg?Leu?Leu?Glu?Glu?Asp?Gly

325 330 335

Ser?Lys?Glu?Ser?Val?Asp?Ser?His?Ser?Asp?Ser?Lys?Asp?Asn?Ser?Glu

340 345 350

Gly?Val?Arg?Met?Ala?Thr?Val?Glu?Asn?Asp?Gly?Gly?Leu?Glu?Ala?Asp

355 360 365

Ala?Asp?Ser?Ser?Phe?Glu?Leu?Leu?Arg?Glu?Asn?Asp?Glu?Leu?Ala?Asp

370 375 380

Glu?Tyr?Ser?Tyr?Asp?Tyr?Asp?Asp?Tyr?Val?Asp?Glu?Lys?Met?Trp?Gly

385 390 395 400

Asp?Glu?Glu?Trp?Val?Glu?Gly?Gln?His?Glu?Asn?Ser?Glu?Asp?Tyr?Val

405 410 415

Asn?Ile?Asp?Ala?His?Ile?Leu?Cys?Thr?Pro?Val?Ile?Ala?Asp?Ile?Asp

420 425 430

Lys?Asp?Gly?Val?Gln?Glu?Met?Ile?Val?Ala?Val?Ser?Tyr?Phe?Phe?Asp

435 440 445

Pro?Glu?Tyr?Tyr?Asp?Asn?Pro?Glu?His?Leu?Lys?Glu?Leu?Gly?Gly?Ile

450 455 460

Asp?Ile?Lys?Asn?Tyr?Ile?Ala?Ser?Ser?Ile?Val?Val?Phe?Asn?Leu?Asp

465 470 475 480

Thr?Lys?Gln?Val?Lys?Trp?Ile?Lys?Glu?Leu?Asp?Leu?Ser?Thr?Asp?Lys

485 490 495

Ala?Asn?Phe?Arg?Ala?Tyr?Ile?Tyr?Ser?Ser?Pro?Thr?Val?Val?Asp?Leu

500 505 510

Asp?Gly?Asp?Gly?Tyr?Leu?Asp?Ile?Leu?Val?Gly?Thr?Ser?Phe?Gly?Leu

515 520 525

Phe?Tyr?Ala?Met?Asp?His?Arg?Gly?Asn?Ile?Arg?Glu?Lys?Phe?Pro?Leu

530 535 540

Glu?Met?Ala?Glu?Ile?Gln?Gly?Ala?Val?Val?Ala?Ala?Asp?Ile?Asn?Asp

545 550 555 560

Asp?Gly?Lys?Ile?Glu?Leu?Val?Thr?Thr?Asp?Ser?His?Gly?Asn?Ile?Ala

565 570 575

Ala?Trp?Thr?Thr?Gln?Gly?Val?Glu?Ile?Trp?Glu?Ala?His?Leu?Lys?Ser

580 585 590

Leu?Val?Pro?Gln?Gly?Pro?Ser?Ile?Gly?Asp?Val?Asp?Gly?Asp?Gly?His

595 600 605

Thr?Glu?Val?Val?Val?Pro?Thr?Ser?Ser?Gly?Asn?Ile?Tyr?Val?Leu?Ser

610 615 620

Gly?Lys?Asp?Gly?Ser?Ile?Val?Arg?Pro?Tyr?Pro?Tyr?Arg?Thr?His?Gly

625 630 635 640

Arg?Val?Met?Asn?Gln?Leu?Leu?Leu?Val?Asp?Leu?Asn?Lys?Arg?Gly?Glu

645 650 655

Lys?Lys?Lys?Gly?Leu?Thr?Ile?Val?Thr?Thr?Ser?Phe?Asp?Gly?Tyr?Leu

660 665 670

Tyr?Leu?Ile?Asp?Gly?Pro?Thr?Ser?Cys?Thr?Asp?Val?Val?Asp?Ile?Gly

675 680 685

Glu?Thr?Ser?Tyr?Ser?Met?Val?Leu?Ala?Asp?Asn?Val?Asp?Gly?Gly?Asp

690 695 700

Asp?Leu?Asp?Leu?Ile?Val?Ser?Thr?Met?Asn?Gly?Asn?Val?Phe?Cys?Phe

705 710 715 720

Ser?Thr?Pro?Ser?Ser?His?His?Pro?Leu?Lys?Ala?Trp?Arg?Ser?Ser?Asp

725 730 735

Gln?Gly?Arg?Asn?Asn?Lys?Ala?Asn?Arg?Tyr?Asp?Arg?Glu?Gly?Val?Phe

740 745 750

Val?Thr?His?Ser?Thr?Arg?Gly?Phe?Arg?Asp?Glu?Glu?Gly?Lys?Asn?Phe

755 760 765

Trp?Ala?Glu?Ile?Glu?Ile?Val?Asp?Lys?Tyr?Arg?Tyr?Pro?Ser?Gly?Ser

770 775 780

Gln?Ala?Pro?Tyr?Asn?Val?Thr?Thr?Thr?Leu?Leu?Val?Pro?Gly?Asn?Tyr

785 790 795 800

Gln?Gly?Glu?Arg?Arg?Ile?Thr?Gln?Ser?Gln?Ile?Tyr?Asp?Arg?Pro?Gly

805 810 815

Lys?Tyr?Arg?Ile?Lys?Leu?Pro?Thr?Val?Gly?Val?Arg?Thr?Thr?Gly?Thr

820 825 830

Val?Met?Val?Glu?Met?Ala?Asp?Lys?Asn?Gly?Leu?His?Phe?Ser?Asp?Glu

835 840 845

Phe?Ser?Leu?Thr?Phe?His?Met?Tyr?Tyr?Tyr?Lys?Leu?Leu?Lys?Trp?Leu

850 855 860

Leu?Val?Leu?Pro?Met?Leu?Gly?Met?Phe?Gly?Leu?Leu?Val?Ile?Leu?Arg

865 870 875 880

Pro?Gln?Glu?Ala?Val?Pro?Leu?Pro?Ser?Phe?Ser?Arg?Asn?Thr?Asp?Leu

885 890 895

<210>47

<211>53

<212>DNA

<213> artificial sequence

<220>

<223> primer: prm06643

<400>47

ggggacaagt?ttgtacaaaa?aagcaggctt?aaacaatgaa?atctcgagcg?agg 53

<210>48

<211>52

<212>DNA

<213> artificial sequence

<220>

<223> primer: prm06644

<400>48

ggggaccact?ttgtacaaga?aagctgggtc?ctgtttacag?atggtaccta?gt 52

<210>49

<211>4938

<212>DNA

<213> artificial sequence

<220>

<223> expression cassette

<400>49

aatccgaaaa?gtttctgcac?cgttttcacc?ccctaactaa?caatataggg?aacgtgtgct 60

aaatataaaa?tgagacctta?tatatgtagc?gctgataact?agaactatgc?aagaaaaact 120

catccaccta?ctttagtggc?aatcgggcta?aataaaaaag?agtcgctaca?ctagtttcgt 180

tttccttagt?aattaagtgg?gaaaatgaaa?tcattattgc?ttagaatata?cgttcacatc 240

tctgtcatga?agttaaatta?ttcgaggtag?ccataattgt?catcaaactc?ttcttgaata 300

aaaaaatctt?tctagctgaa?ctcaatgggt?aaagagagag?atttttttta?aaaaaataga 360

atgaagatat?tctgaacgta?ttggcaaaga?tttaaacata?taattatata?attttatagt 420

ttgtgcattc?gtcatatcgc?acatcattaa?ggacatgtct?tactccatcc?caatttttat 480

ttagtaatta?aagacaattg?acttattttt?attatttatc?ttttttcgat?tagatgcaag 540

gtacttacgc?acacactttg?tgctcatgtg?catgtgtgag?tgcacctcct?caatacacgt 600

tcaactagca?acacatctct?aatatcactc?gcctatttaa?tacatttagg?tagcaatatc 660

tgaattcaag?cactccacca?tcaccagacc?acttttaata?atatctaaaa?tacaaaaaat 720

aattttacag?aatagcatga?aaagtatgaa?acgaactatt?taggtttttc?acatacaaaa 780

aaaaaaagaa?ttttgctcgt?gcgcgagcgc?caatctccca?tattgggcac?acaggcaaca 840

acagagtggc?tgcccacaga?acaacccaca?aaaaacgatg?atctaacgga?ggacagcaag 900

tccgcaacaa?ccttttaaca?gcaggctttg?cggccaggag?agaggaggag?aggcaaagaa 960

aaccaagcat?cctcctcctc?ccatctataa?attcctcccc?ccttttcccc?tctctatata 1020

ggaggcatcc?aagccaagaa?gagggagagc?accaaggaca?cgcgactagc?agaagccgag 1080

cgaccgcctt?cttcgatcca?tatcttccgg?tcgagttctt?ggtcgatctc?ttccctcctc 1140

cacctcctcc?tcacagggta?tgtgcccttc?ggttgttctt?ggatttattg?ttctaggttg 1200

tgtagtacgg?gcgttgatgt?taggaaaggg?gatctgtatc?tgtgatgatt?cctgttcttg 1260

gatttgggat?agaggggttc?ttgatgttgc?atgttatcgg?ttcggtttga?ttagtagtat 1320

ggttttcaat?cgtctggaga?gctctatgga?aatgaaatgg?tttagggtac?ggaatcttgc 1380

gattttgtga?gtaccttttg?tttgaggtaa?aatcagagca?ccggtgattt?tgcttggtgt 1440

aataaaagta?cggttgtttg?gtcctcgatt?ctggtagtga?tgcttctcga?tttgacgaag 1500

ctatcctttg?tttattccct?attgaacaaa?aataatccaa?ctttgaagac?ggtcccgttg 1560

atgagattga?atgattgatt?cttaagcctg?tccaaaattt?cgcagctggc?ttgtttagat 1620

acagtagtcc?ccatcacgaa?attcatggaa?acagttataa?tcctcaggaa?caggggattc 1680

cctgttcttc?cgatttgctt?tagtcccaga?attttttttc?ccaaatatct?taaaaagtca 1740

ctttctggtt?cagttcaatg?aattgattgc?tacaaataat?gcttttatag?cgttatccta 1800

gctgtagttc?agttaatagg?taatacccct?atagtttagt?caggagaaga?acttatccga 1860

tttctgatct?ccatttttaa?ttatatgaaa?tgaactgtag?cataagcagt?attcatttgg 1920

attatttttt?ttattagctc?tcaccccttc?attattctga?gctgaaagtc?tggcatgaac 1980

tgtcctcaat?tttgttttca?aattcacatc?gattatctat?gcattatcct?cttgtatcta 2040

cctgtagaag?tttctttttg?gttattcctt?gactgcttga?ttacagaaag?aaatttatga 2100

agctgtaatc?gggatagtta?tactgcttgt?tcttatgatt?catttccttt?gtgcagttct 2160

tggtgtagct?tgccactttc?accagcaaag?ttcatttaaa?tcaactaggg?atatcacaag 2220

tttgtacaaa?aaagcaggct?taaacaatga?aatctcgagc?gaggcagtgt?ctgctggttt 2280

gtttgctctg?tctttcctta?acgaatctct?cctatggaga?aaataagttc?agagagcgta 2340

aagccaccga?tgacgagctg?ggctaccccg?atattgatga?agatgcttta?ttgaatactc 2400

agtgcccgaa?aaaattggag?ctgcgatggc?aaactgaagt?cacttctagc?gtttatgcta 2460

cacccttgat?tgctgatatt?aacagtgatg?gaaagcttga?cattgttgtt?ccatcttttg 2520

ttcattacct?cgaagttctt?gaaggagctg?atggagacaa?gatgccaggt?tggcctgctt 2580

ttcaccagtc?aaatgtgcac?tcgagtcctc?ttctatttga?tatcgacaaa?gatggtgtta 2640

gagaaattgc?tctggctacc?tacaatgccg?aagtgctctt?tttcagggta?tcaggctttt 2700

tgatgtcaga?taagctagaa?gtgccacgta?gaaaagtgca?caagaactgg?catgtgggac 2760

ttaatcctga?tcctgttgac?cgttcacatc?ctgatgttca?tgatgatgtg?cttgaggagg 2820

aagctatggc?aatgaagtca?tcgaccactc?aaacgaatgc?aactaccaca?acaccaaatg 2880

ttacagtctc?gatgaccaaa?gaagttcatg?gcgctaattc?atatgtgtca?actcaagagg 2940

atcaaaagag?accagagaat?aatcaaacag?aagctattgt?aaagcctact?ccagagctac 3000

ataattcctc?catggatgct?ggagcaaata?atttggcagc?aaatgctact?acagctggct 3060

caagagaaaa?cctcaataga?aatgtaacca?ccaatgaggt?ggatcaaagc?aaaattagtg 3120

gagataagaa?tgaaactgtt?attaaattaa?atactagtac?gggtaattcc?tcagaaactc 3180

tggggacatc?tggaaacagt?agtacggcag?agacagtaac?caaaagtggg?aggcgacttc 3240

tggaagagga?tggttcgaaa?gaatctgtgg?acagccattc?ggacagtaaa?gacaacagtg 3300

agggtgtccg?catggcgaca?gtagaaaatg?atggaggctt?agaagctgac?gcagattcat 3360

cgtttgagtt?gttgcgtgag?aatgatgagt?tagctgatga?atacagttat?gattatgacg 3420

attatgttga?tgagaaaatg?tggggtgatg?aggaatgggt?tgaggggcag?cacgagaact 3480

cagaagatta?tgtgaatatt?gacgcccata?tactatgcac?tcctgtaatt?gctgacatag 3540

acaaagatgg?agtacaggag?atgattgttg?ctgtttccta?tttcttcgac?cccgagtact 3600

atgataatcc?agaacatctg?aaagagcttg?gtggtatcga?cattaaaaat?tatattgcta 3660

gttcaattgt?ggttttcaat?cttgatacta?aacaagtcaa?gtggatcaaa?gagctagatt 3720

tgagtacgga?taaagcaaac?ttccgtgctt?atatttattc?ttcaccaacg?gttgttgatt 3780

tggatggcga?tggttatttg?gatatccttg?tcggaacttc?ctttggctta?ttctacgcca 3840

tggatcatcg?tggaaacatc?agagaaaaat?tcccactgga?aatggctgaa?attcaaggag 3900

cagtggttgc?ggccgacata?aatgatgatg?gaaagattga?acttgtaact?actgattcac 3960

acggaaatat?agcagcatgg?accacccaag?gagtggaaat?ttgggaagca?catcttaaga 4020

gccttgttcc?ccagggtcct?tctataggcg?atgttgatgg?tgacggacac?acggaggttg 4080

tggttcctac?atcatcagga?aacatatacg?ttcttagtgg?caaggatggt?tctattgtcc 4140

gtccttaccc?atacaggact?catggaagag?tgatgaacca?acttcttctt?gttgatctga 4200

acaagcgagg?tgagaaaaag?aagggtctca?ccatcgttac?tacatccttt?gacggttacc 4260

tgtatctcat?agatggaccc?acctcgtgca?ctgacgttgt?tgacattggc?gaaacttcat 4320

acagcatggt?cttggctgat?aatgttgacg?gtggagatga?tctcgatctt?attgtctcaa 4380

ctatgaatgg?aaacgtcttt?tgcttctcaa?cgccttctcc?tcaccatccc?cttaaggctt 4440

ggagatctag?tgatcaaggc?aggaacaata?aggccaatcg?ttatgatcgt?gaaggcgttt 4500

ttgtcacgca?ttcgaccaga?ggtttccgtg?atgaggaagg?caaaaacttc?tgggctgaga 4560

tcgagatcgt?tgataaatat?agatatccat?ctggttcaca?agcaccctac?aacgttacta 4620

cgacgctgtt?ggttccaggc?aattaccagg?gagagaggag?gataacgcag?agccagatct 4680

atgaccgccc?tggaaaatac?cggataaaac?taccaactgt?gggagtgaga?acaacaggaa 4740

ctgtaatggt?ggagatggca?gataagaatg?gactccattt?ctcagacgaa?ttctcactaa 4800

ctttccatat?gtattactac?aagcttctga?aatggcttct?tgttctcccg?atgctcggga 4860

tgttcggtct?gctcgtgata?ctacggcctc?aagaagccgt?gcctctcccg?tctttttccc 4920

gcaacacaga?tttatgat 4938

<210>50

<211>10

<212>PRT

<213> artificial sequence

<220>

<223> guards primitive 1

<220>

<221> variant

<222>(9)..(9)

<223>/ displacement=" Glu "

<400>50

Phe?Asp?Gly?Tyr?Leu?Tyr?Leu?Ile?Asp?Gly

1 5 10

<210>51

<211>5

<212>PRT

<213> artificial sequence

<220>

<223> guards primitive 2

<220>

<221> is uncertain

<222>(3)..(4)

<223>Xaa can be any natural amino acid

<220>

<221> variant

<222>(5)..(5)

<223>/ displacement=" Glu "

<400>51

Asp?Gly?Xaa?Xaa?Asp

1 5

<210>52

<211>9

<212>PRT

<213> artificial sequence

<220>

<223> guards primitive 3

<220>

<221> is uncertain

<222>(2)..(2)

<223>Xaa can be any natural amino acid

<220>

<221> is uncertain

<222>(4)..(4)

<223>Xaa can be any natural amino acid

<220>

<221> is uncertain

<222>(7)..(8)

<223>Xaa can be any natural amino acid

<220>

<221> variant

<222>(9)..(9)

<223>/ displacement=" Glu "

<400>52

Asp?Xaa?Asp?Xaa?Asp?Gly?Xaa?Xaa?Asp

1 5

<210>53

<211>36

<212>PRT

<213> artificial sequence

<220>

<223>FG-GAP conservative domain sequence

<400>53

Gly?Gly?Ser?Ser?Val?Ala?Ala?Gly?Asp?Leu?Asn?Gly?Asp?Gly?Arg?Pro

1 5 10 15

Asp?Leu?Val?Val?Gly?Ala?Pro?Gly?Ala?Asp?Gly?Gly?Thr?Asp?Gly?Ser

20 25 30

Val?Tyr?Leu?Leu

35

<210>54

<211>2449

<212>DNA

<213> Arabidopis thaliana

<400>54

attcttcatc?gttctctctg?ctctggtaag?gagattgctg?ctacctactg?atgcaaatct 60

gccattgata?catctgcttg?cggttagggc?aaagatgagg?aaacgcgatt?tggctatttt 120

gatgctctct?ggatttgcta?tattcttcac?tcttcagcac?gagggtgatt?ttgcgttcaa 180

agaagcatgg?tttcatttgt?atgatgaata?cccagtcaaa?tacgaagctg?atcgtctccc 240

accacctatt?gtagctgatc?ttaatggtga?tggaaagaag?gaggttctcg?ttgctactaa 300

tgatgccaaa?attcaggttc?tggagcctca?ttccaggcgt?gtggatgaag?gttttagtga 360

agcacgtgtt?cttgcggaaa?tcactctttt?gcctgacaag?atccgtgttg?cgtcagggag 420

acgtgctgtg?gccatggcca?caggtgttat?tgataggtac?tataaaaatg?gaactcccca 480

gaagcaggtt?gtggtcgttg?ttacctcagg?ttggtctgtg?ctctgctttg?atcacaacct 540

gaaaaagctg?tgggaaacga?atctgcagga?ggatttccca?cataatgcac?accatagaga 600

gatagcaatt?tcgataagca?attacacatt?gaagcatggt?gatacgggtt?tggttattgt 660

tggtggacgg?atggagatgc?agccatataa?tcacatggac?ccatttgagg?aacttggcat 720

gacagcacaa?aatgctgatc?aacacagaag?aagtgctact?gagaatcagg?cctctgaaga 780

ttctggagcc?ataaacttgc?gtcacttttc?tgtctatgca?tttgctggca?agactggcct 840

tcttcgatgg?agtaaaaaga?ctgatgatgt?tgaagctcac?acctcagatg?catcacaatt 900

aattccacaa?cacaattaca?agcttgatgt?gcatgctcta?aatagccgtc?acccaggaga 960

gtttgagtgc?agggaattta?gagaatcaat?tcttagtgtc?atgccccatc?gctgggaccg 1020

acgtgaagat?acattattga?agcttgctca?tttcaggcga?cacaagagga?aaacattgaa 1080

gaagcaggct?ggtagtaagt?ctacagctta?tccgtttcac?aaacctgagg?aacacacacc 1140

cgctggaaag?gacttgtcaa?gaaagattcc?aaaattgatt?ggaaaggctg?cacgctatgc 1200

tggctcggca?aaacccaaga?agggtatgca?atacattccg?acgataacta?attacacgaa 1260

gctttggtgg?gttcctaatg?ttgttgtggc?tcatcaaaag?gaaggaattg?aagctattca 1320

tttgcctact?ggtcgaacac?tttgcaagct?ttctctactt?gaaggtggac?ttcacgccga 1380

cataaacgga?gatggtgttc?tcgatcatgt?ccagactgtc?ggaggcaatg?ttggagagag 1440

aactgtagtg?agcgggtcaa?tggaagtgtt?gaagccttgc?tgggcagtgg?caacctcagg 1500

cgttcccatc?cgggaacagc?tctttaacgt?ctcgatctgc?catcactccc?cttttaactt 1560

cttgcactat?ggaggagatt?actcacgaca?cttcgcccag?gcaagagaca?cctctactct 1620

ggagatcgca?actcccattc?tcatccccag?agatgatgga?cacaaacacc?gcaaaggcag 1680

tcacggagat?gtaatcttct?tgacaaaccg?tggagaggtg?acatcataca?cgcctgatgt 1740

gcacggccac?gacgcagtct?ggcaatggca?gcttcagaca?gaagccacat?ggtcgaatct 1800

cccgtctcca?tcgggtttaa?ctgaatcagg?gacggtggtc?ccaaccctga?aaccattctc 1860

gttgcgcatt?catgataacc?agcctatgat?ccttgccggg?ggagatcaag?cagcggtcat 1920

catctctccg?ggaggaagca?tattggcttc?catcgaatta?ccgtctcaac?cgactcatgc 1980

acttatcact?gatgacttct?cgaacgatgg?tctaacggat?gtgattgtga?tgacctcaaa 2040

tggggtttac?gggtttgttc?aaaccagaca?gccaggggct?ctgttcttca?gttcgttggt 2100

gggttgtctc?ttagtagtta?tggcagttat?tttcgttact?cagcacttaa?actccattca 2160

aggtaagcct?cgaccatcat?ctagctttta?atagaaatct?cgtagagttt?tcttcctctc 2220

tacggaagtt?aaaccggcag?gtccgcttta?gcagcttcac?ccacatcggt?tttggtaaac 2280

cggaaatatt?actgatatac?cagtgtagat?tcagtgcctt?atttcctggt?ttcagctgta 2340

taactttata?ctttgtagaa?ttcaagtaaa?aaatggtaga?ggcaaataga?ggactttatg 2400

tttttgtcaa?ttttgatgtt?ttaatggaat?tatgtgacat?ttaatttat 2449

<210>55

<211>698

<212>PRT

<213> Arabidopis thaliana

<400>55

Met?Arg?Lys?Arg?Asp?Leu?Ala?Ile?Leu?Met?Leu?Ser?Gly?Phe?Ala?Ile

1 5 10 15

Phe?Phe?Thr?Leu?Gln?His?Glu?Gly?Asp?Phe?Ala?Phe?Lys?Glu?Ala?Trp

20 25 30

Phe?His?Leu?Tyr?Asp?Glu?Tyr?Pro?Val?Lys?Tyr?Glu?Ala?Asp?Arg?Leu

35 40 45

Pro?Pro?Pro?Ile?Val?Ala?Asp?Leu?Asn?Gly?Asp?Gly?Lys?Lys?Glu?Val

50 55 60

Leu?Val?Ala?Thr?Asn?Asp?Ala?Lys?Ile?Gln?Val?Leu?Glu?Pro?His?Ssr

65 70 75 80

Arg?Arg?Val?Asp?Glu?Gly?Phe?Ser?Glu?Ala?Arg?Val?Leu?Ala?Glu?Ile

85 90 95

Thr?Leu?Leu?Pro?Asp?Lys?Ile?Arg?Val?Ala?Ser?Gly?Arg?Arg?Ala?Val

100 105 110

Ala?Met?Ala?Thr?Gly?Val?Ile?Asp?Arg?Tyr?Tyr?Lys?Asn?Gly?Thr?Pro

115 120 125

Gln?Lys?Gln?Val?Val?Val?Val?Val?Thr?Ssr?Gly?Trp?Ser?Val?Leu?Cys

130 135 140

Phe?Asp?His?Asn?Leu?Lys?Lys?Leu?Trp?Glu?Thr?Asn?Leu?Gln?Glu?Asp

145 150 155 160

Phe?Pro?His?Asn?Ala?His?His?Arg?Glu?Ile?Ala?Ile?Ser?Ile?Ser?Asn

165 170 175

Tyr?Thr?Leu?Lys?His?Gly?Asp?Thr?Gly?Leu?Val?Ile?Val?Gly?Gly?Arg

180 185 190

Met?Glu?Met?Gln?Pro?Tyr?Asn?His?Met?Asp?Pro?Phe?Glu?Glu?Leu?Gly

195 200 205

Met?Thr?Ala?Gln?Asn?Ala?Asp?Gln?His?Arg?Arg?Ser?Ala?Thr?Glu?Asn

210 215 220

Gln?Ala?Ser?Glu?Asp?Ser?Gly?Ala?Ile?Asn?Leu?Arg?His?Phe?Ser?Val

225 230 235 240

Tyr?Ala?Phe?Ala?Gly?Lys?Thr?Gly?Leu?Leu?Arg?Trp?Ser?Lys?Lys?Thr

245 250 255

Asp?Asp?Val?Glu?Ala?His?Thr?Ser?Asp?Ala?Ser?Gln?Leu?Ile?Pro?Gln

260 265 270

His?Asn?Tyr?Lys?Leu?Asp?Val?His?Ala?Leu?Asn?Ser?Arg?His?Pro?Gly

275 280 285

Glu?Phe?Glu?Cys?Arg?Glu?Phe?Arg?Glu?Ser?Ile?Leu?Ser?Val?Met?Pro

290 295 300

His?Arg?Trp?Asp?Arg?Arg?Glu?Asp?Thr?Leu?Leu?Lys?Leu?Ala?His?Phe

305 310 315 320

Arg?Arg?His?Lys?Arg?Lys?Thr?Leu?Lys?Lys?Gln?Ala?Gly?Ser?Lys?Ser

325 330 335

Thr?Ala?Tyr?Pro?Phe?His?Lys?Pro?Glu?Glu?His?Thr?Pro?Ala?Gly?Lys

340 345 350

Asp?Leu?Ser?Arg?Lys?Ile?Pro?Lys?Leu?Ile?Gly?Lys?Ala?Ala?Arg?Tyr

355 360 365

Ala?Gly?Ser?Ala?Lys?Pro?Lys?Lys?Gly?Met?Gln?Tyr?Ile?Pro?Thr?Ile

370 375 380

Thr?Asn?Tyr?Thr?Lys?Leu?Trp?Trp?Val?Pro?Asn?Val?Val?Val?Ala?His

385 390 395 400

Gln?Lys?Glu?Gly?Ile?Glu?Ala?Ile?His?Leu?Pro?Thr?Gly?Arg?Thr?Leu

405 410 415

Cys?Lys?Leu?Ser?Leu?Leu?Glu?Gly?Gly?Leu?His?Ala?Asp?Ile?Asn?Gly

420 425 430

Asp?Gly?Val?Leu?Asp?His?Val?Gln?Thr?Val?Gly?Gly?Asn?Val?Gly?Glu

435 440 445

Arg?Thr?Val?Val?Ser?Gly?Ser?Met?Glu?Val?Leu?Lys?Pro?Cys?Trp?Ala

450 455 460

Val?Ala?Thr?Ser?Gly?Val?Pro?Ile?Arg?Glu?Gln?Leu?Phe?Asn?Val?Ser

465 470 475 480

Ile?Cys?His?His?Ser?Pro?Phe?Asn?Phe?Leu?His?Tyr?Gly?Gly?Asp?Tyr

485 490 495

Ser?Arg?His?Phe?Ala?Gln?Ala?Arg?Asp?Thr?Ser?Thr?Leu?Glu?Ile?Ala

500 505 510

Thr?Pro?Ile?Leu?Ile?Pro?Arg?Asp?Asp?Gly?His?Lys?His?Arg?Lys?Gly

515 520 525

Ser?His?Gly?Asp?Val?Ile?Phe?Leu?Thr?Asn?Arg?Gly?Glu?Val?Thr?Ser

530 535 540

Tyr?Thr?Pro?Asp?Val?His?Gly?His?Asp?Ala?Val?Trp?Gln?Trp?Gln?Leu

545 550 555 560

Gln?Thr?Glu?Ala?Thr?Trp?Ser?Asn?Leu?Pro?Ser?Pro?Ser?Gly?Leu?Thr

565 570 575

Glu?Ser?Gly?Thr?Val?Val?Pro?Thr?Leu?Lys?Pro?Phe?Ser?Leu?Arg?Ile

580 585 590

His?Asp?Asn?Gln?Pro?Met?Ile?Leu?Ala?Gly?Gly?Asp?Gln?Ala?Ala?Val

595 600 605

Ile?Ile?Ser?Pro?Gly?Gly?Ser?Ile?Leu?Ala?Ser?Ile?Glu?Leu?Pro?Ser

610 615 620

Gln?Pro?Thr?His?Ala?Leu?Ile?Thr?Asp?Asp?Phe?Ser?Asn?Asp?Gly?Leu

625 630 635 640

Thr?Asp?Val?Ile?Val?Met?Thr?Ser?Asn?Gly?Val?Tyr?Gly?Phe?Val?Gln

645 650 655

Thr?Arg?Gln?Pro?Gly?Ala?Leu?Phe?Phe?Ser?Ser?Leu?Val?Gly?Cys?Leu

660 665 670

Leu?Val?Val?Met?Ala?Val?Ile?Phe?Val?Thr?Gln?His?Leu?Asn?Ser?Ile

675 680 685

Gln?Gly?Lys?Pro?Arg?Pro?Ser?Ser?Ser?Phe

690 695

<210>56

<211>2834

<212>DNA

<213> rice

<400>56

atgcgtcccc?tcctcgcctt?cgcggcggta?tgcgcccttc?tcgtggctgc?cgcagcgccg 60

gcggccgcgg?aggaggagaa?ggcgaacaag?ttccggcagc?gcgaggccac?cgacgacatg 120

cttggatacc?cccaccttga?tgaagatgct?ttattgaaga?ccaagtgtcc?aaaacatgta 180

gagctgagat?ggcagactga?agttagttcc?agcatttatg?caactccgtt?gatcgctgat 240

atcaacagcg?atggaaagtt?ggaagtagtg?gtgccatcat?ttgttcatta?cctggaagtt 300

cttgaaggct?ctgatgggga?caaattgcca?ggatggcctg?catttcacca?gtcaaatgtt 360

cattcaagtc?cacttctata?tgatattgac?aaggacggga?cacgggaaat?agttttggca 420

acttacaatg?gtgtagtgaa?tttcttcagg?gtatcaggtt?atatgatgat?ggacaagcta 480

gaagtacctc?gtaggaaggt?acacaaagac?tggtatgttg?ggctgaatac?agatcccgtt 540

gaccgctccc?atccagatgt?tcatgacagc?tcaattgcaa?agaaagctgc?ttctgaagaa 600

tctcacccaa?atattcagga?caagccagtt?gtgaatgaat?cttctaagga?atcccagtca 660

cggagcacaa?atgactcaac?aacacgagga?gttgattcca?tgaaacatgc?gtctaaggaa 720

gagccagttg?aaagtaaacc?taattctacc?cgaggacagg?agaatatgga?tgtgttaaac 780

aatctaaaca?gcacagatgc?tgggaacaac?tctagtttaa?gtactacaac?agagaatgca 840

tcacatgttc?agagaaggtt?gcttcaaaca?gatgagaaaa?gtaatcaagc?aggaagctca 900

gaaactgatg?caagtgatac?cggaacagca?aaagcagcta?ctgttgaaaa?tagcgagcct 960

ctagaggctg?atgctgatgc?atcatttaat?ttgtttcggg?atgtagaaga?tctgcctgat 1020

gagtacaatt?acgattatga?tgactacgtt?gatgaaacca?tgtggggaga?cgaggactgg 1080

aaagaacaac?aacatgaaaa?ggcagaagat?tatgtgagca?tagatgctca?catcttgtcc 1140

accccagtga?ttgcagatat?tgacagagat?ggcatacaag?aaatggtgat?ttctgtatct 1200

tacttctttg?accacgagta?ttatgataaa?ccagaacatc?taaaggagtt?aggagggatt 1260

gacattggca?aatatattgc?aagcagtata?gttgttttta?accttgacac?aagacaagtc 1320

aaatggactg?cagaacttga?tttgagtaca?gatagtggaa?attttactgc?ccatgcatat 1380

tcttcgccga?ccgtggttga?tttggatggt?gatggaaatt?tggatattct?tgttggaact 1440

tcctttggct?tgttttatgt?tatcgatcat?cgtggtaagg?ttaggaacaa?gttcccactt 1500

gagatggcgg?agattcatgc?accagtcatt?gcagcagata?tcaatgatga?tgggaaaatc 1560

gagatggtca?ctgctgatgt?ccatggcaat?gtagcagcat?ggactgcaga?gggagaagaa 1620

atctgggagg?ttcatcttaa?gagtcttatc?ccacagcgcc?ctactgttgg?tgatgttaat 1680

ggagatggtc?gcactgaagt?tgtggtccca?accgtgtcag?gaaacatata?tgttcttagt 1740

ggaaaggatg?gctcaaaaat?tcagcctttc?ccatatagaa?cgcatggaag?gatcatgagt 1800

cctgttctat?tgcttgacat?gagcaaacat?gatgaaaagt?ctaaaggcct?cacccttgct 1860

actacatcct?ttgatggtta?cttgtatttg?attgagggct?caagtggctg?tgcagatgtt 1920

gttgacattg?gagagacctc?gtacagtatg?gttttggctg?ataatgttga?tggtggagat 1980

gacctcgatc?ttattgttac?taccatgaat?ggcaatgtct?tctgcttctc?cactccctct 2040

ccgcaccatc?cacttaagga?atggagatca?tcaaaccagg?gaagaaacaa?tgctgcatat 2100

cgttacaacc?gtgaaggtat?ttatgttaaa?cacggttcca?gaacattccg?tgacgaagag 2160

ggcaagcatt?tctgggtaga?gtttgagatt?gtggacaagt?acagggttcc?ttatgggaac 2220

caagctcctt?ataacgtgac?ggttactcta?cttgtccctg?ggaattatca?aggagaaagg 2280

cgcattgtgg?ttaatgcagc?ttataatgaa?ccaggcaagc?agcggatgaa?gcttcccaca 2340

gttcctgtga?gaaccacagg?aactgtgctt?gtggaaatgg?ttgacaaaaa?cgggttctac 2400

ttctctgacg?agttctcgct?caccttccac?atgcattatt?acaagcttct?gaaatggctc 2460

gtgcttcttc?caatgcttgg?gatgtttagc?gttcttgtca?tcctgcggcc?acaagaaggc 2520

gctccgttgc?catcattttc?aaggaatatt?gattagtgat?ttgcacagtg?aaacgtcagg 2580

tcctcataga?agcagataag?cagaacaaga?tattagcagg?atatccaatc?acccatgaag 2640

gagcttgtcc?acatcatact?gcatcgggga?gctcaatctg?cacagaaaaa?acccctcacg 2700

atgctgcatc?ccatcagtta?gctagttcgg?gaagtacagc?ttttagtcat?gcaaaaagaa 2760

ttttgtcaca?cttgagattg?ttttctaact?tatgatattt?acacaaggaa?ctggcagctg 2820

tctgatcctg?gttt 2834

<210>57

<211>851

<212>PRT

<213> rice

<400>57

Met?Arg?Pro?Leu?Leu?Ala?Phe?Ala?Ala?Val?Cys?Ala?Leu?Leu?Val?Ala

1 5 10 15

Ala?Ala?Ala?Pro?Ala?Ala?Ala?Glu?Glu?Glu?Lys?Ala?Asn?Lys?Phe?Arg

20 25 30

Gln?Arg?Glu?Ala?Thr?Asp?Asp?Met?Leu?Gly?Tyr?Pro?His?Leu?Asp?Glu

35 40 45

Asp?Ala?Leu?Leu?Lys?Thr?Lys?Cys?Pro?Lys?His?Val?Glu?Leu?Arg?Trp

50 55 60

Gln?Thr?Glu?Val?Ser?Ser?Ser?Ile?Tyr?Ala?Thr?Pro?Leu?Ile?Ala?Asp

65 70 75 80

Ile?Asn?Ser?Asp?Gly?Lys?Leu?Glu?Val?Val?Val?Pro?Ser?Phe?Val?His

85 90 95

Tyr?Leu?Glu?Val?Leu?Glu?Gly?Ser?Asp?Gly?Asp?Lys?Leu?Pro?Gly?Trp

100 105 110

Pro?Ala?Phe?His?Gln?Ser?Asn?Val?His?Ser?Ser?Pro?Leu?Leu?Tyr?Asp

115 120 125

Ile?Asp?Lys?Asp?Gly?Thr?Arg?Glu?Ile?Val?Leu?Ala?Thr?Tyr?Asn?Gly

130 135 140

Val?Val?Asn?Phe?Phe?Arg?Val?Ser?Gly?Tyr?Met?Met?Met?Asp?Lys?Leu

145 150 155 160

Glu?Val?Pro?Arg?Arg?Lys?Val?His?Lys?Asp?Trp?Tyr?Val?Gly?Leu?Asn

165 170 175

Thr?Asp?Pro?Val?Asp?Arg?Ser?His?Pro?Asp?Val?His?Asp?Ser?Ser?Ile

180 185 190

Ala?Lys?Lys?Ala?Ala?Ser?Glu?Glu?Ser?His?Pro?Asn?Ile?Gln?Asp?Lys

195 200 205

Pro?Val?Val?Asn?Glu?Ser?Ser?Lys?Glu?Ser?Gln?Ser?Arg?Ser?Thr?Asn

210 215 220

Asp?Ser?Thr?Thr?Arg?Gly?Val?Asp?Ser?Met?Lys?His?Ala?Ser?Lys?Glu

225 230 235 240

Glu?Pro?Val?Glu?Ser?Lys?Pro?Asn?Ser?Thr?Arg?Gly?Gln?Glu?Asn?Met

245 250 255

Asp?Val?Leu?Asn?Asn?Leu?Asn?Ser?Thr?Asp?Ala?Gly?Asn?Asn?Ser?Ser

260 265 270

Leu?Ser?Thr?Thr?Thr?Glu?Asn?Ala?Ser?His?Val?Gln?Arg?Arg?Leu?Leu

275 280 285

Gln?Thr?Asp?Glu?Lys?Ser?Asn?Gln?Ala?Gly?Ser?Ser?Glu?Thr?Asp?Ala

290 295 300

Ser?Asp?Thr?Gly?Thr?Ala?Lys?Ala?Ala?Thr?Val?Glu?Asn?Ser?Glu?Pro

305 310 315 320

Leu?Glu?Ala?Asp?Ala?Asp?Ala?Ser?Phe?Asn?Leu?Phe?Arg?Asp?Val?Glu

325 330 335

Asp?Leu?Pro?Asp?Glu?Tyr?Asn?Tyr?Asp?Tyr?Asp?Asp?Tyr?Val?Asp?Glu

340 345 350

Thr?Met?Trp?Gly?Asp?Glu?Asp?Trp?Lys?Glu?Gln?Gln?His?Glu?Lys?Ala

355 360 365

Glu?Asp?Tyr?Val?Ser?Ile?Asp?Ala?His?Ile?Leu?Ser?Thr?Pro?Val?Ile

370 375 380

Ala?Asp?Ile?Asp?Arg?Asp?Gly?Ile?Gln?Glu?Met?Val?Ile?Ser?Val?Ser

385 390 395 400

Tyr?Phe?Phe?Asp?His?Glu?Tyr?Tyr?Asp?Lys?Pro?Glu?His?Leu?Lys?Glu

405 410 415

Leu?Gly?Gly?Ile?Asp?Ile?Gly?Lys?Tyr?Ile?Ala?Ser?Ser?Ile?Val?Val

420 425 430

Phe?Asn?Leu?Asp?Thr?Arg?Gln?Val?Lys?Trp?Thr?Ala?Glu?Leu?Asp?Leu

435 440 445

Ser?Thr?Asp?Ser?Gly?Asn?Phe?Thr?Ala?His?Ala?Tyr?Ser?Ser?Pro?Thr

450 455 460

Val?Val?Asp?Leu?Asp?Gly?Asp?Gly?Asn?Leu?Asp?Ile?Leu?Val?Gly?Thr

465 470 475 480

Ser?Phe?Gly?Leu?Phe?Tyr?Val?Ile?Asp?His?Arg?Gly?Lys?Val?Arg?Asn

485 490 495

Lys?Phe?Pro?Leu?Glu?Met?Ala?Glu?Ile?His?Ala?Pro?Val?Ile?Ala?Ala

500 505 510

Asp?Ile?Asn?Asp?Asp?Gly?Lys?Ile?Glu?Met?Val?Thr?Ala?Asp?Val?His

515 520 525

Gly?Asn?Val?Ala?Ala?Trp?Thr?Ala?Glu?Gly?Glu?Glu?Ile?Trp?Glu?Val

530 535 540

His?Leu?Lys?Ser?Leu?Ile?Pro?Gln?Arg?Pro?Thr?Val?Gly?Asp?Val?Asn

545 550 555 560

Gly?Asp?Gly?Arg?Thr?Glu?Val?Val?Val?Pro?Thr?Val?Ser?Gly?Asn?Ile

565 570 575

Tyr?Val?Leu?Ser?Gly?Lys?Asp?Gly?Ser?Lys?Ile?Gln?Pro?Phe?Pro?Tyr

580 585 590

Arg?Thr?His?Gly?Arg?Ile?Met?Ser?Pro?Val?Leu?Leu?Leu?Asp?Met?Ser

595 600 605

Lys?His?Asp?Glu?Lys?Ser?Lys?Gly?Leu?Thr?Leu?Ala?Thr?Thr?Ser?Phe

610 615 620

Asp?Gly?Tyr?Leu?Tyr?Leu?Ile?Glu?Gly?Ser?Ser?Gly?Cys?Ala?Asp?Val

625 630 635 640

Val?Asp?Ile?Gly?Glu?Thr?Ser?Tyr?Ser?Met?Val?Leu?Ala?Asp?Asn?Val

645 650 655

Asp?Gly?Gly?Asp?Asp?Leu?Asp?Leu?Ile?Val?Thr?Thr?Met?Asn?Gly?Asn

660 665 670

Val?Phe?Cys?Phe?Ser?Thr?Pro?Ser?Pro?His?His?Pro?Leu?Lys?Glu?Trp

675 680 685

Arg?Ser?Ser?Asn?Gln?Gly?Arg?Asn?Asn?Ala?Ala?Tyr?Arg?Tyr?Asn?Arg

690 695 700

Glu?Gly?Ile?Tyr?Val?Lys?His?Gly?Ser?Arg?Thr?Phe?Arg?Asp?Glu?Glu

705 710 715 720

Gly?Lys?His?Phe?Trp?Val?Glu?Phe?Glu?Ile?Val?Asp?Lys?Tyr?Arg?Val

725 730 735

Pro?Tyr?Gly?Asn?Gln?Ala?Pro?Tyr?Asn?Val?Thr?Val?Thr?Leu?Leu?Val

740 745 750

Pro?Gly?Asn?Tyr?Gln?Gly?Glu?Arg?Arg?Ile?Val?Val?Asn?Ala?Ala?Tyr

755 760 765

Asn?Glu?Pro?Gly?Lys?Gln?Arg?Met?Lys?Leu?Pro?Thr?Val?Pro?Val?Arg

770 775 780

Thr?Thr?Gly?Thr?Val?Leu?Val?Glu?Met?Val?Asp?Lys?Asn?Gly?Phe?Tyr

785 790 795 800

Phe?Ser?Asp?Glu?Phe?Ser?Leu?Thr?Phe?His?Met?His?Tyr?Tyr?Lys?Leu

805 810 815

Leu?Lys?Trp?Leu?Val?Leu?Leu?Pro?Met?Leu?Gly?Met?Phe?Ser?Val?Leu

820 825 830

Val?Ile?Leu?Arg?Pro?Gln?Glu?Gly?Ala?Pro?Leu?Pro?Ser?Phe?Ser?Arg

835 840 845

Asn?Ile?Asp

850

<210>58

<211>2411

<212>DNA

<213> rice

<400>58

gagtgtctag?gccagtccag?tccagtccag?tccaggacgg?tccagtccgg?tcccgtagag 60

cgccggcgcg?tgtagcttcc?tcctccgctc?caggctccag?cgagggaggg?agggagacca 120

ccgtctccgc?cggctttgag?agagaaagag?aaagagagag?agagagagcg?gcgagatgcg 180

gaagcgggat?ctgggcatcc?tcctcctcgc?cgccttcgcc?gtcttcttct?cgctccagca 240

cgacggcgac?ctctccttcc?gcgaggcctg?gtaccacctc?tccgatgccg?actaccccat 300

caagcacgac?gccgaccgcc?tcccctctcc?cctagtcgcc?gacctcaacg?gcgacggcaa 360

acccgaggtc?ctcatcccca?cccacgacgc?caagatccag?gtcctccagc?cccaccccag 420

gccctccccc?gacgatgcct?ccttccacga?cgcccgcctc?atggctgatg?tctccctcct 480

cccctccaac?gttcgcctct?cctccgggag?gcgccccgtc?gccatggccg?ttggcaccgt 540

cgaccgccac?tacgcccacg?ccccctcccc?ctccaagcag?ctcctcgtcg?tcgtcacctc 600

cggatggtcc?gtcatgtgct?tcgaccacaa?cctcaaaaag?ctctgggagg?ctaatctcca 660

ggacgatttc?ccccacgccg?cccaccatcg?cgaggttgcc?atttccatta?ccaactacac 720

tctcaagcat?ggggatgcag?gtttggtcat?cgtcggagga?aggatggaaa?tgcaacatca 780

ttcagcagag?cttttcgatg?aatttatggt?gtcagaacac?aacagggaag?agcaccgtag 840

aagcgccagt?gagaagcagg?cttctgagac?aggcaacaca?gacctgcgtc?attttgccct 900

ttatgctttt?gctggccgca?ctggtgaatt?aagatggagc?cgaaagaatg?agaatatccc 960

atcgcaacca?tccgatgctt?cagtgctgat?accacaacac?aattacaagc?ttgatgccca 1020

tgcccttaat?agtcgtcatc?ctggtcagtt?cgaatgtcgg?gaatttagag?aatcagttct 1080

tggggtcatg?cctcatcatt?gggataggag?agaggatact?tttctgcaac?ttgcccattt 1140

taggaggcat?aaaaggaaag?cactgaagaa?aacacctgga?aaagctgttg?taaataacgt 1200

gcacaagccc?agtgaacata?atccacctgg?aaaggatgtt?tccaataggt?tagcaaatgt 1260

gattgggaaa?gctgcagata?tggctaattc?aaataaaatc?aagaagtcac?aaaggacgct 1320

ttatgttccg?acaatcacca?actatactca?agtttggtgg?gttcctaatg?ttgttgttgc 1380

ccacgaaaaa?gaagggatag?aggctgttca?tctagcttct?ggacgtacaa?tctgcaagct 1440

tcatttaaca?gaaggaggcc?ttcatgcaga?tattaatgga?gatggggttc?tagaccatgt 1500

tcaggttgtt?ggtgcaaatg?gcatcgagca?aacagttgtt?agtggttcaa?tggaagtgct 1560

gaaaccttgt?tgggcagtag?ctacatctgg?tgtgccagtg?cgggagcaac?tttttaatgt 1620

ttctatctgc?cattacaaca?atttcaattt?gtttcatcat?ggtgactttt?caagaagttt 1680

tgggaggaca?tttgatacaa?ctggcttaga?ggtggcgact?cctattctgc?tccagagaga 1740

tgatggtcat?aaacacagga?gaggaagcca?cggggatatc?atctttctta?cgagtcgtgg 1800

ggaggtgacc?tcgtactctc?caggtctact?tggtcatgat?gcaatatgga?gatggcaact 1860

gtcaacaggt?gcaacatggt?ccaaccttcc?gtctccatca?gggatgatgg?aaaacattgt 1920

agttccaact?ttgaaggctt?tctctctgcg?agcctatgac?ccaaaacagg?taatcatcgc 1980

gggtggtgat?ctggaggctg?tggtgatttc?tccttctggt?ggtttattgg?catccattga 2040

actccctgca?cctccaaccc?atgcgctggt?acttgaagat?ttcaatggtg?atggtttaac 2100

tgatattatt?ctggtaacat?cggggggagt?ctatgggttt?gtgcagacaa?gacatcctgg 2160

ggctcttttc?ttcagcacgc?ttgtgggttg?cttgatagtt?gttatcggag?tgatatttgt 2220

ttcactgcac?ctcaactcct?cgaacagcgg?taaacctagg?gcttcaaccg?actataggtg 2280

acgacattat?gtcagtcgac?agaattcctt?gtcaatattg?aggtgttgtt?atagcatttg 2340

atttagattt?ttcatataat?caactgccaa?ctgggttatg?taaacttgtg?cggcgaatgc 2400

atttttggcg?t 2411

<210>59

<211>701

<212>PRT

<213> rice

<400>59

Met?Arg?Lys?Arg?Asp?Leu?Gly?Ile?Leu?Leu?Leu?Ala?Ala?Phe?Ala?Val

1 5 10 15

Phe?Phe?Ser?Leu?Gln?His?Asp?Gly?Asp?Leu?Ser?Phe?Arg?Glu?Ala?Trp

20 25 30

Tyr?His?Leu?Ser?Asp?Ala?Asp?Tyr?Pro?Ile?Lys?His?Asp?Ala?Asp?Arg

35 40 45

Leu?Pro?Ser?Pro?Leu?Val?Ala?Asp?Leu?Asn?Gly?Asp?Gly?Lys?Pro?Glu

50 55 60

Val?Leu?Ile?Pro?Thr?His?Asp?Ala?Lys?Ile?Gln?Val?Leu?Gln?Pro?His

65 70 75 80

Pro?Arg?Pro?Ser?Pro?Asp?Asp?Ala?Ser?Phe?His?Asp?Ala?Arg?Leu?Met

85 90 95

Ala?Asp?Val?Ser?Leu?Leu?Pro?Ser?Asn?Val?Arg?Leu?Ser?Ser?Gly?Arg

100 105 110

Arg?Pro?Val?Ala?Met?Ala?Val?Gly?Thr?Val?Asp?Arg?His?Tyr?Ala?His

115 120 125

Ala?Pro?Ser?Pro?Ser?Lys?Gln?Leu?Leu?Val?Val?Val?Thr?Ser?Gly?Trp

130 135 140

Ser?Val?Met?Cys?Phe?Asp?His?Asn?Leu?Lys?Lys?Leu?Trp?Glu?Ala?Asn

145 150 155 160

Leu?Gln?Asp?Asp?Phe?Pro?His?Ala?Ala?His?His?Arg?Glu?Val?Ala?Ile

165 170 175

Ser?Ile?Thr?Asn?Tyr?Thr?Leu?Lys?His?Gly?Asp?Ala?Gly?Leu?Val?Ile

180 185 190

Val?Gly?Gly?Arg?Met?Glu?Met?Gln?His?His?Ser?Ala?Glu?Leu?Phe?Asp

195 200 205

Glu?Phe?Met?Val?Ser?Glu?His?Asn?Arg?Glu?Glu?His?Arg?Arg?Ser?Ala

210 215 220

Ser?Glu?Lys?Gln?Ala?Ser?Glu?Thr?Gly?Asn?Thr?Asp?Leu?Arg?His?Phe

225 230 235 240

Ala?Leu?Tyr?Ala?Phe?Ala?Gly?Arg?Thr?Gly?Glu?Leu?Arg?Trp?Ser?Arg

245 250 255

Lys?Asn?Glu?Asn?Ile?Pro?Ser?Gln?Pro?Ser?Asp?Ala?Ser?Val?Leu?Ile

260 265 270

Pro?Gln?His?Asn?Tyr?Lys?Leu?Asp?Ala?His?Ala?Leu?Asn?Ser?Arg?His

275 280 285

Pro?Gly?Gln?Phe?Glu?Cys?Arg?Glu?Phe?Arg?Glu?Ser?Val?Leu?Gly?Val

290 295 300

Met?Pro?His?His?Trp?Asp?Arg?Arg?Glu?Asp?Thr?Phe?Leu?Gln?Leu?Ala

305 310 315 320

His?Phe?Arg?Arg?His?Lys?Arg?Lys?Ala?Leu?Lys?Lys?Thr?Pro?Gly?Lys

325 330 335

Ala?Val?Val?Asn?Asn?Val?His?Lys?Pro?Ser?Glu?His?Asn?Pro?Pro?Gly

340 345 350

Lys?Asp?Val?Ser?Asn?Arg?Leu?Ala?Asn?Val?Ile?Gly?Lys?Ala?Ala?Asp

355 360 365

Met?Ala?Asn?Ser?Asn?Lys?Ile?Lys?Lys?Ser?Gln?Arg?Thr?Leu?Tyr?Val

370 375 380

Pro?Thr?Ile?Thr?Asn?Tyr?Thr?Gln?Val?Trp?Trp?Val?Pro?Asn?Val?Val

385 390 395 400

Val?Ala?His?Glu?Lys?Glu?Gly?Ile?Glu?ALa?Val?His?Leu?Ala?Ser?Gly

405 410 415

Arg?Thr?Ile?Cys?Lys?Leu?His?Leu?Thr?Glu?Gly?Gly?Leu?His?Ala?Asp

420 425 430

Ile?Asn?Gly?Asp?Gly?Val?Leu?Asp?His?Val?Gln?Val?Val?Gly?Ala?Asn

435 440 445

Gly?Ile?Glu?Gln?Thr?Val?Val?Ser?Gly?Ser?Met?Glu?Val?Leu?Lys?Pro

450 455 460

Cys?Trp?Ala?Val?Ala?Thr?Ser?Gly?Val?Pro?Val?Arg?Glu?Gln?Leu?Phe

465 470 475 480

Asn?Val?Ser?Ile?Cys?His?Tyr?Asn?Asn?Phe?Asn?Leu?Phe?His?His?Gly

485 490 495

Asp?Phe?Ser?Arg?Ser?Phe?Gly?Arg?Thr?Phe?Asp?Thr?Thr?Gly?Leu?Glu

500 505 510

Val?Ala?Thr?Pro?Ile?Leu?Leu?Gln?Arg?Asp?Asp?Gly?His?Lys?His?Arg

515 520 525

Arg?Gly?Ser?His?Gly?Asp?Ile?Ile?Phe?Leu?Thr?Ser?Arg?Gly?Glu?Val

530 535 540

Thr?Ser?Tyr?Ser?Pro?Gly?Leu?Leu?Gly?His?Asp?Ala?Ile?Trp?Arg?Trp

545 550 555 560

Gln?Leu?Ser?Thr?Gly?Ala?Thr?Trp?Ser?Asn?Leu?Pro?Ser?Pro?Ser?Gly

565 570 575

Met?Met?Glu?Asn?Ile?Val?Val?Pro?Thr?Leu?Lys?Ala?Phe?Ser?Leu?Arg

580 585 590

Ala?Tyr?Asp?Pro?Lys?Gln?Val?Ile?Ile?Ala?Gly?Gly?Asp?Leu?Glu?Ala

595 600 605

Val?Val?Ile?Ser?Pro?Ser?Gly?Gly?Leu?Leu?Ala?Ser?Ile?Glu?Leu?Pro

610 615 620

Ala?Pro?Pro?Thr?His?Ala?Leu?Val?Leu?Glu?Asp?Phe?Asn?Gly?Asp?Gly

625 630 635 640

Leu?Thr?Asp?Ile?Ile?Leu?Val?Thr?Ser?Gly?Gly?Val?Tyr?Gly?Phe?Val

645 650 655

Gln?Thr?Arg?His?Pro?Gly?Ala?Leu?Phe?Phe?Ser?Thr?Leu?Val?Gly?Cys

660 665 670

Leu?Ile?Val?Val?Ile?Gly?Val?Ile?Phe?Val?Ser?Leu?His?Leu?Asn?Ser

675 680 685

Ser?Asn?Ser?Gly?Lys?Pro?Arg?Ala?Ser?Thr?Asp?Tyr?Arg

690 695 700

<210>60

<211>1103

<212>DNA

<213> common wheat

<220>

<221>misc_feature

<222>(16)..(16)

<223>n is a, c, g, or t

<400>60

gcgttccgga?gctttnaaaa?gagtcaggag?ggattgacat?aggaccatat?attgcatgca 60

gtatagttgt?gggtaacctt?gacacaaaac?aagttaaatg?gacagcagaa?ctcgatttga 120

gtaccgaaag?cgggaaattc?cttgcccatg?catattcgtc?tccaactgtg?gttgatttgg 180

atggtgatgg?aaatttggat?atccttgtcg?gaacttccta?tggcttgttt?tatgttcttg 240

atcatcacgg?taagactagg?aaaaatttcc?cccttgagat?ggctgagatc?catgcaccag 300

tcattgcagc?agacatcaat?gatgatggta?agatcgagat?ggtcactgct?gatgtgcatg 360

gtaatgtagc?agcttggact?gcagagggag?acgaaatctg?ggaggtgcat?ctgaagagcc 420

ttgttccaca?gcgacctact?gtcggggacg?tcaatggaga?tggccacact?gatgttgtgg 480

tcccaactgt?atcaggaaac?atctacgttc?ttagtggaaa?ggatggctca?aaagttcagc 540

ctttcccata?tagaacacat?ggaaggatca?tgagtccggt?cttgttagtt?gacatgagca 600

aacgtggaga?aaagacgcaa?ggactaaccc?ttgctactac?gtcctttgat?ggttatttgt 660

atttgatcga?gggctctagt?ggctgtgcag?atgttgtcga?cattggagag?acctcgtaca 720

ctatgggttt?ggctgacaat?gtggatggcg?gagatgacct?tgatctgatt?gttactacca 780

tgattggcaa?tgtcttttgc?tttttcactc?cctcaccgga?acatcctctc?aaggaatgga 840

gatcatcaaa?ccaggaaagg?aataatgctg?catataggca?ccacccgtca?aggtatttat 900

gtaaggcatg?gttcaggaca?acccgggaat?gaaaagggta?aacatttcgg?ggtcgatttg 960

aaaattggag?acaagtacag?ggttccctat?gggaattaac?tccttaaaat?gtcagggtac 1020

cttactcgtc?ctgggaatta?ccagggaaac?aggggtattg?gggtttgcca?attttaaaat 1080

gaaccgggca?caaggaattg?ggt 1103

<210>61

<211>1152

<212>DNA

<213> Zea mays

<220>

<221>misc_feature

<222>(232)..(256)

<223>n is a, c, g, or t

<220>

<221>misc_feature

<222>(416)..(474)

<223>n is a, c, g, or t

<220>

<221>misc_feature

<222>(525)..(529)

<223>n is a, c, g, or t

<220>

<221>misc_feature

<222>(1025)..(1047)

<223>n is a, c, g, or t

<400>61

acaggcttat?tataggtttg?ttttctacta?atagttatga?agagcgtttt?gacacagtat 60

ccgagagttt?tgcttctcct?ctccgagggt?cgcttctctt?agaatctgac?aattaccgtt 120

tcaaaggcct?actgtaaact?ctcaatggtg?acaatatgct?tgttctttgg?gtgagccaat 180

attgaaaatg?gctgtgtaca?aaattgttct?gcagaactaa?atgggtacat?tnnnnnnnnn 240

nnnnnnnnnn?nnnnnnaaat?ggttaactgt?tgggatacta?cactgaacaa?gacatttagg 300

tcatggagat?gttggggagt?cacttcgtca?gcttcaatgg?gtcaccggca?tttcaccact 360

agtcgatatt?ccgtgaaaac?gatggcagcg?gcgcaccttc?ttggggcctc?aagatnnnnn 420

nnnnnnnnnn?nnnnnnnnnn?nnnnnnnnnn?nnnnnnnnnn?nnnnnnnnnn?nnnnagtaat 480

gcatgtggaa?ggtgagtgag?aactcgtcgg?agaagtacag?cccannnnna?tcgatcatct 540

ccacgaccac?agttccagta?gttctaacag?gaacagtggg?aagcatcatc?cgttgcttcc 600

ctggttgatg?atacacacca?ctgacaacaa?tgcgcctatc?tccttgataa?ttccccggaa 660

caagtaaagt?taccgtcacg?ttataaggag?cttgcttccc?atagggcacc?ctgtacttgt 720

caacgatttc?aaactctatc?cagaaattct?tgccctcttc?gtcacggaag?gtcctggaac 780

catgcttaac?atagatacct?tcacggttgt?actgatatgc?agcattattc?cttccttggt 840

ttgatgacct?ccattcctta?agcggatggt?gtggtgattg?agtggagaag?cagaagacgt 900

tgccattcat?agtggtaaca?ataagatcaa?ggtcatctcc?accatccacg?ttatcagcca 960

aaaccatagt?gtacgaggtc?tctccaatgt?caacaacatc?tgcacagcca?ctcgatccct 1020

caatnnnnnn?nnnnnnnnnn?nnnnnnnacg?ttgttgcaag?agttagccct?tttgcattgt 1080

ctccatgttt?gctcatgtcg?agaagtagaa?caggactcat?gattcttcca?tgtgttctat 1140

atgggaaagg?tt 1152

<210>62

<211>720

<212>DNA

<213> potato (Solanum tuberosum)

<400>62

gtttcaatct?agataccaag?caagttaaat?ggactgcaca?gttggactta?agtactgacg 60

acgggaaatt?ccgtgcctat?atatactctt?ctcctacggt?agttgatttg?gatggtgatg 120

gaaacatgga?cattctagtg?gggacctcct?atggcttctt?ttatgtgttg?gatcacaacg 180

gcaaagtgag?ggaaaagttc?cctctcgaaa?tggctgaaat?ccaaggagca?gtagttgcag 240

ctgatatcaa?tgatgatgga?aagattgaac?tagttacaac?agattcacat?ggaaatgttg 300

ctgcttggac?cgcacaaggc?acagaaattt?gggaaacgca?tctcaagagc?cttgttcctc 360

agggaccggt?tattggcgat?gtggatggag?atggccatac?agatgtcgtt?gtcccaacac 420

tttctgggaa?tatatatgtt?ctgaatggca?aggacggctc?atttgtacgt?ccatatcctt 480

ataggactca?tggtagggtg?atgaatcgag?cacttcttgt?cgacttgagc?aaacgtgggg 540

agaagaaaaa?agggcttaca?attgtcacaa?tgtcatttga?tggttatttg?tatctcatag 600

atggaccaac?atcatgtgct?gatgttgtag?atattggtga?aacttcatac?agcatggtct 660

tggctgataa?tgttgatggt?ggcgatgatc?ttgatcttat?tgtaacaacc?atgaatggta 720

<210>63

<211>904

<212>DNA

<213> aquilegia (Aquilegia)

<400>63

gtgaatattg?attcacacat?cctttgcact?cctgtgattg?cagacatcga?caatgacgga 60

gtatcagaaa?tggttgtcgc?tgtatcctat?ttctttgatc?atgagtatta?tgacaaccca 120

gagcatctct?ctgagttggg?tggcatagat?attgggaaat?atgtagcggg?aggaattgta 180

gtatttgatc?ttgatacaag?acaagttaag?tggacaacag?agctagatct?tagtacagac 240

acaggggact?tccgtgctta?tatatattct?tctccaacgg?tggtcgattt?ggatggagat 300

ggaaatttgg?acattcttgt?tgggacatct?tttggcttgt?tttatgtttt?ggaccataat 360

ggcaagataa?gaaacaagtt?ccctctcgaa?atggctgaga?ttcagggctc?tgtcattgcg 420

gcggatataa?atgatgatgg?aaaaattgaa?ttggttacaa?ctgatactca?tggaaatgtt 480

gctgcatgga?ccccagaagg?agaagaaatt?tgggaagtac?atcttaagag?tcttgttcca 540

caacgtccaa?cagttggtga?tgttgatggc?gatggtcata?ctgatgtggt?ggttcctaca 600

ctatcaggga?acatatacgt?tctcagtggc?aaggatggct?cttttgttca?cccataccca 660

tatcgtactc?atgggagagt?catgaatcaa?gttcttttag?tagatctaag?taaacgtgaa 720

gagaaacaga?agggactcac?tcttgtcaca?acatcatttg?atggctattt?gtaccttatt 780

gacggaccat?catcttgtgc?tgatgttgtt?gatattggcg?agacttcata?tagtatggtc 840

ttggcagaca?atgttgatgg?tggggatgat?cttgatctaa?ttgttacaac?tatgaatggg 900

aatg 904

<210>64

<211>708

<212>DNA

<213> colea (Brassica napus)

<400>64

atttgggaag?tgcatctaaa?gagtcttgtt?ccccagggtc?cttcaatagg?cgatgttgat 60

ggtgatggac?atactgatgt?cgtggttcct?acaacgtcag?gaaacattta?tgttcttagt 120

ggcaaggatg?gttcgattat?acgtccgtac?ccgtacagaa?ctcatggaag?agtgatgaac 180

caacttcttc?ttgttgatct?gaacaagcga?ggtgagaaaa?agaaggggct?caccattgtt 240

accacatcct?ttgacggtta?catgtacctc?atagatggac?ccacctcatg?cacggacgct 300

gttgatattg?gtgaaacttc?atacagcatg?gtcttggctg?ataatgttga?cggtggagat 360

gatcttgatc?taatcgtctc?aactatgaat?ggaaacgtct?tttgcttctc?tacaccttct 420

cctcaccatc?ccctcaaggc?gtggagatcg?actgatcaag?ggaggaacaa?taaggcaatc 480

cgttacggtc?gtgaaggtgt?ctttgtcact?cattcaacca?gaggcttccg?tgacgaggaa 540

ggcaaaaact?tctgggctga?gatcgagatt?gttgataact?acagataccc?atctggttca 600

caagcaccct?acaacgttac?tacgacgttg?ttggtaccag?gcaactacca?aggagatagg 660

aggataacac?atagccagat?ctatgaccga?ccaggaaaat?acagaatt 708

<210>65

<211>834

<212>DNA

<213> sweet orange (Citrus sinensis)

<400>65

gttgatgggg?atggccatac?tgatgttgta?gttccaacac?tatcggggaa?catttacgtt 60

cttagtggca?aggatggcag?taaagtccgt?ccttatcctt?atagaactca?tggaagggtg 120

atgaatcaag?tccttcttgt?tgatttaact?aaacgcgggg?agaaaagcaa?gggactcaca 180

attgttacaa?catcttttga?tggctatttg?taccttatag?atggcccaac?atcatgtgct 240

gatgtagtcg?acattggcga?aacttcatat?agcatggtct?tagctgacaa?tgttgacggt 300

ggagatgatc?ttgatcttat?tgttaccaca?atgaacggca?atgttttttg?cttctcaact 360

cctgctccac?accatcccct?caaggcatgg?agatcaatta?accaaggaag?aaacaatgtt 420

gcaatccgtt?acaaccgtga?aggaatctat?gttacacatc?catcaagagc?tttccgtgat 480

gaggaaggca?gaaacttctg?ggtggagatt?gagattgtag?atgaatatag?attcccatct 540

gggtcccaag?ctccatataa?tgtcactaca?acattgttgg?tccccggcaa?ttaccaaggt 600

gagaggagga?ttaagcaaag?ccaaatcttt?gcacgtcgtg?gaaaatatag?aatcaaattg 660

ccgacagtcg?gggtaaggac?gacagggact?gttttggtgg?agatggttga?caagaacgga 720

ctttatttct?cagacgaatt?ctcgcttaca?ttccatatgt?attactataa?actactaaag 780

tggctcctag?tcctcccgat?gctcgggatg?tttggtgtgc?ttgtcatcct?tcgt 834

<210>66

<211>906

<212>DNA

<213> officinalis (Asparagus officinalis)

<400>66

gggtggaaag?gatggatcgt?ttgttcgacc?cttcccctat?aggacacgag?ggagattgat 60

gagtccagtt?cttctggctg?atttaagcaa?acgtgatgaa?aagttaaagg?gcctaactct 120

tgttacaact?gcatttgatg?gctatttgta?cctaattgat?gggtccactg?gttgtacgga 180

tgttgttgac?attggcgaga?catcatacac?catggtcttg?gcagataatg?ttgatggtgg 240

ggacgatctt?gaccttattg?ttactactat?gaatggcaat?gtcttttgct?tttccacacc 300

ctcaccgcat?catcctctga?aggaatggag?atcatccaac?cagggaagaa?acaatgcagc 360

aagtagatat?aaccgtgaag?gaatatacat?atcacatgga?tccagagctt?tccgcgatga 420

ggaaggtaaa?catttctggg?tggagctgga?gataatagac?aagtacaggt?ttccctcagg 480

gcatcaaggg?ccttataatg?tcacaacaac?attattagtt?cctggaaatt?accaaggaga 540

aaggcgaatt?gtcgtcaaca?atgtatataa?tcaacctgga?aagcaacgga?taaagctgcc 600

aacagttcct?gttcgaacaa?cagggactgt?gctggtggag?atggttgaca?agaatggatt 660

gtatttctct?gatgaatttt?ctcttacatt?tcacatgcat?tactacaagc?tactgaagtg 720

gcttctgttt?ctaccgatgc?tcggaatgtt?tggagttctt?gtcattctac?gtccccagga 780

aggtgcaccg?ttaccatcgt?tttcacgaaa?tttggattga?tattaatgat?atcatccaat 840

gaagatgaga?atactccaaa?gtgcgatgct?atctgacatg?tatgcctttg?tacatctgaa 900

tgtgtg 906

<210>67

<211>779

<212>DNA

<213> Populus (Populus)

<220>

<221>misc_feature

<222>(34)..(39)

<223>n is a, c, g, or t

<220>

<221>misc_feature

<222>(663)..(663)

<223>n is a, c, g, or t

<220>

<221>misc_feature

<222>(686)..(688)

<223>n is a, c, g, or t

<220>

<221>misc_feature

<222>(739)..(744)

<223>n is a, c, g, or t

<220>

<221>misc_feature

<222>(746)..(748)

<223>n is a, c, g, or t

<220>

<221>misc_feature

<222>(760)..(761)

<223>n is a, c, g, or t

<220>

<221>misc_feature

<222>(766)..(769)

<223>n is a, c, g, or t

<220>

<221>misc_feature

<222>(773)..(777)

<223>n is a, c, g, or t

<400>67

tgaatcaagt?tcttcttctt?gacttaagta?aacnnnnnng?agaaaaacaa?gggactcaca 60

cttgttacaa?catcattcga?tggttatctt?taccttatag?atggaccaac?ttcttgtgct 120

gatgttgttg?atattggtga?aacttcatat?agcatggtct?tggcagacaa?tgttgatggt 180

ggagatgatc?ttgatctcat?agtttcaaca?atgaatggaa?atgtcttttg?cttttcaact 240

cctgttccac?atcatcccct?gaaggcttgg?agatctaata?atcaaggaag?aaacaatgta 300

gcaaaccgct?acaaccgtga?aggggtgtat?attaaacctt?catcaagaag?tttccgtgat 360

gaggagggga?agagcttctg?ggtggaattt?gagattgtgg?acaagtatag?aatcccgtct 420

gggtctcaag?caccttataa?tgtcactaca?accctgttag?ttcctggcaa?ttatcaaggt 480

gaacgacgga?taaagcaaaa?tcaaatcttt?gaccgtccag?gaaaatatcg?gataaaactt 540

ccaacagttg?gagtgagaac?tactggaact?gttttggtgg?agatggttga?taagaatgga 600

ctctatttct?cagatgactt?ctcgcttaca?ttccacatgc?attactataa?actgctgaag 660

tgnctccttg?tcctcccaat?gcttgnnntg?tttggtgtgc?ttgtcatcct?tcgtccacaa 720

gaggccgtgc?ccttgccann?nnnntnnngg?aatactgacn?ngtgannnnc?atnnnnnac 779

<210>68

<211>723

<212>DNA

<213> Populus

<400>68

ggcacgagca?cacttgttac?aacatcattt?gatggttatt?tgtaccttat?agacggacca 60

acttcttgtg?ctgatgttgt?tgatattggt?gaaacttcat?acagcatggt?cttggcagat 120

aatgttgatg?gtggagatga?tctagatctc?atagtctcaa?caatgaatgg?gaatgtcttt 180

tgcttttcaa?ctcctgttcc?acatcaccct?ctcaaggctt?ggagatcttc?taatcaagga 240

agaaacaacg?tggtgaaccg?ctacaaccgt?gaaggggttt?atgttacacc?ttcatcaaga 300

agttttcgtg?atgaggaggg?aaagagcttc?tgggtggaat?ttgagattgt?agacaagtat 360

agattcccat?ctgggtctca?agcaccttat?aatgtcacta?caaccctttt?agttcctggc 420

aattatcaag?gtgagagacg?aataaagcaa?agccaaatct?ttgaccgtcc?aggaaattat 480

cgggtaaaac?ttccaacagt?tggagtgagg?actactggaa?ctgttttggt?ggagatggtt 540

gataagaacg?ggctctattt?ctcagatgac?ttctccctta?cgtttcacat?gcattactat 600

aaactgctga?agtggctcct?agtcctccca?atgcttggaa?tgttttgtgt?gcttgtcatc 660

cttcgtccac?agaggccatg?ccccttacat?cattttcagg?aatactgact?tgtgatatca 720

tct 723

<210>69

<211>704

<212>DNA

<213> Euphorbia esula L (Euphorbia esula)

<220>

<221>misc_feature

<222>(10)..(11)

<223>n is a, c, g, or t

<400>69

ctgatacccn?ntgaaatgtt?gctgcttgga?cttcacaagg?aaaggaaatt?tgggagaggc 60

atctcaaaag?tcttatttcc?cagggcccat?cagttggtga?tgtggatggg?gatggccata 120

ccgatgtggt?agtccctact?atatctggga?atatatatgt?tttgagcggc?aaggatgggt 180

caaatgttcg?cccataccca?tatagaaccc?atgggagagt?aatgaatcaa?gttctccttg 240

ttgatttaag?taaacgtggg?gagaaaagca?ccggactcag?ccttgtaaca?acttcatttg 300

atggatactt?gtaccttata?gatgggccca?catcctgcgc?tgatgtcgtt?gatattggtg 360

aaacctcata?tagcatggtc?ttagcggaca?atgtagacgg?aggagatgac?cttgacctag 420

tagtcacaac?aatgaatggg?aacgtctttt?gcttcgcgac?tcctgttcca?catcatcccc 480

ttaaggcatg?gagatcggct?aatcaaggta?gaaataatgt?ggcaaacaga?tttaaccgtg 540

aaggggtcta?tgttacacct?tcatcaagag?cttttcgaga?cgaggaagga?aagaatttct 600

gggtggaaat?cgaaatcgtg?gataaatata?gatacccttc?tggttctcaa?gcaccttata 660

aagtcactac?aaccctgtta?gttccgggta?attatcaagg?tgag 704

<210>70

<211>1088

<212>DNA

<213>Ceratopteris?richardii

<400>70

ccacgcgtcc?gggttacaac?agatgcccgg?ggaaatgttg?ctgcatggac?aaataaagga 60

aaagaaattt?gggaagttca?cttaaaaagc?ttgattgctc?agggtccgac?tgtcggagat 120

attgatggag?acggaacatt?ggatattgtt?gtgccaactg?tgtcaggaaa?tatatatgtt 180

ttgcatggaa?agactggtgt?tactatgaag?ccatatccat?ttcgtaccca?tgggcgtgtg 240

atggctcctg?ttcttctggt?ggacttggcc?aagctaggca?ccgagagaag?aggtctggtc 300

ctggtggttt?catcatttga?tgggtacctc?tacctcatag?atggtcccac?agcctgtgct 360

gatgtggttg?atgtaggaga?gacatcctac?acaatggtgc?ttgcagacaa?cgttgatgga 420

ggagatgatt?tggatttaat?agtgacgacc?atgaatggga?atgttttctg?cttctctaca 480

cctgctcctt?atcatccttt?acggtcatgg?acctcacaga?atcagggtag?gagcaatctt 540

gcatctcgta?taagacatga?agggatttat?gctacatctg?gctcgagaag?tttcagggat 600

gaaggtggtg?aaagtttttg?ggtgcatttc?aatattattg?atgagaaccg?cttaccttcg 660

gggccttaca?atattacggc?tacccttctt?gtcccccaca?actacatggg?tccaaggcgc 720

attacagaga?gtcagttaat?tcaacaacca?ggaacgcaca?agttcaaact?gccatgtgta 780

tctgtacgat?catctgggac?tgtagttcta?gagatggtgg?ataaacatgg?gttctatttc 840

actgatgagt?attcattgac?attccacatg?cactattatc?ggctactgaa?atggatggta 900

gtgcttccaa?tgcttggaat?gctttttgtc?ttgttgtggc?ttcatcctga?ggatgccata 960

tcagttcttc?cttccttttc?aagggatcat?taaaatgaca?tatgagctca?atttttggta 1020

ctcctaaatc?caaaccttat?tgtaaatgta?tacattttga?catttatcca?gtctactaaa 1080

gaaatgca 1088

<210>71

<211>830

<212>DNA

<213> orchid at the age of one hundred years old (Welwitschia mirabilis)

<400>71

atgacaatca?tgaacacttg?aaggagctgg?gtgatattga?tattagcaaa?tatgtttcag 60

gtgctatagt?ggtatttaat?cttgatacaa?agcaagtgaa?gtggagtact?cagttggatc 120

ttagcacaac?ctctgggact?tttaatgcat?acatctattc?ttctcctact?gtggttgacc 180

tggatggtga?cggcaatttg?gatattattg?ttggcacgtc?atttggtttc?ttttatgtat 240

tggatcacca?tggaaaaaat?agagaaggct?ttccattaca?gatgggtgag?attcaaggac 300

aagtaattgc?tgctgatata?aatgatgatg?ggaagattga?aatggttaca?acagataccc 360

gtggaaatgt?ggctgcttgg?acttctcagg?ggaaagaaat?atgggagata?catttaaaaa 420

gtcttattgc?tcaggggcct?acagtaggtg?atattgatgg?agatggtcat?acagatttgg 480

tggttcctac?agtatcagga?aatatttatg?tattaaatgg?gaaagatgga?tcattggtga 540

agccatttcc?ttatcgtact?catggaagag?tcatgagtcc?ggtacttttg?gttgacctta 600

gcaaacgtgg?ggaaaagcaa?aagggcttaa?ctcttgcagc?attatcattt?gatggttact 660

tctacttaat?tgatggtcaa?acagcttgtg?cagatgttgt?tgatattgga?gagacttcct 720

actctatggc?tttggcggac?aatgtagatg?gcggcgatga?tcttgatttt?attatcacaa 780

ctatgaatgg?caatgtgttc?tgcttttcaa?cccctgctcc?acatcatcca 830

<210>72

<211>8730

<212>DNA

<213> alfalfa

<400>72

atgaggaagc?gtgatttggc?gattcttatg?ctctgcgctt?tcgctatttt?cttctctctt 60

caggtattgt?accctttaac?cccctaattc?actttctcac?tcttaaaccc?taaccctcat 120

tttcaattca?attgattcag?caagatggtg?gtgtttcatt?caaagacgcg?tggatgcatc 180

taacagatga?atacccaatc?aaatacgaag?ccgaacgcct?tcctcctcct?gttgtcgccg 240

atctcaacgg?cgatggtaag?aaagaagttc?tcgtagctac?ccacgatgcc?aaaattcagg 300

ttctttcatt?tcccaatttt?cctcaatttt?ttattcactt?ataaaattcc?aggttttatt 360

tggtttcctt?cacaactgga?cattgtcaaa?aaaacatttt?ttttctttca?gtaaaccatc 420

aatgtagttg?atgaactata?actctcttca?atttagtttg?taagtagtct?ctaaaattca 480

tcaattaatc?cctgctatta?atgtttggtt?ctacaccgaa?gaaagttgac?tttgaatgag 540

ttgattgtgt?aaactctatt?tgggctaaaa?ttgatttgaa?ggtaaagtga?tttatgtttg 600

gactttggat?acattcatgt?aaaagtgaat?tgaacaggtg?aaaaatcaac?tctagaatca 660

gaagctacaa?tttctaactt?taagtagaat?gtagaatcaa?ttctggaggt?aaaatcaatt 720

ttactctaga?agaaccaaat?atgtcaatca?attttgggtc?ctccaaaatt?agaaccaaac 780

atacagaaag?tagagactaa?aattgatgga?ttttcatata?ctttagggac?ttaattgacc 840

ggttttatat?actttaaaga?ctacttatca?tatttatata?gtttagggac?tagattgatg 900

gtacaagtaa?tatagtagta?actggatttt?gtatttatgg?tcggtgtctt?agattttgga 960

gccacatagt?aggcgtgttg?atgaaggatt?cagtgaggca?cgtgtgttag?cggaggtgtc 1020

tctgttgcct?gacaaagtgc?gtgtcatgtc?tgggagacga?cctgttgcta?tggccactgg 1080

ctttattgac?cgccatagaa?ttggacaacc?acataagcag?gttttggttg?tagtaacatc 1140

gggttggttt?gtaatgtgtt?ttgattccaa?cctccaaaag?ttgtgggaaa?ataatttgca 1200

ggtatgatgt?ttatgttgtg?ccatgtttca?gttgatagaa?ttttcagtta?aacattttga 1260

ttatcttgtt?atgttttagt?ttaccaactg?ttttagtggt?tgttaacagg?aggatttccc 1320

ccataatgct?caccacaggg?aagtttcaat?atctataagc?aattatactc?tcaagcatgg 1380

agatacagga?ttgatcattg?ttggtgggag?aatggaaatg?cagcctcatg?tatgtgtcac 1440

tttccttctt?gttttctggt?ttgttattct?ttttagcaga?gtatgtgtgt?ctgtgttcta 1500

tctgctgatg?gaaaaactta?gaatttaatg?tggatggtgt?ttaccatctt?ttatgaaagc 1560

gaaaactctc?aacttcatga?gtagcataag?attctggcta?tcttgttttc?ttggaagtga 1620

tgaaaatgaa?agttcctgag?taattttatt?tgataaagta?tgatggtaat?gtgagggttt 1680

gctgctgctt?ctcgagtttc?agaatttttt?atttgttatt?tgattctttc?tatggtaatg 1740

attttggaat?tgttcatctt?tggaattatt?ggcattatct?tctaatctga?tggttctgtt 1800

ggcttatgtt?gattgctttc?cattttcaga?tttttatgga?cccttttgaa?gaaatgggaa 1860

tgggagctag?atttgctgag?cagcatcgaa?gaagtgctac?tgaaaaggag?gtatagatac 1920

gtttctagtt?gatgctaaat?tttatgccca?tttttttact?atctgtagca?tgctaatttt 1980

ggtttaaact?ttgagacact?atttgcttta?tttatttcac?tttaattttg?ggtcttcaag 2040

gttgacctta?ttttatgctc?ctaaacagtc?aattcaaatt?cctattttga?tataaataga 2100

taatataaaa?gttcaccatg?tcttggcatg?ataaagccaa?taaataaaat?ctgtgcacct 2160

tgcagtaagt?agtctataaa?tctgaacctt?catgatcagg?tagctaaata?aacaggagac 2220

agtttcactc?gttttgttta?gatttttgtt?tttacaaaaa?aatgtatcag?gtgattttag 2280

ttttcttccc?attttaaggt?tgaagacttt?aacttgttta?ttgtgttcct?ttttctggat 2340

aggcttctga?aaacaccgga?actgtggatt?tacgccattt?tgcattttat?gcatttgctg 2400

gtcgatcagg?tgtagaacga?tggagcagaa?aaacagaggt?ggtgttcttt?tttttttgtt 2460

ttcagtgcgc?tctattattt?gggtgttgtc?aacatgcaaa?tatgaaacaa?ttatttattt 2520

ttaatttaaa?aatgcatttt?cttgtttttt?aaaagagctg?tcttttctat?ctggaaattc 2580

attaggtgat?taagtgaact?ttctctgtcc?tccctctctg?tacataactt?tattcagggg 2640

gtagcaactt?agttctagac?agtatgtttt?gtcctgcaac?agacatgaaa?actgaagaaa 2700

agttatatag?ttaagctcac?aaagttcaga?acataatgag?ttagagccta?aatgtcaata 2760

atagattata?aattatacct?ttgaagatat?tggagtcttg?ttgcaagcat?ctgcacttgg 2820

attttaacgc?actggtgcac?aaatatgtat?tttttgaaaa?gaaaatctat?caaacaaatg 2880

gaaccacctc?ccaaccagca?taaactttag?tcttttctgt?ctttgggtgg?tagtaccaga 2940

tagatgtttt?acaatcaaca?tagcggtcca?gtttgattga?atatgtgatt?tacgctagtc 3000

caacatttat?tttgttaaat?gatcttgtgt?atccttgtcc?tttttttttt?cttttctttt 3060

ctaattgcta?gtattgtgat?ttaattgttt?agaacattga?agcagcagct?tcttcagacg 3120

catcacagtt?aattccacag?cataactaca?aacttgatgt?tcatgctctg?aatagacgtc 3180

aacctggaga?ggtacttagc?tatagctgtt?caatttaatc?ctaaattcct?aatggtatat 3240

tgaattgatg?gaatatggta?aattggagtg?gcataaaata?ccattccatc?ctttttaagc 3300

aggggaatca?ttgcttttct?ttttcataca?tccattttat?tctaatctag?aaatatgcat 3360

gttgattttt?atgttctccc?ctttagctca?acgtactgat?tttgttatat?gtaagtaata 3420

ctgtaatttc?agatttatta?ctttttccat?tcctttcctc?atcaatctta?agtaataccg 3480

tagaatagat?tcctagtcat?atctttatgt?tcttcacctt?ttctcttcaa?atgatcaaac 3540

actaaagcaa?atatttgttt?gttaatatgg?agtttactat?gagaactcta?gtacaatagt 3600

actcatccaa?atctacttga?gtaacttggt?catctccttc?ctttgtgtgt?ggaaatagca 3660

gcatgtgcac?ataaaggagt?gtttcaatca?aatttaatat?tattgtgaaa?cctttgtata 3720

tgtttatcca?tatctaccca?atagatagct?tcctgtgaca?tgtgaaatta?tagtttgaat 3780

gcagggaatt?cagagaatca?atcctgggag?ttatgccaca?tcaatgggta?cactctattt 3840

tcaaccttga?ttaacgtttg?gtactaaagc?ataatctcaa?atgtcatagt?taactgatat 3900

tagatacatg?cactcatcag?gataggagag?aagatacttt?attgaagttg?gtccacttca 3960

atcggcataa?gaggaaaaca?ttgaagaaaa?cacctggaaa?gactatcaat?taccctttcg 4020

acaagcctga?ggaaaaccat?ccaccaggga?aggactcaac?caaaaaaatt?tcaaacataa 4080

ttgggaaagc?agcaaatttt?gctggttcag?caaaatccaa?gaaggtaatt?agaaaccatg 4140

tcatgcaatg?caactggtaa?caattcattc?aattgttgac?ataatgataa?ttagttttaa 4200

gatggctaca?actggacaac?tcaaaaattc?ttttccaaac?atgatttcag?ctacaagctt 4260

ttgttgtctt?tatccagtaa?cagagctgtc?tgtttacttt?ctaactactg?catgtccaat 4320

tttttgttat?gtgatctaaa?tctttgtgtt?ggtaatattc?tcagcatctg?ctgattttaa 4380

ttcattttgg?ctaaacctat?tttgaatttg?ttatgataac?cattgcttag?catttttaat 4440

ttttttttta?aactaagcac?tggtcagata?aaccatctca?cttgttatat?ttgtatttgt 4500

tcttaaagat?ttaagtctag?ctacattttt?tatttctcat?ttaaattttt?tgaatcctga 4560

atttagggag?ccaagatatt?tagttataaa?aataatgatt?aataataaat?atgcagttct 4620

ccccattgtc?gtgttaattt?ggtagatagc?atagtagtca?atcttggata?gcggtgcgta 4680

gtggccaacc?ccaaaaatgg?gatagcgtat?agcggtatga?caaatagcgg?tcaccgatgt 4740

ttgattattt?tttggacaat?tatatgaata?atagcaaagt?ataaacaaac?ttatatattt 4800

ctcaacaaaa?aaaacttata?ttaaatataa?cactcaaatc?tcacgagaca?ttcataaatc 4860

aaaacaccga?aaacaaaaga?caggaacaaa?taaaaaaaat?cataaaacag?gagaaaccat 4920

aagatagaag?atagaagagt?gtgtttcgcg?gcacaggtga?gaagagagaa?aaagttgaaa 4980

aatgttaggg?tttacgaaat?cctcaaaatg?ccctaaaaaa?ggttttaaaa?atagggtcaa 5040

tttggaaatt?tcctactaaa?ataaatagcg?gctgctatcc?aacccgcacc?gctatagcag 5100

ctgaagcggc?cgctatttga?ttccgcgcta?tttgataccg?ctatgctaca?cgcggccgct 5160

atagcgccac?tatcggctgc?tattgactac?tatggtagat?agaaactgtt?aggttaccta 5220

gtagggctga?tgatgtgtta?gtgggctcaa?gtaatgagtg?agaggcccat?tatttggagg 5280

gtgtatgaac?gtgggaagaa?gagaggagag?aagggactaa?gggtgcttcc?tagctggcag 5340

ttagttagta?tgaggcagag?ggagtgaata?tatttcttct?gaggagctgt?tgctctagtt 5400

tatccgtcat?agtgatttca?ttgttattct?agtttagcca?ggctttggga?gtatttggta 5460

tatctacctc?gaagatgcta?ggtcctaaaa?tgatgcagtt?ggaaggttcg?attgcgggag 5520

tctctctgtt?ggtgatgatt?taaacacaat?ttcatatact?cctggtgtgg?ttgaagcgtt 5580

gggggttgcc?tttggattca?tcagatactg?ctggtgtgca?tttgggtggg?ggtggggggt 5640

catatggtgc?agatattggg?caaatgtgtg?gttggcttct?gcatatcggc?ccttatgcag 5700

tcttgctgga?tacatatgtg?ttggggttag?aagaggtcat?gccaaagtac?caattactct 5760

cttaatacct?gtctaataag?actctaatgc?tttaaattga?cgaggatttg?catttttcac 5820

ctttcactgg?caaacatatg?ggttaaactg?gtagatgttt?agcgtgttca?agtacaagct 5880

gtgttcccat?agatgaagta?cttcatgttt?ggggagtttg?atcgttaaac?tacctaattg 5940

tttgtttaaa?tgaattttga?attccctctt?ctaataattt?tagtgcttcc?aaagattata 6000

atgcatataa?aacaatttga?ggattatctt?gttcttaggt?gaaaaacagt?ttttttccca 6060

tttgaaatta?gataaacaga?gtagttgtag?atttctactg?tggaaagcat?aacatgtcta 6120

agctggttaa?atatacttaa?ttgatggttt?ttgtcattaa?agtaatttct?ttgcatacat 6180

ttttatgttc?tcatgttatt?gcttaatcgg?aaaggggttc?tataaaatgg?atggcatttt 6240

atgggattcc?gagaagcctt?tttctttttt?ttgccagggt?ggggggtttg?cattatttgt 6300

cataatgttt?tttcttttgg?aatgcagtat?ccaccatatg?ttcccaccat?aaccaactat 6360

actaaggttt?ggtgggttcc?taatgttgtt?gtggctcatc?taaaggaggg?gatagaagtc 6420

cttcatctgg?catctggtcg?aacactatgt?aaggtaaata?taaagccact?gatcagcttg 6480

aaaatcaaaa?tacaaaaaaa?aaaaaaaaaa?gtttacaagt?agttgtacaa?catttgctcc 6540

tgtggttgta?gatttgtagt?attaaactgc?catggtttca?gccaaaatct?tatttagcat 6600

tcacgttact?tttgaaattt?ttcgtattct?gtgaaatgac?acttctattt?atctcagctt 6660

caccttcagg?aaggtggtct?acatgctgat?attaatggtg?atggagttct?ggatcatgtg 6720

caggttcact?ttttttcctt?cacatttttt?gataaacaaa?caagccaaat?ctttattaat 6780

ttagcatgat?aattgttaac?ttaacggggg?attttcctct?gcctgatgtc?tgaaagattt 6840

atctaatcag?gctgttggag?gaaatggtgc?tgagcaaact?gtagttagtg?ggtccatgga 6900

tgttctacgt?ccttgttggg?ctgttgcaac?gtctggcgta?ccagtacggg?aacaactctt 6960

caatgtatct?atttgtcatt?atacccattt?taacttattc?caacatggag?aactttatag 7020

aggcttcaac?cgaggttcag?atatgtcttc?tttggaggta?gcaacaccca?ttctcattcc 7080

tagaagcgat?ggtcacaagc?accggaaggg?aagccacggg?gatgttatct?tcttgacaaa 7140

ccggggagag?gtacgctctt?ttttgttcga?ctaaatctgg?ttatgtaaca?tttgatagtt 7200

tgtttgagca?ccaatcaaac?aaacctagtt?cttaacttct?gttaacaaat?tatttcaagt 7260

cacgcacgac?taatatattt?tggtggtatt?tgtgagataa?tccgtacctc?cgtactgact 7320

ttatgaaaat?tgctccttgc?agataacttc?gcacactcct?ggtttgcatg?gtcatgatgc 7380

tgtttggcag?tggcaacaat?caactggtgt?cacatggtca?aacctacctt?ccccagcagg 7440

gatgatggaa?ggtggtttgg?tgattcccac?actaaagcct?tttcctttgc?ggttgcatga 7500

caatcatgag?atgatccttg?cagctggaga?acaagaggct?gtggtaatat?cacccggagg 7560

tagcatattg?gctacaattg?aactccctgg?ttcacctaca?catgtattga?tccgtgaaga 7620

cttctcaaat?gatgggctca?ctgaccttat?tctcgtcacc?tcatccggag?tgtacggctt 7680

tgtccagact?cgacaacctg?gtgctctctt?cttcagtgtg?ctgatcggct?gtctcatagt 7740

cgtgatggga?attatatttg?ttacccagca?cataaattcc?atgaagggga?agcctcgtcc 7800

atcatctggt?cctaggtgaa?atgcaggacc?tgaaatttat?acattaactt?tgcaggcgct 7860

tacagatgaa?gcagaagaca?aagcggtgtg?cgcatcgtat?ggagcttcaa?gattgttgga 7920

aatgcataga?atgtaaggag?attttgagga?ggtgttgtac?tgtctaggat?ggatgattgt 7980

aaaatttaga?cagaagtgac?agaatgtcct?tcatgagaga?aacatgatcc?attaatataa 8040

ggaaactata?gtctttgcct?acgtatctgg?ctgttgttta?gaagttatac?tgcccacact 8100

tgacaattgt?cacccgttcc?gaattagttg?atacttgata?gttgatgcat?aacagaaact 8160

caccttggtc?tttacacttt?tcgctaaaag?gattttctct?tgtcattaca?caattcttgt 8220

aaatacgacc?atcgtttatt?tgcttcagat?ttagcagtgt?aaaacattaa?atctagcaac 8280

caacttgctc?caatctgtct?tggtcttctt?cagaatacac?ttcttaaaag?tcaattaaga 8340

aatgacttcc?tgattccatc?aaattaccaa?tgtggttgat?cccatcatac?atcaagtgct 8400

atgtacgtaa?tccctgttag?tctttggcat?caccttaagt?gttttagcta?ttgcttttcc 8460

tgtgcgtcga?gaaatgtttc?aaataaccat?ctgaatgatt?caatattgca?tcatataata 8520

ttgcaaaccc?aaaattagtg?tgttcctata?atggataaag?cttgaaaata?atgcgagtgg 8580

tcgattagtg?cgattggtgc?aatgttggat?tcattaacaa?ctggtattga?aaatattgca 8640

taaagctatc?aacttctcca?tataccatgc?tacattgtct?tttgcctgat?gatgattttt 8700

gacatccaac?cgtgtaaata?caatattagt 8730

<210>73

<211>57

<212>PRT

<213> alfalfa

<400>73

Ile?Gln?Gln?Asp?Gly?Gly?Val?Ser?Phe?Lys?Asp?Ala?Trp?Met?His?Leu

1 5 10 15

Thr?Asp?Glu?Tyr?Pro?Ile?Lys?Tyr?Glu?Ala?Glu?Arg?Leu?Pro?Pro?Pro

20 25 30

Val?Val?Ala?Asp?Leu?Asn?Gly?Asp?Gly?Lys?Lys?Glu?Val?Leu?Val?Ala

35 40 45

Thr?His?Asp?Ala?Lys?Ile?Gln?Val?Leu

50 55

<210>74

<211>25

<212>PRT

<213> alfalfa

<400>74

Leu?Ser?Gln?Leu?His?Leu?Gln?Glu?Gly?Gly?Leu?His?Ala?Asp?Ile?Asn

1 5 10 15

Gly?Asp?Gly?Val?Leu?Asp?His?Val?Gln

20 25

<210>75

<211>107

<212>PRT

<213> alfalfa

<400>75

Gln?Ala?Val?Gly?Gly?Asn?Gly?Ala?Glu?Gln?Thr?Val?Val?Ser?Gly?Ser

1 5 10 15

Met?Asp?Val?Leu?Arg?Pro?Cys?Trp?Ala?Val?Ala?Thr?Ser?Gly?Val?Pro

20 25 30

Val?Arg?Glu?Gln?Leu?Phe?Asn?Val?Ser?Ile?Cys?His?Tyr?Thr?His?Phe

35 40 45

Asn?Leu?Phe?Gln?His?Gly?Glu?Leu?Tyr?Arg?Gly?Phe?Asn?Arg?Gly?Ser

50 55 60

Asp?Met?Ser?Ser?Leu?Glu?Val?Ala?Thr?Pro?Ile?Leu?Ile?Pro?Arg?Ser

65 70 75 80

Asp?Gly?His?Lys?His?Arg?Lys?Gly?Ser?His?Gly?Asp?Val?Ile?Phe?Leu

85 90 95

Thr?Asn?Arg?Gly?Glu?Val?Arg?Ser?Phe?Leu?Phe

100 105

<210>76

<211>156

<212>PRT

<213> alfalfa

<400>76

Gln?Ile?Thr?Ser?His?Thr?Pro?Gly?Leu?His?Gly?His?Asp?Ala?Val?Trp

1 5 10 15

Gln?Trp?Gln?Gln?Ser?Thr?Gly?Val?Thr?Trp?Ser?Asn?Leu?Pro?Ser?Pro

20 25 30

Ala?Gly?Met?Met?Glu?Gly?Gly?Leu?Val?Ile?Pro?Thr?Leu?Lys?Pro?Phe

35 40 45

Pro?Leu?Arg?Leu?His?Asp?Asn?His?Glu?Met?Ile?Leu?Ala?Ala?Gly?Glu

50 55 60

Gln?Glu?Ala?Val?Val?Ile?Ser?Pro?Gly?Gly?Ser?Ile?Leu?Ala?Thr?Ile

65 70 75 80

Glu?Leu?Pro?Gly?Ser?Pro?Thr?His?Val?Leu?Ile?Arg?Glu?Asp?Phe?Ser

85 90 95

Asn?Asp?Gly?Leu?Thr?Asp?Leu?Ile?Leu?Val?Thr?Ser?Ser?Gly?Val?Tyr

100 105 110

Gly?Phe?Val?Gln?Thr?Arg?Gln?Pro?Gly?Ala?Leu?Phe?Phe?Ser?Val?Leu

115 120 125

Ile?Gly?Cys?Leu?Ile?Val?Val?Met?Gly?Ile?Ile?Phe?Val?Thr?Gln?His

130 135 140

Ile?Asn?Ser?Met?Lys?Gly?Lys?Pro?Arg?Pro?Ser?Ser

145 150 155

<210>77

<211>1521

<212>DNA

<213> rice

<400>77

atggccgcca?tgatggcgtc?cataaccagc?gagctgctct?tctttctccc?cttcatcctc 60

cttgccctgc?tcacgttcta?caccaccacc?gtggccaaat?gccacggcgg?gcactggtgg 120

cgaggtggga?cgacgccggc?gaagaggaag?cggatgaacc?tgccgcccgg?cgccgccggg 180

tggccgctcg?tcggcgagac?gttcggctac?ctccgcgccc?accccgccac?ctccgtcggc 240

cgcttcatgg?agcagcacat?cgcacggtac?gggaagatat?accggtcgag?cctgttcggg 300

gagcggacgg?tggtgtcggc?ggacgcgggg?ctcaaccggt?acatcctgca?gaacgagggg 360

aggctgttcg?agtgcagcta?cccgcgcagc?atcggcggca?tcctgggcaa?gtggtccatg 420

ctggtcctcg?tcggggaccc?gcaccgcgag?atgcgcgcca?tctccctcaa?cttcctctcc 480

tccgtccgcc?tccgcgccgt?cctcctcccc?gaggtcgagc?gccacaccct?cctcgtcctc 540

cgcgcctggc?ccccttcctc?caccttctcc?gctcagcacc?aagccaagaa?gttcacgttc 600

aacctgatgg?cgaagaacat?aatgagcatg?gacccggggg?aggaagagac?ggagcggctg 660

cggcgggagt?acatcacctt?catgaagggc?gtggtctccg?cgccgctcaa?cctgcccggg 720

acgccctact?ggaaggctct?caagtcgcgt?gctgccattc?tcggagtaat?agagaggaaa 780

atggaagagc?gggttgagaa?gctgagcaag?gaggatgcaa?gcgtagagca?agacgatctt 840

ctcggatggg?ctctgaaaca?atctaacctt?tcaaaagagc?aaatcctgga?cctcttgctg 900

agcttgctct?tcgccgggca?cgagacgtcg?tccatggcgc?tcgccctcgc?catcttcttc 960

cttgaaggct?gccccaaggc?tgtccaagaa?ctgagggagg?agcatcttgg?gattgcaagg 1020

agacaaaggc?taagagggga?gtgcaaattg?agctgggaag?actacaaaga?gatggttttc 1080

acgcaatgtg?tcataaacga?gacgttgcgg?ctaggaaacg?tggtcaggtt?cctgcaccgg 1140

aaggtcatca?aggacgtgca?ctacaagggt?tatgacattc?caagcggatg?gaagatcctg 1200

ccggtgttag?ccgcggtgca?tctggactcg?tccctgtacg?aggaccccca?gcgcttcaat 1260

ccctggagat?ggaagagtag?cggatcatcc?ggcggcttgg?ctcagagcag?cagcttcatg 1320

ccgtacggcg?gcgggacgcg?gctgtgcgcc?gggtcggagc?tcgcgaagct?ggagatggcc 1380

gtgttcttgc?accacctggt?gctcaacttc?aggtgggagc?tcgccgagcc?ggaccaagcc 1440

ttcgtcttcc?ccttcgtcga?cttccccaag?ggccttccca?ttagggttca?tagaattgca 1500

caggatgatg?agcaggagta?a 1521

<210>78

<211>505

<212>PRT

<213> rice

<400>78

Met?Ala?Ala?Met?Met?Ala?Ser?Ile?Thr?Ser?Glu?Leu?Leu?Phe?Phe?Leu

1 5 10 15

Pro?Phe?Ile?Leu?Leu?Ala?Leu?Leu?Thr?Phe?Tyr?Thr?Thr?Thr?Val?Ala

20 25 30

Lys?Cys?His?Gly?Gly?His?Trp?Trp?Arg?Gly?Gly?Thr?Thr?Pro?Ala?Lys

35 40 45

Arg?Lys?Arg?Met?Asn?Leu?Pro?Pro?Gly?Ala?Ala?Gly?Trp?Pro?Leu?Val

50 55 60

Gly?Glu?Thr?Phe?Gly?Tyr?Leu?Arg?Ala?His?Pro?Ala?Thr?Ser?Val?Gly

65 70 75 80

Arg?Phe?Met?Glu?Gln?His?Ile?Ala?Arg?Tyr?Gly?Lys?Ile?Tyr?Arg?Ser

85 90 95

Ser?Leu?Phe?Gly?Glu?Arg?Thr?Val?Val?Ser?Ala?Asp?Ala?Gly?Leu?Asn

100 105 110

Arg?Tyr?Ile?Leu?Gln?Asn?Glu?Gly?Arg?Leu?Phe?Glu?Cys?Ser?Tyr?Pro

115 120 125

Arg?Ser?Ile?Gly?Gly?Ile?Leu?Gly?Lys?Trp?Ser?Met?Leu?Val?Leu?Val

130 135 140

Gly?Asp?Pro?His?Arg?Glu?Met?Arg?Ala?Ile?Ser?Leu?Asn?Phe?Leu?Ser

145 150 155 160

Ser?Val?Arg?Leu?Arg?Ala?Val?Leu?Leu?Pro?Glu?Val?Glu?Arg?His?Thr

165 170 175

Leu?Leu?Val?Leu?Arg?Ala?Trp?Pro?Pro?Ser?Ser?Thr?Phe?Ser?Ala?Gln

180 185 190

His?Gln?Ala?Lys?Lys?Phe?Thr?Phe?Asn?Leu?Met?Ala?Lys?Asn?Ile?Met

195 200 205

Ser?Met?Asp?Pro?Gly?Glu?Glu?Glu?Thr?Glu?Arg?Leu?Arg?Arg?Glu?Tyr

210 215 220

Ile?Thr?Phe?Met?Lys?Gly?Val?Val?Ser?Ala?Pro?Leu?Asn?Leu?Pro?Gly

225 230 235 240

Thr?Pro?Tyr?Trp?Lys?Ala?Leu?Lys?Ser?Arg?Ala?Ala?Ile?Leu?Gly?Val

245 250 255

Ile?Glu?Arg?Lys?Met?Glu?Glu?Arg?Val?Glu?Lys?Leu?Ser?Lys?Glu?Asp

260 265 270

Ala?Ser?Val?Glu?Gln?Asp?Asp?Leu?Leu?Gly?Trp?Ala?Leu?Lys?Gln?Ser

275 280 285

Asn?Leu?Ser?Lys?Glu?Gln?Ile?Leu?Asp?Leu?Leu?Leu?Ser?Leu?Leu?Phe

290 295 300

Ala?Gly?His?Glu?Thr?Ser?Ser?Met?Ala?Leu?Ala?Leu?Ala?Ile?Phe?Phe

305 310 315 320

Leu?Glu?Gly?Cys?Pro?Lys?Ala?Val?Gln?Glu?Leu?Arg?Glu?Glu?His?Leu

325 330 335

Gly?Ile?Ala?Arg?Arg?Gln?Arg?Leu?Arg?Gly?Glu?Cys?Lys?Leu?Ser?Trp

340 345 350

Glu?Asp?Tyr?Lys?Glu?Met?Val?Phe?Thr?Gln?Cys?Val?Ile?Asn?Glu?Thr

355 360 365

Leu?Arg?Leu?Gly?Asn?Val?Val?Arg?Phe?Leu?His?Arg?Lys?Val?Ile?Lys

370 375 380

Asp?Val?His?Tyr?Lys?Gly?Tyr?Asp?Ile?Pro?Ser?Gly?Trp?Lys?Ile?Leu

385 390 395 400

Pro?Val?Leu?Ala?Ala?Val?His?Leu?Asp?Ser?Ser?Leu?Tyr?Glu?Asp?Pro

405 410 415

Gln?Arg?Phe?Asn?Pro?Trp?Arg?Trp?Lys?Ser?Ser?Gly?Ser?Ser?Gly?Gly

420 425 430

Leu?Ala?Gln?Ser?Ser?Ser?Phe?Met?Pro?Tyr?Gly?Gly?Gly?Thr?Arg?Leu

435 440 445

Cys?Ala?Gly?Ser?Glu?Leu?Ala?Lys?Leu?Glu?Met?Ala?Val?Phe?Leu?His

450 455 460

His?Leu?Val?Leu?Asn?Phe?Arg?Trp?Glu?Leu?Ala?Glu?Pro?Asp?Gln?Ala

465 470 475 480

Phe?Val?Phe?Pro?Phe?Val?Asp?Phe?Pro?Lys?Gly?Leu?Pro?Ile?Arg?Val

485 490 495

His?Arg?Ile?Ala?Gln?Asp?Asp?Glu?Gln

500 505

<210>79

<211>1542

<212>DNA

<213> Arabidopis thaliana

<400>79

atgttcgaaa?cagagcatca?tactctctta?cctcttcttc?ttctcccatc?gcttttgtct 60

cttcttctct?tcttgattct?cttgaagaga?agaaatagaa?aaaccagatt?caatctacct 120

ccgggtaaat?ccggttggcc?atttcttggt?gaaaccatcg?gttatcttaa?accgtacacc 180

gccacaacac?tcggtgactt?catgcaacaa?catgtctcca?agtatggtaa?gatatataga 240

tcgaacttgt?ttggagaacc?aacgatcgta?tcagctgatg?ctggacttaa?tagattcata 300

ttacaaaacg?aaggaaggct?ctttgaatgt?agttatccta?gaagtatagg?tgggattctt 360

gggaaatggt?cgatgcttgt?tcttgttggt?gacatgcata?gagatatgag?aagtatctcg 420

cttaacttct?taagtcacgc?acgtcttaga?actattctac?ttaaagatgt?tgagagacat 480

actttgtttg?ttcttgattc?ttggcaacaa?aactctattt?tctctgctca?agacgaggcc 540

aaaaagttta?cgtttaatct?aatggcgaag?catataatga?gtatggatcc?tggagaagaa 600

gaaacagagc?aattaaagaa?agagtatgta?actttcatga?aaggagttgt?ctctgctcct 660

ctaaatctac?caggaactgc?ttatcataaa?gctcttcagt?cacgagcaac?gatattgaag 720

ttcattgaga?ggaaaatgga?agagagaaaa?ttggatatca?aggaagaaga?tcaagaagaa 780

gaagaagtga?aaacagagga?tgaagcagag?atgagtaaga?gtgatcatgt?taggaaacaa 840

agaacagacg?atgatctttt?gggatgggtt?ttgaaacatt?cgaatttatc?gacggagcaa 900

attctcgatc?tcattcttag?tttgttattt?gccggacatg?agacttcttc?tgtagccatt 960

gctctcgcta?tcttcttctt?gcaagcttgc?cctaaagccg?ttgaagagct?tagggaagag 1020

catcttgaga?tcgcgagggc?caagaaggaa?ctaggagagt?cagaattaaa?ttgggatgat 1080

tacaagaaaa?tggactttac?tcaatgtgtt?ataaatgaaa?ctcttcgatt?gggaaatgta 1140

gttaggtttt?tgcatcgcaa?agcactcaaa?gatgttcggt?acaaaggata?cgatatccct 1200

agtgggtgga?aagtgttacc?ggtgatctca?gccgtacatt?tggataattc?tcgttatgac 1260

caacctaatc?tctttaatcc?ttggagatgg?caacagcaaa?acaacggagc?gtcatcgtca 1320

ggaagtggta?gtttttcgac?gtggggaaac?aactacatgc?cgtttggagg?agggccaagg 1380

ctatgtgctg?gttcagagct?agccaagtta?gaaatggcag?tgtttattca?tcatctagtt 1440

cttaaattca?attgggaatt?agcagaagat?gatcaaccat?ttgcttttcc?ttttgttgat 1500

tttcctaacg?gtttgcctat?tagggtttct?cgtattctgt?aa 1542

<210>80

<211>513

<212>PRT

<213> Arabidopis thaliana

<400>80

Met?Phe?Glu?Thr?Glu?His?His?Thr?Leu?Leu?Pro?Leu?Leu?Leu?Leu?Pro

1 5 10 15

Ser?Leu?Leu?Ser?Leu?Leu?Leu?Phe?Leu?Ile?Leu?Leu?Lys?Arg?Arg?Asn

20 25 30

Arg?Lys?Thr?Arg?Phe?Asn?Leu?Pro?Pro?Gly?Lys?Ser?Gly?Trp?Pro?Phe

35 40 45

Leu?Gly?Glu?Thr?Ile?Gly?Tyr?Leu?Lys?Pro?Tyr?Thr?Ala?Thr?Thr?Leu

50 55 60

Gly?Asp?Phe?Met?Gln?Gln?His?Val?Ser?Lys?Tyr?Gly?Lys?Ile?Tyr?Arg

65 70 75 80

Ser?Asn?Leu?Phe?Gly?Glu?Pro?Thr?Ile?Val?Ser?Ala?Asp?Ala?Gly?Leu

85 90 95

Asn?Arg?Phe?Ile?Leu?Gln?Asn?Glu?Gly?Arg?Leu?Phe?Glu?Cys?Ser?Tyr

100 105 110

Pro?Arg?Ser?Ile?Gly?Gly?Ile?Leu?Gly?Lys?Trp?Ser?Met?Leu?Val?Leu

115 120 125

Val?Gly?Asp?Met?His?Arg?Asp?Met?Arg?Ser?Ile?Ser?Leu?Asn?Phe?Leu

130 135 140

Ser?His?Ala?Arg?Leu?Arg?Thr?Ile?Leu?Leu?Lys?Asp?Val?Glu?Arg?His

145 150 155 160

Thr?Leu?Phe?Val?Leu?Asp?Ser?Trp?Gln?Gln?Asn?Ser?Ile?Phe?Ser?Ala

165 170 175

Gln?Asp?Glu?Ala?Lys?Lys?Phe?Thr?Phe?Asn?Leu?Met?Ala?Lys?His?Ile

180 185 190

Met?Ser?Met?Asp?Pro?Gly?Glu?Glu?Glu?Thr?Glu?Gln?Leu?Lys?Lys?Glu

195 200 205

Tyr?Val?Thr?Phe?Met?Lys?Gly?Val?Val?Ser?Ala?Pro?Leu?Asn?Leu?Pro

210 215 220

Gly?Thr?Ala?Tyr?His?Lys?Ala?Leu?Gln?Ser?Arg?Ala?Thr?Ile?Leu?Lys

225 230 235 240

Phe?Ile?Glu?Arg?Lys?Met?Glu?Glu?Arg?Lys?Leu?Asp?Ile?Lys?Glu?Glu

245 250 255

Asp?Gln?Glu?Glu?Glu?Glu?Val?Lys?Thr?Glu?Asp?Glu?Ala?Glu?Met?Ser

260 265 270

Lys?Ser?Asp?His?Val?Arg?Lys?Gln?Arg?Thr?Asp?Asp?Asp?Leu?Leu?Gly

275 280 285

Trp?Val?Leu?Lys?His?Ser?Asn?Leu?Ser?Thr?Glu?Gln?Ile?Leu?Asp?Leu

290 295 300

Ile?Leu?Ser?Leu?Leu?Phe?Ala?Gly?His?Glu?Thr?Ser?Ser?Val?Ala?Ile

305 310 315 320

Ala?Leu?Ala?Ile?Phe?Phe?Leu?Gln?Ala?Cys?Pro?Lys?Ala?Val?Glu?Glu

325 330 335

Leu?Arg?Glu?Glu?His?Leu?Glu?Ile?Ala?Arg?Ala?Lys?Lys?Glu?Leu?Gly

340 345 350

Glu?Ser?Glu?Leu?Asn?Trp?Asp?Asp?Tyr?Lys?Lys?Met?Asp?Phe?Thr?Gln

355 360 365

Cys?Val?Ile?Asn?Glu?Thr?Leu?Arg?Leu?Gly?Asn?Val?Val?Arg?Phe?Leu

370 375 380

His?Arg?Lys?Ala?Leu?Lys?Asp?Val?Arg?Tyr?Lys?Gly?Tyr?Asp?Ile?Pro

385 390 395 400

Ser?Gly?Trp?Lys?Val?Leu?Pro?Val?Ile?Ser?Ala?Val?His?Leu?Asp?Asn

405 410 415

Ser?Arg?Tyr?Asp?Gln?Pro?Asn?Leu?Phe?Asn?Pro?Trp?Arg?Trp?Gln?Gln

420 425 430

Gln?Asn?Asn?Gly?Ala?Ser?Ser?Ser?Gly?Ser?Gly?Ser?Phe?Ser?Thr?Trp

435 440 445

Gly?Asn?Asn?Tyr?Met?Pro?Phe?Gly?Gly?Gly?Pro?Arg?Leu?Cys?Ala?Gly

450 455 460

Ser?Glu?Leu?Ala?Lys?Leu?Glu?Met?Ala?Val?Phe?Ile?His?His?Leu?Val

465 470 475 480

Leu?Lys?Phe?Asn?Trp?Glu?Leu?Ala?Glu?Asp?Asp?Gln?Pro?Phe?Ala?Phe

485 490 495

Pro?Phe?Val?Asp?Phe?Pro?Asn?Gly?Leu?Pro?Ile?Arg?Val?Ser?Arg?Ile

500 505 510

Leu

<210>81

<211>1590

<212>DNA

<213> sugarcane

<220>

<221>misc_feature

<222>(394)..(394)

<223>n is a, c, g, or t

<400>81

atgggcgcca?tgatggcctc?cataaccagc?gagctcctct?tcttccttcc?cttcatcctg 60

ctggccctcc?tcgccctgta?caccaccact?gtcgccaaat?gcgacggcac?ccaccagtgg 120

cgccggccga?agaagaagcg?gccgaacctg?cccccgggcg?ccctcggatg?gcctttcgtc 180

ggcgagacct?tcggctacct?ccgcgcccac?ccggccacct?ccgtgggcct?cttcatggag 240

cagcatgtcg?cacggtacgg?caagatatac?cggtcgagcc?tgttcgggga?gcggacggtg 300

gtgtcggcgg?acgcggggct?caaccgctac?atcctgcaga?acgaggggcg?gctgttcgag 360

tgcagctacc?cgcgcagcat?cggcggcatc?ctgngcaagt?ggtccatgct?ggtgctggtg 420

ggcgacgcgc?accgcgagat?gcgcgccatc?tcgctcaact?ttctcagctc?cgtccgcctc 480

cgcgccgtgc?tgctcccgga?ggtggagcgc?cacaccctgc?tggtgctccg?ctcatggccg 540

ccctccgacg?gcacggtctc?cgcgcagcac?caagccaaga?agttcacgtt?taacctgatg 600

gcgaagaaca?taatgagcat?ggaccccggc?gaggaggaga?cggagcggct?gcggctggag 660

tacatcacct?tcatgaaggg?cgtcgtgtca?gcgccgctca?acttcccggg?cacggcctac 720

tggaaggcgc?tcaagtcacg?cgcgtccata?cttggagtaa?tagagaggaa?gatggaggac 780

aggcttcaga?aaatgagtaa?ggagaactca?agtgtggagg?aagacgatct?tcttggatgg 840

gccctgaagc?agtccaatct?gtcaaaggaa?cagatcctgg?acctcttgct?gagcctgctc 900

ttcgccgggc?acgagacttc?gtcaatggcg?ctagccctcg?ccatcttctt?ccttgaagga 960

tgccccaagg?ctgttcaaga?actccgggag?gagcatctcg?agattgctag?gagacaaagg 1020

ctaagagggg?cgttcaaatt?gagctgggaa?gactacaagg?aaatggtttt?cacgccatgg 1080

tgtataaacg?agacattgcg?ggttggcaac?gtggtcaggt?tcctgcaccg?gaaggtcatc 1140

caagatgtgc?actacaatgg?gtacgacata?ccacgcgggt?ggaaaatcct?gccggtgtta 1200

gcggcggtgc?atctggattc?gtcgctgtac?aaggacccct?accggttcaa?cccttggaga 1260

tggaagagca?acgcgccgag?cagcttcatg?ccgtacggcg?gcgggccgcg?gctgtgcgcc 1320

gggtcggagc?tggccaagct?ggagatcgcc?atcttcctgc?accacctggt?gctcaacttc 1380

cggtgggagc?tggcggagcc?ggaccaagcc?ttcgtctacc?ccttcgtcga?cttccccaag 1440

ggcctcccga?tcagggtcca?gcggatcgcc?gacgaccagg?gggcatcgca?gcgttttgac 1500

cgagaagcac?gatgtagcgg?tacgggtaca?caagcaagta?caaaattttc?gttgcatttt 1560

gagggaattg?gggctgggtg?gttatggtaa 1590

<210>82

<211>529

<212>PRT

<213> sugarcane

<220>

<221> is uncertain

<222>(132)..(132)

<223>Xaa can be any natural amino acid

<400>82

Met?Gly?Ala?Met?Met?Ala?Ser?Ile?Thr?Ser?Glu?Leu?Leu?Phe?Phe?Leu

1 5 10 15

Pro?Phe?Ile?Leu?Leu?Ala?Leu?Leu?Ala?Leu?Tyr?Thr?Thr?Thr?Val?Ala

20 25 30

Lys?Cys?Asp?Gly?Thr?His?Gln?Trp?Arg?Arg?Pro?Lys?Lys?Lys?Arg?Pro

35 40 45

Asn?Leu?Pro?Pro?Gly?Ala?Leu?Gly?Trp?Pro?Phe?Val?Gly?Glu?Thr?Phe

50 55 60

Gly?Tyr?Leu?Arg?Ala?His?Pro?Ala?Thr?Ser?Val?Gly?Leu?Phe?Met?Glu

65 70 75 80

Gln?His?Val?Ala?Arg?Tyr?Gly?Lys?Ile?Tyr?Arg?Ser?Ser?Leu?Phe?Gly

85 90 95

Glu?Arg?Thr?Val?Val?Ser?Ala?Asp?Ala?Gly?Leu?Asn?Arg?Tyr?Ile?Leu

100 105 110

Gln?Asn?Glu?Gly?Arg?Leu?Phe?Glu?Cys?Ser?Tyr?Pro?Arg?Ser?Ile?Gly

115 120 125

Gly?Ile?Leu?Xaa?Lys?Trp?Ser?Met?Leu?Val?Leu?Val?Gly?Asp?Ala?His

130 135 140

Arg?Glu?Met?Arg?Ala?Ile?Ser?Leu?Asn?Phe?Leu?Ser?Ser?Val?Arg?Leu

145 150 155 160

Arg?Ala?Val?Leu?Leu?Pro?Glu?Val?Glu?Arg?His?Thr?Leu?Leu?Val?Leu

165 170 175

Arg?Ser?Trp?Pro?Pro?Ser?Asp?Gly?Thr?Val?Ser?Ala?Gln?His?Gln?Ala

180 185 190

Lys?Lys?Phe?Thr?Phe?Asn?Leu?Met?Ala?Lys?Asn?Ile?Met?Ser?Met?Asp

195 200 205

Pro?Gly?Glu?Glu?Glu?Thr?Glu?Arg?Leu?Arg?Leu?Glu?Tyr?Ile?Thr?Phe

210 215 220

Met?Lys?Gly?Val?Val?Ser?Ala?Pro?Leu?Asn?Phe?Pro?Gly?Thr?Ala?Tyr

225 230 235 240

Trp?Lys?Ala?Leu?Lys?Ser?Arg?Ala?Ser?Ile?Leu?Gly?Val?Ile?Glu?Arg

245 250 255

Lys?Met?Glu?Asp?Arg?Leu?Gln?Lys?Met?Ser?Lys?Glu?Asn?Ser?Ser?Val

260 265 270

Glu?Glu?Asp?Asp?Leu?Leu?Gly?Trp?Ala?Leu?Lys?Gln?Ser?Asn?Leu?Ser

275 280 285

Lys?Glu?Gln?Ile?Leu?Asp?Leu?Leu?Leu?Ser?Leu?Leu?Phe?Ala?Gly?His

290 295 300

Glu?Thr?Ser?Ser?Met?Ala?Leu?Ala?Leu?Ala?Ile?Phe?Phe?Leu?Glu?Gly

305 310 315 320

Cys?Pro?Lys?Ala?Val?Gln?Glu?Leu?Arg?Glu?Glu?His?Leu?Glu?Ile?Ala

325 330 335

Arg?Arg?Gln?Arg?Leu?Arg?Gly?Ala?Phe?Lys?Leu?Ser?Trp?Glu?Asp?Tyr

340 345 350

Lys?Glu?Met?Val?Phe?Thr?Pro?Trp?Cys?Ile?Asn?Glu?Thr?Leu?Arg?Val

355 360 365

Gly?Asn?Val?Val?Arg?Phe?Leu?His?Arg?Lys?Val?Ile?Gln?Asp?Val?His

370 375 380

Tyr?Asn?Gly?Tyr?Asp?Ile?Pro?Arg?Gly?Trp?Lys?Ile?Leu?Pro?Val?Leu

385 390 395 400

Ala?Ala?Val?His?Leu?Asp?Ser?Ser?Leu?Tyr?Lys?Asp?Pro?Tyr?Arg?Phe

405 410 415

Asn?Pro?Trp?Arg?Trp?Lys?Ser?Asn?Ala?Pro?Ser?Ser?Phe?Met?Pro?Tyr

420 425 430

Gly?Gly?Gly?Pro?Arg?Leu?Cys?Ala?Gly?Ser?Glu?Leu?Ala?Lys?Leu?Glu

435 440 445

Ile?Ala?Ile?Phe?Leu?His?His?Leu?Val?Leu?Asn?Phe?Arg?Trp?Glu?Leu

450 455 460

Ala?Glu?Pro?Asp?Gln?Ala?Phe?Val?Tyr?Pro?Phe?Val?Asp?Phe?Pro?Lys

465 470 475 480

Gly?Leu?Pro?Ile?Arg?Val?Gln?Arg?Ile?Ala?Asp?Asp?Gln?Gly?Ala?Ser

485 490 495

Gln?Arg?Phe?Asp?Arg?Glu?Ala?Arg?Cys?Ser?Gly?Thr?Gly?Thr?Gln?Ala

500 505 510

Ser?Thr?Lys?Phe?Ser?Leu?His?Phe?Glu?Gly?Ile?Gly?Ala?Gly?Trp?Leu

515 520 525

Trp

<210>83

<211>1437

<212>DNA

<213> onion (Allium cepa)

<400>83

atggagatca?tattagtgtc?tacattgatc?atatcgctac?taatatttct?tggatttaga 60

agcaatggga?aaacggagag?aaaattgctg?cctacactac?caccaggcaa?tcttggaggt 120

tggccattca?tcggtgacac?cattccgttc?atgacacctc?attcttctgc?tttgttgggc 180

acttacatcg?atcaaaatat?ttccaaatat?gggaggatat?ttcgaatgaa?cttgttagga 240

aaggcaacga?tcgtgtctgt?agaccctgat?ttcaacagat?atattctaca?gaatgaagga 300

agattgtttg?aaaatagctg?cccaacgagc?attaaagaga?ttttgggaaa?atggtctatg 360

cttgcattag?ctggggatat?acacagagaa?atgagatcca?ttgctgtgaa?tttcatgaac 420

agtgttaagc?ttagaactta?ttttttaaag?gatattgata?ttcaggctgt?taatattctt 480

gatgcttgga?aggtcaactc?tactttctct?gcacaggatg?aaggaaagaa?gtttgcattt 540

aacctcatgg?tgaagcatct?aatgaatatg?gatcctggaa?tgccagagac?agaagaaatc 600

agaaaagagt?acattttctt?catggagggg?atggcttcca?ttcctttaaa?ctttcctgga 660

acagcctaca?gaagagcttt?acagtcaagg?tccaggattc?tggcaataat?ggggcaaaag 720

cttgacgaaa?ggatgcagaa?aataaaagaa?ggctgtaaag?gactggaaga?agaggatctt 780

cttgcctcag?ttgcaagaaa?tactaacata?acaagagacc?agattcttga?tttgatgatc 840

agcatgcttt?ttgctggtca?tgaaacttct?tctgccgcta?tttctcttgc?catttatttc 900

ctgcaagctt?cccccgatgt?tcttaaaaag?cttcgagagg?agcacataaa?gattgcaaaa 960

caaaagaaag?aaaggggcga?aactgaattg?aactgggatg?attacaagca?aatggaattc 1020

acaaactgcg?ttattcatga?aaccctaaga?ttaggcaaca?tcgttaagtt?tttgcatcgg 1080

aaaaccatca?aagatgttca?atacaaaggt?tatgaaattc?catgtgggtg?ggaagtagtg 1140

ccaatcatct?cagcagcaca?tttggattct?tctatctttg?acaacccaaa?agttatgaat 1200

ccttcgaggt?gggaggcgat?attttcagca?ggagcaaaga?gcaatataat?gtcattcagc 1260

ggtggacctc?ggttatgtcc?aggagcagag?ttggcgaaac?tggagatggc?tatttttctt 1320

catcatcttg?tacagaggtt?cgactgggaa?ttggtggaga?aggataaccc?tgtatcattc 1380

cccttccttg?gatttcccaa?gaaattgcct?atcaaaatca?cagctcttaa?acattga 1437

<210>84

<211>478

<212>PRT

<213> onion

<400>84

Met?Glu?Ile?Ile?Leu?Val?Ser?Thr?Leu?Ile?Ile?Ser?Leu?Leu?Ile?Phe

1 5 10 15

Leu?Gly?Phe?Arg?Ser?Asn?Gly?Lys?Thr?Glu?Arg?Lys?Leu?Leu?Pro?Thr

20 25 30

Leu?Pro?Pro?Gly?Asn?Leu?Gly?Gly?Trp?Pro?Phe?Ile?Gly?Asp?Thr?Ile

35 40 45

Pro?Phe?Met?Thr?Pro?His?Ser?Ser?Ala?Leu?Leu?Gly?Thr?Tyr?Ile?Asp

50 55 60

Gln?Asn?Ile?Ser?Lys?Tyr?Gly?Arg?Ile?Phe?Arg?Met?Asn?Leu?Leu?Gly

65 70 75 80

Lys?Ala?Thr?Ile?Val?Ser?Val?Asp?Pro?Asp?Phe?Asn?Arg?Tyr?Ile?Leu

85 90 95

Gln?Asn?Glu?Gly?Arg?Leu?Phe?Glu?Asn?Ser?Cys?Pro?Thr?Ser?Ile?Lys

100 105 110

Glu?Ile?Leu?Gly?Lys?Trp?Ser?Met?Leu?Ala?Leu?Ala?Gly?Asp?Ile?His

115 120 125

Arg?Glu?Met?Arg?Ser?Ile?Ala?Val?Asn?Phe?Met?Asn?Ser?Val?Lys?Leu

130 135 140

Arg?Thr?Tyr?Phe?Leu?Lys?Asp?Ile?Asp?Ile?Gln?Ala?Val?Asn?Ile?Leu

145 150 155 160

Asp?Ala?Trp?Lys?Val?Asn?Ser?Thr?Phe?Ser?Ala?Gln?Asp?Glu?Gly?Lys

165 170 175

Lys?Phe?Ala?Phe?Asn?Leu?Met?Val?Lys?His?Leu?Met?Asn?Met?Asp?Pro

180 185 190

Gly?Met?Pro?Glu?Thr?Glu?Glu?Ile?Arg?Lys?Glu?Tyr?Ile?Phe?Phe?Met

195 200 205

Glu?Gly?Met?Ala?Ser?Ile?Pro?Leu?Asn?Phe?Pro?Gly?Thr?Ala?Tyr?Arg

210 215 220

Arg?Ala?Leu?Gln?Ser?Arg?Ser?Arg?Ile?Leu?Ala?Ile?Met?Gly?Gln?Lys

225 230 235 240

Leu?Asp?Glu?Arg?Met?Gln?Lys?Ile?Lys?Glu?Gly?Cys?Lys?Gly?Leu?Glu

245 250 255

Glu?Glu?Asp?Leu?Leu?Ala?Ser?Val?Ala?Arg?Asn?Thr?Asn?Ile?Thr?Arg

260 265 270

Asp?Gln?Ile?Leu?Asp?Leu?Met?Ile?Ser?Met?Leu?Phe?Ala?Gly?His?Glu

275 280 285

Thr?Ser?Ser?Ala?Ala?Ile?Ser?Leu?Ala?Ile?Tyr?Phe?Leu?Gln?Ala?Ser

290 295 300

Pro?Asp?Val?Leu?Lys?Lys?Leu?Arg?Glu?Glu?His?Ile?Lys?Ile?Ala?Lys

305 310 315 320

Gln?Lys?Lys?Glu?Arg?Gly?Glu?Thr?Glu?Leu?Asn?Trp?Asp?Asp?Tyr?Lys

325 330 335

Gln?Met?Glu?Phe?Thr?Asn?Cys?Val?Ile?His?Glu?Thr?Leu?Arg?Leu?Gly

340 345 350

Asn?Ile?Val?Lys?Phe?Leu?His?Arg?Lys?Thr?Ile?Lys?Asp?Val?Gln?Tyr

355 360 365

Lys?Gly?Tyr?Glu?Ile?Pro?Cys?Gly?Trp?Glu?Val?Val?Pro?Ile?Ile?Ser

370 375 380

Ala?Ala?His?Leu?Asp?Ser?Ser?Ile?Phe?Asp?Asn?Pro?Lys?Val?Met?Asn

385 390 395 400

Pro?Ser?Arg?Trp?Glu?Ala?Ile?Phe?Ser?Ala?Gly?Ala?Lys?Ser?Asn?Ile

405 410 415

Met?Ser?Phe?Ser?Gly?Gly?Pro?Arg?Leu?Cys?Pro?Gly?Ala?Glu?Leu?Ala

420 425 430

Lys?Leu?Glu?Met?Ala?Ile?Phe?Leu?His?His?Leu?Val?Gln?Arg?Phe?Asp

435 440 445

Trp?Glu?Leu?Val?Glu?Lys?Asp?Asn?Pro?Val?Ser?Phe?Pro?Phe?Leu?Gly

450 455 460

Phe?Pro?Lys?Lys?Leu?Pro?Ile?Lys?Ile?Thr?Ala?Leu?Lys?His

465 470 475

<210>85

<211>1491

<212>DNA

<213> youth-and-old-age (Zinnia elegans)

<400>85

atgtgttcaa?caaccctaaa?tatgtgtgac?cttgagttct?tcatccttgc?atcttgtctt 60

gtcttggctc?tttttctcat?cttgaagctt?gtcaaaagaa?gaacaaacaa?tggttcgact 120

cgaaatcttc?caccgggcaa?catgggctgg?ccgttcatcg?gtgaaaccat?cggttacctc 180

caaccgtatt?cggctacaac?catcggcaag?tttatggaac?aacacatatc?caagtatggg 240

aagatataca?aatctagttt?gtttggtgag?ccaacaatag?tttctgctga?tccagggttg 300

aataagtaca?tattgcaaaa?tgaagggagg?ttatttgaat?gtagttatcc?aagaagcata 360

gggggtattc?ttggcaaatg?gtccatgttg?gttttggttg?gtgacatgca?tagagacatg 420

aggcaaattt?cactcaactt?tttgtccaat?gcaaggctta?aaactcaact?agtaaatgaa 480

gttgagaaaa?atactttgtg?ggtattagat?tcttggaaag?aaaactcacc?tttttgtgcc 540

caagaagaag?ccaagaagtt?tacttttaat?ctaatggcaa?cacatatcat?gagtttagac 600

ccgggtgaac?cggagaccga?gcgattgaag?aaagagtatg?taactttcat?gaaaggtgtg 660

gtttctcccc?ctttaaactt?ccctggaact?gcatactgga?aagctttaaa?gtctcgagcg 720

acgattctta?aattcatcga?aacaaaaatg?gaggagcgga?ttaggatgga?cgaaggaaac 780

ggattaggga?aactagacaa?tgatcttctt?ggatggtcta?tgaagaactc?aaatctcact 840

aaagagcaaa?tactcgattt?ggtattgagt?ctactctttg?ctggtcacga?aacgtcttcg 900

gtttcgatat?cgttagccgt?ttacttcctt?gaagcttgtc?ctaccgcggt?tcgtcaactt 960

agagaagaac?atgaagaaat?tgtgatgaaa?aaaaagctat?tgggtgagaa?gtatctcact 1020

tgggatgact?acaaaaagat?ggagtttact?cagtgtgtga?tcaatgagac?gctaagattc 1080

gggaatgtgg?tgagattcct?ccacagaaag?gctattaaag?atgtgaggta?taaaggatat 1140

gacattccat?gtggttggaa?agtgctgcca?gtgattgcag?ccgtgcattt?ggatcctaca 1200

cattttgacc?aaccttacct?ttttgatcca?tggagatggc?agaacgcaag?tgtcacgtca 1260

tctacttgtt?caaccccgcc?atcagcaagt?aacttcatgc?catttggtgg?agggccccgc 1320

ttatgcacag?ggtcagagct?agcgaaacta?gagatggcga?tatttatcca?ccatttggtc 1380

ctaaaatacg?agtgggaatt?ggttgactca?gatgaagcat?tcgcttatcc?atatctcgac 1440

tttccaaaag?gtctgccaat?caaaatccgt?caccgaaaac?aatcatgtta?g 1491

<210>86

<211>496

<212>PRT

<213> youth-and-old-age

<400>86

Met?Cys?Ser?Thr?Thr?Leu?Asn?Met?Cys?Asp?Leu?Glu?Phe?Phe?Ile?Leu

1 5 10 15

Ala?Ser?Cys?Leu?Val?Leu?Ala?Leu?Phe?Leu?Ile?Leu?Lys?Leu?Val?Lys

20 25 30

Arg?Arg?Thr?Asn?Asn?Gly?Ser?Thr?Arg?Asn?Leu?Pro?Pro?Gly?Asn?Met

35 40 45

Gly?Trp?Pro?Phe?Ile?Gly?Glu?Thr?Ile?Gly?Tyr?Leu?Gln?Pro?Tyr?Ser

50 55 60

Ala?Thr?Thr?Ile?Gly?Lys?Phe?Met?Glu?Gln?His?Ile?Ser?Lys?Tyr?Gly

65 70 75 80

Lys?Ile?Tyr?Lys?Ser?Ser?Leu?Phe?Gly?Glu?Pro?Thr?Ile?Val?Ser?Ala

85 90 95

Asp?Pro?Gly?Leu?Asn?Lys?Tyr?Ile?Leu?Gln?Asn?Glu?Gly?Arg?Leu?Phe

100 105 110

Glu?Cys?Ser?Tyr?Pro?Arg?Ser?Ile?Gly?Gly?Ile?Leu?Gly?Lys?Trp?Ser

115 120 125

Met?Leu?Val?Leu?Val?Gly?Asp?Met?His?Arg?Asp?Met?Arg?Gln?Ile?Ser

130 135 140

Leu?Asn?Phe?Leu?Ser?Asn?Ala?Arg?Leu?Lys?Thr?Gln?Leu?Val?Asn?Glu

145 150 155 160

Val?Glu?Lys?Asn?Thr?Leu?Trp?Val?Leu?Asp?Ser?Trp?Lys?Glu?Asn?Ser

165 170 175

Pro?Phe?Cys?Ala?Gln?Glu?Glu?Ala?Lys?Lys?Phe?Thr?Phe?Asn?Leu?Met

180 185 190

Ala?Thr?His?Ile?Met?Ser?Leu?Asp?Pro?Gly?Glu?Pro?Glu?Thr?Glu?Arg

195 200 205

Leu?Lys?Lys?Glu?Tyr?Val?Thr?Phe?Met?Lys?Gly?Val?Val?Ser?Pro?Pro

210 215 220

Leu?Asn?Phe?Pro?Gly?Thr?Ala?Tyr?Trp?Lys?Ala?Leu?Lys?Ser?Arg?Ala

225 230 235 240

Thr?Ile?Leu?Lys?Phe?Ile?Glu?Thr?Lys?Met?Glu?Glu?Arg?Ile?Arg?Met

245 250 255

Asp?Glu?Gly?Asn?Gly?Leu?Gly?Lys?Leu?Asp?Asn?Asp?Leu?Leu?Gly?Trp

260 265 270

Ser?Met?Lys?Asn?Ser?Asn?Leu?Thr?Lys?Glu?Gln?Ile?Leu?Asp?Leu?Val

275 280 285

Leu?Ser?Leu?Leu?Phe?Ala?Gly?His?Glu?Thr?Ser?Ser?Val?Ser?Ile?Ser

290 295 300

Leu?Ala?Val?Tyr?Phe?Leu?Glu?Ala?Cys?Pro?Thr?Ala?Val?Arg?Gln?Leu

305 310 315 320

Arg?Glu?Glu?His?Glu?Glu?Ile?Val?Met?Lys?Lys?Lys?Leu?Leu?Gly?Glu

325 330 335

Lys?Tyr?Leu?Thr?Trp?Asp?Asp?Tyr?Lys?Lys?Met?Glu?Phe?Thr?Gln?Cys

340 345 350

Val?Ile?Asn?Glu?Thr?Leu?Arg?Phe?Gly?Asn?Val?Val?Arg?Phe?Leu?His

355 360 365

Arg?Lys?Ala?Ile?Lys?Asp?Val?Arg?Tyr?Lys?Gly?Tyr?Asp?Ile?Pro?Cys

370 375 380

Gly?Trp?Lys?Val?Leu?Pro?Val?Ile?Ala?Ala?Val?His?Leu?Asp?Pro?Thr

385 390 395 400

His?Phe?Asp?Gln?Pro?Tyr?Leu?Phe?Asp?Pro?Trp?Arg?Trp?Gln?Asn?Ala

405 410 415

Ser?Val?Thr?Ser?Ser?Thr?Cys?Ser?Thr?Pro?Pro?Ser?Ala?Ser?Asn?Phe

420 425 430

Met?Pro?Phe?Gly?Gly?Gly?Pro?Arg?Leu?Cys?Thr?Gly?Ser?Glu?Leu?Ala

435 440 445

Lys?Leu?Glu?Met?Ala?Ile?Phe?Ile?His?His?Leu?Val?Leu?Lys?Tyr?Glu

450 455 460

Trp?Glu?Leu?Val?Asp?Ser?Asp?Glu?Ala?Phe?Ala?Tyr?Pro?Tyr?Leu?Asp

465 470 475 480

Phe?Pro?Lys?Gly?Leu?Pro?Ile?Lys?Ile?Arg?His?Arg?Lys?Gln?Ser?Cys

485 490 495

<210>87

<211>1422

<212>DNA

<213> puncture vine clover (Medicago trunculata)

<400>87

atgtctaact?catacttaac?ttgcagtttt?ctttcttcca?tctttgttct?ttctttgatt 60

ttcattttca?tcaaaagaaa?gaaaacaagg?tataatcttc?cacctggaaa?aatgggatgg 120

ccctttatag?gagaaaccat?tggttatttg?aagccttaca?ctgccaccac?aatgggagaa 180

tttatggaaa?atcacatagc?aaggtatggg?acaatttaca?agtcaaattt?gtttggaggg 240

ccagctattg?tatcagcaga?tgcagaattg?aataggttca?tattacaaaa?tgatggaaaa 300

ttgtttgagt?gtagctatcc?aaaaagcatt?ggtggaatac?ttggaaaatg?gtcaatgttg 360

gttttagtag?gtgacatgca?tagggaaatg?aggaatatat?cactaaactt?tatgagctat 420

gctaggctta?aaacacattt?tttgaaagat?atggagaagc?ataccctttt?tgttctaagc 480

tcttggaaag?aaaattgtac?attttcagct?caagatgaag?caaaaaagtt?caccttcaat 540

ttgatggcca?aacaaatcat?gagtttggat?ccagggaatc?ttgagacaga?acagttgaaa 600

aaagagtatg?tctgtttcat?gaaaggtgtt?gtttctgctc?ctttgaattt?gccaggaact 660

gcatacagaa?aagcattaaa?gtctaggaac?aatatattga?agttcataga?ggggaaaatg 720

gaagaaaggg?tgaagagaaa?ccaagaagga?aaaaaaggga?tggaggaaaa?tgatcttcta 780

aattgggttt?taaagcattc?aaatctttcc?actgagcaaa?ttcttgactt?gattctaagt 840

ttactttttg?ctggccatga?aacttcatct?gtggctatag?ctctagctat?ttactttttg 900

cctagttgtc?ctcaagctat?acaacaatta?agggaagagc?atagagaaat?agctagatcc 960

aagaagaaag?caggggaggt?tgaattaact?tgggatgatt?ataaaagaat?ggaatttact 1020

cattgtgttg?tgaatgaaac?actaaggttg?ggtaatgttg?tgagattcct?tcacaggaag 1080

gctatcaaag?atgttcatta?caaaggttat?gacattccat?gtggatggaa?agtccttccg 1140

gtgatttcag?cggtacattt?ggatccttca?aattttgacc?aacctcaaca?cttcaatcct 1200

tggagatggc?agatgagcaa?taacaacttc?atgccatttg?gaggaggacc?aaggctatgt 1260

gcaggattag?aattagccaa?acttgaaatg?gctgttttca?ttcaccatat?catcctcaaa 1320

tacaactggg?acatggtcga?tgttgatcaa?cctattgtat?acccttttgt?tgattttccc 1380

aaaggtttgc?caattagagt?ccaaagccaa?gccactcttt?aa 1422

<210>88

<211>480

<212>PRT

<213> puncture vine clover

<400>88

Met?Ser?Asn?Ser?Tyr?Leu?Thr?Cys?Ser?Phe?Leu?Ser?Ser?Ile?Phe?Val

1 5 10 15

Leu?Ser?Leu?Ile?Phe?Ile?Phe?Ile?Lys?Arg?Lys?Lys?Thr?Arg?Tyr?Asn

20 25 30

Leu?Pro?Pro?Gly?Lys?Met?Gly?Trp?Pro?Phe?Ile?Gly?Glu?Thr?Ile?Gly

35 40 45

Tyr?Leu?Lys?Pro?Tyr?Thr?Ala?Thr?Thr?Met?Gly?Glu?Phe?Met?Glu?Asn

50 55 60

His?Ile?Ala?Arg?Tyr?Gly?Thr?Ile?Tyr?Lys?Ser?Asn?Leu?Phe?Gly?Gly

65 70 75 80

Pro?Ala?Ile?Val?Ser?Ala?Asp?Ala?Glu?Leu?Asn?Arg?Phe?Ile?Leu?Gln

85 90 95

Asn?Asp?Gly?Lys?Leu?Phe?Glu?Cys?Ser?Tyr?Pro?Lys?Ser?Ile?Gly?Gly

100 105 110

Ile?Leu?Gly?Lys?Trp?Ser?Met?Leu?Val?Leu?Val?Gly?Asp?Met?His?Arg

115 120 125

Glu?Met?Arg?Asn?Ile?Ser?Leu?Asn?Phe?Met?Ser?Tyr?Ala?Arg?Leu?Lys

130 135 140

Thr?His?Phe?Leu?Lys?Asp?Met?Glu?Lys?His?Thr?Leu?Phe?Val?Leu?Ser

145 150 155 160

Ser?Trp?Lys?Glu?Asn?Cys?Thr?Phe?Ser?Ala?Gln?Asp?Glu?Ala?Lys?Lys

165 170 175

Phe?Thr?Phe?Asn?Leu?Met?Ala?Lys?Gln?Ile?Met?Ser?Leu?Asp?Pro?Gly

180 185 190

Asn?Leu?Glu?Thr?Glu?Gln?Leu?Lys?Lys?Glu?Tyr?Val?Cys?Phe?Met?Lys

195 200 205

Gly?Val?Val?Ser?Ala?Pro?Leu?Asn?Leu?Pro?Gly?Thr?Ala?Tyr?Arg?Lys

210 215 220

Ala?Leu?Lys?Ser?Arg?Asn?Asn?Ile?Leu?Lys?Phe?Ile?Glu?Gly?Lys?Met

225 230 235 240

Glu?Glu?Arg?Val?Lys?Arg?Asn?Gln?Glu?Gly?Lys?Lys?Gly?Met?Glu?Glu

245 250 255

Asn?Asp?Leu?Leu?Asn?Trp?Val?Leu?Lys?His?Ser?Asn?Leu?Ser?Thr?Glu

260 265 270

Gln?Ile?Leu?Asp?Leu?Ile?Leu?Ser?Leu?Leu?Phe?Ala?Gly?His?Glu?Thr

275 280 285

Ser?Ser?Val?Ala?Ile?Ala?Leu?Ala?Ile?Tyr?Phe?Leu?Pro?Ser?Cys?Pro

290 295 300

Gln?Ala?Ile?Gln?Gln?Leu?Arg?Glu?Glu?His?Arg?Glu?Ile?Ala?Arg?Ser

305 310 315 320

Lys?Lys?Lys?Ala?Gly?Glu?Val?Glu?Leu?Thr?Trp?Asp?Asp?Tyr?Lys?Arg

325 330 335

Met?Glu?Phe?Thr?His?Cys?Val?Val?Asn?Glu?Thr?Leu?Arg?Leu?Gly?Asn

340 345 350

Val?Val?Arg?Phe?Leu?His?Arg?Lys?Ala?Ile?Lys?Asp?Val?His?Tyr?Lys

355 360 365

Gly?Tyr?Asp?Ile?Pro?Cys?Gly?Trp?Lys?Val?Leu?Pro?Val?Ile?Ser?Ala

370 375 380

Val?His?Leu?Asp?Pro?Ser?Asn?Phe?Asp?Gln?Pro?Gln?His?Phe?Asn?Pro

385 390 395 400

Trp?Arg?Trp?Gln?Gln?Asn?Asn?Asp?Gly?Ala?Ser?Gly?Asn?Ser?Asn?Ile

405 410 415

Phe?Leu?Pro?Phe?Gly?Gly?Gly?Pro?Arg?Leu?Cys?Ala?Gly?Leu?Glu?Leu

420 425 430

Ala?Lys?Leu?Glu?Met?Ala?Val?Phe?Ile?His?His?Ile?Ile?Leu?Lys?Tyr

435 440 445

Asn?Trp?Asp?Met?Val?Asp?Val?Asp?Gln?Pro?Ile?Val?Tyr?Pro?Phe?Val

450 455 460

Asp?Phe?Pro?Lys?Gly?Leu?Pro?Ile?Arg?Val?Gln?Ser?Gln?Ala?Thr?Leu

465 470 475 480

<210>89

<211>1485

<212>DNA

<213> comospore poplar (populus trichocarpa)

<220>

<221>misc_feature

<222>(1110)..(1110)

<223>n is a, c, g, or t

<400>89

atgtctcact?cagagcttgt?tgtctttctc?cttccatcga?ttttatcact?actcttgctc 60

ttcattctcg?tgcaaagaaa?gcaagtaaga?tttaatctcc?caccgggcaa?catggggtgg 120

ccatttcttg?gagaaaccat?tggctacctg?aagccttact?ctgctacttc?aataggagaa 180

ttcatggaac?agcacatatc?aaggtatgga?aagatttaca?agtccaattt?gtttggggag 240

ccaacaatag?tatccgcaga?tgctggactt?agcagattta?tactacagaa?tgagggaaga 300

ttatttgaat?gcagctatcc?aaaaagtatt?ggtggaattc?ttggaaaatg?gtccatgatg 360

gttcttgttg?gagacatgca?tagagacatg?aggattatat?ctctcaactt?tttgagccat 420

gccaggttaa?gaactcatct?attgaaagaa?gtggagaagc?aaaccctgct?tgttcttagc 480

tcttggaagg?agaattgtac?attttcagct?caagatgaag?caaacaagtt?taccttcaat 540

tggatggcaa?aacatatcat?gagcttggat?cctggaaaga?cagagactga?gcagctgaaa 600

aaagagtatg?ttactttcat?gaaaggagta?gtttcaggtc?ctataaattt?tcctggaacc 660

ccatatagaa?aagccttgaa?gtctcgatca?atcatcttga?aatttataga?gcgaaagatg 720

gaggagagaa?ttggagaaac?gaagggtgga?gtagaaaact?tggaagacga?tgatcttctt 780

ggatgggtct?tgaagcattc?aaatctttat?acggagcaaa?tccttgaatt?aatcttaagc 840

ttgctctttg?ctggccacga?aacttcttct?gtgtccatag?ctctagccat?atccttcttg 900

caagcttgtc?ctggttctat?tcaacagtta?aaagaagaac?atattcaaat?ctccagagcc 960

aagaaacggt?caggagagac?ggaattgacc?tgggatgatt?acaaaaaaat?ggaattcact 1020

caatgcgtta?taagcgagac?agtgaggctt?ggaaacgtag?tcaggtttgt?tcacagaaaa 1080

gctctaaaag?atgttcggta?caaagggtan?gacattccat?gtggatggaa?agtgttacca 1140

gtaatctcat?ccgtccattt?agattcaact?cttttcgacc?aacctcaaca?cttcaatcca 1200

tggagatggc?agcagcacaa?caatgctcgt?ggatcttcta?cttgttcgag?tgcggcggcg 1260

gcggcggcgg?cggcggtgag?tagtaatcac?ttcatgccat?ttgggggagg?accgcgactc 1320

tgtgcaggat?cggaattggc?aaaacttgaa?atggcagttt?tcattcacca?tttggttctg 1380

aacttccatt?gggaattggt?cggtgccgat?caagcctttg?cctttccttt?tgttgatttt 1440

cctaaaggct?tgccaataag?agtcaagcac?cacacagtca?tataa 1485

<210>90

<211>494

<212>PRT

<213> comospore poplar

<220>

<221> is uncertain

<222>(370)..(370)

<223>Xaa can be any natural amino acid

<400>90

Met?Ser?His?Ser?Glu?Leu?Val?Val?Phe?Leu?Leu?Pro?Ser?Ile?Leu?Ser

1 5 10 15

Leu?Leu?Leu?Leu?Phe?Ile?Leu?Val?Gln?Arg?Lys?Gln?Val?Arg?Phe?Asn

20 25 30

Leu?Pro?Pro?Gly?Asn?Met?Gly?Trp?Pro?Phe?Leu?Gly?Glu?Thr?Ile?Gly

35 40 45

Tyr?Leu?Lys?Pro?Tyr?Ser?Ala?Thr?Ser?Ile?Gly?Glu?Phe?Met?Glu?Gln

50 55 60

His?Ile?Ser?Arg?Tyr?Gly?Lys?Ile?Tyr?Lys?Ser?Asn?Leu?Phe?Gly?Glu

65 70 75 80

Pro?Thr?Ile?Val?Ser?Ala?Asp?Ala?Gly?Leu?Ser?Arg?Phe?Ile?Leu?Gln

85 90 95

Asn?Glu?Gly?Arg?Leu?Phe?Glu?Cys?Ser?Tyr?Pro?Lys?Ser?Ile?Gly?Gly

100 105 110

Ile?Leu?Gly?Lys?Trp?Ser?Met?Met?Val?Leu?Val?Gly?Asp?Met?His?Arg

115 120 125

Asp?Met?Arg?Ile?Ile?Ser?Leu?Asn?Phe?Leu?Ser?His?Ala?Arg?Leu?Arg

130 135 140

Thr?His?Leu?Leu?Lys?Glu?Val?Glu?Lys?Gln?Thr?Leu?Leu?Val?Leu?Ser

145 150 155 160

Ser?Trp?Lys?Glu?Asn?Cys?Thr?Phe?Ser?Ala?Gln?Asp?Glu?Ala?Asn?Lys

165 170 175

Phe?Thr?Phe?Asn?Trp?Met?Ala?Lys?His?Ile?Met?Ser?Leu?Asp?Pro?Gly

180 185 190

Lys?Thr?Glu?Thr?Glu?Gln?Leu?Lys?Lys?Glu?Tyr?Val?Thr?Phe?Met?Lys

195 200 205

Gly?Val?Val?Ser?Gly?Pro?Ile?Asn?Phe?Pro?Gly?Thr?Pro?Tyr?Arg?Lys

210 215 220

Ala?Leu?Lys?Ser?Arg?Ser?Ile?Ile?Leu?Lys?Phe?Ile?Glu?Arg?Lys?Met

225 230 235 240

Glu?Glu?Arg?Ile?Gly?Glu?Thr?Lys?Gly?Gly?Val?Glu?Asn?Leu?Glu?Asp

245 250 255

Asp?Asp?Leu?Leu?Gly?Trp?Val?Leu?Lys?His?Ser?Asn?Leu?Tyr?Thr?Glu

260 265 270

Gln?Ile?Leu?Glu?Leu?Ile?Leu?Ser?Leu?Leu?Phe?Ala?Gly?His?Glu?Thr

275 280 285

Ser?Ser?Val?Ser?Ile?Ala?Leu?Ala?Ile?Ser?Phe?Leu?Gln?Ala?Cys?Pro

290 295 300

Gly?Ser?Ile?Gln?Gln?Leu?Lys?Glu?Glu?His?Ile?Gln?Ile?Ser?Arg?Ala

305 310 315 320

Lys?Lys?Arg?Ser?Gly?Glu?Thr?Glu?Leu?Thr?Trp?Asp?Asp?Tyr?Lys?Lys

325 330 335

Met?Glu?Phe?Thr?Gln?Cys?Val?Ile?Ser?Glu?Thr?Val?Arg?Leu?Gly?Asn

340 345 350

Val?Val?Arg?Phe?Val?His?Arg?Lys?Ala?Leu?Lys?Asp?Val?Arg?Tyr?Lys

355 360 365

Gly?Xaa?Asp?Ile?Pro?Cys?Gly?Trp?Lys?Val?Leu?Pro?Val?Ile?Ser?Ser

370 375 380

Val?His?Leu?Asp?Ser?Thr?Leu?Phe?Asp?Gln?Pro?Gln?His?Phe?Asn?Pro

385 390 395 400

Trp?Arg?Trp?Gln?Gln?His?Asn?Asn?Ala?Arg?Gly?Ser?Ser?Thr?Cys?Ser

405 410 415

Ser?Ala?Ala?Ala?Ala?Ala?Ala?Ala?Ala?Val?Ser?Ser?Asn?His?Phe?Met

420 425 430

Pro?Phe?Gly?Gly?Gly?Pro?Arg?Leu?Cys?Ala?Gly?Ser?Glu?Leu?Ala?Lys

435 440 445

Leu?Glu?Met?Ala?Val?Phe?Ile?His?His?Leu?Val?Leu?Asn?Phe?His?Trp

450 455 460

Glu?Leu?Val?Gly?Ala?Asp?Gln?Ala?Phe?Ala?Phe?Pro?Phe?Val?Asp?Phe

465 470 475 480

Pro?Lys?Gly?Leu?Pro?Ile?Arg?Val?Lys?His?His?Thr?Val?Ile

485 490

<210>91

<211>1407

<212>DNA

<213>Aquilegia?formosa?x?Aquilegia?pubescens

<220>

<221>misc_feature

<222>(1031)..(1032)

<223>n is a, c, g, or t

<400>91

atgcctgagc?ttgtgttttt?cttttcatta?gctccagcaa?ttttagcact?aatacttctc 60

ttgaaactct?tcaaaaggaa?gaaaaagtca?tataatcttc?caccaggaaa?catgggttgg 120

ccatatctag?gcgaaactct?tggttatttg?aagccttatt?gtgctatcac?tactggagat 180

ttcatggagc?aacatatatc?aaggtatggg?aagatctaca?agtcaaattt?atttggttat 240

cctacaatag?tttcagttga?tcctgaatta?aatcgatatg?tattacaaaa?cgaaggaaga 300

ctgtttgaat?gtagttatcc?aagtagttta?ggtgggattc?ttggcaaatg?gtcaatgtta 360

gttttggttg?gagacatgca?taaaaacatg?aggatgatct?ctgtcaactt?catgagcagc 420

gcaagacttc?gaacacatct?aattcaagat?gtggagactc?aagccttatt?ggtgctgaaa 480

tcttggcagg?ttgataaaaa?gattttggcc?caagatgaag?caaagaagtt?taccttcaat 540

ttaattgtaa?aaaatataat?gagcatggaa?cctggaacac?ctgaaagtga?gaagcttagg 600

agggaataca?ttacattcat?gaaaggaatc?atttctgcgc?ctttgaattt?gcctggaact 660

gcatatagaa?gagccttaaa?gtctcgatcg?aacattctgc?aacttatcga?gcataacatg 720

aatgagagac?tccaaaagac?taacggagat?ggtaagaaag?tggaagatga?tgatctactt 780

ggatgggtct?tgaagcattc?aaatcttacc?actgaacaaa?ttcttgattt?gatactaagt 840

atgcttttcg?cgggtcatga?aacttcctca?gtatctatat?ctctagccat?ataccttttg 900

caaggatgcc?taaaagcagt?tgaagagtta?agggaagagc?atattagaat?tgctaaagca 960

aaagaacagg?caggacagag?atctggatta?aattgggaag?attacaaaca?catggaattc 1020

actcaatgtg?nntttcttca?tagaaaaact?ctcaaagatg?ttcagtacaa?agggtatgac 1080

attccatgtg?gttggaaagt?tcttccagta?tttgcagcag?ttcatttgga?ccctttaaat 1140

ttcgaccaac?ctcatgcttt?caatccatgg?agatggcaga?atgggaagac?aagcacgacg 1200

actaacaact?tcatgccgtt?tggtggtgga?ttacggttat?gtgctggttc?agagctagcc 1260

aagttggaaa?tggctatttt?cattcaccat?ttggtcttga?attatgattg?ggatatagca 1320

gaaccagatc?aaccatttgc?ctacccattt?gttgaatttc?caaaaggtct?accaattaag 1380

gtctatgacc?atcagtgctt?aacatga 1407

<210>92

<211>468

<212>PRT

<213>Aquilegia?formosa?x?Aquilegia?pubescens

<220>

<22l> is uncertain

<222>(344)..(344)

<223>Xaa can be any natural amino acid

<400>92

Met?Pro?Glu?Leu?Val?Phe?Phe?Phe?Ser?Leu?Ala?Pro?Ala?Ile?Leu?Ala

1 5 10 15

Leu?Ile?Leu?Leu?Leu?Lys?Leu?Phe?Lys?Arg?Lys?Lys?Lys?Ser?Tyr?Asn

20 25 30

Leu?Pro?Pro?Gly?Asn?Met?Gly?Trp?Pro?Tyr?Leu?Gly?Glu?Thr?Leu?Gly

35 40 45

Tyr?Leu?Lys?Pro?Tyr?Cys?Ala?Ile?Thr?Thr?Gly?Asp?Phe?Met?Glu?Gln

50 55 60

His?Ile?Ser?Arg?Tyr?Gly?Lys?Ile?Tyr?Lys?Ser?Asn?Leu?Phe?Gly?Tyr

65 70 75 80

Pro?Thr?Ile?Val?Ser?Val?Asp?Pro?Glu?Leu?Asn?Arg?Tyr?Val?Leu?Gln

85 90 95

Asn?Glu?Gly?Arg?Leu?Phe?Glu?Cys?Ser?Tyr?Pro?Ser?Ser?Leu?Gly?Gly

100 105 110

Ile?Leu?Gly?Lys?Trp?Ser?Met?Leu?Val?Leu?Val?Gly?Asp?Met?His?Lys

115 120 125

Asn?Met?Arg?Met?Ile?Ser?Val?Asn?Phe?Met?Ser?Ser?Ala?Arg?Leu?Arg

130 135 140

Thr?His?Leu?Ile?Gln?Asp?Val?Glu?Thr?Gln?Ala?Leu?Leu?Val?Leu?Lys

145 150 155 160

Ser?Trp?Gln?Val?Asp?Lys?Lys?Ile?Leu?Ala?Gln?Asp?Glu?Ala?Lys?Lys

165 170 175

Phe?Thr?Phe?Asn?Leu?Ile?Val?Lys?Asn?Ile?Met?Ser?Met?Glu?Pro?Gly

180 185 190

Thr?Pro?Glu?Ser?Glu?Lys?Leu?Arg?Arg?Glu?Tyr?Ile?Thr?Phe?Met?Lys

195 200 205

Gly?Ile?Ile?Ser?Ala?Pro?Leu?Asn?Leu?Pro?Gly?Thr?Ala?Tyr?Arg?Arg

210 215 220

Ala?Leu?Lys?Ser?Arg?Ser?Asn?Ile?Leu?Gln?Leu?Ile?Glu?His?Asn?Met

225 230 235 240

Asn?Glu?Arg?Leu?Gln?Lys?Thr?Asn?Gly?Asp?Gly?Lys?Lys?Val?Glu?Asp

245 250 255

Asp?Asp?Leu?Leu?Gly?Trp?Val?Leu?Lys?His?Ser?Asn?Leu?Thr?Thr?Glu

260 265 270

Gln?Ile?Leu?Asp?Leu?Ile?Leu?Ser?Met?Leu?Phe?Ala?Gly?His?Glu?Thr

275 280 285

Ser?Ser?Val?Ser?Ile?Ser?Leu?Ala?Ile?Tyr?Leu?Leu?Gln?Gly?Cys?Leu

290 295 300

Lys?Ala?Val?Glu?Glu?Leu?Arg?Glu?Glu?His?Ile?Arg?Ile?Ala?Lys?Ala

305 310 315 320

Lys?Glu?Gln?Ala?Gly?Gln?Arg?Ser?Gly?Leu?Asn?Trp?Glu?Asp?Tyr?Lys

325 330 335

His?Met?Glu?Phe?Thr?Gln?Cys?Xaa?Phe?Leu?His?Arg?Lys?Thr?Leu?Lys

340 345 350

Asp?Val?Gln?Tyr?Lys?Gly?Tyr?Asp?Ile?Pro?Cys?Gly?Trp?Lys?Val?Leu

355 360 365

Pro?Val?Phe?Ala?Ala?Val?His?Leu?Asp?Pro?Leu?Asn?Phe?Asp?Gln?Pro

370 375 380

His?Ala?Phe?Asn?Pro?Trp?Arg?Trp?Gln?Asn?Gly?Lys?Thr?Ser?Thr?Thr

385 390 395 400

Thr?Asn?Asn?Phe?Met?Pro?Phe?Gly?Gly?Gly?Leu?Arg?Leu?Cys?Ala?Gly

405 410 415

Ser?Glu?Leu?Ala?Lys?Leu?Glu?Met?Ala?Ile?Phe?Ile?His?His?Leu?Val

420 425 430

Leu?Asn?Tyr?Asp?Trp?Asp?Ile?Ala?Glu?Pro?Asp?Gln?Pro?Phe?Ala?Tyr

435 440 445

Pro?Phe?Val?Glu?Phe?Pro?Lys?Gly?Leu?Pro?Ile?Lys?Val?Tyr?Asp?His

450 455 460

Gln?Cys?Leu?Thr

465

<210>93

<2ll>64l

<212>DNA

<213> common wheat

<400>93

atggccgcca?tcatggcctc?cataaccagc?gagctccttt?tcttcctccc?cttcatcctc 60

ctggccctgc?tcaccttcta?caccagcgcc?gtggctaaat?gccatggcct?ccactggtgg 120

agcggccgga?cgaagaagag?gcggccgaac?ctgccgcccg?gcgccgtcgg?ctggcccttc 180

atcggcgaga?ccttcgggta?cctccgcgcc?cacccggcca?cctccatcgg?ccagttcatg 240

gaccagcaca?tcgcacggta?cgggaagata?taccggtcga?gcctgttcgg?ggaccggacg 300

gtggtgtcgg?cggacgcggg?gctgaaccgg?tacatcctgc?agaacgaggg?gcggctgttc 360

gagtgtagct?acccgcggag?catcggcggc?atccttggca?aatggtcgat?gctggtgctc 420

gtcggcgacc?cccaccgcga?gatgcgcttc?atctccctca?acttcctcag?ctccgtccgc 480

ctccgcgccg?tgctcctccc?ggaggtggag?cgccacaccc?tcctcgtcct?ccgcgactgg 540

ctgccttact?cctcctcctc?cgtcttctcc?gcgcagcacg?aagccaagaa?gttcacgttt 600

aacctgatgg?cgaagaacat?catgagcatg?gaccccggcg?a 641

<210>94

<211>213

<212>PRT

<213> common wheat

<400>94

Met?Ala?Ala?Ile?Met?Ala?Ser?Ile?Thr?Ser?Glu?Leu?Leu?Phe?Phe?Leu

1 5 10 15

Pro?Phe?Ile?Leu?Leu?Ala?Leu?Leu?Thr?Phe?Tyr?Thr?Ser?Ala?Val?Ala

20 25 30

Lys?Cys?His?Gly?Leu?His?Trp?Trp?Ser?Gly?Arg?Thr?Lys?Lys?Arg?Arg

35 40 45

Pro?Asn?Leu?Pro?Pro?Gly?Ala?Val?Gly?Trp?Pro?Phe?Ile?Gly?Glu?Thr

50 55 60

Phe?Gly?Tyr?Leu?Arg?Ala?His?Pro?Ala?Thr?Ser?Ile?Gly?Gln?Phe?Met

65 70 75 80

Asp?Gln?His?Ile?Ala?Arg?Tyr?Gly?Lys?Ile?Tyr?Arg?Ser?Ser?Leu?Phe

85 90 95

Gly?Asp?Arg?Thr?Val?Val?Ser?Ala?Asp?Ala?Gly?Leu?Asn?Arg?Tyr?Ile

100 105 110

Leu?Gln?Asn?Glu?Gly?Arg?Leu?Phe?Glu?Cys?Ser?Tyr?Pro?Arg?Ser?Ile

115 120 125

Gly?Gly?Ile?Leu?Gly?Lys?Trp?Ser?Met?Leu?Val?Leu?Val?Gly?Asp?Pro

130 135 140

His?Arg?Glu?Met?Arg?Phe?Ile?Ser?Leu?Asn?Phe?Leu?Ser?Ser?Val?Arg

145 150 155 160

Leu?Arg?Ala?Val?Leu?Leu?Pro?Glu?Val?Glu?Arg?His?Thr?Leu?Leu?Val

165 170 175

Leu?Arg?Asp?Trp?Leu?Pro?Tyr?Ser?Ser?Ser?Ser?Val?Phe?Ser?Ala?Gln

180 185 190

His?Glu?Ala?Lys?Lys?Phe?Thr?Phe?Asn?Leu?Met?Ala?Lys?Asn?Ile?Met

195 200 205

Ser?Met?Asp?Pro?Gly

210

<210>95

<211>791

<212>DNA

<213> common wheat

<400>95

ggaaggccct?caagtcgcga?gccaccatac?ttggagtaat?agagaggaaa?atggaggaaa 60

ggcttgagaa?aatgaataag?gaggcctcga?gcatggaaga?agatgatctt?ctcgggtggg 120

cgatgaagca?gtccaatctt?tcgaaagaac?aaatattgga?cctcttgctg?agcttgctgt 180

ttgccgggca?tgagacatcg?tcaatggcgc?tcgccctcgc?catcttcttc?ctcgaaggtt 240

gccctaaagc?cgttgaagaa?ctgcgggagg?agcatcttga?gattgctagg?agacagaagc 300

tgagagggga?gtgcaaactg?agctgggaag?actacaaaga?gatggttttc?acgcaatgcg 360

ttataaacga?gaccttgcgg?ctaggcaacg?tggtcaggtt?cctgcaccgg?aaggtcattc 420

gagatgtgca?ctacaatggg?tatgacatcc?cgagcggatg?gaaaattctg?ccggtgttag 480

cggcggtgca?tctcgactcg?tcgctgtacg?aggaccccag?cagcttcaac?ccttggagat 540

ggaagggcaa?cgcgtccggc?gtggcgcaga?acagtaactt?catgccctac?ggcggcggca 600

cgaggctctg?cgccgggtcg?gagctcgcca?agctcgagat?ggccatcttc?ctgcaccacc 660

tggtgctcaa?cttccggtgg?gagctcgccg?agcccgacca?ggcgttcgtg?tacccgttcg 720

tcgacttccc?caagggcctg?cccatcaggg?tccataggat?tgcacaggaa?gaagaaggag 780

aagaggagta?a 791

<210>96

<211>261

<212>PRT

<213> common wheat

<400>96

Lys?Ala?Leu?Lys?Ser?Arg?Ala?Thr?Ile?Leu?Gly?Val?Ile?Glu?Arg?Lys

1 5 10 15

Met?Glu?Glu?Arg?Leu?Glu?Lys?Met?Asn?Lys?Glu?Ala?Ser?Ser?Met?Glu

20 25 30

Glu?Asp?Asp?Leu?Leu?Gly?Trp?Ala?Met?Lys?Gln?Ser?Asn?Leu?Ser?Lys

35 40 45

Glu?Gln?Ile?Leu?Asp?Leu?Leu?Leu?Ser?Leu?Leu?Phe?Ala?Gly?His?Glu

50 55 60

Thr?Ser?Ser?Met?Ala?Leu?Ala?Leu?Ala?Ile?Phe?Phe?Leu?Glu?Gly?Cys

65 70 75 80

Pro?Lys?Ala?Val?Glu?Glu?Leu?Arg?Glu?Glu?His?Leu?Glu?Ile?Ala?Arg

85 90 95

Arg?Gln?Lys?Leu?Arg?Gly?Glu?Cys?Lys?Leu?Ser?Trp?Glu?Asp?Tyr?Lys

100 105 110

Glu?Met?Val?Phe?Thr?Gln?Cys?Val?Ile?Asn?Glu?Thr?Leu?Arg?Leu?Gly

115 120 125

Asn?Val?Val?Arg?Phe?Leu?His?Arg?Lys?Val?Ile?Arg?Asp?Val?His?Tyr

130 135 140

Asn?Gly?Tyr?Asp?Ile?Pro?Ser?Gly?Trp?Lys?Ile?Leu?Pro?Val?Leu?Ala

145 150 155 160

Ala?Val?His?Leu?Asp?Ser?Ser?Leu?Tyr?Glu?Asp?Pro?Ser?Ser?Phe?Asn

165 170 175

Pro?Trp?Arg?Trp?Lys?Gly?Asn?Ala?Ser?Gly?Val?Ala?Gln?Asn?Ser?Asn

180 185 190

Phe?Met?Pro?Tyr?Gly?Gly?Gly?Thr?Arg?Leu?Cys?Ala?Gly?Ser?Glu?Leu

195 200 205

Ala?Lys?Leu?Glu?Met?Ala?Ile?Phe?Leu?His?His?Leu?Val?Leu?Asn?Phe

210 215 220

Arg?Trp?Glu?Leu?Ala?Glu?Pro?Asp?Gln?Ala?Phe?Val?Tyr?Pro?Phe?Val

225 230 235 240

Asp?Phe?Pro?Lys?Gly?Leu?Pro?Ile?Arg?Val?His?Arg?Ile?Ala?Gln?Glu

245 250 255

Glu?Glu?Gly?Glu?Glu

260

<210>97

<211>789

<212>DNA

<213> Euphorbia esula L

<220>

<221>misc_feature

<222>(325)..(326)

<223>n is a, c, g, or t

<400>97

agcatggacc?ctggaaaacc?agagactgaa?aagctcaaga?aagaatatgt?tactttcatg 60

aaaggagttg?tttctgctcc?tattaatttg?cctggaactg?cttatagaag?ggccttacag 120

tctcgatcga?caattttgaa?gttcatagag?gagaaaatgg?aggaaagaaa?tgaaaaatta 180

aaagaaggaa?aagcagagga?agaagaagaa?gatgatcttc?taggatgggt?tttaaagcat 240

tcaaatcttt?caactgagca?aattctagat?ttggtattaa?gtttaatgtt?tgctggccat 300

gaaacttctt?cagtagcaat?tcttnnagct?atctattttt?tgcaagattc?tcctgctgct 360

cttcaacagc?taagggaaga?acataaggaa?attgaaaaag?ccaagaagca?gtcaggagag 420

aagggattga?actgggatgt?ttacaaaaat?atggaattca?ctcagtgtgt?tatcaatgaa 480

acactaagac?ttggaaatgt?agtcaggttc?cttcatagga?agactattaa?acacgttcaa 540

tacaaaggat?atgacattcc?acgtggatgg?aaagtgctgc?cagtgattgc?agccgtgcat 600

ttggacagta?gccattttga?gaagcctcaa?cacttcaatc?catggagatg?gttgcaccag 660

aataatggga?tacaaaatat?gaataataat?ttcatgccat?ttgggggagg?accaagatta 720

tgtgcaggat?cagaattagc?aaaactagaa?atggctattt?ttattcatca?tttggtcctt 780

aattaccag 789

<210>98

<211>263

<212>PRT

<213> Euphorbia esula L

<220>

<221> is uncertain

<222>(109)..(109)

<223>Xaa can be any natural amino acid

<400>98

Ser?Met?Asp?Pro?Gly?Lys?Pro?Glu?Thr?Glu?Lys?Leu?Lys?Lys?Glu?Tyr

1 5 10 15

Val?Thr?Phe?Met?Lys?Gly?Val?Val?Ser?Ala?Pro?Ile?Asn?Leu?Pro?Gly

20 25 30

Thr?Ala?Tyr?Arg?Arg?Ala?Leu?Gln?Ser?Arg?Ser?Thr?Ile?Leu?Lys?Phe

35 40 45

Ile?Glu?Glu?Lys?Met?Glu?Glu?Arg?Asn?Glu?Lys?Leu?Lys?Glu?Gly?Lys

50 55 60

Ala?Glu?Glu?Glu?Glu?Glu?Asp?Asp?Leu?Leu?Gly?Trp?Val?Leu?Lys?His

65 70 75 80

Ser?Asn?Leu?Ser?Thr?Glu?Gln?Ile?Leu?Asp?Leu?Val?Leu?Ser?Leu?Met

85 90 95

Phe?Ala?Gly?His?Glu?Thr?Ser?Ser?Val?Ala?Ile?Leu?Xaa?Ala?Ile?Tyr

100 105 110

Phe?Leu?Gln?Asp?Ser?Pro?Ala?Ala?Leu?Gln?Gln?Leu?Arg?Glu?Glu?His

115 120 125

Lys?Glu?Ile?Glu?Lys?Ala?Lys?Lys?Gln?Ser?Gly?Glu?Lys?Gly?Leu?Asn

130 135 140

Trp?Asp?Val?Tyr?Lys?Asn?Met?Glu?Phe?Thr?Gln?Cys?Val?Ile?Asn?Glu

145 150 155 160

Thr?Leu?Arg?Leu?Gly?Asn?Val?Val?Arg?Phe?Leu?His?Arg?Lys?Thr?Ile

165 170 175

Lys?His?Val?Gln?Tyr?Lys?Gly?Tyr?Asp?Ile?Pro?Arg?Gly?Trp?Lys?Val

180 185 190

Leu?Pro?Val?Ile?Ala?Ala?Val?His?Leu?Asp?Ser?Ser?His?Phe?Glu?Lys

195 200 205

Pro?Gln?His?Phe?Asn?Pro?Trp?Arg?Trp?Leu?His?Gln?Asn?Asn?Gly?Ile

210 215 220

Gln?Asn?Met?Asn?Asn?Asn?Phe?Met?Pro?Phe?Gly?Gly?Gly?Pro?Arg?Leu

225 230 235 240

Cys?Ala?Gly?Ser?Glu?Leu?Ala?Lys?Leu?Glu?Met?Ala?Ile?Phe?Ile?His

245 250 255

His?Leu?Val?Leu?Asn?Tyr?Gln

260

<210>99

<211>955

<212>DNA

<213> upland cotton (Gossypium hirsutum)

<400>99

atgcctgact?cagagcctat?tttcttgctt?cttccatcta?ttttatcttt?gattctgttc 60

ttcattctca?tcaagagaaa?gcaaagaagg?tataatcttc?caccagggaa?catggggtgg 120

ccttttctcg?gcgaaacaat?cggttacttg?aggccttact?ctgctacttc?agtaggtgaa 180

ttcatgcacc?agcatatatc?aaggtatggg?aatatctaca?aatcgaattt?gtttggtgag 240

aagacaatag?tgtctgcaga?tgctgggttg?aacaagttca?tattacaaaa?cgaagggaga 300

ttattcgagt?gcagttaccc?gagaagcatt?ggtggcattc?ttgggaaatg?gtcgatgctg 360

gttttggttg?gggatatgca?tagagacatg?aggattatat?cactcaactt?cttgagcaac 420

gccaggctga?ggactcatct?tttgagagaa?gtggagaaac?atactttgct?tgttctaaat 480

acttggaaag?agaagtgcat?attttcagct?caggatgaag?caaaaaagtt?cactttcaat 540

ttgatggcaa?aaaatatcat?gagcatggac?cctggacatc?cagagacgga?gcagctaaag 600

aaagaatatg?ttactttcat?gaaaggagtc?gtttctgctc?ctttaaattt?acctggaact 660

gcatacagaa?aagccttaca?atctcgatca?acaatcctga?aatttattga?aaagaaaatg 720

gaagtaagga?taaggaaaat?gaaggaagga?aaagaaaact?cagaggaaga?tgatcttctt 780

gaatgggtct?taaagcattc?taatctttcc?acagagcaaa?tccttgactt?gattttgagc 840

ttgctttttg?ctggacatga?gacttcctcg?gtagccataa?ccttagccat?ctacttcttg 900

ccaggttgtc?ctttggccat?tcaacagttg?agagaggaac?accttgaagt?tgcag 955

<210>100

<211>333

<212>PRT

<213> upland cotton

<220>

<221> is uncertain

<222>(326)..(326)

<223>Xaa can be any natural amino acid

<400>100

Met?Pro?Asp?Ser?Glu?Pro?Ile?Phe?Leu?Leu?Leu?Pro?Ser?Ile?Leu?Ser

1 5 10 15

Leu?Ile?Leu?Phe?Phe?Ile?Leu?Ile?Lys?Arg?Lys?Gln?Arg?Arg?Tyr?Asn

20 25 30

Leu?Pro?Pro?Gly?Asn?Met?Gly?Trp?Pro?Phe?Leu?Gly?Glu?Thr?Ile?Gly

35 40 45

Tyr?Leu?Arg?Pro?Tyr?Ser?Ala?Thr?Ser?Val?Gly?Glu?Phe?Met?His?Gln

50 55 60

His?Ile?Ser?Arg?Tyr?Gly?Asn?Ile?Tyr?Lys?Ser?Asn?Leu?Phe?Gly?Glu

65 70 75 80

Lys?Thr?Ile?Val?Ser?Ala?Asp?Ala?Gly?Leu?Asn?Lys?Phe?Ile?Leu?Gln

85 90 95

Asn?Glu?Gly?Arg?Leu?Phe?Glu?Cys?Ser?Tyr?Pro?Arg?Ser?Ile?Gly?Gly

100 105 110

Ile?Leu?Gly?Lys?Trp?Ser?Met?Leu?Val?Leu?Val?Gly?Asp?Met?His?Arg

115 120 125

Asp?Met?Arg?Ile?Ile?Ser?Leu?Asn?Phe?Leu?Ser?Asn?Ala?Arg?Leu?Arg

130 135 140

Thr?His?Leu?Leu?Arg?Glu?Val?Glu?Lys?His?Thr?Leu?Leu?Val?Leu?Asn

145 150 155 160

Thr?Trp?Lys?Glu?Lys?Cys?Ile?Phe?Ser?Ala?Gln?Asp?Glu?Ala?Lys?Lys

165 170 175

Phe?Thr?Phe?Asn?Leu?Met?Ala?Lys?Asn?Ile?Met?Ser?Met?Asp?Pro?Gly

180 185 190

His?Pro?Glu?Thr?Glu?Gln?Leu?Lys?Lys?Glu?Tyr?Val?Thr?Phe?Met?Lys

195 200 205

Gly?Val?Val?Ser?Ala?Pro?Leu?Asn?Leu?Pro?Gly?Thr?Ala?Tyr?Arg?Lys

210 215 220

Ala?Leu?Gln?Ser?Arg?Ser?Thr?Ile?Leu?Lys?Phe?Ile?Glu?Lys?Lys?Met

225 230 235 240

Glu?Val?Arg?Ile?Arg?Lys?Met?Lys?Glu?Gly?Lys?Glu?Asn?Ser?Glu?Glu

245 250 255

Asp?Asp?Leu?Leu?Glu?Trp?Val?Leu?Lys?His?Ser?Asn?Leu?Ser?Thr?Glu

260 265 270

Gln?Ile?Leu?Asp?Leu?Ile?Leu?Ser?Leu?Leu?Phe?Ala?Gly?His?Glu?Thr

275 280 285

Ser?Ser?Val?Ala?Ile?Thr?Leu?Ala?Ile?Tyr?Phe?Leu?Pro?Gly?Cys?Pro

290 295 300

Leu?Ala?Ile?Gln?Gln?Leu?Arg?Glu?Asn?Thr?Leu?Lys?Leu?Gln?Ser?Gln

305 310 315 320

Thr?Asn?Gln?Arg?Asp?Xaa?Leu?Asn?Trp?Asp?Asp?Thr?Glu

325 330

<210>101

<211>832

<212>DNA

<213> tomato (Lycopersicon esculentum)

<400>101

atgggttggc?cttttcttgg?tgaaactatt?ggctatttga?gaccttattc?agctactact 60

attggagatt?tcatgcaaga?tcatatctct?aggtatggga?aaattttcaa?gtcaaatttg 120

tttggagagc?caacaatagt?ttcagcagat?gcagggctaa?acagatacat?tctgcagaat 180

gaagggagat?tatttgagtg?taattatcca?agaagtatag?gtgggatact?tggtaaatgg 240

tctatgttag?ttcaagttgg?acaaatgcat?agagatatga?ggatgatttc?tctgaatttt 300

ttgagcaatg?ctaggctaag?gaatcaactt?ttaagtgaag?ttgaaaagca?tactttgctt 360

gttcttggct?cttggaaaca?ggattctgtt?gtttgtgcac?aagatgaagc?aaagaagtta 420

acattcaact?ttatggcaga?gcatatcatg?agtctacaac?ctggaaatcc?agagacagag 480

aagctgaaaa?aagagtacat?cacatttatg?aaaggagtgg?tttctgctcc?attgaatttt 540

ccaggaacag?cttacagaaa?ggccttacag?tctcgatcaa?caattcttgg?atttattgag 600

agaaaaatgg?aggagaggct?taaggaaatg?aacagaaacg?aaaacgacct?tctaggttgg 660

gttctgaaga?attcaaatct?ctcaaaagag?caaattcttg?atttgctact?gagtttgctc 720

tttgctggcc?atgaaacttc?atcagtagca?atagctctgt?ctattttctt?actcgaaagc 780

tgtcctgctg?ctgttcaaca?attaacagaa?gagcacttgg?agatttcccg?gg 832

<210>102

<211>277

<212>PRT

<213> tomato

<400>102

Met?Gly?Trp?Pro?Phe?Leu?Gly?Glu?Thr?Ile?Gly?Tyr?Leu?Arg?Pro?Tyr

1 5 10 15

Ser?Ala?Thr?Thr?Ile?Gly?Asp?Phe?Met?Gln?Asp?His?Ile?Ser?Arg?Tyr

20 25 30

Gly?Lys?Ile?Phe?Lys?Ser?Asn?Leu?Phe?Gly?Glu?Pro?Thr?Ile?Val?Ser

35 40 45

Ala?Asp?Ala?Gly?Leu?Asn?Arg?Tyr?Ile?Leu?Gln?Asn?Glu?Gly?Arg?Leu

50 55 60

Phe?Glu?Cys?Asn?Tyr?Pro?Arg?Ser?Ile?Gly?Gly?Ile?Leu?Gly?Lys?Trp

65 70 75 80

Ser?Met?Leu?Val?Gln?Val?Gly?Gln?Met?His?Arg?Asp?Met?Arg?Met?Ile

85 90 95

Ser?Leu?Asn?Phe?Leu?Ser?Asn?Ala?Arg?Leu?Arg?Asn?Gln?Leu?Leu?Ser

100 105 110

Glu?Val?Glu?Lys?His?Thr?Leu?Leu?Val?Leu?Gly?Ser?Trp?Lys?Gln?Asp

115 120 125

Ser?Val?Val?Cys?Ala?Gln?Asp?Glu?Ala?Lys?Lys?Leu?Thr?Phe?Asn?Phe

130 135 140

Met?Ala?Glu?His?Ile?Met?Ser?Leu?Gln?Pro?Gly?Asn?Pro?Glu?Thr?Glu

145 150 155 160

Lys?Leu?Lys?Lys?Glu?Tyr?Ile?Thr?Phe?Met?Lys?Gly?Val?Val?Ser?Ala

165 170 175

Pro?Leu?Asn?Phe?Pro?Gly?Thr?Ala?Tyr?Arg?Lys?Ala?Leu?Gln?Ser?Arg

180 185 190

Ser?Thr?Ile?Leu?Gly?Phe?Ile?Glu?Arg?Lys?Met?Glu?Glu?Arg?Leu?Lys

195 200 205

Glu?Met?Asn?Arg?Asn?Glu?Asn?Asp?Leu?Leu?Gly?Trp?Val?Leu?Lys?Asn

210 215 220

Ser?Asn?Leu?Ser?Lys?Glu?Gln?Ile?Leu?Asp?Leu?Leu?Leu?Ser?Leu?Leu

225 230 235 240

Phe?Ala?Gly?His?Glu?Thr?Ser?Ser?Val?Ala?Ile?Ala?Leu?Ser?Ile?Phe

245 250 255

Leu?Leu?Glu?Ser?Cys?Pro?Ala?Ala?Val?Gln?Gln?Leu?Thr?Glu?Glu?His

260 265 270

Leu?Glu?Ile?Ser?Arg

275

<210>103

<211>711

<212>DNA

<213> potato

<400>103

atgtctgact?tagagttttt?tctttttctt?gttcctccaa?tcttggcagt?ccttattatt 60

cttaatctat?tcaaaagaaa?acacaaattt?caaaatcttc?caccagggga?tatgggttgg 120

ccttttcttg?gtgaaactat?tggttatttg?agaccttact?cagttactac?tattggagat 180

ttcatgcaag?atcatatctc?aaggtatggg?aaaattttca?agtcaaattt?gtttggagag 240

ccaacaattg?tttcagcaga?tgcagggctt?aacagataca?ttctgcagaa?tgaagggaga 300

ttatttgagt?gtaattatcc?aagaagtata?ggtgggatac?ttggtaaatg?gtctatgttg 360

gttcaagttg?gacaaatgca?tagagatatg?aggatgattt?ctctgaattt?tttgagcaat 420

gctagactca?ggaatcaact?tttaagtgaa?gttgaaaagc?atactgtgct?tgttcttggc 480

tcttggaaac?aggattctgt?tgtttgtgca?caagatgaag?caaagaagtt?tacattcaac 540

tttatggcag?agcatatcat?gagtctacaa?cctggaaatc?cagagacaga?gaagctgaag 600

aaagagtaca?tcacatttat?gaaaggagtg?gtttctgctc?cattgaattt?tccaggaaca 660

gcttacagaa?aagccctaca?gtctcgatca?acaattcttg?gaattattga?g 711

<210>104

<211>237

<212>PRT

<213> potato

<400>104

Met?Ser?Asp?Leu?Glu?Phe?Phe?Leu?Phe?Leu?Val?Pro?Pro?Ile?Leu?Ala

1 5 10 15

Val?Leu?Ile?Ile?Leu?Asn?Leu?Phe?Lys?Arg?Lys?His?Lys?Phe?Gln?Asn

20 25 30

Leu?Pro?Pro?Gly?Asp?Met?Gly?Trp?Pro?Phe?Leu?Gly?Glu?Thr?Ile?Gly

35 40 45

Tyr?Leu?Arg?Pro?Tyr?Ser?Val?Thr?Thr?Ile?Gly?Asp?Phe?Met?Gln?Asp

50 55 60

His?Ile?Ser?Arg?Tyr?Gly?Lys?Ile?Phe?Lys?Ser?Asn?Leu?Phe?Gly?Glu

65 70 75 80

Pro?Thr?Ile?Val?Ser?Ala?Asp?Ala?Gly?Leu?Asn?Arg?Tyr?Ile?Leu?Gln

85 90 95

Asn?Glu?Gly?Arg?Leu?Phe?Glu?Cys?Asn?Tyr?Pro?Arg?Ser?Ile?Gly?Gly

100 105 110

Ile?Leu?Gly?Lys?Trp?Ser?Met?Leu?Val?Gln?Val?Gly?Gln?Met?His?Arg

115 120 125

Asp?Met?Arg?Met?Ile?Ser?Leu?Asn?Phe?Leu?Ser?Asn?Ala?Arg?Leu?Arg

130 135 140

Asn?Gln?Leu?Leu?Ser?Glu?Val?Glu?Lys?His?Thr?Val?Leu?Val?Leu?Gly

145 150 155 160

Ser?Trp?Lys?Gln?Asp?Ser?Val?Val?Cys?Ala?Gln?Asp?Glu?Ala?Lys?Lys

165 170 175

Phe?Thr?Phe?Asn?Phe?Met?Ala?Glu?His?Ile?Met?Ser?Leu?Gln?Pro?Gly

180 185 190

Asn?Pro?Glu?Thr?Glu?Lys?Leu?Lys?Lys?Glu?Tyr?Ile?Thr?Phe?Met?Lys

195 200 205

Gly?Val?Val?Ser?Ala?Pro?Leu?Asn?Phe?Pro?Gly?Thr?Ala?Tyr?Arg?Lys

210 215 220

Ala?Leu?Gln?Ser?Arg?Ser?Thr?Ile?Leu?Gly?Ile?Ile?Glu

225 230 235

<210>105

<211>431

<212>DNA

<213> potato

<400>105

ggaaagctgt?gaaagatgtt?cgatacaaag?gttatgacat?tccatgtgga?tggaaagtat 60

tgccggtgat?ttcagcagcg?catttagatc?cttcactttt?tgaccgacct?cacgactttg 120

atccttggag?atggcagaat?gcagaagagt?cgccttcagg?taaaggagga?agcacaggca 180

caagcagcac?aacaaaaagt?agtaataatt?tcatgccatt?tgggggaggt?ccacgtctat 240

gtgcaggatc?tgaactggcc?aaacttgaga?tggccatttt?cattcactat?cttgttctta 300

attttcactg?gaaattagct?gcacctgatc?aggcttttgc?ctatccttac?gtagattttc 360

ccaatgccct?accaatcact?atccaacatc?gatcgtcaaa?taaattaaac?caccacactt 420

actacctcta?a 431

<210>106

<211>142

<212>PRT

<213> potato

<400>106

Lys?Ala?Val?Lys?Asp?Val?Arg?Tyr?Lys?Gly?Tyr?Asp?Ile?Pro?Cys?Gly

1 5 10 15

Trp?Lys?Val?Leu?Pro?Val?Ile?Ser?Ala?Ala?His?Leu?Asp?Pro?Ser?Leu

20 25 30

Phe?Asp?Arg?Pro?His?Asp?Phe?Asp?Pro?Trp?Arg?Trp?Gln?Asn?Ala?Glu

35 40 45

Glu?Ser?Pro?Ser?Gly?Lys?Gly?Gly?Ser?Thr?Gly?Thr?Ser?Ser?Thr?Thr

50 55 60

Lys?Ser?Ser?Asn?Asn?Phe?Met?Pro?Phe?Gly?Gly?Gly?Pro?Arg?Leu?Cys

65 70 75 80

Ala?Gly?Ser?Glu?Leu?Ala?Lys?Leu?Glu?Met?Ala?Ile?Phe?Ile?His?Tyr

85 90 95

Leu?Val?Leu?Asn?Phe?His?Trp?Lys?Leu?Ala?Ala?Pro?Asp?Gln?Ala?Phe

100 105 110

Ala?Tyr?Pro?Tyr?Val?Asp?Phe?Pro?Asn?Ala?Leu?Pro?Ile?Thr?Ile?Gln

115 120 125

His?Arg?Ser?Ser?Asn?Lys?Leu?Asn?His?His?Thr?Tyr?Tyr?Leu

130 135 140

<210>107

<211>52

<212>DNA

<213> artificial sequence

<220>

<223> primer: prm06540

<400>107

ggggacaagt?ttgtacaaaa?aagcaggctt?aaacaatggc?cgccatgatg?gc 52

<210>108

<211>48

<212>DNA

<213> artificial sequence

<220>

<223> primer: prm06520

<400>108

ggggaccact?ttgtacaaga?aagctgggtt?tactcctgct?catcatcc 48

<210>109

<211>654

<212>DNA

<213> rice

<400>109

cttctacatc?ggcttaggtg?tagcaacacg?actttattat?tattattatt?attattatta 60

ttattttaca?aaaatataaa?atagatcagt?ccctcaccac?aagtagagca?agttggtgag 120

ttattgtaaa?gttctacaaa?gctaatttaa?aagttattgc?attaacttat?ttcatattac 180

aaacaagagt?gtcaatggaa?caatgaaaac?catatgacat?actataattt?tgtttttatt 240

attgaaatta?tataattcaa?agagaataaa?tccacatagc?cgtaaagttc?tacatgtggt 300

gcattaccaa?aatatatata?gcttacaaaa?catgacaagc?ttagtttgaa?aaattgcaat 360

ccttatcaca?ttgacacata?aagtgagtga?tgagtcataa?tattattttc?tttgctaccc 420

atcatgtata?tatgatagcc?acaaagttac?tttgatgatg?atatcaaaga?acatttttag 480

gtgcacctaa?cagaatatcc?aaataatatg?actcacttag?atcataatag?agcatcaagt 540

aaaactaaca?ctctaaagca?accgatggga?aagcatctat?aaatagacaa?gcacaatgaa 600

aatcctcatc?atccttcacc?acaattcaaa?tattatagtt?gaagcatagt?agta 654

<210>110

<211>1236

<212>DNA

<213> rice

<400>110

ggtcagccaa?tacattgatc?cgttgccaat?catgcaaagt?attttggctg?tggccgagtg 60

ccggaattga?taattgtgtt?ctgactaaat?taaatgacca?gaagtcgcta?tcttccaatg 120

tatccgaaac?ctggattaaa?caatcctgtt?ctgttctcta?gcccctcctg?catggccgga 180

ttgttttttt?gacatgtttt?cttgactgag?gcctgtttgt?tctaaacttt?ttcttcaaac 240

ttttaacttt?ttcatcacat?cagaactttt?ctacacatat?aaacttttaa?cttttccgtc 300

acatcgttcc?aatttcaatc?aaactttcaa?ttttggcgtg?aactaaacac?accctgagtc 360

ttttattgct?cctccgtacg?ggttggctgg?ttgagaatag?gtattttcag?agagaaaatc 420

tagatattgg?gaggaacttg?gcatgaatgg?ccactatatt?tagagcaatt?ctacggtcct 480

tgaggaggta?ccatgaggta?ccaaaatttt?agtgtaaatt?ttagtatctc?attataacta 540

ggtattatga?ggtaccaaat?ttacaataga?aaaaatagta?cttcatggta?ctttcttaag 600

taccgtaaaa?ttgctcctat?atttaagggg?atgtttatat?ctatccatat?ccataatttg 660

attttgataa?gaaaaaatgt?gagcacacca?agcatgtcca?tgaccttgca?ctcttggctc 720

actcgtcaac?tgtgaagaac?ctcaaaaatg?ctcaatatag?ctacaggtgc?ctgaaaaaat 780

aactttaaag?ttttgaacat?cgatttcact?aaacaacaat?tattatctcc?ctctgaaaga 840

tgatagttta?gaactctaga?atcattgtcg?gcggagaaag?taaattattt?tccccaaatt 900

tccagctatg?aaaaaaccct?caccaaacac?catcaaacaa?gagttcacca?aaccgcccat 960

gcggccatgc?tgtcacgcaa?cgcaccgcat?tgcctgatgg?ccgctcgatg?catgcatgct 1020

tccccgtgca?catatccgac?agacgcgccg?tgtcagcgag?ctcctcgacc?gacctgtgta 1080

gcccatgcaa?gcatccaccc?ccgccacgta?caccccctcc?tcctccctac?gtgtcaccgc 1140

tctctccacc?tatatatgcc?cacctggccc?ctctcctccc?atctccactt?cacccgatcg 1200

cttcttcttc?ttcttcgttg?cattcatctt?gctagc 1236

<210>111

<211>1455

<212>DNA

<213> soybean (Glycine max)

<220>

<221>misc_feature

<222>(1043)..(1044)

<223>n is a, c, g, or t

<400>111

atgtctgact?cactcttaac?tttctattct?ctttcagcca?ttcttgctct?tctcccaatc 60

ttcatcttca?ttctcatcaa?aagaaagcaa?agcaaaccca?ggctcaacct?tcccccaggt 120

aacatgggtt?ggccatttct?tggtgaaacc?attggctatt?tgaagcctta?ttctgccacc 180

acagtagggg?aattcatgga?gcaacacata?gcaaggtatg?gtacaattta?caagtcaaaa 240

ctgtttgcgg?ggccagcaat?agtgtcagca?gatgcaggac?tcaacaggtt?cattctacaa 300

aacgaaggga?aattgttcga?gtgcagctat?cctagaagca?tcggtggaat?actaggaaaa 360

tggtccatgt?tggtcttagt?tggtgacatg?catagagaca?tgcgggttat?atcactcaac 420

tttctaagcc?acgccaggct?cagaacacac?ctcttgaaag?aggtggagaa?gcaatccctc 480

ttggttctga?actcttggag?ccaaaattcc?atattctcag?cccaagatga?agctaagaag 540

ttcaccttca?atttaatggc?taagcatatc?atgagcatgg?atcctgggga?tatcgagaca 600

gagcaactaa?agaaagagta?cgtcactttc?atgaaagggg?tggtttccgc?gccattgaat 660

ttacctggaa?ctgcataccg?aaaggcattg?aagtctcggt?ccattatact?aaagttcata 720

gaggggaaaa?tggaagagag?agttagaaga?atccaagagg?ggaatgagag?tttggaggaa 780

gatgatcttc?taaattgggt?tttgaagaat?tcaaatcttt?caaccgagca?aattcttgac 840

ttgattctca?gcttgctctt?cgctggccat?gaaacttcgt?cggtagccat?agctctagcc 900

atttacttct?tacccggttg?tcctcaagct?atacaacagt?taaaggaaga?acacagagaa 960

attgccagag?ccaaaaagca?agcaggggaa?gttgaactca?cttgggatga?ctacaaacga 1020

atggaattta?ctcattgtgt?aannttggga?aatgttgtga?ggtttctcca?caggaaggct 1080

gtgaaagatg?ttaactataa?aggttatgac?attccatgtg?ggtggaaagt?cctcccggtg 1140

attgcagccg?tgcatctgga?tccttcactt?tttgaccaac?ctcaacactt?caatccatgg 1200

agatggcaga?acaatggcag?tcatggaagt?tgtccaagca?agaacacagc?aaacaacaac 1260

tttcttccgt?tcggaggagg?accacgatta?tgtgcaggat?cagagttagc?taagcttgaa 1320

atggctgttt?tcattcacca?tctcattctc?aactaceatt?gggaattggc?tgataccgat 1380

caagcttttg?cctacccttt?tgtcgacttc?cccaaaggcc?tacccgttag?agtccaagcc 1440

cattctttac?tttga 1455

<210>112

<211>530

<212>PRT

<213> soybean

<220>

<221> is uncertain

<222>(391)..(392)

<223>Xaa can be any natural amino acid

<400>112

Met?Ser?Asp?Ser?Leu?Leu?Thr?Phe?Tyr?Ser?Leu?Ser?Ala?Ile?Leu?Ala

1 5 10 15

Leu?Leu?Pro?Ile?Phe?Ile?Phe?Ile?Leu?Ile?Lys?Arg?Lys?Gln?Ser?Lys

20 25 30

Pro?Arg?Leu?Asn?Leu?Pro?Pro?Gly?Asn?Met?Gly?Trp?Pro?Phe?Leu?Gly

35 40 45

Glu?Thr?Ile?Gly?Tyr?Leu?Lys?Pro?Tyr?Ser?Ala?Thr?Thr?Val?Gly?Glu

50 55 60

Phe?Met?Glu?Gln?His?Ile?Ala?Arg?Tyr?Gly?Thr?Ile?Tyr?Lys?Ser?Lys

65 70 75 80

Leu?Phe?Ala?Gly?Pro?Ala?Ile?Val?Ser?Ala?Asp?Ala?Gly?Leu?Asn?Arg

85 90 95

Phe?Ile?Leu?Gln?Asn?Glu?Gly?Lys?Leu?Phe?Glu?Cys?Ser?Tyr?Pro?Arg

100 105 110

Ser?Ile?Gly?Gly?Ile?Leu?Gly?Lys?Trp?Ser?Met?Leu?Val?Leu?Val?Gly

115 120 125

Asp?Met?His?Arg?Asp?Met?Arg?Val?Ile?Ser?Leu?Asn?Phe?Leu?Ser?His

130 135 140

Ala?Arg?Leu?Arg?Thr?His?Leu?Leu?Lys?Glu?Val?Glu?Lys?Gln?Ser?Leu

145 150 155 160

Leu?Val?Leu?Asn?Ser?Trp?Ser?Gln?Asn?Ser?Ile?Phe?Ser?Ala?Gln?Asp

165 170 175

Glu?Ala?Lys?Lys?Phe?Thr?Phe?Asn?Leu?Met?Ala?Lys?His?Ile?Met?Ser

180 185 190

Met?Asp?Pro?Gly?Asp?Ile?Glu?Thr?Glu?Gln?Leu?Lys?Lys?Glu?Tyr?Val

195 200 205

Thr?Phe?Met?Lys?Gly?Val?Val?Ser?Ala?Pro?Leu?Asn?Leu?Pro?Gly?Thr

210 215 220

Ala?Tyr?Arg?Lys?Ala?Leu?Lys?Ser?Arg?Ser?Ile?Ile?Leu?Lys?Phe?Ile

225 230 235 240

Glu?Gly?Lys?Met?Glu?Glu?Arg?Val?Arg?Arg?Ile?Gln?Glu?Gly?Asn?Glu

245 250 255

Ser?Leu?Glu?Glu?Asp?Asp?Leu?Leu?Asn?Trp?Val?Leu?Lys?Asn?Ser?Asn

260 265 270

Leu?Ser?Thr?Glu?Gln?Ile?Leu?Asp?Leu?Ile?Leu?Ser?Leu?Leu?Phe?Ala

275 280 285

Gly?His?Glu?Thr?Ser?Ser?Val?Ala?Ile?Ala?Leu?Ala?Ile?Tyr?Phe?Leu

290 295 300

Pro?Gly?Cys?Pro?Gln?Ala?Ile?Gln?Gln?Leu?Lys?Glu?Glu?His?Arg?Glu

305 310 315 320

Ile?Ala?Arg?Ala?Lys?Lys?Gln?Ala?Gly?Glu?Val?Glu?Leu?Thr?Trp?Asp

325 330 335

Asp?Tyr?Lys?Arg?Met?Glu?Phe?Thr?His?Cys?Val?Ser?Gly?Met?Ile?Ile

340 345 350

Asn?Glu?Leu?Trp?Arg?Ser?Thr?Cys?Leu?Phe?Phe?Tyr?Phe?Met?Tyr?Ser

355 360 365

Asn?Cys?Tyr?Tyr?Tyr?Tyr?Leu?Met?Asn?Met?Leu?Val?Val?Ser?Asn?Ile

370 375 380

Ile?Trp?Asp?Asp?Glu?Ala?Xaa?Xaa?Val?Gly?Leu?Gly?Asn?Val?Val?Arg

385 390 395 400

Phe?Leu?His?Arg?Lys?Ala?Val?Lys?Asp?Val?Asn?Tyr?Lys?Gly?Tyr?Asp

405 410 415

Ile?Pro?Cys?Gly?Trp?Lys?Val?Leu?Pro?Val?Ile?Ala?Ala?Val?His?Leu

420 425 430

Asp?Pro?Ser?Leu?Phe?Asp?Gln?Pro?Gln?His?Phe?Asn?Pro?Trp?Arg?Trp

435 440 445

Gln?Asn?Asn?Gly?Ser?His?Gly?Ser?Cys?Pro?Ser?Lys?Asn?Thr?Ala?Asn

450 455 460

Asn?Asn?Phe?Leu?Pro?Phe?Gly?Gly?Gly?Pro?Arg?Leu?Cys?Ala?Gly?Ser

465 470 475 480

Glu?Leu?Ala?Lys?Leu?Glu?Met?Ala?Val?Phe?Ile?His?His?Leu?Ile?Leu

485 490 495

Asn?Tyr?His?Trp?Glu?Leu?Ala?Asp?Thr?Asp?Gln?Ala?Phe?Ala?Tyr?Pro

500 505 510

Phe?Val?Asp?Phe?Pro?Lys?Gly?Leu?Pro?Val?Arg?Val?Gln?Ala?His?Ser

515 520 525

Leu?Leu

530

<210>113

<211>1458

<212>DNA

<213> upland cotton

<400>113

atgcctgact?cagagcctat?tttcttgctt?ctaccatcta?ttttatcttt?gattctgttc 60

ttcattctca?tcaagagaaa?gcaaagaagg?tataatcttc?caccagggaa?catggggtgg 120

ccttttctcg?gcgaaacaat?cggttacttg?aggccttact?ctgctacttc?agtaggtgaa 180

ttcatgcacc?agcatatatc?aaggtatggg?aatatctaca?aatcgaattt?gtttggtgag 240

aagacaatag?tgtctgcaga?tgctgggttg?aacaagttca?tattacaaaa?cgaagggaga 300

ttattcgagt?gcagttaccc?gagaagcatt?ggtggcattc?ttgggaaatg?gtcgatgctg 360

gttttggttg?gggatatgca?tagagacatg?aggattatat?cactcaactt?cttgagcaac 420

gccaggctga?ggactcatct?tttgagagaa?gtggagaaac?atactttgct?tgttctaaat 480

acttggaaag?agaagtgcat?attttcagct?caggatgaag?caaaaaagtt?cactttcaat 540

ttggtggcaa?aaaatatcat?gagcatggac?cctggacatc?cagagacgga?gcagctaaag 600

aaagaatatg?ttactttcat?gaaaggagtc?gtttctgctc?ctttaaattt?acctggaact 660

gcatacagaa?aagccttaca?atctcgatca?acaatcctga?aatttattga?aaagaaaatg 720

gaagtaagga?taaggaaaat?gaaggaagga?aaagaaaact?cagaggaaga?tgatcttctt 780

gaatgggtct?taaagcattc?taatctttcc?acagagcaaa?tccttgactt?gattttgagc 840

ttgctttttg?ctggacatga?gacctcctcg?gtagccataa?ccttagccat?ctacttcttg 900

ccaggttgtc?ctttggccat?tcaacagttg?agagaagaac?accttgaagt?tgccagagcc 960

aagaaccaat?caggagagac?tgaactcaac?tgggatgatt?acaagaaaat?ggagttcact 1020

caatgtgtta?ttaacgagac?acttaggctt?ggtaatgtcg?tcagatttct?ccacagaaaa 1080

gctctcaaag?atattagata?taaaggttat?gatattccat?gtgggtggaa?agtgcttcca 1140

gtgattgcag?cagtgcactt?ggatccctgt?ctttttgacc?accctcaact?cttcaatcca 1200

tggcgatggc?agcaaaataa?tgggagtcga?ggggcgggga?cggcaacgtc?atcagcgagc 1260

agcagcaatt?acttcatgcc?attcggggga?ggaccacggc?tatgtgcagg?aacagagctg 1320

gctaaactgg?aaatggcggt?gttcatccac?catttggtcc?tcaactacca?gtgggagtta 1380

gccgatacgg?atgaagcctt?tgccttccct?tttgtcgact?tccctaaagg?cctacccatc 1440

agagtcttca?aatcttaa 1458

<210>114

<211>485

<212>PRT

<213> upland cotton

<400>114

Met?Pro?Asp?Ser?Glu?Pro?Ile?Phe?Leu?Leu?Leu?Pro?Ser?Ile?Leu?Ser

1 5 10 15

Leu?Ile?Leu?Phe?Phe?Ile?Leu?Ile?Lys?Arg?Lys?Gln?Arg?Arg?Tyr?Asn

20 25 30

Leu?Pro?Pro?Gly?Asn?Met?Gly?Trp?Pro?Phe?Leu?Gly?Glu?Thr?Ile?Gly

35 40 45

Tyr?Leu?Arg?Pro?Tyr?Ser?Ala?Thr?Ser?Val?Gly?Glu?Phe?Met?His?Gln

50 55 60

His?Ile?Ser?Arg?Tyr?Gly?Asn?Ile?Tyr?Lys?Ser?Asn?Leu?Phe?Gly?Glu

65 70 75 80

Lys?Thr?Ile?Val?Ser?Ala?Asp?Ala?Gly?Leu?Asn?Lys?Phe?Ile?Leu?Gln

85 90 95

Asn?Glu?Gly?Arg?Leu?Phe?Glu?Cys?Ser?Tyr?Pro?Arg?Ser?Ile?Gly?Gly

100 105 110

Ile?Leu?Gly?Lys?Trp?Ser?Met?Leu?Val?Leu?Val?Gly?Asp?Met?His?Arg

115 120 125

Asp?Met?Arg?Ile?Ile?Ser?Leu?Asn?Phe?Leu?Ser?Asn?Ala?Arg?Leu?Arg

130 135 140

Thr?His?Leu?Leu?Arg?Glu?Val?Glu?Lys?His?Thr?Leu?Leu?Val?Leu?Asn

145 150 155 160

Thr?Trp?Lys?Glu?Lys?Cys?Ile?Phe?Ser?Ala?Gln?Asp?Glu?Ala?Lys?Lys

165 170 175

Phe?Thr?Phe?Asn?Leu?Val?Ala?Lys?Asn?Ile?Met?Ser?Met?Asp?pro?Gly

180 185 190

His?Pro?Glu?Thr?Glu?Gln?Leu?Lys?Lys?Glu?Tyr?Val?Thr?Phe?Met?Lys

195 200 205

Gly?Val?Val?Ser?Ala?Pro?Leu?Asn?Leu?Pro?Gly?Thr?Ala?Tyr?Arg?Lys

210 215 220

Ala?Leu?Gln?Ser?Arg?Ser?Thr?Ile?Leu?Lys?Phe?Ile?Glu?Lys?Lys?Met

225 230 235 240

Glu?Val?Arg?Ile?Arg?Lys?Met?Lys?Glu?Gly?Lys?Glu?Asn?Ser?Glu?Glu

245 250 255

Asp?Asp?Leu?Leu?Glu?Trp?Val?Leu?Lys?His?Ser?Asn?Leu?Ser?Thr?Glu

260 265 270

Gln?Ile?Leu?Asp?Leu?Ile?Leu?Ser?Leu?Leu?Phe?Ala?Gly?His?Glu?Thr

275 280 285

Ser?Ser?Val?Ala?Ile?Thr?Leu?Ala?Ile?Tyr?Phe?Leu?Pro?Gly?Cys?Pro

290 295 300

Leu?Ala?Ile?Gln?Gln?Leu?Arg?Glu?Glu?His?Leu?Glu?Val?Ala?Arg?Ala

305 310 315 320

Lys?Asn?Gln?Ser?Gly?Glu?Thr?Glu?Leu?Asn?Trp?Asp?Asp?Tyr?Lys?Lys

325 330 335

Met?Glu?Phe?Thr?Gln?Cys?Val?Ile?Asn?Glu?Thr?Leu?Arg?Leu?Gly?Asn

340 345 350

Val?Val?Arg?Phe?Leu?His?Arg?Lys?Ala?Leu?Lys?Asp?Ile?Arg?Tyr?Lys

355 360 365

Gly?Tyr?Asp?Ile?Pro?Cys?Gly?Trp?Lys?Val?Leu?Pro?Val?Ile?Ala?Ala

370 375 380

Val?His?Leu?Asp?Pro?Cys?Leu?Phe?Asp?His?Pro?Gln?Leu?Phe?Asn?Pro

385 390 395 400

Trp?Arg?Trp?Gln?Gln?Asn?Asn?Gly?Ser?Arg?Gly?Ala?Gly?Thr?Ala?Thr

405 410 415

Ser?Ser?Ala?Ser?Ser?Ser?Asn?Tyr?Phe?Met?Pro?Phe?Gly?Gly?Gly?Pro

420 425 430

Arg?Leu?Cys?Ala?Gly?Thr?Glu?Leu?Ala?Lys?Leu?Glu?Met?Ala?Val?Phe

435 440 445

Ile?His?His?Leu?Val?Leu?Asn?Tyr?Gln?Trp?Glu?Leu?Ala?Asp?Thr?Asp

450 455 460

Glu?Ala?Phe?Ala?Phe?Pro?Phe?Val?Asp?Phe?Pro?Lys?Gly?Leu?Pro?Ile

465 470 475 480

Arg?Val?Phe?Lys?Ser

485

<210>115

<211>1521

<212>DNA

<213> Zea mays

<400>115

atgggcgcca?tgatggcctc?cataaccagc?gagctcctct?tcttccttcc?cttcatcctg 60

ctggccctcc?tcgccttgta?caccaccacc?gtegccaaat?gccacggcac?ccacccgtgg 120

cgccgtcaga?agaagaagcg?gcccaacctg?cccccgggcg?cccgcggatg?gcccttggtc 180

ggcgaaactt?tcggctacct?ccgcgcccac?ccggccacct?ccgtgggccg?cttcatggag 240

cggcatgtcg?cacggtacgg?gaagatatac?cggtcgagcc?tgttcgggga?gcggacggtg 300

gtgtcggcgg?acgcggggct?gaaccgctac?atcctgcaga?acgaggggcg?gctgttcgag 360

tgcagctacc?cgcgcagcat?cggcggcatc?ctgggcaagt?ggtccatgct?ggtgctcgtg 420

ggcgacgcgc?accgcgagat?gcgcgctatc?tcgctcaact?tcctcagctc?cgtccgcctc 480

cgcgccgtgc?tgctccccga?ggtggagcgc?cacaccctgc?tggtcctccg?ctcgtggccg 540

ccctccgacg?gcaccttctc?cgcccagcac?gaagccaaga?agttcacgtt?taacctgatg 600

gcgaagaaca?taatgagcat?ggaccccggc?gaggaggaga?cggagcggct?gcggctggag 660

tacatcacct?tcatgaaggg?cgtcgtgtca?gcgccgctca?acttcccggg?cacggcctac 720

tggaaggcgc?tcaagtcacg?cgcgtccata?cttggagtga?tagagaggaa?gatggaggac 780

aggcttgaga?agatgagcag?ggagaagtca?agcgtggagg?aggacgacct?tcttggatgg 840

gccctgaagc?aatccaacct?gtccaaggaa?cagatcctgg?acctcttgct?gagcctgctc 900

ttcgcggggc?acgagacttc?gtccatggcg?ctcgccctcg?ccatcttctt?cctcgaaggg 960

tgccctaagg?ccgtgcaaga?actccgggag?gagcatctcc?tgattgctag?gagacaaagg 1020

ctaagagggg?cgtctaaatt?gagctgggaa?gactacaagg?aaatggtttt?cacgcagtgt 1080

gttataaacg?agacattgcg?gctcggcaac?gtggtcaggt?tcctgcaccg?gaaggtcatc 1140

cgagatgtac?actacaatgg?gtacgacata?ccgcgggggt?ggaaaatcct?gccggttcta 1200

gcggcggtgc?acctggactc?gtcgctgtac?gaggacccca?gccggttcaa?cccttggaga 1260

tggaagagca?acaacgcgcc?aagcagcttc?atgccgtacg?gcggcgggcc?gcggctgtgc 1320

gccgggtcgg?agctggccaa?gctggagatg?gccatcttcc?tgcaccacct?ggtgctcaac 1380

ttccggtggg?agctggcgga?gccggaccag?gccttcgttt?accctttcgt?cgacttcccc 1440

aagggcctcc?cgatcagggt?ccagcgggtc?gccgacgacc?aaggccatcg?tagcgttttg 1500

accgagagca?caagaggctg?a 1521

<210>116

<211>506

<212>PRT

<213> Zea mays

<400>116

Met?Gly?Ala?Met?Met?Ala?Ser?Ile?Thr?Ser?Glu?Leu?Leu?Phe?Phe?Leu

1 5 10 15

Pro?Phe?Ile?Leu?Leu?Ala?Leu?Leu?Ala?Leu?Tyr?Thr?Thr?Thr?Val?Ala

20 25 30

Lys?Cys?His?Gly?Thr?His?Pro?Trp?Arg?Arg?Gln?Lys?Lys?Lys?Arg?Pro

35 40 45

Asn?Leu?Pro?Pro?Gly?Ala?Arg?Gly?Trp?Pro?Leu?Val?Gly?Glu?Thr?Phe

50 55 60

Gly?Tyr?Leu?Arg?Ala?His?Pro?Ala?Thr?Ser?Val?Gly?Arg?Phe?Met?Glu

65 70 75 80

Arg?His?Val?Ala?Arg?Tyr?Gly?Lys?Ile?Tyr?Arg?Ser?Ser?Leu?Phe?Gly

85 90 95

Glu?Arg?Thr?Val?Val?Ser?Ala?Asp?Ala?Gly?Leu?Asn?Arg?Tyr?Ile?Leu

100 105 110

Gln?Asn?Glu?Gly?Arg?Leu?Phe?Glu?Cys?Ser?Tyr?Pro?Arg?Ser?Ile?Gly

115 120 125

Gly?Ile?Leu?Gly?Lys?Trp?Ser?Met?Leu?Val?Leu?Val?Gly?Asp?Ala?His

130 135 140

Arg?Glu?Met?Arg?Ala?Ile?Ser?Leu?Asn?Phe?Leu?Ser?Ser?Val?Arg?Leu

145 150 155 160

Arg?Ala?Val?Leu?Leu?Pro?Glu?Val?Glu?Arg?His?Thr?Leu?Leu?Val?Leu

165 170 175

Arg?Ser?Trp?Pro?Pro?Ser?Asp?Gly?Thr?Phe?Ser?Ala?Gln?His?Glu?Ala

180 185 190

Lys?Lys?Phe?Thr?Phe?Asn?Leu?Met?Ala?Lys?Asn?Ile?Met?Ser?Met?Asp

195 200 205

Pro?Gly?Glu?Glu?Glu?Thr?Glu?Arg?Leu?Arg?Leu?Glu?Tyr?Ile?Thr?Phe

210 215 220

Met?Lys?Gly?Val?Val?Ser?Ala?Pro?Leu?Asn?Phe?Pro?Gly?Thr?Ala?Tyr

225 230 235 240

Trp?Lys?Ala?Leu?Lys?Ser?Arg?Ala?Ser?Ile?Leu?Gly?Val?Ile?Glu?Arg

245 250 255

Lys?Met?Glu?Asp?Arg?Leu?Glu?Lys?Met?Ser?Arg?Glu?Lys?Ser?Ser?Val

260 265 270

Glu?Glu?Asp?Asp?Leu?Leu?Gly?Trp?Ala?Leu?Lys?Gln?Ser?Asn?Leu?Ser

275 280 285

Lys?Glu?Gln?Ile?Leu?Asp?Leu?Leu?Leu?Ser?Leu?Leu?Phe?Ala?Gly?His

290 295 300

Glu?Thr?Ser?Ser?Met?Ala?Leu?Ala?Leu?Ala?Ile?Phe?Phe?Leu?Glu?Gly

305 310 315 320

Cys?Pro?Lys?Ala?Val?Gln?Glu?Leu?Arg?Glu?Glu?His?Leu?Leu?Ile?Ala

325 330 335

Arg?Arg?Gln?Arg?Leu?Arg?Gly?Ala?Ser?Lys?Leu?Ser?Trp?Glu?Asp?Tyr

340 345 350

Lys?Glu?Met?Val?Phe?Thr?Gln?Cys?Val?Ile?Asn?Glu?Thr?Leu?Arg?Leu

355 360 365

Gly?Asn?Val?Val?Arg?Phe?Leu?His?Arg?Lys?Val?Ile?Arg?Asp?Val?His

370 375 380

Tyr?Asn?Gly?Tyr?Asp?Ile?Pro?Arg?Gly?Trp?Lys?Ile?Leu?Pro?Val?Leu

385 390 395 400

Ala?Ala?Val?His?Leu?Asp?Ser?Ser?Leu?Tyr?Glu?Asp?Pro?Ser?Arg?Phe

405 410 415

Asn?Pro?Trp?Arg?Trp?Lys?Ser?Asn?Asn?Ala?Pro?Ser?Ser?Phe?Met?Pro

420 425 430

Tyr?Gly?Gly?Gly?Pro?Arg?Leu?Cys?Ala?Gly?Ser?Glu?Leu?Ala?Lys?Leu

435 440 445

Glu?Met?Ala?Ile?Phe?Leu?His?His?Leu?Val?Leu?Asn?Phe?Arg?Trp?Glu

450 455 460

Leu?Ala?Glu?Pro?Asp?Gln?Ala?Phe?Val?Tyr?Pro?Phe?Val?Asp?Phe?Pro

465 470 475 480

Lys?Gly?Leu?Pro?Ile?Arg?Val?Gln?Arg?Val?Ala?Asp?Asp?Gln?Gly?His

485 490 495

Arg?Ser?Val?Leu?Thr?Glu?Ser?Thr?Arg?Gly

500 505

<210>117

<211>1566

<212>DNA

<213> Zea mays

<400>117

atgggcgcca?tgatggcctc?cataaccagc?gagctcctct?tcttccttcc?cttcatcctg 60

ctggccctcc?tcgccttgta?caccaccacc?gtcgccaaat?gccacggcac?ccaccagtgg 120

cgccgtcaga?agaagaagcg?gcccaacctg?cccccgggcg?cccgcggatg?gcccttggtc 180

ggcgagactt?tcggctacct?ccgcgcccac?ccggccacct?ccgtgggccg?cttcatggag 240

cggcatgtcg?cacggtacgg?gaagatatac?cggtcgagcc?tgttcgggga?gcggacggtg 300

gtgtcggcgg?acgcggggct?gaaccggtac?atcctgcaga?acgaggggcg?gctgttcgag 360

tgcagctacc?cgcgcagcat?cggcggcatc?ctgggcaagt?ggtccatgct?ggtgctcgtg 420

ggcgacgcgc?accgcgagat?gcgcgctatc?tcgctcaact?tcctcagctc?cgtccgcctc 480

cgcgccgtgc?tgctccccga?ggtggagcgc?cacaccctgc?tggtcctccg?ctcctggccg 540

cctccgaccg?gcaccttctc?cgcccagcac?gaagccaaga?agttcacgtt?taacctgatg 600

gcgaagaaca?taatgagcat?ggaccccggc?gaggaggaga?cggagcggct?gcggctggag 660

tacatcacct?tcatgaaggg?cgtcgtgtca?gcgccgctca?acttcccggg?cacggcctac 720

tggaaggcgc?tcaagtcgcg?cgcgtccata?cttggagtga?tagagaggaa?gatggaggac 780

aggcttgaga?agatgagcag?ggagaagtca?agcgtggagg?aggacgacct?tcttggatgg 840

gccctgaagc?aatccaacct?gtccaaggaa?cagatcctgg?acctcttgct?gagcctgctc 900

ttcgcggggc?acgagacttc?gtccatggcg?ctcgccctcg?ccatcttctt?cctcgaaggg 960

tgccctaagg?ccgtgcaaga?actccgggag?gagcatctcc?tgattgctag?gagacaaagg 1020

ctaagggggg?cgtccaaatt?gagctgggaa?gactacaagg?aaatggtttt?cacgcagtgt 1080

gttataaacg?agacattgcg?gctcggcaac?gtggtcaggt?tcctgcaccg?gaaggtcatc 1140

cgagatgtac?actacaatgg?gtacgacata?ccgcgggggt?ggaaaatcct?gccggttcta 1200

gcggcggtgc?acctggactc?gtcgctgtac?gaggatccca?gccggttcaa?cccttggaga 1260

tggaaggtca?gtgccctgcc?ccctcccctc?gcaaaaggca?caagccaagg?gacaagcaag 1320

aggtttacac?cgttcggtgg?tggcccccgg?ctctgcccag?gatcagagct?cgctaaagtg 1380

gagactgctt?tcttcctcca?tcaccttgtc?ctcaattata?gatggagaat?tgatggcgat 1440

gacattccaa?tggcataccc?gtatgtggag?tttcagagag?gtctgccaat?agaaatcgag 1500

ccaacgtccc?ctgaatttga?ctgtcctgga?gctacagcca?tcagttatca?caccagagag 1560

aaatga 1566

<210>118

<211>521

<212>PRT

<213> Zea mays

<400>118

Met?Gly?Ala?Met?Met?Ala?Ser?Ile?Thr?Ser?Glu?Leu?Leu?Phe?Phe?Leu

1 5 10 15

Pro?Phe?Ile?Leu?Leu?Ala?Leu?Leu?Ala?Leu?Tyr?Thr?Thr?Thr?Val?Ala

20 25 30

Lys?Cys?His?Gly?Thr?His?Gln?Trp?Arg?Arg?Gln?Lys?Lys?Lys?Arg?Pro

35 40 45

Asn?Leu?Pro?Pro?Gly?Ala?Arg?Gly?Trp?Pro?Leu?Val?Gly?Glu?Thr?Phe

50 55 60

Gly?Tyr?Leu?Arg?Ala?His?Pro?Ala?Thr?Ser?Val?Gly?Arg?Phe?Met?Glu

65 70 75 80

Arg?His?Val?Ala?Arg?Tyr?Gly?Lys?Ile?Tyr?Arg?Ser?Ser?Leu?Phe?Gly

85 90 95

Glu?Arg?Thr?Val?Val?Ser?Ala?Asp?Ala?Gly?Leu?Asn?Arg?Tyr?Ile?Leu

100 105 110

Gln?Asn?Glu?Gly?Arg?Leu?Phe?Glu?Cys?Ser?Tyr?Pro?Arg?Ser?Ile?Gly

115 120 125

Gly?Ile?Leu?Gly?Lys?Trp?Ser?Met?Leu?Val?Leu?Val?Gly?Asp?Ala?His

130 135 140

Arg?Glu?Met?Arg?Ala?Ile?Ser?Leu?Asn?Phe?Leu?Ser?Ser?Val?Arg?Leu

145 150 155 160

Arg?Ala?Val?Leu?Leu?Pro?Glu?Val?Glu?Arg?His?Thr?Leu?Leu?Val?Leu

165 170 175

Arg?Ser?Trp?Pro?Pro?Pro?Thr?Gly?Thr?Phe?Ser?Ala?Gln?His?Glu?Ala

180 185 190

Lys?Lys?Phe?Thr?Phe?Asn?Leu?Met?Ala?Lys?Asn?Ile?Met?Ser?Met?Asp

195 200 205

Pro?Gly?Glu?Glu?Glu?Thr?Glu?Arg?Leu?Arg?Leu?Glu?Tyr?Ile?Thr?Phe

210 215 220

Met?Lys?Gly?Val?Val?Ser?Ala?Pro?Leu?Asn?Phe?Pro?Gly?Thr?Ala?Tyr

225 230 235 240

Trp?Lys?Ala?Leu?Lys?Ser?Arg?Ala?Ser?Ile?Leu?Gly?Val?Ile?Glu?Arg

245 250 255

Lys?Met?Glu?Asp?Arg?Leu?Glu?Lys?Met?Ser?Arg?Glu?Lys?Ser?Ser?Val

260 265 270

Glu?Glu?Asp?Asp?Leu?Leu?Gly?Trp?Ala?Leu?Lys?Gln?Ser?Asn?Leu?Ser

275 280 285

Lys?Glu?Gln?Ile?Leu?Asp?Leu?Leu?Leu?Ser?Leu?Leu?Phe?Ala?Gly?His

290 295 300

Glu?Thr?Ser?Ser?Met?Ala?Leu?Ala?Leu?Ala?Ile?Phe?Phe?Leu?Glu?Gly

305 310 315 320

Cys?Pro?Lys?Ala?Val?Gln?Glu?Leu?Arg?Glu?Glu?His?Leu?Leu?Ile?Ala

325 330 335

Arg?Arg?Gln?Arg?Leu?Arg?Gly?Ala?Ser?Lys?Leu?Ser?Trp?Glu?Asp?Tyr

340 345 350

Lys?Glu?Met?Val?Phe?Thr?Gln?Cys?Val?Ile?Asn?Glu?Thr?Leu?Arg?Leu

355 360 365

Gly?Asn?Val?Val?Arg?Phe?Leu?His?Arg?Lys?Val?Ile?Arg?Asp?Val?His

370 375 380

Tyr?Asn?Gly?Tyr?Asp?Ile?Pro?Arg?Gly?Trp?Lys?Ile?Leu?Pro?Val?Leu

385 390 395 400

Ala?Ala?Val?His?Leu?Asp?Ser?Ser?Leu?Tyr?Glu?Asp?Pro?Ser?Arg?Phe

405 410 415

Asn?Pro?Trp?Arg?Trp?Lys?Val?Ser?Ala?Leu?Pro?Pro?Pro?Leu?Ala?Lys

420 425 430

Gly?Thr?Ser?Gln?Gly?Thr?Ser?Lys?Arg?Phe?Thr?Pro?Phe?Gly?Gly?Gly

435 440 445

Pro?Arg?Leu?Cys?Pro?Gly?Ser?Glu?Leu?Ala?Lys?Val?Glu?Thr?Ala?Phe

450 455 460

Phe?Leu?His?His?Leu?Val?Leu?Asn?Tyr?Arg?Trp?Arg?Ile?Asp?Gly?Asp

465 470 475 480

Asp?Ile?Pro?Met?Ala?Tyr?Pro?Tyr?Val?Glu?Phe?Gln?Arg?Gly?Leu?Pro

485 490 495

Ile?Glu?Ile?Glu?Pro?Thr?Ser?Pro?Glu?Phe?Asp?Cys?Pro?Gly?Ala?Thr

500 505 510

Ala?Ile?Ser?Tyr?His?Thr?Arg?Glu?Lys

515 520

<210>119

<211>1257

<212>DNA

<213> overgrown with weeds blue or green (Brassica rapa)

<220>

<221>misc_feature

<222>(967)..(969)

<223>n is a, c, g, or t

<400>119

atgttcgaaa?cagagcatac?tctcgtgcct?cttcttcttc?tcccatcact?tctatctctt 60

ctcctcttct?tgattctctt?gaagagacga?agtcgacaca?gtttcaatct?ccctcctgga 120

aaatctggat?ggccatttct?aggcgaaacc?atcggatatc?tcaaacctta?ctctgccaaa 180

actctcggtt?acttcatgca?acaacatatc?tccaagtatg?ggaagatata?tagatcgaat 240

ttgtttggag?aaccaacgat?cgtatcagct?gatgcaggac?tcaacaggtt?catattacaa 300

aacgaaggaa?gactctttga?atgtagttat?cctcgaagta?ttggtgggat?tcttgggaaa 360

tggtcgatgc?ttgttcttgt?tggagacatg?catagagaca?tgagaagtat?ctcgctaaac 420

tttctaagtc?acgctcgtct?cagaacgatt?cttcttaagg?acgttgagag?gcatactttg 480

ttcgttctta?attcttggca?acaacattct?gttttctctg?ctcaagatga?ggccaaaaag 540

tttacgttta?atctaatggc?gaagcatata?atgagtatgg?atcctggaga?agaagagaca 600

gagcagttaa?agaaagagta?tgtgactttc?atgaaagggg?ttgtttctgc?tcctctcaat 660

ctcccaggaa?ctgcttatcg?taaagctctc?cagcagtcac?gagggacgat?attgaagttt 720

attgagaaga?aaatggaaga?gagaaaatca?gagattcaag?aagaagacga?agaagatgaa 780

gcagagatta?gtagaagtga?tcattatgag?agaaaacata?gagcagatga?tgatcttttg 840

ggatgggttc?taaaacattc?caatctttcg?actgagcaaa?ttctcgatct?tattctcagt 900

ttattatttg?ccggacatga?gacatcatct?gtagccatcg?ctctcgctat?ctacttttta 960

gcgggcnnnt?tgaaggaaga?gcatcttgaa?atcgcgaggg?tgaagaagga?acttggagag 1020

tcagaattga?attgggatga?ttacaagaca?atggacttta?ctcatagtgt?tataaatgag 1080

actcttcgac?taggaaatgt?agtaaggttt?ttgcatcgta?aagcactcaa?aaacgttcgg 1140

tataaaggat?acgatatccc?aagtgggtgg?aaagtgttac?cagtgatctc?agccgtacat 1200

ttggataact?cccgttacga?cgaacctaat?ctctttaatc?cttggagatg?gcaacag 1257

<210>120

<211>419

<212>PRT

<213> is overgrown with weeds blue or green

<220>

<221> is uncertain

<222>(323)..(323)

<223>Xaa can be any natural amino acid

<400>120

Met?Phe?Glu?Thr?Glu?His?Thr?Leu?Val?Pro?Leu?Leu?Leu?Leu?Pro?Ser

1 5 10 15

Leu?Leu?Ser?Leu?Leu?Leu?Phe?Leu?Ile?Leu?Leu?Lys?Arg?Arg?Ser?Arg

20 25 30

His?Ser?Phe?Asn?Leu?Pro?Pro?Gly?Lys?Ser?Gly?Trp?Pro?Phe?Leu?Gly

35 40 45

Glu?Thr?Ile?Gly?Tyr?Leu?Lys?Pro?Tyr?Ser?Ala?Lys?Thr?Leu?Gly?Tyr

50 55 60

Phe?Met?Gln?Gln?His?Ile?Ser?Lys?Tyr?Gly?Lys?Ile?Tyr?Arg?Ser?Asn

65 70 75 80

Leu?Phe?Gly?Glu?Pro?Thr?Ile?Val?Ser?Ala?Asp?Ala?Gly?Leu?Asn?Arg

85 90 95

Phe?Ile?Leu?Gln?Asn?Glu?Gly?Arg?Leu?Phe?Glu?Cys?Ser?Tyr?Pro?Arg

100 105 110

Ser?Ile?Gly?Gly?Ile?Leu?Gly?Lys?Trp?Ser?Met?Leu?Val?Leu?Val?Gly

115 120 125

Asp?Met?His?Arg?Asp?Met?Arg?Ser?Ile?Ser?Leu?Asn?Phe?Leu?Ser?His

130 135 140

Ala?Arg?Leu?Arg?Thr?Ile?Leu?Leu?Lys?Asp?Val?Glu?Arg?His?Thr?Leu

145 150 155 160

Phe?Val?Leu?Asn?Ser?Trp?Gln?Gln?His?Ser?Val?Phe?Ser?Ala?Gln?Asp

165 170 175

Glu?Ala?Lys?Lys?Phe?Thr?Phe?Asn?Leu?Met?Ala?Lys?His?Ile?Met?Ser

180 185 190

Met?Asp?Pro?Gly?Glu?Glu?Glu?Thr?Glu?Gln?Leu?Lys?Lys?Glu?Tyr?Val

195 200 205

Thr?Phe?Met?Lys?Gly?Val?Val?Ser?Ala?Pro?Leu?Asn?Leu?Pro?Gly?Thr

210 215 220

Ala?Tyr?Arg?Lys?Ala?Leu?Gln?Gln?Ser?Arg?Gly?Thr?Ile?Leu?Lys?Phe

225 230 235 240

Ile?Glu?Lys?Lys?Met?Glu?Glu?Arg?Lys?Ser?Glu?Ile?Gln?Glu?Glu?Asp

245 250 255

Glu?Glu?Asp?Glu?Ala?Glu?Ile?Ser?Arg?Ser?Asp?His?Tyr?Glu?Arg?Lys

260 265 270

His?Arg?Ala?Asp?Asp?Asp?Leu?Leu?Gly?Trp?Val?Leu?Lys?His?Ser?Asn

275 280 285

Leu?Ser?Thr?Glu?Gln?Ile?Leu?Asp?Leu?Ile?Leu?Ser?Leu?Leu?Phe?Ala

290 295 300

Gly?His?Glu?Thr?Ser?Ser?Val?Ala?Ile?Ala?Leu?Ala?Ile?Tyr?Phe?Leu

305 310 315 320

Ala?Gly?Xaa?Leu?Lys?Glu?Glu?His?Leu?Glu?Ile?Ala?Arg?Val?Lys?Lys

325 330 335

Glu?Leu?Gly?Glu?Ser?Glu?Leu?Asn?Trp?Asp?Asp?Tyr?Lys?Thr?Met?Asp

340 345 350

Phe?Thr?His?Ser?Val?Ile?Asn?Glu?Thr?Leu?Arg?Leu?Gly?Asn?Val?Val

355 360 365

Arg?Phe?Leu?His?Arg?Lys?Ala?Leu?Lys?Asn?Val?Arg?Tyr?Lys?Gly?Tyr

370 375 380

Asp?Ile?Pro?Ser?Gly?Trp?Lys?Val?Leu?Pro?Val?Ile?Ser?Ala?Val?His

385 390 395 400

Leu?Asp?Asn?Ser?Arg?Tyr?Asp?Glu?Pro?Asn?Leu?Phe?Asn?Pro?Trp?Arg

405 410 415

Trp?Gln?Gln

<210>121

<211>848

<212>DNA

<213> barley

<400>121

atggccgcca?tgatggcatc?cataaccagc?gagctccttt?tcttcctccc?cttcatcctc 60

ctggccctgc?tcaccttcta?caccagcagc?gtggccaaat?gccatggcct?ccaccggtgg 120

agcggccgga?cgaagaagaa?gcggccgaat?ctgccgcccg?gcgccgccgg?ctggcctttc 180

gtcggcgaga?ccttcgggta?cctccgcgcc?cacccggcca?cctccatcgg?ccagttcatg 240

aaccagcaca?tcgcacggta?cgggaagata?taccggtcga?gcctgttcgg?ggagcggacg 300

gtggtgtcgg?cggacgcggg?gctgaaccgg?tacatcctgc?agaacgaggg?gcggctgttc 360

gagtgcagct?acccgcggag?catcggcggc?atcctgggca?aatggtccat?gctggtgctc 420

gtgggcgacc?cccaccgcga?gatgcgctcc?atctccctca?acttcctcag?ctccctccgc 480

ctccgcgccg?tgctcctccc?ggaggtggag?cgccacaccc?tcctcgtcct?ccgcgactgg 540

ctgccttcct?cctcctccgc?cgtcttctcc?gcccagcacg?aagccaagaa?gttcacgttt 600

aacctgatgg?cgaagaacat?catgagcatg?gaccccggcg?aggaggagac?ggagcggctg 660

aggctcgagt?acatcacctt?catgaagggg?gtggtgtccg?cgcccctcaa?cttccccggg 720

acggcctact?ggaaggccct?caagtctcga?gccaccatac?ttggggtaat?agagaggaaa 780

atggaggata?ggctcgagaa?aatgaacaag?gaggcctcga?gcatgaagaa?gatatctctc 840

ggggggcg 848

<210>122

<211>282

<212>PRT

<213> barley

<400>122

Met?Ala?Ala?Met?Met?Ala?Ser?Ile?Thr?Ser?Glu?Leu?Leu?Phe?Phe?Leu

1 5 10 15

Pro?Phe?Ile?Leu?Leu?Ala?Leu?Leu?Thr?Phe?Tyr?Thr?Ser?Ser?Val?Ala

20 25 30

Lys?Cys?His?Gly?Leu?His?Arg?Trp?Ser?Gly?Arg?Thr?Lys?Lys?Lys?Arg

35 40 45

Pro?Asn?Leu?Pro?Pro?Gly?Ala?Ala?Gly?Trp?Pro?Phe?Val?Gly?Glu?Thr

50 55 60

Phe?Gly?Tyr?Leu?Arg?Ala?His?Pro?Ala?Thr?Ser?Ile?Gly?Gln?Phe?Met

65 70 75 80

Asn?Gln?His?Ile?Ala?Arg?Tyr?Gly?Lys?Ile?Tyr?Arg?Ser?Ser?Leu?Phe

85 90 95

Gly?Glu?Arg?Thr?Val?Val?Ser?Ala?Asp?Ala?Gly?Leu?Asn?Arg?Tyr?Ile

100 105 110

Leu?Gln?Asn?Glu?Gly?Arg?Leu?Phe?Glu?Cys?Ser?Tyr?Pro?Arg?Ser?Ile

115 120 125

Gly?Gly?Ile?Leu?Gly?Lys?Trp?Ser?Met?Leu?Val?Leu?Val?Gly?Asp?Pro

130 135 140

His?Arg?Glu?Met?Arg?Ser?Ile?Ser?Leu?Asn?Phe?Leu?Ser?Ser?Leu?Arg

145 150 155 160

Leu?Arg?Ala?Val?Leu?Leu?Pro?Glu?Val?Glu?Arg?His?Thr?Leu?Leu?Val

165 170 175

Leu?Arg?Asp?Trp?Leu?Pro?Ser?Ser?Ser?Ser?Ala?Val?Phe?Ser?Ala?Gln

180 185 190

His?Glu?Ala?Lys?Lys?Phe?Thr?Phe?Asn?Leu?Met?Ala?Lys?Asn?Ile?Met

195 200 205

Ser?Met?Asp?Pro?Gly?Glu?Glu?Glu?Thr?Glu?Arg?Leu?Arg?Leu?Glu?Tyr

210 215 220

Ile?Thr?Phe?Met?Lys?Gly?Val?Val?Ser?Ala?Pro?Leu?Asn?Phe?Pro?Gly

225 230 235 240

Thr?Ala?Tyr?Trp?Lys?Ala?Leu?Lys?Ser?Arg?Ala?Thr?Ile?Leu?Gly?Val

245 250 255

Ile?Glu?Arg?Lys?Met?Glu?Asp?Arg?Leu?Glu?Lys?Met?Asn?Lys?Glu?Ala

260 265 270

Ser?Ser?Met?Lys?Lys?Ile?Ser?Leu?Gly?Gly

275 280

<210>123

<211>1200

<212>DNA

<213> light leaf Root or stem of Littleleaf Indianmulberry (Lotus japonicus)

<400>123

atgtctgact?catacctcac?tttctgtttt?ctttcttcca?ttcttgctct?cactgtaatc 60

atcattttca?tgaaaagaaa?gaaggcaagg?cttaaccttc?cccctggaaa?aatgggatgg 120

ccctttcttg?gggaaaccat?tgggtacttg?aagccatact?ctgctaccac?agtaggagat 180

tttatggaaa?agcacatagc?aaggtatggt?acaatttaca?agtcaaaatt?gtttggtgag 240

cctgcaatag?tttctgcaga?tgcagagttg?aacaggttca?tattacagaa?cgaagggaag 300

ctgtttgagt?gcagctatcc?aagaagcatt?ggaggaatac?ttggaaaatg?gtccatgttg 360

gtcttagttg?gggacatgca?tagggacatg?agaaacattt?cactgaactt?tctgagcctt 420

gctaggctca?aaacacatct?attgaaagaa?gtggagaagc?actctcttct?agttctaggc 480

tcttggaaag?aaaattgtac?attctcagct?caagatgaag?caaagaagtt?cacattcaat 540

ttgatggcga?aacatatcat?gagcttggat?cctgggaatc?tagagacaga?acagctgaag 600

aaagagtatg?tctctttcat?gaatggtgtg?gtgtctgcac?ctttgaattt?tcccggaact 660

gcatacagaa?aagcattaaa?gtctaggtcc?accatactga?agttcataga?gggaaaaatg 720

gaagaaagga?tcaaaagaaa?ccaaaatttg?gaggaagatc?ttctaaactg?ggttgtgatg 780

cattcaaatc?tttcaactga?gcaaattctt?gacctggttc?tgagcttgct?ctttgcaggc 840

catgaaactt?catctgtggc?tatagcttta?gctatttact?ttttgccagg?ttgtcctaaa 900

gctatacaac?aattaaggga?agaacataga?gaaatagcca?ggtccaagaa?gcaagcaggg 960

gaggttgaat?taacttggga?tgattacaaa?agaatggagt?ttactcaatg?tgtagttgtg 1020

aatgaaacac?tgaggttggg?aaatgttgtg?aggttccttc?acaggaaggc?tctgaaagat 1080

gttcggtaca?aaggttatga?cattccacgt?gggtggaaag?tcctccctgt?gatttcagct 1140

atgcatctgg?atcctgcact?tttttaccaa?cctcaacact?tcaatccatg?gagatggaag 1200

<210>124

<211>400

<212>PRT

<213> light leaf Root or stem of Littleleaf Indianmulberry

<400>124

Met?Ser?Asp?Ser?Tyr?Leu?Thr?Phe?Cys?Phe?Leu?Ser?Ser?Ile?Leu?Ala

1 5 10 15

Leu?Thr?Val?Ile?Ile?Ile?Phe?Met?Lys?Arg?Lys?Lys?Ala?Arg?Leu?Asn

20 25 30

Leu?Pro?Pro?Gly?Lys?Met?Gly?Trp?Pro?Phe?Leu?Gly?Glu?Thr?Ile?Gly

35 40 45

Tyr?Leu?Lys?Pro?Tyr?Ser?Ala?Thr?Thr?Val?Gly?Asp?Phe?Met?Glu?Lys

50 55 60

His?Ile?Ala?Arg?Tyr?Gly?Thr?Ile?Tyr?Lys?Ser?Lys?Leu?Phe?Gly?Glu

65 70 75 80

Pro?Ala?Ile?Val?Ser?Ala?Asp?Ala?Glu?Leu?Asn?Arg?Phe?Ile?Leu?Gln

85 90 95

Asn?Glu?Gly?Lys?Leu?Phe?Glu?Cys?Ser?Tyr?Pro?Arg?Ser?Ile?Gly?Gly

100 105 110

Ile?Leu?Gly?Lys?Trp?Ser?Met?Leu?Val?Leu?Val?Gly?Asp?Met?His?Arg

115 120 125

Asp?Met?Arg?Asn?Ile?Ser?Leu?Asn?Phe?Leu?Ser?Leu?Ala?Arg?Leu?Lys

130 135 140

Thr?His?Leu?Leu?Lys?Glu?Val?Glu?Lys?His?Ser?Leu?Leu?Val?Leu?Gly

145 150 155 160

Ser?Trp?Lys?Glu?Asn?Cys?Thr?Phe?Ser?Ala?Gln?Asp?Glu?Ala?Lys?Lys

165 170 175

Phe?Thr?Phe?Asn?Leu?Met?Ala?Lys?His?Ile?Met?Ser?Leu?Asp?Pro?Gly

180 185 190

Asn?Leu?Glu?Thr?Glu?Gln?Leu?Lys?Lys?Glu?Tyr?Val?Ser?Phe?Met?Asn

195 200 205

Gly?Val?Val?Ser?Ala?Pro?Leu?Asn?Phe?Pro?Gly?Thr?Ala?Tyr?Arg?Lys

210 215 220

Ala?Leu?Lys?Ser?Arg?Ser?Thr?Ile?Leu?Lys?Phe?Ile?Glu?Gly?Lys?Met

225 230 235 240

Glu?Glu?Arg?Ile?Lys?Arg?Asn?Gln?Asn?Leu?Glu?Glu?Asp?Leu?Leu?Asn

245 250 255

Trp?Val?Val?Met?His?Ser?Asn?Leu?Ser?Thr?Glu?Gln?Ile?Leu?Asp?Leu

260 265 270

Val?Leu?Ser?Leu?Leu?Phe?Ala?Gly?His?Glu?Thr?Ser?Ser?Val?Ala?Ile

275 280 285

Ala?Leu?Ala?Ile?Tyr?Phe?Leu?Pro?Gly?Cys?Pro?Lys?Ala?Ile?Gln?Gln

290 295 300

Leu?Arg?Glu?Glu?His?Arg?Glu?Ile?Ala?Arg?Ser?Lys?Lys?Gln?Ala?Gly

305 310 315 320

Glu?Val?Glu?Leu?Thr?Trp?Asp?Asp?Tyr?Lys?Arg?Met?Glu?Phe?Thr?Gln

325 330 335

Cys?Val?Val?Val?Asn?Glu?Thr?Leu?Arg?Leu?Gly?Asn?Val?Val?Arg?Phe

340 345 350

Leu?His?Arg?Lys?Ala?Leu?Lys?Asp?Val?Arg?Tyr?Lys?Gly?Tyr?Asp?Ile

355 360 365

Pro?Arg?Gly?Trp?Lys?Val?Leu?Pro?Val?Ile?Ser?Ala?Met?His?Leu?Asp

370 375 380

Pro?Ala?Leu?Phe?Tyr?Gln?Pro?Gln?His?Phe?Asn?Pro?Trp?Arg?Trp?Lys

385 390 395 400

<210>125

<211>1092

<212>DNA

<213> apple (Malus domestica)

<400>125

agagacatga?ggatgatatc?tctcaacttc?ttgagccatg?ccagactcag?aacccatctg 60

atgagagaag?ttgaaaagca?cactcttctt?gttttgggga?gttggaagga?aaactctgtt 120

ttttcagctc?aggatgaagc?taagaagttc?acgttcaact?tgatggccaa?acatatcatg 180

agcttggatc?ctggaaaacc?agagactgag?cagctgaaga?aattgtatgt?tactttcatg 240

aaaggtgtgg?tttctcctcc?tctgaattta?ccaggaacag?cttacagaag?agccttacag 300

tcaagatcaa?cgattctgaa?gtttatagag?tgcaaaatga?aagaaagatt?gatggaggga 360

accgaaaaca?ttggggaaga?tgatctgctt?ggatgggttc?tgaagaattc?aaatctttca 420

aaggagcaaa?ttcttgactt?aatattgagc?ttgctctttg?ctggccatga?aacttcatca 480

gtgtctatag?ccttagcaat?ttacttttta?ccaagctgcc?ctaatgcaat?tctgcagtta 540

agggaagaac?acagtgaaat?tgccaaagcc?aagaaactgg?caggcgagac?agagttgaat 600

tgggaggact?acaagaaaat?ggagttcacc?gaatgtgtaa?tctgtgagac?acttcggctt 660

gggaatgtgg?tgagattttt?acacagaaag?gctctgaagg?atgttcggta?caaagggtat 720

gacattccat?ctgggtggaa?agtgcttccg?gtgattgcag?ccgtgcattt?ggatccttta 780

ctttttgacc?acccgcaaca?cttcaatcca?tggagatggc?agcagaataa?caaccaccac 840

caccgtggat?catcgtcgtc?atcatcatgc?tacacgagca?tgacaagtca?caactttatg 900

ccatttgggg?gaggaccacg?actttgcgcc?ggttcagaat?tggccaaact?tgaaatggcc 960

gtgttcatcc?accaccttgt?cctcaacttc?cactgggagt?tagccgatcc?tttcgacaaa 1020

ccttttgctt?tccccttcgt?cgatttccaa?aatggcctac?caatcacagc?ccaccgctac 1080

gtaccaaact?aa 1092

<210>126

<211>363

<212>PRT

<213> apple

<400>126

Arg?Asp?Met?Arg?Met?Ile?Ser?Leu?Asn?Phe?Leu?Ser?His?Ala?Arg?Leu

1 5 10 15

Arg?Thr?His?Leu?Met?Arg?Glu?Val?Glu?Lys?His?Thr?Leu?Leu?Val?Leu

20 25 30

Gly?Ser?Trp?Lys?Glu?Asn?Ser?Val?Phe?Ser?Ala?Gln?Asp?Glu?Ala?Lys

35 40 45

Lys?Phe?Thr?Phe?Asn?Leu?Met?Ala?Lys?His?Ile?Met?Ser?Leu?Asp?Pro

50 55 60

Gly?Lys?Pro?Glu?Thr?Glu?Gln?Leu?Lys?Lys?Leu?Tyr?Val?Thr?Phe?Met

65 70 75 80

Lys?Gly?Val?Val?Ser?Pro?Pro?Leu?Asn?Leu?Pro?Gly?Thr?Ala?Tyr?Arg

85 90 95

Arg?Ala?Leu?Gln?Ser?Arg?Ser?Thr?Ile?Leu?Lys?Phe?Ile?Glu?Cys?Lys

100 105 110

Met?Lys?Glu?Arg?Leu?Met?Glu?Gly?Thr?Glu?Asn?Ile?Gly?Glu?Asp?Asp

115 120 125

Leu?Leu?Gly?Trp?Val?Leu?Lys?Asn?Ser?Asn?Leu?Ser?Lys?Glu?Gln?Ile

130 135 140

Leu?Asp?Leu?Ile?Leu?Ser?Leu?Leu?Phe?Ala?Gly?His?Glu?Thr?Ser?Ser

145 150 155 160

Val?Ser?Ile?Ala?Leu?Ala?Ile?Tyr?Phe?Leu?Pro?Ser?Cys?Pro?Asn?Ala

165 170 175

Ile?Leu?Gln?Leu?Arg?Glu?Glu?His?Ser?Glu?Ile?Ala?Lys?Ala?Lys?Lys

180 185 190

Leu?Ala?Gly?Glu?Thr?Glu?Leu?Asn?Trp?Glu?Asp?Tyr?Lys?Lys?Met?Glu

195 200 205

Phe?Thr?Glu?Cys?Val?Ile?Cys?Glu?Thr?Leu?Arg?Leu?Gly?Asn?Val?Val

210 215 220

Arg?Phe?Leu?His?Arg?Lys?Ala?Leu?Lys?Asp?Val?Arg?Tyr?Lys?Gly?Tyr

225 230 235 240

Asp?Ile?Pro?Ser?Gly?Trp?Lys?Val?Leu?Pro?Val?Ile?Ala?Ala?Val?His

245 250 255

Leu?Asp?Pro?Leu?Leu?Phe?Asp?His?Pro?Gln?His?Phe?Asn?Pro?Trp?Arg

260 265 270

Trp?Gln?Gln?Asn?Asn?Asn?His?His?His?Arg?Gly?Ser?Ser?Ser?Ser?Ser

275 280 285

Ser?Cys?Tyr?Thr?Ser?Met?Thr?Ser?His?Asn?Phe?Met?Pro?Phe?Gly?Gly

290 295 300

Gly?Pro?Arg?Leu?Cys?Ala?Gly?Ser?Glu?Leu?Ala?Lys?Leu?Glu?Met?Ala

305 310 315 320

Val?Phe?Ile?His?His?Leu?Val?Leu?Asn?Phe?His?Trp?Glu?Leu?Ala?Asp

325 330 335

Pro?Phe?Asp?Lys?Pro?Phe?Ala?Phe?Pro?Phe?Val?Asp?Phe?Gln?Asn?Gly

340 345 350

Leu?Pro?Ile?Thr?Ala?His?Arg?Tyr?Val?Pro?Asn

355 360

<210>127

<211>748

<212>DNA

<213> grape

<400>127

agacttcatg?gagcaacaca?tatcaaggtt?cggagaaatc?tacaagtcca?atctgtttgg 60

cgagccaacc?atagtctcag?cggattctgg?gctgaacaga?ttcatactac?agaacgaagg 120

aaaattgttt?gaatgcagct?atcccagaag?cataggtgga?attcttggga?aatggtccat 180

gctggtttta?gttggagaca?tgcatagaga?catgagaacc?atctccctca?acttcttgag 240

ccatggcagg?cttaggactc?atctcctacc?agaggtggtg?aagcacactt?tgcttgttct 300

aagctcttgg?aaggagaatt?gtacattttc?tgctcaagat?gaagctaaga?agtttacctt 360

caatctgatg?gcaaaacata?tcatgagctt?ggatcccgga?aagccggaga?ctgagcagct 420

taagaaagag?tatgttactt?tcatgaaagg?agtggtatct?gctcctttga?atttccctgg 480

aactgcatac?agaaaagccc?tacagtctcg?gtccaccatc?ttaaaattta?tcgagctgaa 540

gatggaagag?aggattcaga?aactgagggg?aggagggttt?gagaatatgg?aggatgacga 600

tcttcttgga?tgggtgctga?agcattccaa?cctttcaact?gagcaaatcc?tggacttggt 660

actgagcttg?ctctttgctg?gccatgaaac?ttcatcagtg?gcaatagctt?tagctatcta 720

cttcttggaa?ggctgtccca?acgccgtt 748

<210>128

<211>248

<212>PRT

<213> grape

<400>128

Asp?Phe?Met?Glu?Gln?His?Ile?Ser?Arg?Phe?Gly?Glu?Ile?Tyr?Lys?Ser

1 5 10 15

Asn?Leu?Phe?Gly?Glu?Pro?Thr?Ile?Val?Ser?Ala?Asp?Ser?Gly?Leu?Asn

20 25 30

Arg?Phe?Ile?Leu?Gln?Asn?Glu?Gly?Lys?Leu?Phe?Glu?Cys?Ser?Tyr?Pro

35 40 45

Arg?Ser?Ile?Gly?Gly?Ile?Leu?Gly?Lys?Trp?Ser?Met?Leu?Val?Leu?Val

50 55 60

Gly?Asp?Met?His?Arg?Asp?Met?Arg?Thr?Ile?Ser?Leu?Asn?Phe?Leu?Ser

65 70 75 80

His?Gly?Arg?Leu?Arg?Thr?His?Leu?Leu?Pro?Glu?Val?Val?Lys?His?Thr

85 90 95

Leu?Leu?Val?Leu?Ser?Ser?Trp?Lys?Glu?Asn?Cys?Thr?Phe?Ser?Ala?Gln

100 105 110

Asp?Glu?Ala?Lys?Lys?Phe?Thr?Phe?Asn?Leu?Met?Ala?Lys?His?Ile?Met

115 120 125

Ser?Leu?Asp?Pro?Gly?Lys?Pro?Glu?Thr?Glu?Gln?Leu?Lys?Lys?Glu?Tyr

130 135 140

Val?Thr?Phe?Met?Lys?Gly?Val?Val?Ser?Ala?Pro?Leu?Asn?Phe?Pro?Gly

145 150 155 160

Thr?Ala?Tyr?Arg?Lys?Ala?Leu?Gln?Ser?Arg?Ser?Thr?Ile?Leu?Lys?Phe

165 170 175

Ile?Glu?Leu?Lys?Met?Glu?Glu?Arg?Ile?Gln?Lys?Leu?Arg?Gly?Gly?Gly

180 185 190

Phe?Glu?Asn?Met?Glu?Asp?Asp?Asp?Leu?Leu?Gly?Trp?Val?Lau?Lys?His

195 200 205

Ser?Asn?Leu?Ser?Thr?Glu?Gln?Ile?Leu?Asp?Leu?Val?Leu?Ser?Leu?Leu

210 215 220

Phe?Ala?Gly?His?Glu?Thr?Ser?Ser?Val?Ala?Ile?Ala?Leu?Ala?Ile?Tyr

225 230 235 240

Phe?Leu?Glu?Gly?Cys?Pro?Asn?Ala

245

<210>129

<211>1737

<212>DNA

<213> Arabidopis thaliana

<400>129

atgcaacaac?tgtcaacttc?cctcggctta?aacacttaca?acgaggaacg?taattcaact 60

tctactaaaa?acacgagttc?tgaagattat?agtccaaggc?agtctaaaca?cacacaaagc 120

catggcctta?aagatatctc?cggaaatttc?cattctcatg?gagttaatgg?aggtgtttcg 180

aacatgtcat?tctataatac?gccttcgcca?gtggctgcac?agctatccgg?tatagctcca 240

ccaccacttt?tccggaattt?tcagccagct?gttgcaaacc?caaactccct?tattactgac 300

agttctccaa?agtccactgt?taactctact?cttcaagcac?ctagaagaaa?gtttgtagat 360

gaaggaaagt?tacgtaagat?ttctggcaga?ctattttctg?attctggtcc?acgacggagt 420

tcaagactgt?ctgctgattc?aggggcaaac?attaattcaa?gtgttgcaac?agtaagcgga 480

aatgtgaaca?acgcttccaa?gtatttggga?ggttctaaat?tgagttcttt?ggcacttcgt 540

tctgtaacac?ttcggaaggg?acactcctgg?gcaaatgaaa?acatggatga?aggggtccgt 600

ggggaacctt?ttgatgattc?aaggcctaat?actgcctcaa?cgactggttc?tatggcttcc 660

aatgatcaag?aagacgaaac?aatgtcgatt?ggtggcatag?caatgagttc?tcaaacaatc 720

acaattggtg?tttcggaaat?tttaaacctc?cttaggacac?tcggagaagg?gtgtagactt 780

tcatacatgt?acaggtgtca?ggaggcactg?gatacgtata?tgaaacttcc?acataagcat 840

tataatacag?gatgggttct?ttcccaggtc?gggaaagcat?actttgaact?aattgactat 900

ttagaggctg?aaaaggcatt?ccgtcttgcc?cgtctggctt?ctccttattg?cttagaagga 960

atggatatat?actctacggt?cctctatcat?ttgaaggaag?acatgaagct?gagttacttg 1020

gctcaggaac?taatatcaac?cgatcgctta?gctcctcaat?cttggtgtgc?tatgggaaat 1080

tgctatagct?tgcaaaagga?ccatgagacc?gcactgaaga?atttcctacg?agctgttcaa 1140

ctgaatccaa?gatttgcata?tgcacatacc?ttatgtggcc?acgaatacac?aactcttgag 1200

gattttgaga?acggaatgaa?aagttaccaa?aacgcacttc?gtgtagatac?aagacactac 1260

aacgcatggt?acgggcttgg?aatgatatat?ctacgccaag?agaagttaga?gttctcagag 1320

catcacttca?gaatggcttt?cctaataaac?ccgagttcct?ctgttataat?gtcttattta 1380

gggacatctt?tgcatgcctt?gaagagaagt?gaggaagcac?tagagataat?ggagcaagcc 1440

atagtagcag?atagaaaaaa?ccctcttcca?atgtaccaga?aagctaacat?acttgtctgc 1500

ttagaaagat?tagatgaagc?tctagaagtt?cttgaggagc?tcaaagagta?tgcgccttca 1560

gagagcagcg?tttacgcttt?aatgggcagg?atctataagc?ggcgaaacat?gcacgataaa 1620

gccatgcttc?atttcggtct?agctttagat?atgaaaccgc?ctgcaactga?cgttgctgca 1680

ataaaggctg?caatggagaa?attgcatgtt?ccagatgaga?tcgatgagag?cccgtga 1737

<210>130

<211>578

<212>PRT

<213> Arabidopis thaliana

<400>130

Met?Gln?Gln?Leu?Ser?Thr?Ser?Leu?Gly?Leu?Asn?Thr?Tyr?Asn?Glu?Glu

1 5 10 15

Arg?Asn?Ser?Thr?Ser?Thr?Lys?Asn?Thr?Ser?Ser?Glu?Asp?Tyr?Ser?Pro

20 25 30

Arg?Gln?Ser?Lys?His?Thr?Gln?Ser?His?Gly?Leu?Lys?Asp?Ile?Ser?Gly

35 40 45

Asn?Phe?His?Ser?His?Gly?Val?Asn?Gly?Gly?Val?Ser?Asn?Met?Ser?Phe

50 55 60

Tyr?Asn?Thr?Pro?Ser?Pro?Val?Ala?Ala?Gln?Leu?Ser?Gly?Ile?Ala?Pro

65 70 75 80

Pro?Pro?Leu?Phe?Arg?Asn?Phe?Gln?Pro?Ala?Val?Ala?Asn?Pro?Asn?Ser

85 90 95

Leu?Ile?Thr?Asp?Ser?Ser?Pro?Lys?Ser?Thr?Val?Asn?Ser?Thr?Leu?Gln

100 105 110

Ala?Pro?Arg?Arg?Lys?Phe?Val?Asp?Glu?Gly?Lys?Leu?Arg?Lys?Ile?Ser

115 120 125

Gly?Arg?Leu?Phe?Ser?Asp?Ser?Gly?Pro?Arg?Arg?Ser?Ser?Arg?Leu?Ser

130 135 140

Ala?Asp?Ser?Gly?Ala?Asn?Ile?Asn?Ser?Ser?Val?Ala?Thr?Val?Ser?Gly

145 150 155 160

Asn?Val?Asn?Asn?Ala?Ser?Lys?Tyr?Leu?Gly?Gly?Ser?Lys?Leu?Ser?Ser

165 170 175

Leu?Ala?Leu?Arg?Ser?Val?Thr?Leu?Arg?Lys?Gly?His?Ser?Trp?Ala?Asn

180 185 190

Glu?Asn?Met?Asp?Glu?Gly?Val?Arg?Gly?Glu?Pro?Phe?Asp?Asp?Ser?Arg

195 200 205

Pro?Asn?Thr?Ala?Ser?Thr?Thr?Gly?Ser?Met?Ala?Ser?Asn?Asp?Gln?Glu

210 215 220

Asp?Glu?Thr?Met?Ser?Ile?Gly?Gly?Ile?Ala?Met?Ser?Ser?Gln?Thr?Ile

225 230 235 240

Thr?Ile?Gly?Val?Ser?Glu?Ile?Leu?Asn?Leu?Leu?Arg?Thr?Leu?Gly?Glu

245 250 255

Gly?Cys?Arg?Leu?Ser?Tyr?Met?Tyr?Arg?Cys?Gln?Glu?Ala?Leu?Asp?Thr

260 265 270

Tyr?Met?Lys?Leu?Pro?His?Lys?His?Tyr?Asn?Thr?Gly?Trp?Val?Leu?Ser

275 280 285

Gln?Val?Gly?Lys?Ala?Tyr?Phe?Glu?Leu?Ile?Asp?Tyr?Leu?Glu?Ala?Glu

290 295 300

Lys?Ala?Phe?Arg?Leu?Ala?Arg?Leu?Ala?Ser?Pro?Tyr?Cys?Leu?Glu?Gly

305 310 315 320

Met?Asp?Ile?Tyr?Ser?Thr?Val?Leu?Tyr?His?Leu?Lys?Glu?Asp?Met?Lys

325 330 335

Leu?Ser?Tyr?Leu?Ala?Gln?Glu?Leu?Ile?Ser?Thr?Asp?Arg?Leu?Ala?Pro

340 345 350

Gln?Ser?Trp?Cys?Ala?Met?Gly?Asn?Cys?Tyr?Ser?Leu?Gln?Lys?Asp?His

355 360 365

Glu?Thr?Ala?Leu?Lys?Asn?Phe?Leu?Arg?Ala?Val?Gln?Leu?Asn?Pro?Arg

370 375 380

Phe?Ala?Tyr?Ala?His?Thr?Leu?Cys?Gly?His?Glu?Tyr?Thr?Thr?Leu?Glu

385 390 395 400

Asp?Phe?Glu?Asn?Gly?Met?Lys?Ser?Tyr?Gln?Asn?Ala?Leu?Arg?Val?Asp

405 410 415

Thr?Arg?His?Tyr?Asn?Ala?Trp?Tyr?Gly?Leu?Gly?Met?Ile?Tyr?Leu?Arg

420 425 430

Gln?Glu?Lys?Leu?Glu?Phe?Ser?Glu?His?His?Phe?Arg?Met?Ala?Phe?Leu

435 440 445

Ile?Asn?Pro?Ser?Ser?Ser?Val?Ile?Met?Ser?Tyr?Leu?Gly?Thr?Ser?Leu

450 455 460

His?Ala?Leu?Lys?Arg?Ser?Glu?Glu?Ala?Leu?Glu?Ile?Met?Glu?Gln?Ala

465 470 475 480

Ile?Val?Ala?Asp?Arg?Lys?Asn?Pro?Leu?Pro?Met?Tyr?Gln?Lys?Ala?Asn

485 490 495

Ile?Leu?Val?Cys?Leu?Glu?Arg?Leu?Asp?Glu?Ala?Leu?Glu?Val?Leu?Glu

500 505 510

Glu?Leu?Lys?Glu?Tyr?Ala?Pro?Ser?Glu?Ser?Ser?Val?Tyr?Ala?Leu?Met

515 520 525

Gly?Arg?Ile?Tyr?Lys?Arg?Arg?Asn?Met?His?Asp?Lys?Ala?Met?Leu?His

530 535 540

Phe?Gly?Leu?Ala?Leu?Asp?Met?Lys?Pro?Pro?Ala?Thr?Asp?Val?Ala?Ala

545 550 555 560

Ile?Lys?Ala?Ala?Met?Glu?Lys?Leu?His?Val?Pro?Asp?Glu?Ile?Asp?Glu

565 570 575

Ser?Pro

<210>131

<211>2235

<212>DNA

<213> Arabidopis thaliana

<400>131

atggaagcta?tgcttgtgga?ctgtgtaaac?aacagtcttc?gtcattttgt?ctacaaaaat 60

gctattttca?tgtgcgagcg?tctctgcgct?gagtttcctt?ctgaggttaa?tttgcagcta 120

ttagccacca?gctacctgca?gaataatcaa?gcttacagtg?catatcatct?gctaaaggga 180

acacaaatgg?ctcagtcccg?atacttgttc?gcattatcat?gcttccagat?ggaccttctc 240

aatgaagctg?aatctgcact?ctgccctgtt?aatgaacctg?gtgcggagat?cccaaatggt 300

gcagcaggcc?attaccttct?tggacttatt?tacaagtata?ctgatagaag?gaagaatgct 360

gctcaacaat?ttaaacagtc?cttgacaata?gaccctctac?tttgggctgc?atatgaggaa 420

ttatgtatat?taggtgctgc?tgaggaagca?actgcagttt?ttggtgaaac?agctgctctc 480

tccattcaaa?agcagtatat?gcaacaactg?tcaacttccc?tcggcttaaa?cacttacaac 540

gaggaacgta?attcaacttc?tactaaaaac?acgagttctg?aagattatag?tccaaggcag 600

tctaaacaca?cacaaagcca?tggccttaaa?gatatctccg?gaaatttcca?ttctcatgga 660

gttaatggag?gtgtttcgaa?catgtcattc?tataatacgc?cttcgccagt?ggctgcacag 720

ctatccggta?tagctccacc?accacttttc?cggaattttc?agccagctgt?tgcaaaccca 780

aactccctta?ttactgacag?ttctccaaag?tccactgtta?actctactct?tcaagcacct 840

agaagaaagt?ttgtagatga?aggaaagtta?cgtaagattt?ctggcagact?attttctgat 900

tctggtccac?gacggagttc?aagactgtct?gctgattcag?gggcaaacat?taattcaagt 960

gttgcaacag?taagcggaaa?tgtgaacaac?gcttccaagt?atttgggagg?ttctaaattg 1020

agttctttgg?cacttcgttc?tgtaacactt?cggaagggac?actcctgggc?aaatgaaaac 1080

atggatgaag?gggtccgtgg?ggaacctttt?gatgattcaa?ggcctaatac?tgcctcaacg 1140

actggttcta?tggcttccaa?tgatcaagaa?gacgaaacaa?tgtcgattgg?tggcatagca 1200

atgagttctc?aaacaatcac?aattggtgtt?tcggaaattt?taaacctcct?taggacactc 1260

ggagaagggt?gtagactttc?atacatgtac?aggtgtcagg?aggcactgga?tacgtatatg 1320

aaacttccac?ataagcatta?taatacagga?tgggttcttt?cccaggtcgg?gaaagcatac 1380

tttgaactaa?ttgactattt?agaggctgaa?aaggcattcc?gtcttgcccg?tctggcttct 1440

ccttattgct?tagaaggaat?ggatatatac?tctacggtcc?tctatcattt?gaaggaagac 1500

atgaagctga?gttacttggc?tcaggaacta?atatcaaccg?atcgcttagc?tcctcaatct 1560

tggtgtgcta?tgggaaattg?ctatagcttg?caaaaggacc?atgagaccgc?actgaagaat 1620

ttcctacgag?ctgttcaact?gaatccaaga?tttgcatatg?cacatacctt?atgtggccac 1680

gaatacacaa?ctcttgagga?ttttgagaac?ggaatgaaaa?gttaccaaaa?cgcacttcgt 1740

gtagatacaa?gacactacaa?cgcatggtac?gggcttggaa?tgatatatct?acgccaagag 1800

aagttagagt?tctcagagca?tcacttcaga?atggctttcc?taataaaccc?gagttcctct 1860

gttataatgt?cttatttagg?gacatctttg?catgccttga?agagaagtga?ggaagcacta 1920

gagataatgg?agcaagccat?agtagcagat?agaaaaaacc?ctcttccaat?gtaccagaaa 1980

gctaacatac?ttgtctgctt?agaaagatta?gatgaagctc?tagaagttct?tgaggagctc 2040

aaagagtatg?cgccttcaga?gagcagcgtt?tacgctttaa?tgggcaggat?ctataagcgg 2100

cgaaacatgc?acgataaagc?catgcttcat?ttcggtctag?ctttagatat?gaaaccgcct 2160

gcaactgacg?ttgctgcaat?aaaggctgca?atggagaaat?tgcatgttcc?agatgagatc 2220

gatgagagcc?cgtga 2235

<210>132

<211>744

<212>PRT

<213> Arabidopis thaliana

<400>132

Met?Glu?Ala?Met?Leu?Val?Asp?Cys?Val?Asn?Asn?Ser?Leu?Arg?His?Phe

1 5 10 15

Val?Tyr?Lys?Asn?Ala?Ile?Phe?Met?Cys?Glu?Arg?Leu?Cys?Ala?Glu?Phe

20 25 30

Pro?Ser?Glu?Val?Asn?Leu?Gln?Leu?Leu?Ala?Thr?Ser?Tyr?Leu?Gln?Asn

35 40 45

Asn?Gln?Ala?Tyr?Ser?Ala?Tyr?His?Leu?Leu?Lys?Gly?Thr?Gln?Met?Ala

50 55 60

Gln?Ser?Arg?Tyr?Leu?Phe?Ala?Leu?Ser?Cys?Phe?Gln?Met?Asp?Leu?Leu

65 70 75 80

Asn?Glu?Ala?Glu?Ser?Ala?Leu?Cys?Pro?Val?Asn?Glu?Pro?Gly?Ala?Glu

85 90 95

Ile?Pro?Asn?Gly?Ala?Ala?Gly?His?Tyr?Leu?Leu?Gly?Leu?Ile?Tyr?Lys

100 105 110

Tyr?Thr?Asp?Arg?Arg?Lys?Asn?Ala?Ala?Gln?Gln?Phe?Lys?Gln?Ser?Leu

115 120 125

Thr?Ile?Asp?Pro?Leu?Leu?Trp?Ala?Ala?Tyr?Glu?Glu?Leu?Cys?Ile?Leu

130 135 140

Gly?Ala?Ala?Glu?Glu?Ala?Thr?Ala?Val?Phe?Gly?Glu?Thr?Ala?Ala?Leu

145 150 155 160

Ser?Ile?Gln?Lys?Gln?Tyr?Met?Gln?Gln?Leu?Ser?Thr?Ser?Leu?Gly?Leu

165 170 175

Asn?Thr?Tyr?Asn?Glu?Glu?Arg?Asn?Ser?Thr?Ser?Thr?Lys?Asn?Thr?Ser

180 185 190

Ser?Glu?Asp?Tyr?Ser?Pro?Arg?Gln?Ser?Lys?His?Thr?Gln?Ser?His?Gly

195 200 205

Leu?Lys?Asp?Ile?Ser?Gly?Asn?Phe?His?Ser?His?Gly?Val?Asn?Gly?Gly

210 215 220

Val?Ser?Asn?Met?Ser?Phe?Tyr?Asn?Thr?Pro?Ser?Pro?Val?Ala?Ala?Gln

225 230 235 240

Leu?Ser?Gly?Ile?Ala?Pro?Pro?Pro?Leu?Phe?Arg?Asn?Phe?Gln?Pro?Ala

245 250 255

Val?Ala?Asn?Pro?Asn?Ser?Leu?Ile?Thr?Asp?Ser?Ser?Pro?Lys?Ser?Thr

260 265 270

Val?Asn?Ser?Thr?Leu?Gln?Ala?Pro?Arg?Arg?Lys?Phe?Val?Asp?Glu?Gly

275 280 285

Lys?Leu?Arg?Lys?Ile?Ser?Gly?Arg?Leu?Phe?Ser?Asp?Ser?Gly?Pro?Arg

290 295 300

Arg?Ser?Ser?Arg?Leu?Ser?Ala?Asp?Ser?Gly?Ala?Asn?Ile?Asn?Ser?Ser

305 310 315 320

Val?Ala?Thr?Val?Ser?Gly?Asn?Val?Asn?Asn?Ala?Ser?Lys?Tyr?Leu?Gly

325 330 335

Gly?Ser?Lys?Lau?Ser?Ser?Leu?Ala?Leu?Arg?Ser?Val?Thr?Leu?Arg?Lys

340 345 350

Gly?His?Ser?Trp?Ala?Asn?Glu?Asn?Met?Asp?Glu?Gly?Val?Arg?Gly?Glu

355 360 365

Pro?Phe?Asp?Asp?Ser?Arg?Pro?Asn?Thr?Ala?Ser?Thr?Thr?Gly?Ser?Met

370 375 380

Ala?Ser?Asn?Asp?Gln?Glu?Asp?Glu?Thr?Met?Ser?Ile?Gly?Gly?Ile?Ala

385 390 395 400

Met?Ser?Ser?Gln?Thr?Ile?Thr?Ile?Gly?Val?Ser?Glu?Ile?Leu?Asn?Leu

405 410 415

Leu?Arg?Thr?Leu?Gly?Glu?Gly?Cys?Arg?Leu?Ser?Tyr?Met?Tyr?Arg?Cys

420 425 430

Gln?Glu?Ala?Leu?Asp?Thr?Tyr?Met?Lys?Leu?Pro?His?Lys?His?Tyr?Asn

435 440 445

Thr?Gly?Trp?Val?Leu?Ser?Gln?Val?Gly?Lys?Ala?Tyr?Phe?Glu?Leu?Ile

450 455 460

Asp?Tyr?Leu?Glu?Ala?Glu?Lys?Ala?Phe?Arg?Leu?Ala?Arg?Leu?Ala?Ser

465 470 475 480

Pro?Tyr?Cys?Leu?Glu?Gly?Met?Asp?Ile?Tyr?Ser?Thr?Val?Leu?Tyr?His

485 490 495

Leu?Lys?Glu?Asp?Met?Lys?Leu?Ser?Tyr?Leu?Ala?Gln?Glu?Leu?Ile?Ser

500 505 510

Thr?Asp?Arg?Leu?Ala?Pro?Gln?Ser?Trp?Cys?Ala?Met?Gly?Asn?Cys?Tyr

515 520 525

Ser?Leu?Gln?Lys?Asp?His?Glu?Thr?Ala?Leu?Lys?Asn?Phe?Leu?Arg?Ala

530 535 540

Val?Gln?Leu?Asn?Pro?Arg?Phe?Ala?Tyr?Ala?His?Thr?Leu?Cys?Gly?His

545 550 555 560

Glu?Tyr?Thr?Thr?Leu?Glu?Asp?Phe?Glu?Asn?Gly?Met?Lys?Ser?Tyr?Gln

565 570 575

Asn?Ala?Leu?Arg?Val?Asp?Thr?Arg?His?Tyr?Asn?Ala?Trp?Tyr?Gly?Leu

580 585 590

Gly?Met?Ile?Tyr?Leu?Arg?Gln?Glu?Lys?Leu?Glu?Phe?Ser?Glu?His?His

595 600 605

Phe?Arg?Met?Ala?Phe?Leu?Ile?Asn?Pro?Ser?Ser?Ser?Val?Ile?Met?Ser

610 615 620

Tyr?Leu?Gly?Thr?Ser?Leu?His?Ala?Leu?Lys?Arg?Ser?Glu?Glu?Ala?Leu

625 630 635 640

Glu?Ile?Met?Glu?Gln?Ala?Ile?Val?Ala?Asp?Arg?Lys?Asn?Pro?Leu?Pro

645 650 655

Met?Tyr?Gln?Lys?Ala?Asn?Ile?Leu?Val?Cys?Leu?Glu?Arg?Leu?Asp?Glu

660 665 670

Ala?Leu?Glu?Val?Leu?Glu?Glu?Leu?Lys?Glu?Tyr?Ala?Pro?Ser?Glu?Ser

675 680 685

Ser?Val?Tyr?Ala?Leu?Met?Gly?Arg?Ile?Tyr?Lys?Arg?Arg?Asn?Met?His

690 695 700

Asp?Lys?Ala?Met?Leu?His?Phe?Gly?Leu?Ala?Leu?Asp?Met?Lys?Pro?Pro

705 710 715 720

Ala?Thr?Asp?Val?Ala?Ala?Ile?Lys?Ala?Ala?Met?Glu?Lys?Leu?His?Val

725 730 735

Pro?Asp?Glu?Ile?Asp?Glu?Ser?Pro

740

<210>133

<211>2181

<212>DNA

<213> Arabidopis thaliana

<400>133

atgatggaga?atctactggc?gaattgtgtc?cagaaaaacc?ttaaccattt?tatgttcacc 60

aatgctatct?tcctttgcga?acttcttctc?gcccaatttc?catctgaggt?gaacctgcaa 120

ttgttagcca?ggtgttactt?gagtaacagt?caagcttata?gtgcatatta?tatccttaaa 180

ggttcaaaaa?cgcctcagtc?tcggtattta?tttgcattct?catgctttaa?gttggatctt 240

cttggagagg?ctgaagctgc?attgttgccc?tgtgaagatt?atgctgaaga?agttcctggt 300

ggtgcagctg?ggcattatct?tcttggtctt?atatatagat?attctgggag?gaagaactgt 360

tcaatacaac?agtttaggat?ggcattgtca?tttgatccat?tgtgttggga?agcatatgga 420

gaactttgta?gtttaggtgc?cgctgaagaa?gcctcaacag?ttttcgggaa?tgttgcttcc 480

cagcgtctta?aaacttgtgt?agaacaaaga?ataagcttct?cagaaggagc?aaccatagac 540

cagattacag?attctgataa?ggccttaaaa?gatacaggtt?tatcgcaaac?agaacacatt 600

ccaggagaga?accaacaaga?tctgaaaatt?atgcagcagc?ctggagatat?tccaccaaat 660

actgacaggc?aacttagtac?aaacggatgg?gacttgaaca?caccttctcc?agtgctttta 720

caggtaatgg?atgctccacc?gcctctgctt?cttaagaata?tgcgtcgtcc?agcagtggaa 780

ggatctttga?tgtctgtaca?tggagtgcgt?gtgcgtcgaa?gaaacttttt?tagtgaagaa 840

ttgtcagcag?aggctcaaga?agaatctggg?cgccgccgta?gtgctagaat?agcagcaagg 900

aaaaagaatc?ctatgtcgca?gtcatttgga?aaagattccc?attggttaca?tctttcacct 960

tccgagtcaa?actatgcacc?ttctctttcc?tcgatgattg?gaaaatgcag?aatccaaagc 1020

agcaaagaag?cgattcctga?taccgttact?ctaaatgatc?cagcaacgac?gtcaggccag 1080

tctgtaagtg?acactggaag?ctctgttgat?gatgaggaaa?agtcaaatcc?tagtgaatct 1140

tccccggatc?gtttcagcct?tatttctgga?atttcagaag?tgctaggcat?tctgaaaatt 1200

cttggagatg?gccacaggca?tttacatatg?tacaagtgtc?aggaagcttt?gttggcatat 1260

caaaagctat?ctcagaaaca?atacaataca?cactgggttc?tcatgcaggt?tggaaaagca 1320

tattttgagc?tacaagacta?cttcaacgct?gactcttcct?ttactcttgc?tcatcaaaag 1380

tatccttatg?ctttggaagg?aatggataca?tactccactg?ttctttatca?cctgaaagaa 1440

gagatgaggt?tgggctatct?ggctcaggaa?ctgatttcag?ttgatcgcct?gtctccagaa 1500

tcctggtgtg?cagttgggaa?ctgttacagt?ttgcgtaagg?atcatgatac?tgctctcaaa 1560

atgtttcaga?gagctatcca?actgaatgaa?agattcacat?atgcacatac?cctttgtggc 1620

cacgagtttg?ccgcattgga?agaattcgag?gatgcagaga?gatgctaccg?gaaggctctg 1680

ggcatagata?cgagacacta?taatgcatgg?tacggtcttg?gaatgaccta?tcttcgtcag 1740

gagaaattcg?agtttgcgca?gcatcaattt?caactggctc?tccaaataaa?tccaagatct 1800

tcagtcatca?tgtgttacta?tggaattgct?ttgcatgagt?caaagagaaa?cgatgaggcg 1860

ttgatgatga?tggagaaggc?tgtactcact?gatgcaaaga?atccgctccc?caagtactac 1920

aaggctcaca?tattaaccag?cctaggtgat?tatcacaaag?cacagaaagt?tttagaagag 1980

ctcaaagaat?gtgctcctca?agaaagcagt?gtccatgcat?cgcttggcaa?aatatacaat 2040

cagctaaagc?aatacgacaa?agccgtgtta?catttcggca?ttgctttgga?tttaagccct 2100

tctccatctg?atgctgtcaa?gataaaggct?tacatggaga?ggttgatact?accagacgag 2160

ctggtgacgg?aggaaaattt?g 2181

<210>134

<211>728

<212>PRT

<213> Arabidopis thaliana

<400>134

Met?Met?Glu?Asn?Leu?Leu?Ala?Asn?Cys?Val?Gln?Lys?Asn?Leu?Asn?His

1 5 10 15

Phe?Met?Phe?Thr?Asn?Ala?Ile?Phe?Lau?Cys?Glu?Leu?Leu?Leu?Ala?Gln

20 25 30

Phe?Pro?Ser?G1u?Val?Asn?Leu?Gln?Leu?Leu?Ala?Arg?Cys?Tyr?Leu?Ser

35 40 45

Asn?Ser?Gln?Ala?Tyr?Ser?Ala?Tyr?Tyr?Ile?Lau?Lys?Gly?Ser?Lys?Thr

50 55 60

Pro?Gln?Ser?Arg?Tyr?Leu?Phe?Ala?Phe?Ser?Cys?Phe?Lys?Leu?Asp?Leu

65 70 75 80

Leu?Gly?Glu?Ala?Glu?Ala?Ala?Leu?Leu?Pro?Cys?Glu?Asp?Tyr?Ala?Glu

85 90 95

Glu?Val?Pro?Gly?Gly?Ala?Ala?Gly?His?Tyr?Leu?Leu?Gly?Leu?Ile?Tyr

100 105 110

Arg?Tyr?Ser?Gly?Arg?Lys?Asn?Cys?Ser?Ile?Gln?Gln?Phe?Arg?Met?Ala

115 120 125

Leu?Ser?Phe?Asp?Pro?Leu?Cys?Trp?Glu?Ala?Tyr?Gly?Glu?Leu?Cys?Ser

130 135 140

Leu?Gly?Ala?Ala?Glu?Glu?Ala?Ser?Thr?Val?Phe?Gly?Asn?Val?Ala?Ser

145 150 155 160

Gln?Arg?Leu?Gln?Lys?Thr?Cys?Val?Glu?Gln?Arg?Ile?Ser?Phe?Ser?Glu

165 170 175

Gly?Ala?Thr?Ile?Asp?Gln?Ile?Thr?Asp?Ser?Asp?Lys?Ala?Leu?Lys?Asp

180 185 190

Thr?Gly?Leu?Ser?Gln?Thr?Glu?His?Ile?Pro?Gly?Glu?Asn?Gln?Gln?Asp

195 200 205

Leu?Lys?Ile?Met?Gln?Gln?Pro?Gly?Asp?Ile?Pro?Pro?Asn?Thr?Asp?Arg

210 215 220

Gln?Leu?Ser?Thr?Asn?Gly?Trp?Asp?Leu?Asn?Thr?Pro?Ser?Pro?Val?Leu

225 230 235 240

Leu?Gln?Val?Met?Asp?Ala?Leu?Pro?Pro?Leu?Leu?Leu?Lys?Asn?Met?Arg

245 250 255

Arg?Pro?Ala?Val?Glu?Gly?Ser?Leu?Met?Ser?Val?His?Gly?Val?Arg?Val

260 265 270

Arg?Arg?Arg?Asn?Phe?Phe?Ser?Glu?Glu?Leu?Ser?Ala?Glu?Ala?Gln?Glu

275 280 285

Glu?Ser?Gly?Arg?Arg?Arg?Ser?Ala?Arg?Ile?Ala?Ala?Arg?Lys?Lys?Asn

290 295 300

Pro?Met?Ser?Gln?Ser?Phe?Gly?Lys?Asp?Ser?His?Trp?Leu?His?Leu?Ser

305 310 315 320

Pro?Ser?Glu?Ser?Asn?Tyr?Ala?Pro?Ser?Leu?Ser?Ser?Met?Ile?Gly?Lys

325 330 335

Cys?Arg?Ile?Gln?Ser?Ser?Lys?Glu?Val?Ile?Pro?Asp?Thr?Val?Thr?Leu

340 345 350

Asn?Asp?Pro?Ala?Thr?Thr?Ser?Gly?Gln?Ser?Val?Ser?Asp?Ile?Gly?Ser

355 360 365

Ser?Val?Asp?Asp?Glu?Glu?Lys?Ser?Asn?Pro?Ser?Glu?Ser?Ser?Pro?Asp

370 375 380

Arg?Phe?Ser?Leu?Ile?Ser?Gly?Ile?Ser?Glu?Val?Leu?Ser?Leu?Leu?Lys

385 390 395 400

Ile?Leu?Gly?Asp?Gly?His?Arg?His?Leu?His?Met?Tyr?Lys?Cys?Gln?Glu

405 410 415

Ala?Leu?Leu?Ala?Tyr?Gln?Lys?Leu?Ser?Gln?Lys?Gln?Tyr?Asn?Thr?His

420 425 430

Trp?Val?Leu?Met?Gln?Val?Gly?Lys?Ala?Tyr?Phe?Glu?Leu?Gln?Asp?Tyr

435 440 445

Phe?Asn?Ala?Asp?Ser?Ser?Phe?Thr?Leu?Ala?His?Gln?Lys?Tyr?Pro?Tyr

450 455 460

Ala?Leu?Glu?Gly?Met?Asp?Thr?Tyr?Ser?Thr?Val?Leu?Tyr?His?Leu?Lys

465 470 475 480

Glu?Glu?Met?Arg?Leu?Gly?Tyr?Leu?Ala?Gln?Glu?Leu?Ile?Ser?Val?Asp

485 490 495

Arg?Leu?Ser?Pro?Glu?Ser?Trp?Cys?Ala?Val?Gly?Asn?Cys?Tyr?Ser?Leu

500 505 510

Arg?Lys?Asp?His?Asp?Thr?Ala?Leu?Lys?Met?Phe?Gln?Arg?Ala?Ile?Gln

515 520 525

Leu?Asn?Glu?Arg?Phe?Thr?Tyr?Ala?His?Thr?Leu?Cys?Gly?His?Glu?Phe

530 535 540

Ala?Ala?Leu?Glu?Glu?Phe?Glu?Asp?Ala?Glu?Arg?Cys?Tyr?Arg?Lys?Ala

545 550 555 560

Leu?Gly?Ile?Asp?Thr?Arg?His?Tyr?Asn?Ala?Trp?Tyr?Gly?Leu?Gly?Met

565 570 575

Thr?Tyr?Leu?Arg?Gln?Glu?Lys?Phe?Glu?Phe?Ala?Gln?His?Gln?Phe?Gln

580 585 590

Leu?Ala?Leu?Gln?Ile?Asn?Pro?Arg?Ser?Ser?Val?Ile?Met?Cys?Tyr?Tyr

595 600 605

Gly?Ile?Ala?Leu?His?Glu?Ser?Lys?Arg?Asn?Asp?Glu?Ala?Leu?Met?Met

610 615 620

Met?Glu?Lys?Ala?Val?Leu?Thr?Asp?Ala?Lys?Asn?Pro?Leu?Pro?Lys?Tyr

625 630 635 640

Tyr?Lys?Ala?His?Ile?Leu?Thr?Ser?Leu?Gly?Asp?Tyr?His?Lys?Ala?Gln

645 650 655

Lys?Val?Leu?Glu?Glu?Leu?Lys?Glu?Cys?Ala?Pro?Gln?Glu?Ser?Ser?Val

660 665 670

His?Ala?Ser?Leu?Gly?Lys?Ile?Tyr?Asn?Gln?Leu?Lys?Gln?Tyr?Asp?Lys

675 680 685

Ala?Val?Leu?His?Phe?Gly?Ile?Ala?Leu?Asp?Leu?Ser?Pro?Ser?Pro?Ser

690 695 700

Asp?Ala?Val?Lys?Ile?Lys?Ala?Tyr?Met?Glu?Arg?Leu?Ile?Leu?Pro?Asp

705 710 715 720

Glu?Leu?Val?Thr?Glu?Glu?Asn?Leu

725

<210>135

<211>1835

<212>DNA

<213> rice

<220>

<221>misc_feature

<222>(729)..(732)

<223>n is a, c, g, or t

<400>135

atggaaaccc?taatggtgga?ccgcgtccac?ggcagcctcc?gcctcttcat?gcaccgcaac 60

gccgtcttcc?tctgcgagcg?cctctgcgcc?cagttccccg?ccgagacaaa?tgtccagttg 120

tagcaacttg?ctaccttcac?aacaaccagc?catatgctgc?ataccacatc?ttgaaaggaa 180

agaagctgcc?agagtcccgg?tacttgtttg?ctatgtcatg?cttccgaatg?aacctcttac 240

gggaagctga?agaagccttg?tgtcctgtca?atgaaccaaa?tattgaggtt?ccaagtggtg 300

caacagggca?ctaccttctt?ggagtaattt?acaggtacac?tggcagagtg?gaagctgcag 360

ctgagcaatt?tgtacaagct?ctgactcttg?atcctcttct?atgggcagca?tacgaggaat 420

tgtgcatact?aggtgttgct?gaagatgcaa?atgaatgttt?cagtgaagca?acagctctac 480

gtcttcagca?ggaactcaca?tccacatcaa?atgtggaaaa?gtcaaacttt?gttaatgaaa 540

atcggtttct?atcttccaat?gtgtcagcaa?gttttggtga?tagtcctaag?caaattaaac 600

agctgcatgc?taacaccact?gcagaagtat?ctggttatcc?tcatgtaaag?tcaactgcat 660

tgcatatgca?gaacggtgca?ccatctaatt?tatcacagtt?tgacactcca?tcgccaactt 720

caacgcagnn?nnataatgta?acttcaactt?cgtcttctac?aagtatagtt?gatggaagat 780

atcccgagca?agagaaatct?gaacgagttc?tgtcacagga?ctccaaatta?gctattggta 840

tcagggagct?aatggcactc?ttgcggacac?taggggaagg?gtataggctt?tcttgcttgt 900

ttaagtgtca?ggaagcattg?gaagtatata?gaaagctccc?agaggcacaa?tttaatactg 960

gatgggttct?ttgccaggtt?gggaagacat?attttgaact?cgtcaattat?ttagaagccg 1020

atcatttttt?tgagttagcg?catcgactat?caccatgcac?gttggaggga?atggacattt 1080

actccactgt?tctttatcat?ttgaatgagg?aaatgcggct?aagttacctt?gctcaagatc 1140

ttgtttctat?tgatcgacta?tctccccaag?catggtgtgc?tgtgggaaat?tgctttgcct 1200

tgaggaaaga?tcatgagact?gccttgaaga?attttcaacg?tgctgtacag?cttgactcaa 1260

gagttgcata?cgctcacacg?ctatgcggtc?acgatataaa?actataccga?tctgcacttc 1320

aggtagatga?aagacactac?aatgcctggt?atggccttgg?agtggtgtac?cttcgccagg 1380

aaaagtttga?gtttgctgag?catcatttca?gaagggcatt?ccagataaat?ccttgctctt 1440

ctgttcttat?gtgctatctt?gggatggcct?tgcatgcttt?aaagaggaat?gaggaagcct 1500

tggaaatgat?ggagaaggct?atatttgctg?ataagaagaa?tccactcccc?aagtatcaaa 1560

aggctttaat?ccttctaggc?ctacaaaaat?accctgatgc?tctggatgag?ttggaacggc 1620

taaaggaaat?tgcacctcat?gaaagtagta?tgtatgcact?gatgggaaag?atttacaagc 1680

aacttaacat?tcttgacaag?gctgtatttt?gctttggcat?tgccctggat?ttgaaacctc 1740

ctgctgctga?cgttgctata?atacaatctg?caatggagaa?agtacacctt?ccagatgaac 1800

ttatggatga?tgatgatgat?gatgatgaga?tttaa 1835

<210>136

<211>757

<212>PRT

<213> rice

<400>136

Met?Glu?Thr?Leu?Met?Val?Asp?Arg?Val?His?Gly?Ser?Leu?Arg?Leu?Phe

1 5 10 15

Met?His?Arg?Asn?Ala?Val?Phe?Leu?Cys?Glu?Arg?Leu?Cys?Ala?Gln?Phe

20 25 30

Pro?Ala?Glu?Val?Asn?Val?Gln?Leu?Leu?Ala?Thr?Cys?Tyr?Leu?His?Asn

35 40 45

Asn?Gln?Pro?Tyr?Ala?Ala?Tyr?His?Ile?Leu?Lys?Gly?Lys?Lys?Leu?Pro

50 55 60

Glu?Ser?Arg?Tyr?Leu?Phe?Ala?Met?Ser?Cys?Phe?Arg?Met?Asn?Leu?Leu

65 70 75 80

Arg?Glu?Ala?Glu?Glu?Ala?Leu?Cys?Pro?Val?Asn?Glu?Pro?Asn?Ile?Glu

85 90 95

Val?Pro?Ser?Gly?Ala?Thr?Gly?His?Tyr?Leu?Leu?Gly?Val?Ile?Tyr?Arg

100 105 110

Tyr?Thr?Gly?Arg?Val?Glu?Ala?Ala?Ala?Glu?Gln?Phe?Val?Gln?Ala?Leu

115 120 125

Thr?Leu?Asp?Pro?Leu?Leu?Trp?Ala?Ala?Tyr?Glu?Glu?Leu?Cys?Ile?Leu

130 135 140

Gly?Val?Ala?Glu?Asp?Ala?Asn?Glu?Cys?Phe?Ser?Glu?Ala?Thr?Ala?Leu

145 150 155 160

Arg?Leu?Gln?Gln?Glu?Leu?Thr?Ser?Thr?Ser?Asn?Val?Glu?Lys?Ser?Asn

165 170 175

Phe?Val?Asn?Glu?Asn?Arg?Phe?Leu?Ser?Ser?Asn?Val?Ser?Ala?Ser?Phe

180 185 190

Gly?Asp?Ser?Pro?Lys?Gln?Ile?Lys?Gln?Leu?His?Ala?Asn?Thr?Thr?Ala

195 200 205

Glu?Val?Ser?Gly?Tyr?Pro?His?Val?Lys?Ser?Thr?Ala?Leu?His?Met?Gln

210 215 220

Asn?Gly?Ala?Pro?Ser?Asn?Leu?Ser?Gln?Phe?Asp?Thr?Pro?Ser?Pro?Thr

225 230 235 240

Ser?Thr?Gln?Val?Ser?Gly?Ile?Ala?Pro?Pro?Pro?Leu?Phe?Arg?Asn?Met

245 250 255

His?Ala?Tyr?Gln?Asn?Thr?Ala?Gly?Gly?Asn?Ala?Pro?Ser?Lys?Pro?Lys

260 265 270

Val?Asn?Ala?Pro?Asn?Leu?Thr?Leu?Arg?Arg?Lys?Tyr?Ile?Asp?Glu?Ala

275 280 285

Gly?Leu?Lys?Lys?Val?Ser?Gly?Arg?Leu?Phe?Asn?Gln?Ser?Ser?Asp?Ser

290 295 300

Val?Pro?Arg?Arg?Ser?Ala?Arg?Leu?Ser?Arg?Asp?Thr?Thr?Ile?Asn?Ser

305 310 315 320

Asn?Ser?Asn?Ile?Ser?Gln?Phe?Gly?Gly?Asn?Gly?Thr?Asp?His?Ser?Ser

325 330 335

Gly?Lys?Leu?Arg?Val?Asn?Ser?Ser?Thr?Pro?Ser?Lys?Leu?Cys?Ser?Thr

340 345 350

Ala?Leu?Arg?Ser?Val?Gln?Val?Arg?Lys?Gly?Lys?Pro?Gln?Ala?Thr?Glu

355 360 365

Asn?Phe?Asp?Glu?Gly?Asp?Tyr?His?Phe?Asp?Met?Asp?Asp?Ser?Val?Thr

370 375 380

Ser?Thr?Ser?Ser?Ser?Thr?Ser?Ile?Val?Asp?Gly?Arg?Tyr?Pro?Glu?Gln

385 390 395 400

Glu?Lys?Ser?Glu?Arg?Val?Leu?Ser?Gln?Asp?Ser?Lys?Leu?Ala?Ile?Gly

405 410 415

Ile?Arg?Glu?Leu?Met?Ala?Leu?Leu?Arg?Thr?Leu?Gly?Glu?Gly?Tyr?Arg

420 425 430

Leu?Ser?Cys?Leu?Phe?Lys?Cys?Gln?Glu?Ala?Leu?Glu?Val?Tyr?Arg?Lys

435 440 445

Leu?Pro?Glu?Ala?Gln?Phe?Asn?Thr?Gly?Trp?Val?Leu?Cys?Gln?Val?Gly

450 455 460

Lys?Thr?Tyr?Phe?Glu?Leu?Val?Asn?Tyr?Leu?Glu?Ala?Asp?His?Phe?Phe

465 470 475 480

Glu?Leu?Ala?His?Arg?Leu?Ser?Pro?Cys?Thr?Leu?Glu?Gly?Met?Asp?Ile

485 490 495

Tyr?Ser?Thr?Val?Leu?Tyr?His?Leu?Asn?Glu?Glu?Met?Arg?Leu?Ser?Tyr

500 505 510

Leu?Ala?Gln?Asp?Leu?Val?Ser?Ile?Asp?Arg?Leu?Ser?Pro?Gln?Ala?Trp

515 520 525

Cys?Ala?Val?Gly?Asn?Cys?Phe?Ala?Leu?Arg?Lys?Asp?His?Glu?Thr?Ala

530 535 540

Leu?Lys?Asn?Phe?Gln?Arg?Ala?Val?Gln?Leu?Asp?Ser?Arg?Val?Ala?Tyr

545 550 555 560

Ala?His?Thr?Leu?Cys?Gly?His?Glu?Tyr?Ser?Ala?Leu?Glu?Asp?Tyr?Glu

565 570 575

Asn?Ser?Ile?Lys?Leu?Tyr?Arg?Ser?Ala?Leu?Gln?Val?Asp?Glu?Arg?His

580 585 590

Tyr?Asn?Ala?Trp?Tyr?Gly?Leu?Gly?Val?Val?Tyr?Leu?Arg?Gln?Glu?Lys

595 600 605

Phe?Glu?Phe?Ala?Glu?His?His?Phe?Arg?Arg?Ala?Phe?Gln?Ile?Asn?Pro

610 615 620

Cys?Ser?Ser?Val?Leu?Met?Cys?Tyr?Leu?Gly?Met?Ala?Leu?His?Ala?Leu

625 630 635 640

Lys?Arg?Asn?Glu?Glu?Ala?Leu?Glu?Met?Met?Glu?Asn?Ala?Ile?Phe?Ala

645 650 655

Asp?Lys?Lys?Asn?Pro?Leu?Pro?Lys?Tyr?Gln?Lys?Ala?Leu?Ile?Leu?Leu

660 665 670

Gly?Leu?Gln?Lys?Tyr?Pro?Asp?Ala?Leu?Asp?Glu?Leu?Glu?Arg?Leu?Lys

675 680 685

Glu?Ile?Ala?Pro?His?Glu?Ser?Ser?Met?Tyr?Ala?Leu?Met?Gly?Lys?Ile

690 695 700

Tyr?Lys?Gln?Leu?Asn?Ile?Leu?Asp?Lys?Ala?Val?Phe?Cys?Phe?Gly?Ile

705 710 715 720

Ala?Leu?Asp?Leu?Lys?Pro?Pro?Ala?Ala?Asp?Val?Ala?Ile?Ile?Lys?Ser

725 730 735

Ala?Met?Glu?Lys?Val?His?Leu?Pro?Asp?Glu?Leu?Met?Asp?Asp?Asp?Asp

740 745 750

Asp?Asp?Asp?Glu?Ile

755

<210>137

<211>2253

<212>DNA

<213> potato

<400>137

atggaaaccc?tactagctga?atctgtgcaa?aacagccttg?gccaatttat?gtaccacaac 60

gccattttca?tgtgtgaacg?actctgtgcc?gagttcccca?ctgagacaaa?tatgcagctt 120

ttagctggct?gctacctgca?caaccaacag?gcttatgctg?catatcatct?tctcaagggg 180

acaagtatgg?ctcaatcccg?ctacttgttt?gcactatcat?gctttcagat?ggatcttctc 240

actgaagctg?agacagcact?ttgccctcct?aatgagccaa?ctgcagaggt?tccaaatggt 300

gcagctgggc?attaccttct?tggtcttatt?tacaggtata?cagatagaag?aaatagttcc 360

atccagcatt?tcaatcaggc?attgttattg?gatccattgc?tatgggctgc?atatgaggag 420

ttgtgtatac?taggtgctgc?agaagaagca?gctgcagttt?ttggggaagc?atctttgctt 480

tgcattcaga?aacaacacat?agaccaaggg?aaccaatctc?aaaatttaca?agcatccact 540

gatgatcaga?atgtagcttc?tacgaatatt?gtctcaggcg?acatcagccc?tatgcaatca 600

aaacatacac?acagccataa?tcttcgagaa?atgtctggaa?attataatgg?agcagctgct 660

atccagaatt?taggtggggt?ttctactaac?atgtcattct?acaacactcc?ctcaccaatg 720

gcatcacagt?tgtcaggagt?ggttccacct?ccagtttgta?gaaattttca?gcaaaatgga 780

actaatgcat?ctgtggctgg?tgctgataat?tctccacgag?caactgtcaa?ttcaaccatt 840

caggcccctc?ggagaaagtt?tgttgatgag?gggaagttaa?gaaagatatc?tgggaggtta 900

ttttctgatt?ctggccctcg?acgaaattca?aggcttgctg?gagaatctac?tggaaacaca 960

aattcaaatg?tatctggtgc?ttctggaaat?ggaacaattc?attcttccaa?atattatggt 1020

agttcgaagc?tgagctcaat?gactttacgt?tccatgacaa?gtcgaaaggc?acaatcttgg 1080

gctaccgaaa?actatggtga?agggactcgc?aatgacattt?ctaatgattc?tcggctaaat 1140

atgactatgt?cacacccttc?tggagatgct?agacctcttg?aacaagaaag?gccccgaact 1200

tctgcttctg?gggttaatgt?aagcagcaca?tctatccctc?tcagtgcttc?agagatattg 1260

gcccttttca?ggtttcttgg?ggaaggctat?agactttctt?gtttatatag?atgtcaggat 1320

gcactggatg?tttataacaa?actcccacac?aaacattatc?acactggatg?ggttctttct 1380

cagattggaa?gagcatactt?cgaaatggtt?gattacctag?aagcagatca?tgcatttggc 1440

cttgctcgtc?tggcctcacc?ttatagttta?gaaggaatgg?acgtgtactc?gacagtgttg 1500

tttcatctca?aggaggacat?gaagttgagc?tatctggcgc?aggtgctggt?atcaactgat 1560

agattagctc?ctcaatcttg?gtgtgctatg?gggaattgct?atagtttaca?gaaagaccat 1620

gaaactgctc?ttaaaaattt?tcaacgagct?gtacaactaa?atcctagatt?tgcatacggg 1680

cacacgcttt?gtggtcatga?atatgttgct?ttagaagatt?ttgaaaatgc?tattaagagc 1740

tatcagagtg?cacttcgtgt?ggatgccagg?cattacaatg?cctggtatgg?gcttggaatg 1800

atctatctcc?gacaggagaa?gtttgaattt?tcagagcatc?actttcgaat?ggctttgggt 1860

ataaatccac?agtcttctgt?tatcatgtca?tatcttggca?ctgcattaca?cgctctgaag 1920

aaaaatgaag?aggcattgga?agtgatggag?ctggctattg?tagcagacaa?gaaaaaccct 1980

cttccaatgt?atcagaaggc?taacatcctt?gtgagcacgg?aaagttttga?tgccgcttta 2040

gaagtcttag?aggaacttaa?agagcatgct?cctcgtgaga?gcagtgtcta?tgctttgatg 2100

ggtcggatat?acaagaggcg?taatatgtac?gacaaagcca?tgcttcattt?tggagtggca 2160

ttagatttaa?aaccatctgc?aactgatgtt?gctaccatta?aggctgccat?tgaaaagctg 2220

catgtaccag?atgagatgga?agatgaatta?taa 2253

<210>138

<211>750

<212>PRT

<213> potato

<400>138

Met?Glu?Thr?Leu?Leu?Ala?Glu?Ser?Val?Gln?Asn?Ser?Leu?Gly?Gln?Phe

1 5 10 15

Met?Tyr?His?Asn?Ala?Ile?Phe?Met?Cys?Glu?Arg?Leu?Cys?Ala?Glu?Phe

20 25 30

Pro?Thr?Glu?Thr?Asn?Met?Gln?Leu?Leu?Ala?Gly?Cys?Tyr?Leu?His?Asn

35 40 45

Gln?Gln?Ala?Tyr?Ala?Ala?Tyr?His?Leu?Leu?Lys?Gly?Thr?Ser?Met?Ala

50 55 60

Gln?Ser?Arg?Tyr?Leu?Phe?Ala?Leu?Ser?Cys?Phe?Gln?Met?Asp?Leu?Leu

65 70 75 80

Thr?Glu?Ala?Glu?Thr?Ala?Leu?Cys?Pro?Pro?Asn?Glu?Pro?Thr?Ala?Glu

85 90 95

Val?Pro?Asn?Gly?Ala?Ala?Gly?His?Tyr?Leu?Leu?Gly?Leu?Ile?Tyr?Arg

100 105 110

Tyr?Thr?Asp?Arg?Arg?Asn?Ser?Ser?Ile?Gln?His?Phe?Asn?Gln?Ala?Leu

115 120 125

Leu?Leu?Asp?Pro?Leu?Leu?Trp?Ala?Ala?Tyr?Glu?Glu?Leu?Cys?Ile?Leu

130 135 140

Gly?Ala?Ala?Glu?Glu?Ala?Ala?Ala?Val?Phe?Gly?Glu?Ala?Ser?Leu?Leu

145 150 155 160

Cys?Ile?Gln?Lys?Gln?His?Ile?Asp?Gln?Gly?Asn?Gln?Ser?Gln?Asn?Leu

165 170 175

Gln?Ala?Ser?Thr?Asp?Asp?Gln?Asn?Val?Ala?Ser?Thr?Asn?Ile?Val?Ser

180 185 190

Gly?Asp?Ile?Ser?Pro?Met?Gln?Ser?Lys?His?Thr?His?Ser?His?Asn?Leu

195 200 205

Arg?Glu?Met?Ser?Gly?Asn?Tyr?Asn?Gly?Ala?Ala?Ala?Ile?Gln?Asn?Leu

210 215 220

Gly?Gly?Val?Ser?Thr?Asn?Met?Ser?Phe?Tyr?Asn?Thr?Pro?Ser?Pro?Met

225 230 235 240

Ala?Ser?Gln?Leu?Ser?Gly?Val?Val?Pro?Pro?Pro?Val?Cys?Arg?Asn?Phe

245 250 255

Gln?Gln?Asn?Gly?Thr?Asn?Ala?Ser?Val?Ala?Gly?Ala?Asp?Asn?Ser?Pro

260 265 270

Arg?Ala?Thr?Val?Asn?Ser?Thr?Ile?Gln?Ala?Pro?Arg?Arg?Lys?Phe?Val

275 280 285

Asp?Glu?Gly?Lys?Leu?Arg?Lys?Ile?Ser?Gly?Arg?Leu?Phe?Ser?Asp?Ser

290 295 300

Gly?Pro?Arg?Arg?Asn?Ser?Arg?Leu?Ala?Gly?Glu?Ser?Thr?Gly?Asn?Thr

305 310 315 320

Asn?Ser?Asn?Val?Ser?Gly?Ala?Ser?Gly?Asn?Gly?Thr?Ile?His?Ser?Ser

325 330 335

Lys?Tyr?Tyr?Gly?Ser?Ser?Lys?Leu?Ser?Ser?Met?Thr?Leu?Arg?Ser?Met

340 345 350

Thr?Ser?Arg?Lys?Ala?Gln?Ser?Trp?Ala?Thr?Glu?Asn?Tyr?Gly?Glu?Gly

355 360 365

Thr?Arg?Asn?Asp?Ile?Ser?Asn?Asp?Ser?Arg?Leu?Asn?Met?Thr?Met?Ser

370 375 380

His?Pro?Ser?Gly?Asp?Ala?Arg?Pro?Leu?Glu?Gln?Glu?Arg?Pro?Arg?Thr

385 390 395 400

Ser?Ala?Ser?Gly?Val?Asn?Val?Ser?Ser?Thr?Ser?Ile?Pro?Leu?Ser?Ala

405 410 415

Ser?Glu?Ile?Leu?Ala?Leu?Phe?Arg?Phe?Leu?Gly?Glu?Gly?Tyr?Arg?Leu

420 425 430

Ser?Cys?Leu?Tyr?Arg?Cys?Gln?Asp?Ala?Leu?Asp?Val?Tyr?Asn?Lys?Leu

435 440 445

Pro?His?Lys?His?Tyr?His?Thr?Gly?Trp?Val?Leu?Ser?Gln?Ile?Gly?Arg

450 455 460

Ala?Tyr?Phe?Glu?Met?Val?Asp?Tyr?Leu?Glu?Ala?Asp?His?Ala?Phe?Gly

465 470 475 480

Leu?Ala?Arg?Leu?Ala?Ser?Pro?Tyr?Ser?Leu?Glu?Gly?Met?Asp?Val?Tyr

485 490 495

Ser?Thr?Val?Leu?Phe?His?Leu?Lys?Glu?Asp?Met?Lys?Leu?Ser?Tyr?Leu

500 505 510

Ala?Gln?Val?Leu?Val?Ser?Thr?Asp?Arg?Leu?Ala?Pro?Gln?Ser?Trp?Cys

515 520 525

Ala?Met?Gly?Asn?Cys?Tyr?Ser?Leu?Gln?Lys?Asp?His?Glu?Thr?Ala?Leu

530 535 540

Lys?Asn?Phe?Gln?Arg?Ala?Val?Gln?Leu?Asn?Pro?Arg?Phe?Ala?Tyr?Gly

545 550 555 560

His?Thr?Leu?Cys?Gly?His?Glu?Tyr?Val?Ala?Leu?Glu?Asp?Phe?Glu?Asn

565 570 575

Ala?Ile?Lys?Ser?Tyr?Gln?Ser?Ala?Leu?Arg?Val?Asp?Ala?Arg?His?Tyr

580 585 590

Asn?Ala?Trp?Tyr?Gly?Leu?Gly?Met?Ile?Tyr?Leu?Arg?Gln?Glu?Lys?Phe

595 600 605

Glu?Phe?Ser?Glu?His?His?Phe?Arg?Met?Ala?Leu?Gly?Ile?Asn?Pro?Gln

610 615 620

Ser?Ser?Val?Ile?Met?Ser?Tyr?Leu?Gly?Thr?Ala?Leu?His?Ala?Leu?Lys

625 630 635 640

Lys?Asn?Glu?Glu?Ala?Leu?Glu?Val?Met?Glu?Leu?Ala?Ile?Val?Ala?Asp

645 650 655

Lys?Lys?Asn?Pro?Leu?Pro?Met?Tyr?Gln?Lys?Ala?Asn?Ile?Leu?Val?Ser

660 665 670

Thr?Glu?Ser?Phe?Asp?Ala?Ala?Leu?Glu?Val?Leu?Glu?Glu?Leu?Lys?Glu

675 680 685

His?Ala?Pro?Arg?Glu?Ser?Ser?Val?Tyr?Ala?Leu?Met?Gly?Arg?Ile?Tyr

690 695 700

Lys?Arg?Arg?Asn?Met?Tyr?Asp?Lys?Ala?Met?Leu?His?Phe?Gly?Val?Ala

705 710 715 720

Leu?Asp?Leu?Lys?Pro?Ser?Ala?Thr?Asp?Val?Ala?Thr?Ile?Lys?Ala?Ala

725 730 735

Ile?Glu?Lys?Leu?His?Val?Pro?Asp?Glu?Met?Glu?Asp?Glu?Leu

740 745 750

<210>139

<211>1998

<212>DNA

<213> schizosaccharomyces pombe (Schizosaccharomyces pombe)

<400>139

atgacagatc?gattgaaatg?tttaatatgg?tattgcattg?ataatcagaa?ttatgataat 60

tcaatttttt?attcagaacg?tttacatgca?attgaagatt?caaacgagag?tttgtatctt 120

ttggcatatt?cgcatttcct?aaacctcgat?tacaatattg?tatacgactt?attagataga 180

gtaattagtc?atgttccttg?cacatactta?tttgcaagga?ccagccttat?tttaggcaga 240

tataaacaag?gaataagtgc?tgtggaggcc?tgtcgatcga?attggcgctc?cattcagcca 300

aacataaatg?actcaattag?cagtcgtgga?catccagatg?cctcttgcat?gcttgatgtt 360

ttgggtacta?tgtataaaaa?ggcagggttc?ctcaaaaaag?ctacagattg?ttttgtagaa 420

gctgtctcca?ttaacccata?taatttctct?gctttccaga?atttaactgc?aataggcgtg 480

ccactcgatg?ctaataatgt?atttgttatt?ccaccctacc?ttacggcaat?gaagggtttt 540

gaaaaatctc?aaacgaatgc?tacagcttcg?gtaccagaac?cgtctttttt?gaagaaaagt 600

aaagagtctt?cctcatcttc?caacaagttt?tcggtttctg?aatcgatagc?aaatagttat 660

tcaaactcat?ccatttcagc?atttactaag?tggtttgata?gggttgacgc?ttctgagctt 720

ccaggaagtg?agaaggaacg?acatcaaagc?ttgaaattac?aatctcaatc?tcagactagc 780

aaaaaccttt?tggctttcaa?tgatgctcaa?aaagctgatt?ctaacaatag?ggatacgtct 840

ttaaaatccc?actttgtgga?acctagaacc?caagcattaa?gaccaggagc?tcgtttaaca 900

tataaattac?gcgaagcgag?aagttctaaa?agaggagaga?gcacacctca?aagcttccgc 960

gaagaggaca?ataatttgat?ggaattacta?aagttattcg?gtaagggtgt?ttacctgctc 1020

gcccagtata?agttacgaga?ggctttaaat?tgtttccaaa?gcttgcccat?cgaacagcaa 1080

aatacacctt?ttgttcttgc?aaagcttgga?ataacctact?ttgaactggt?tgattacgaa 1140

aaatctgaag?aagtgtttca?aaaattaagg?gacttgtcgc?cttcacgtgt?caaagatatg 1200

gaagtctttt?caactgcact?ttggcatttg?caaaagtctg?ttcctttatc?ttaccttgcc 1260

catgaaactt?tggaaactaa?tccttattcc?ccagaatcat?ggtgcattct?tgctaattgc 1320

ttctcacttc?aacgtgaaca?ctcgcaggca?ttaaaatgta?ttaatagagc?tattcaattg 1380

gatccaactt?ttgaatatgc?ttatacgctt?caagggcacg?agcattctgc?aaacgaagaa 1440

tacgaaaaat?cgaaaacatc?tttccgcaaa?gcaattagag?taaatgttcg?acattacaat 1500

gcatggtatg?gcctgggaat?ggtttattta?aaaacagggc?gaaatgatca?agcagacttt 1560

cattttcaac?gtgctgcaga?gatcaatcct?aacaactctg?tactcatcac?ttgtattggt 1620

atgatttacg?aacgctgcaa?agattacaaa?aaagcacttg?atttttatga?tcgggcatgt 1680

aaactggatg?aaaagtcttc?gcttgccagg?ttcaagaaag?ccaaagtgct?tattttatta 1740

catgatcacg?ataaagcact?cgttgaattg?gaacaattaa?aggcaattgc?gccagatgaa 1800

gcaaatgttc?attttttgct?cggcaaaatt?ttcaagcaaa?tgcggaaaaa?aaatttagcc 1860

ttaaagcact?tcactatagc?atggaactta?gacggcaagg?ctacgcatat?tattaaggaa 1920

tcgattgaaa?atctggatat?tcccgaagaa?aatttgttaa?ctgaaacagg?tgaaatttat 1980

aggaatctgg?aaacttaa 1998

<210>140

<211>665

<212>PRT

<213> schizosaccharomyces pombe

<400>140

Met?Thr?Asp?Arg?Leu?Lys?Cys?Leu?Ile?Trp?Tyr?Cys?Ile?Asp?Asn?Gln

1 5 10 15

Asn?Tyr?Asp?Asn?Ser?Ile?Phe?Tyr?Ser?Glu?Arg?Leu?His?Ala?Ile?Glu

20 25 30

Asp?Ser?Asn?Glu?Ser?Leu?Tyr?Leu?Leu?Ala?Tyr?Ser?His?Phe?Leu?Asn

35 40 45

Leu?Asp?Tyr?Asn?Ile?Val?Tyr?Asp?Leu?Leu?Asp?Arg?Val?Ile?Ser?His

50 55 60

Val?Pro?Cys?Thr?Tyr?Leu?Phe?Ala?Arg?Thr?Ser?Leu?Ile?Leu?Gly?Arg

65 70 75 80

Tyr?Lys?Gln?Gly?Ile?Ser?Ala?Val?Glu?Ala?Cys?Arg?Ser?Asn?Trp?Arg

85 90 95

Ser?Ile?Gln?Pro?Asn?Ile?Asn?Asp?Ser?Ile?Ser?Ser?Arg?Gly?His?Pro

100 105 110

Asp?Ala?Ser?Cys?Met?Leu?Asp?Val?Leu?Gly?Thr?Met?Tyr?Lys?Lys?Ala

115 120 125

Gly?Phe?Leu?Lys?Lys?Ala?Thr?Asp?Cys?Phe?Val?Glu?Ala?Val?Ser?Ile

130 135 140

Asn?Pro?Tyr?Asn?Phe?Ser?Ala?Phe?Gln?Asn?Leu?Thr?Ala?Ile?Gly?Val

145 150 155 160

Pro?Leu?Asp?Ala?Asn?Asn?Val?Phe?Val?Ile?Pro?Pro?Tyr?Leu?Thr?Ala

165 170 175

Met?Lys?Gly?Phe?Glu?Lys?Ser?Gln?Thr?Asn?Ala?Thr?Ala?Ser?Val?Pro

180 185 190

Glu?Pro?Ser?Phe?Leu?Lys?Lys?Ser?Lys?Glu?Ser?Ser?Ser?Ser?Ser?Asn

195 200 205

Lys?Phe?Ser?Val?Ser?Glu?Ser?Ile?Ala?Asn?Ser?Tyr?Ser?Asn?Ser?Ser

210 215 220

Ile?Ser?Ala?Phe?Thr?Lys?Trp?Phe?Asp?Arg?Val?Asp?Ala?Ser?Glu?Leu

225 230 235 240

Pro?Gly?Ser?Glu?Lys?Glu?Arg?His?Gln?Ser?Leu?Lys?Leu?Gln?Ser?Gln

245 250 255

Ser?Gln?Thr?Ser?Lys?Asn?Leu?Leu?Ala?Phe?Asn?Asp?Ala?Gln?Lys?Ala

260 265 270

Asp?Ser?Asn?Asn?Arg?Asp?Thr?Ser?Leu?Lys?Ser?His?Phe?Val?Glu?Pro

275 280 285

Arg?Thr?Gln?Ala?Leu?Arg?Pro?Gly?Ala?Arg?Leu?Thr?Tyr?Lys?Leu?Arg

290 295 300

Glu?Ala?Arg?Ser?Ser?Lys?Arg?Gly?Glu?Ser?Thr?Pro?Gln?Ser?Phe?Arg

305 310 315 320

Glu?Glu?Asp?Asn?Asn?Leu?Met?Glu?Leu?Leu?Lys?Leu?Phe?Gly?Lys?Gly

325 330 335

Val?Tyr?Leu?Leu?Ala?Gln?Tyr?Lys?Leu?Arg?Glu?Ala?Leu?Asn?Cys?Phe

340 345 350

Gln?Ser?Leu?Pro?Ile?Glu?Gln?Gln?Asn?Thr?Pro?Phe?Val?Leu?Ala?Lys

355 360 365

Leu?Gly?Ile?Thr?Tyr?Phe?Glu?Leu?Val?Asp?Tyr?Glu?Lys?Ser?Glu?Glu

370 375 380

Val?Phe?Gln?Lys?Leu?Arg?Asp?Leu?Ser?Pro?Ser?Arg?Val?Lys?Asp?Met

385 390 395 400

Glu?Val?Phe?Ser?Thr?Ala?Leu?Trp?His?Leu?Gln?Lys?Ser?Val?Pro?Leu

405 410 415

Ser?Tyr?Leu?Ala?His?Glu?Thr?Leu?Glu?Thr?Asn?Pro?Tyr?Ser?Pro?Glu

420 425 430

Ser?Trp?Cys?Ile?Leu?Ala?Asn?Cys?Phe?Ser?Leu?Gln?Arg?Glu?His?Ser

435 440 445

Gln?Ala?Leu?Lys?Cys?Ile?Asn?Arg?Ala?Ile?Gln?Leu?Asp?Pro?Thr?Phe

450 455 460

Glu?Tyr?Ala?Tyr?Thr?Leu?Gln?Gly?His?Glu?His?Ser?Ala?Asn?Glu?Glu

465 470 475 480

Tyr?Glu?Lys?Ser?Lys?Thr?Ser?Phe?Arg?Lys?Ala?Ile?Arg?Val?Asn?Val

485 490 495

Arg?His?Tyr?Asn?Ala?Trp?Tyr?Gly?Leu?Gly?Met?Val?Tyr?Leu?Lys?Thr

500 505 510

Gly?Arg?Asn?Asp?Gln?Ala?Asp?Phe?His?Phe?Gln?Arg?Ala?Ala?Glu?Ile

515 520 525

Asn?Pro?Asn?Asn?Ser?Val?Leu?Ile?Thr?Cys?Ile?Gly?Met?Ile?Tyr?Glu

530 535 540

Arg?Cys?Lys?Asp?Tyr?Lys?Lys?Ala?Leu?Asp?Phe?Tyr?Asp?Arg?Ala?Cys

545 550 555 560

Lys?Leu?Asp?Glu?Lys?Ser?Ser?Leu?Ala?Arg?Phe?Lys?Lys?Ala?Lys?Val

565 570 575

Leu?Ile?Leu?Leu?His?Asp?His?Asp?Lys?Ala?Leu?Val?Glu?Leu?Glu?Gln

580 585 590

Leu?Lys?Ala?Ile?Ala?Pro?Asp?Glu?Ala?Asn?Val?His?Phe?Leu?Leu?Gly

595 600 605

Lys?Ile?Phe?Lys?Gln?Met?Arg?Lys?Lys?Asn?Leu?Ala?Leu?Lys?His?Phe

610 615 620

Thr?Ile?Ala?Trp?Asn?Leu?Asp?Gly?Lys?Ala?Thr?His?Ile?Ile?Lys?Glu

625 630 635 640

Ser?Ile?Glu?Asn?Leu?Asp?Ile?Pro?Glu?Glu?Asn?Leu?Leu?Thr?Glu?Thr

645 650 655

Gly?Glu?Ile?Tyr?Arg?Asn?Leu?Glu?Thr

660 665

<210>141

<211>2421

<212>DNA

<213> aspergillus niger (Aspergillus niger)

<400>141

atgactccgt?ccacatcaca?tatttcgagc?cagctaaggc?agctgatata?ttaccatctt 60

gacaacaacc?ttgctcggaa?cgcgctgttc?cttgccggtc?gtttacacgc?ctacgaacct 120

cggacgtcgg?aagcttcgta?cctattagct?ctgtgttacc?tacaaaatgg?tcaggtgaaa 180

gcagcatggg?aaactagcaa?gcattttggg?tcgaggggtg?cgcatcttgg?atgttcttac 240

gtctacgcgc?aggcttgtct?tgacctcggg?aaatatacgg?acggtattaa?cgcgctagag 300

cgaagtaagg?gacaatggac?ttcgcgaaac?cactggaata?aacacagtga?gacgcgacga 360

caacacttgc?cggatgctgc?ggcagtttta?tgtttgcaag?gaaaattatg?gcaggcacac 420

aaggaacaca?acaaggctgt?ggagtgttac?gctgcagctt?taaagctgaa?tcccttcatg 480

tgggatgcat?tcttgaatct?gtgcgaaact?ggtgttgatt?tgcgtgtttc?aaacatatat 540

aagatgagcc?cggaattgta?cagcatggta?tcgtctgctg?cgctcgaaga?tgttgaatcc 600

caggttctac?ctccggacgg?tccactccag?acacaagtta?acccaaatcc?gagcttggac 660

ccgttcactg?ccggtacgac?tcgcagcgat?tcgacctcta?ctcacgggag?ctcagctttg 720

tgggaaaagt?tgaatggaag?cacagttagt?gtggcatctt?caggaacagg?accgcatctt 780

ccgcgggaag?gcatggagac?tcctggtggc?caaagtagcg?aatctgatga?tccacgtgta 840

accaacggta?atggcacaga?tgtttttgag?ccgccgctag?cccctgcaaa?gaagaatcga 900

acgatccaaa?caataggcgg?cgatcatccg?atggatcccc?cgccaaagat?gcggccaacc 960

ggtattcgac?cgaggacccg?aaccaaattc?gagtcagatg?aaggtcatac?tgagagagac 1020

gcgggcatgg?gtcacaggtt?aggcgatcgg?aaacgaacgg?tctctggaca?agttgcgcat 1080

ccgtcggtac?cgcattcaac?cgaccaaggt?gtcgggcaac?ggcgaagtgt?acgtctcttt 1140

aaccagataa?agccatcaac?gaacaaaata?tctagcacgg?cattaggagt?gaaagagggc 1200

cgggaggtga?aaaaggtgag?aactacgggg?aataaggcgc?gcacaacaac?aagctcaaat 1260

gtgggccgtg?ttgttagcgg?caacaatcga?cgacacgctg?gggagatcca?tgacggagac 1320

agcaaagaat?accgtggaac?atcttcaaca?tcaaatggct?ctcagaacgc?atcgtctaag 1380

ctcgctatat?ctgagcggac?caaatcggtt?gaagccttgg?cttggatttt?ggacttgttt 1440

ttcaagatag?cctccggcta?tttctgtctc?agccggtaca?aatgctccga?tgctatccag 1500

attttcagct?ctctatccca?gggccaacgg?gagacaccgt?gggttcttgc?tcaaattgga 1560

cgagcttact?acgagcaagc?aatgtataca?gaggccgaga?aatactttgt?ccgggtgaag 1620

gccatggcgc?cttcccggtt?agaagatatg?gagatctact?cgacggttct?ttggcatttg 1680

aagaatgatg?tcgaacttgc?ttacctggcc?catgagttaa?tggatgtcga?tcgcttatca 1740

ccagaagctt?ggtgtgctgt?cggtaactcg?ttctcacacc?agcgggacca?cgatcaagct 1800

ctgaagtgct?tcaagcgtgc?cactcaattg?gatcctcatt?tcgcgtatgg?gttcacgcta 1860

cagggccatg?agtatgttgc?caacgaggaa?tatgacaagg?cattggatgc?ctatagaagc 1920

ggcatcaacg?cggacagtcg?acattataat?gcctggtacg?ggctgggaac?ggtctacgat 1980

aagatgggca?aacttgactt?tgctgaacag?cacttccgta?atgcggccaa?gattaatcct 2040

tctaatgctg?ttttaatatg?ctgcattggc?ttggtcttag?agaagatgaa?caatccgaag 2100

tcagcgttga?tccagtacaa?cagggcctgc?accctcgcgc?ctcattctgt?tcttgctcga 2160

ttccgaaaag?cccgtgcgtt?gatgaaattg?caggatctca?agtcagcgct?tacggagctg 2220

aaggttctga?aggacatggc?gccggatgag?gcaaacgttc?attacctcct?gggcaaactg 2280

tataagatgc?ttcgtgacaa?gggaaatgcc?attaagcact?tcacaactgc?attaaacctt 2340

gatcccaagg?cggcgcagta?catcaaagat?gcaatggaag?cccttgacga?cgatgaagag 2400

gatgaagaag?atatggcgtg?a 2421

<210>142

<211>806

<212>PRT

<213> aspergillus niger

<400>142

Met?Thr?Pro?Ser?Thr?Ser?His?Ile?Ser?Ser?Gln?Leu?Arg?Gln?Leu?Ile

1 5 10 15

Tyr?Tyr?His?Leu?Asp?Asn?Asn?Leu?Ala?Arg?Asn?Ala?Leu?Phe?Leu?Ala

20 25 30

Gly?Arg?Leu?His?Ala?Tyr?Glu?Pro?Arg?Thr?Ser?Glu?Ala?Ser?Tyr?Leu

35 40 45

Leu?Ala?Leu?Cys?Tyr?Leu?Gln?Asn?Gly?Gln?Val?Lys?Ala?Ala?Trp?Glu

50 55 60

Thr?Ser?Lys?His?Phe?Gly?Ser?Arg?Gly?Ala?His?Leu?Gly?Cys?Ser?Tyr

65 70 75 80

Val?Tyr?Ala?Gln?Ala?Cys?Leu?Asp?Leu?Gly?Lys?Tyr?Thr?Asp?Gly?Ile

85 90 95

Asn?Ala?Leu?Glu?Arg?Ser?Lys?Gly?Gln?Trp?Thr?Ser?Arg?Asn?His?Trp

100 105 110

Asn?Lys?His?Ser?Glu?Thr?Arg?Arg?Gln?His?Leu?Pro?Asp?Ala?Ala?Ala

115 120 125

Val?Leu?Cys?Leu?Gln?Gly?Lys?Leu?Trp?Gln?Ala?His?Lys?Glu?His?Asn

130 135 140

Lys?Ala?Val?Glu?Cys?Tyr?Ala?Ala?Ala?Leu?Lys?Leu?Asn?Pro?Phe?Met

145 150 155 160

Trp?Asp?Ala?Phe?Leu?Asn?Leu?Cys?Glu?Thr?Gly?Val?Asp?Leu?Arg?Val

165 170 175

Ser?Asn?Ile?Tyr?Lys?Met?Ser?Pro?Glu?Leu?Tyr?Ser?Met?Val?Ser?Ser

180 185 190

Ala?Ala?Leu?Glu?Asp?Val?Glu?Ser?Gln?Val?Leu?Pro?Pro?Asp?Gly?Pro

195 200 205

Leu?Gln?Thr?Gln?Val?Asn?Pro?Asn?Pro?Ser?Leu?Asp?Pro?Phe?Thr?Ala

210 215 220

Gly?Thr?Thr?Arg?Ser?Asp?Ser?Thr?Ser?Thr?His?Gly?Ser?Ser?Ala?Leu

225 230 235 240

Trp?Glu?Lys?Leu?Asn?Gly?Ser?Thr?Val?Ser?Val?Ala?Ser?Ser?Gly?Thr

245 250 255

Gly?Pro?His?Leu?Pro?Arg?Glu?Gly?Met?Glu?Thr?Pro?Gly?Gly?Gln?Ser

260 265 270

Ser?Glu?Ser?Asp?Asp?Pro?Arg?Val?Thr?Asn?Gly?Asn?Gly?Thr?Asp?Val

275 280 285

Phe?Glu?Pro?Pro?Leu?Ala?Pro?Ala?Lys?Lys?Asn?Arg?Thr?Ile?Gln?Thr

290 295 300

Ile?Gly?Gly?Asp?His?Pro?Met?Asp?Pro?Pro?Pro?Lys?Met?Arg?Pro?Thr

305 310 315 320

Gly?Ile?Arg?Pro?Arg?Thr?Arg?Thr?Lys?Phe?Glu?Ser?Asp?Glu?Gly?His

325 330 335

Thr?Glu?Arg?Asp?Ala?Gly?Met?Gly?His?Arg?Leu?Gly?Asp?Arg?Lys?Arg

340 345 350

Thr?Val?Ser?Gly?Gln?Val?Ala?His?Pro?Ser?Val?Pro?His?Ser?Thr?Asp

355 360 365

Gln?Gly?Val?Gly?Gln?Arg?Arg?Ser?Val?Arg?Leu?Phe?Asn?Gln?Ile?Lys

370 375 380

Pro?Ser?Thr?Asn?Lys?Ile?Ser?Ser?Thr?Ala?Leu?Gly?Val?Lys?Glu?Gly

385 390 395 400

Arg?Glu?Val?Lys?Lys?Val?Arg?Thr?Thr?Gly?Asn?Lys?Ala?Arg?Thr?Thr

405 410 415

Thr?Ser?Ser?Asn?Val?Gly?Arg?Val?Val?Ser?Gly?Asn?Asn?Arg?Arg?His

420 425 430

Ala?Gly?Glu?Ile?His?Asp?Gly?Asp?Ser?Lys?Glu?Tyr?Arg?Gly?Thr?Ser

435 440 445

Ser?Thr?Ser?Asn?Gly?Ser?Gln?Asn?Ala?Ser?Ser?Lys?Leu?Ala?Ile?Ser

450 455 460

Glu?Arg?Thr?Lys?Ser?Val?Glu?Ala?Leu?Ala?Trp?Ile?Leu?Asp?Leu?Phe

465 470 475 480

Phe?Lys?Ile?Ala?Ser?Gly?Tyr?Phe?Cys?Leu?Ser?Arg?Tyr?Lys?Cys?Ser

485 490 495

Asp?Ala?Ile?Gln?Ile?Phe?Ser?Ser?Leu?Ser?Gln?Gly?Gln?Arg?Glu?Thr

500 505 510

Pro?Trp?Val?Leu?Ala?Gln?Ile?Gly?Arg?Ala?Tyr?Tyr?Glu?Gln?Ala?Met

515 520 525

Tyr?Thr?Glu?Ala?Glu?Lys?Tyr?Phe?Val?Arg?Val?Lys?Ala?Met?Ala?Pro

530 535 540

Ser?Arg?Leu?Glu?Asp?Met?Glu?Ile?Tyr?Ser?Thr?Val?Leu?Trp?His?Leu

545 550 555 560

Lys?Asn?Asp?Val?Glu?Leu?Ala?Tyr?Leu?Ala?His?Glu?Leu?Met?Asp?Val

565 570 575

Asp?Arg?Leu?Ser?Pro?Glu?Ala?Trp?Cys?Ala?Val?Gly?Asn?Ser?Phe?Ser

580 585 590

His?Gln?Arg?Asp?His?Asp?Gln?Ala?Leu?Lys?Cys?Phe?Lys?Arg?Ala?Thr

595 600 605

Gln?Leu?Asp?Pro?His?Phe?Ala?Tyr?Gly?Phe?Thr?Leu?Gln?Gly?His?Glu

610 615 620

Tyr?Val?Ala?Asn?Glu?Glu?Tyr?Asp?Lys?Ala?Leu?Asp?Ala?Tyr?Arg?Ser

625 630 635 640

Gly?Ile?Asn?Ala?Asp?Ser?Arg?His?Tyr?Asn?Ala?Trp?Tyr?Gly?Leu?Gly

645 650 655

Thr?Val?Tyr?Asp?Lys?Met?Gly?Lys?Leu?Asp?Phe?Ala?Glu?Gln?His?Phe

660 665 670

Arg?Asn?Ala?Ala?Lys?Ile?Asn?Pro?Ser?Asn?Ala?Val?Leu?Ile?Cys?Cys

675 680 685

Ile?Gly?Leu?Val?Leu?Glu?Lys?Met?Asn?Asn?Pro?Lys?Ser?Ala?Leu?Ile

690 695 700

Gln?Tyr?Asn?Arg?Ala?Cys?Thr?Leu?Ala?Pro?His?Ser?Val?Leu?Ala?Arg

705 710 715 720

Phe?Arg?Lys?Ala?Arg?Ala?Leu?Met?Lys?Leu?Gln?Asp?Leu?Lys?Ser?Ala

725 730 735

Leu?Thr?Glu?Leu?Lys?Val?Leu?Lys?Asp?Met?Ala?Pro?Asp?Glu?Ala?Asn

740 745 750

Val?His?Tyr?Leu?Leu?Gly?Lys?Leu?Tyr?Lys?Met?Leu?Arg?Asp?Lys?Gly

755 760 765

Asn?Ala?Ile?Lys?His?Phe?Thr?Thr?Ala?Leu?Asn?Leu?Asp?Pro?Lys?Ala

770 775 780

Ala?Gln?Tyr?Ile?Lys?Asp?Ala?Met?Glu?Ala?Leu?Asp?Asp?Asp?Glu?Glu

785 790 795 800

Asp?Glu?Glu?Asp?Met?Ala

805

<210>143

<211>2472

<212>DNA

<213> people (Homo sapiens)

<400>143

atgacggtgc?tgcaggaacc?cgtccaggct?gctatatggc?aagcactaaa?ccactatgct 60

taccgagatg?cggttttcct?cgcagaacgc?ctttatgcag?aagtacactc?agaagaagcc 120

ttgtttttac?tggcaacctg?ttattaccgc?tcaggaaagg?catataaagc?atatagactc 180

ttgaaaggac?acagttgtac?tacaccgcaa?tgcaaatacc?tgcttgcaaa?atgttgtgtt 240

gatctcagca?agcttgcaga?aggggaacaa?atcttatctg?gtggagtgtt?taataagcag 300

aaaagccatg?atgatattgt?tactgagttt?ggtgattcag?cttgctttac?tctttcattg 360

ttgggacatg?tatattgcaa?gacagatcgg?cttgccaaag?gatcagaatg?ttaccaaaag 420

agccttagtt?taaatccttt?cctctggtct?ccctttgaat?cattatgtga?aataggtgaa 480

aagccagatc?ctgaccaaac?atttaaattc?acatctttac?agaactttag?caactgtctg 540

cccaactctt?gcacaacaca?agtacctaat?catagtttat?ctcacagaca?gcctgagaca 600

gttcttacgg?aaacacccca?ggacacaatt?gaattaaaca?gattgaattt?agaatcttcc 660

aattcaaagt?actccttgaa?tacagattcc?tcagtgtctt?atattgattc?agctgtaatt 720

tcacctgata?ctgtcccact?gggaacagga?acttccatat?tatctaaaca?ggttcaaaat 780

aaaccaaaaa?ctggtcgaag?tttattagga?ggaccagcag?ctcttagtcc?attaacccca 840

agttttggga?ttttgccatt?agaaacccca?agtcctggag?atggatccta?tttacaaaac 900

tacactaata?cacctcctgt?aattgatgtg?ccatccaccg?gagccccttc?aaaaaagtct 960

gttgccagaa?tcggccaaac?tggaacaaag?tctgtcttct?cacagagtgg?aaatagccga 1020

gaggtaactc?caattcttgc?acaaacacaa?agttctggtc?cacaaacaag?tacaacacct 1080

caggtattga?gccccactat?tacatctccc?ccaaacgcac?tacctcgaag?aagttcacga 1140

ctctttacta?gtgacagctc?cacaaccaag?gagaatagca?aaaaattaaa?aatgaagttt 1200

ccacctaaaa?tcccaaacag?aaaaacaaaa?agtaaaacta?ataaaggagg?aataactcaa 1260

cctaacataa?atgatagcct?ggaaattaca?aaattggact?cttccatcat?ttcagaaggg 1320

aaaatatcca?caatcacacc?tcagattcag?gcctttaatc?tacaaaaagc?agcagcaggt 1380

ttgatgagcc?ttcttcgtga?aatggggaaa?ggttatttag?ctttgtgttc?atacaactgc 1440

aaagaagcta?taaatatttt?gagccatcta?ccttctcacc?actacaatac?tggttgggta 1500

ctgtgccaaa?ttggaagggc?ctattttgaa?ctttcagagt?acatgcaagc?tgaaagaata 1560

ttctcagagg?ttagaaggat?tgagaattat?agagttgaag?gcatggagat?ctactctaca 1620

acactttggc?atcttcaaaa?agatgttgct?ctttcagttc?tgtcaaaaga?cttaacagac 1680

atggataaaa?attcgccaga?ggcctggtgt?gctgcaggga?actgtttcag?tctgcaacgg 1740

gaacatgata?ttgcaattaa?attcttccag?agagctatcc?aagttgatcc?aaattacgct 1800

tatgcctata?ctctattagg?gcatgagttt?gtcttaactg?aagaattgga?caaagcatta 1860

gcttgttttc?gaaatgctat?cagagtcaat?cctagacatt?ataatgcatg?gtatggttta 1920

ggaatgattt?attacaagca?agaaaaattc?agccttgcag?aaatgcattt?ccaaaaagcg 1980

cttgatatca?accctcaaag?ttcagtttta?ctttgccaca?ttggagtagt?tcaacatgca 2040

ctgaaaaaat?cagagaaggc?tttggatacc?ctaaacaaag?ccattgtcat?tgatcccaag 2100

aaccctctat?gcaaatttca?cagagcctca?gttttatttc?gaaatgaaaa?atataagtct 2160

gctttacaag?aacttgaaga?attgaaacaa?attgttccca?aagaatccct?cgtttacttc 2220

ttaataggaa?aggtttacaa?gaagttaggt?caaacgcacc?tcgccctgat?gaatttctct 2280

tgggctatgg?atttagatcc?taaaggagcc?aataaccaga?ttaaagaggc?aattgataag 2340

cgttatcttc?cagatgatga?ggagccaata?acccaagaag?aacagatcat?gggaacagat 2400

gaatcccagg?agagcagcat?gacagatgcg?gatgacacac?aacttcatgc?agctgaaagt 2460

gatgaatttt?aa 2472

<210>144

<211>824

<212>PRT

<213> people

<400>144

Met?Thr?Val?Leu?Gln?Glu?Pro?Val?Gln?Ala?Ala?Ile?Trp?Gln?Ala?Leu

1 5 10 15

Asn?His?Tyr?Ala?Tyr?Arg?Asp?Ala?Val?Phe?Leu?Ala?Glu?Arg?Leu?Tyr

20 25 30

Ala?Glu?Val?His?Ser?Glu?Glu?Ala?Leu?Phe?Leu?Leu?Ala?Thr?Cys?Tyr

35 40 45

Tyr?Arg?Ser?Gly?Lys?Ala?Tyr?Lys?Ala?Tyr?Arg?Leu?Leu?Lys?Gly?His

50 55 60

Ser?Cys?Thr?Thr?Pro?Gln?Cys?Lys?Tyr?Leu?Leu?Ala?Lys?Cys?Cys?Val

65 70 75 80

Asp?Leu?Ser?Lys?Leu?Ala?Glu?Gly?Glu?Gln?Ile?Leu?Ser?Gly?Gly?Val

85 90 95

Phe?Asn?Lys?Gln?Lys?Ser?His?Asp?Asp?Ile?Val?Thr?Glu?Phe?Gly?Asp

100 105 110

Ser?Ala?Cys?Phe?Thr?Leu?Ser?Leu?Leu?Gly?His?Val?Tyr?Cys?Lys?Thr

115 120 125

Asp?Arg?Leu?Ala?Lys?Gly?Ser?Glu?Cys?Tyr?Gln?Lys?Ser?Leu?Ser?Leu

130 135 140

Asn?Pro?Phe?Leu?Trp?Ser?Pro?Phe?Glu?Ser?Leu?Cys?Glu?Ile?Gly?Glu

145 150 155 160

Lys?Pro?Asp?Pro?Asp?Gln?Thr?Phe?Lys?Phe?Thr?Ser?Leu?Gln?Asn?Phe

165 170 175

Ser?Asn?Cys?Leu?Pro?Asn?Ser?Cys?Thr?Thr?Gln?Val?Pro?Asn?His?Ser

180 185 190

Leu?Ser?His?Arg?Gln?Pro?Glu?Thr?Val?Leu?Thr?Glu?Thr?Pro?Gln?Asp

195 200 205

Thr?Ile?Glu?Leu?Asn?Arg?Leu?Asn?Leu?Glu?Ser?Ser?Asn?Ser?Lys?Tyr

210 215 220

Ser?Leu?Asn?Thr?Asp?Ser?Ser?Val?Ser?Tyr?Ile?Asp?Ser?Ala?Val?Ile

225 230 235 240

Ser?Pro?Asp?Thr?Val?Pro?Leu?Gly?Thr?Gly?Thr?Ser?Ile?Leu?Ser?Lys

245 250 255

Gln?Val?Gln?Asn?Lys?Pro?Lys?Thr?Gly?Arg?Ser?Leu?Leu?Gly?Gly?Pro

260 265 270

Ala?Ala?Leu?Ser?Pro?Leu?Thr?Pro?Ser?Phe?Gly?Ile?Leu?Pro?Leu?Glu

275 280 285

Thr?Pro?Ser?Pro?Gly?Asp?Gly?Ser?Tyr?Leu?Gln?Asn?Tyr?Thr?Asn?Thr

290 295 300

Pro?Pro?Val?Ile?Asp?Val?Pro?Ser?Thr?Gly?Ala?Pro?Ser?Lys?Lys?Ser

305 310 315 320

Val?Ala?Arg?Ile?Gly?Gln?Thr?Gly?Thr?Lys?Ser?Val?Phe?Ser?Gln?Ser

325 330 335

Gly?Asn?Ser?Arg?Glu?Val?Thr?Pro?Ile?Leu?Ala?Gln?Thr?Gln?Ser?Ser

340 345 350

Gly?Pro?Gln?Thr?Ser?Thr?Thr?Pro?Gln?Val?Leu?Ser?Pro?Thr?Ile?Thr

355 360 365

Ser?Pro?Pro?Asn?Ala?Leu?Pro?Arg?Arg?Ser?Ser?Arg?Leu?Phe?Thr?Ser

370 375 380

Asp?Ser?Ser?Thr?Thr?Lys?Glu?Asn?Ser?Lys?Lys?Leu?Lys?Met?Lys?Phe

385 390 395 400

Pro?Pro?Lys?Ile?Pro?Asn?Arg?Lys?Thr?Lys?Ser?Lys?Thr?Asn?Lys?Gly

405 410 415

Gly?Ile?Thr?Gln?Pro?Asn?Ile?Asn?Asp?Ser?Leu?Glu?Ile?Thr?Lys?Leu

420 425 430

Asp?Ser?Ser?Ile?Ile?Ser?Glu?Gly?Lys?Ile?Ser?Thr?Ile?Thr?Pro?Gln

435 440 445

Ile?Gln?Ala?Phe?Asn?Leu?Gln?Lys?Ala?Ala?Ala?Ala?Gly?Leu?Met?Ser

450 455 460

Leu?Leu?Arg?Glu?Met?Gly?Lys?Gly?Tyr?Leu?Ala?Leu?Cys?Ser?Tyr?Asn

465 470 475 480

Cys?Lys?Glu?Ala?Ile?Asn?Ile?Leu?Ser?His?Leu?Pro?Ser?His?His?Tyr

485 490 495

Asn?Thr?Gly?Trp?Val?Leu?Cys?Gln?Ile?Gly?Arg?Ala?Tyr?Phe?Glu?Leu

500 505 510

Ser?Glu?Tyr?Met?Gln?Ala?Glu?Arg?Ile?Phe?Ser?Glu?Val?Arg?Arg?Ile

515 520 525

Glu?Asn?Tyr?Arg?Val?Glu?Gly?Met?Glu?Ile?Tyr?Ser?Thr?Thr?Leu?Trp

530 535 540

His?Leu?Gln?Lys?Asp?Val?Ala?Leu?Ser?Val?Leu?Ser?Lys?Asp?Leu?Thr

545 550 555 560

Asp?Met?Asp?Lys?Asn?Ser?Pro?Glu?Ala?Trp?Cys?Ala?Ala?Gly?Asn?Cys

565 570 575

Phe?Ser?Leu?Gln?Arg?Glu?His?Asp?Ile?Ala?Ile?Lys?Phe?Phe?Gln?Arg

580 585 590

Ala?Ile?Gln?Val?Asp?Pro?Asn?Tyr?Ala?Tyr?Ala?Tyr?Thr?Leu?Leu?Gly

595 600 605

His?Glu?Phe?Val?Leu?Thr?Glu?Glu?Leu?Asp?Lys?Ala?Leu?Ala?Cys?Phe

610 615 620

Arg?Asn?Ala?Ile?Arg?Val?Asn?Pro?Arg?His?Tyr?Asn?Ala?Trp?Tyr?Gly

625 630 635 640

Leu?Gly?Met?Ile?Tyr?Tyr?Lys?Gln?Glu?Lys?Phe?Ser?Leu?Ala?Glu?Met

645 650 655

His?Phe?Gln?Lys?Ala?Leu?Asp?Ile?Asn?Pro?Gln?Ser?Ser?Val?Leu?Leu

660 665 670

Cys?His?Ile?Gly?Val?Val?Gln?His?Ala?Leu?Lys?Lys?Ser?Glu?Lys?Ala

675 680 685

Leu?Asp?Thr?Leu?Asn?Lys?Ala?Ile?Val?Ile?Asp?Pro?Lys?Asn?Pro?Leu

690 695 700

Cys?Lys?Phe?His?Arg?Ala?Ser?Val?Leu?Phe?Ala?Asn?Glu?Lys?Tyr?Lys

705 710 715 720

Ser?Ala?Leu?Gln?Glu?Leu?Glu?Glu?Leu?Lys?Gln?Ile?Val?Pro?Lys?Glu

725 730 735

Ser?Leu?Val?Tyr?Phe?Leu?Ile?Gly?Lys?Val?Tyr?Lys?Lys?Leu?Gly?Gln

740 745 750

Thr?His?Leu?Ala?Leu?Met?Asn?Phe?Ser?Trp?Ala?Met?Asp?Leu?Asp?Pro

755 760 765

Lys?Gly?Ala?Asn?Asn?Gln?Ile?Lys?Glu?Ala?Ile?Asp?Lys?Arg?Tyr?Leu

770 775 780

Pro?Asp?Asp?Glu?Glu?Pro?Ile?Thr?Gln?Glu?Glu?Gln?Ile?Met?Gly?Thr

785 790 795 800

Asp?Glu?Ser?Gln?Glu?Ser?Ser?Met?Thr?Asp?Ala?Asp?Asp?Thr?Gln?Leu

805 810 815

His?Ala?Ala?Glu?Ser?Asp?Glu?Phe

820

<210>145

<211>783

<212>DNA

<213> sugarcane

<220>

<221>misc_feature

<222>(780)..(783)

<223>n is a, c, g, or t

<400>145

atggaaaccc?taatggtgga?ccgcgtccac?agcagcctcc?gcctcttcat?gcaccgcaac 60

gccgtattcc?tctgcgagcg?cctctgcgcg?cagttcccct?ccgagaccaa?tgtgcaattg 120

ttagcgacct?gctacctcca?caacaatcag?ccatatgctg?cataccacat?tttgaaaggg 180

aagaagctgc?eggagtcccg?gtacttgttt?gctacatcat?gctttcgaat?gaacctcttg 240

cgtgaagcag?aagaaactct?atgtccagtc?aatgaaccaa?acatggaggt?tccaagtgga 300

gcaacaggac?actacctcct?tggagtgatt?tacaggtgca?caggcagaat?ttcagctgca 360

gctgaacaat?ttacacaagc?gttgactcta?gatcctcttt?tatgggcggc?atatgaggaa 420

ttgtgtatat?taggtattgc?tgaagatact?gatgagtgtt?ttagtgaatc?gactgctcta 480

cgtctccagc?aggaacacac?atccacggcc?actctggtga?agtcgaactt?cgccaatgaa 540

aatcgagttc?tatcatccag?ggtctctgca?aatcttgggg?atattagtcc?taagcaaatc 600

aaacagcttc?atgctaacaa?catagcagaa?gtatctggct?atcctcatgt?aagaccaact 660

gcattgcatg?tgcagaacag?ttcaacctct?aatgtagcac?agtttgacac?cccatcacca 720

actgcagcac?agacttctag?tatcatgcca?ccaccactct?ttaggaatgt?ccatgcttan 780

nnn 783

<210>146

<211>259

<212>PRT

<213> sugarcane

<400>146

Met?Glu?Thr?Leu?Met?Val?Asp?Arg?Val?His?Ser?Ser?Leu?Arg?Leu?Phe

1 5 10 15

Met?His?Arg?Asn?Ala?Val?Phe?Leu?Cys?Glu?Arg?Leu?Cys?Ala?Gln?Phe

20 25 30

Pro?Ser?Glu?Thr?Asn?Val?Gln?Leu?Leu?Ala?Thr?Cys?Tyr?Leu?His?Asn

35 40 45

Asn?Gln?Pro?Tyr?Ala?Ala?Tyr?His?Ile?Leu?Lys?Gly?Lys?Lys?Leu?Pro

50 55 60

Glu?Ser?Arg?Tyr?Leu?Phe?Ala?Thr?Ser?Cys?Phe?Arg?Met?Asn?Leu?Leu

65 70 75 80

Arg?Glu?Ala?Glu?Glu?Thr?Leu?Cys?Pro?Val?Asn?Glu?Pro?Asn?Met?Glu

85 90 95

Val?Pro?Ser?Gly?Ala?Thr?Gly?His?Tyr?Leu?Leu?Gly?Val?Ile?Tyr?Arg

100 105 110

Cys?Thr?Gly?Arg?Ile?Ser?Ala?Ala?Ala?Glu?Gln?Phe?Thr?Gln?Ala?Leu

115 120 125

Thr?Leu?Asp?Pro?Leu?Leu?Trp?Ala?Ala?Tyr?Glu?Glu?Leu?Cys?Ile?Leu

130 135 140

Gly?Ile?Ala?Glu?Asp?Thr?Asp?Glu?Cys?Phe?Ser?Glu?Ser?Thr?Ala?Leu

145 150 155 160

Arg?Leu?Gln?Gln?Glu?His?Thr?Ser?Thr?Ala?Thr?Leu?Val?Lys?Ser?Asn

165 170 175

Phe?Ala?Asn?Glu?Asn?Arg?Val?Leu?Ser?Ser?Arg?Val?Ser?Ala?Asn?Leu

180 185 190

Gly?Asp?Ile?Ser?Pro?Lys?Gln?Ile?Lys?Gln?Leu?His?Ala?Asn?Asn?Ile

195 200 205

Ala?Glu?Val?Ser?Gly?Tyr?Pro?His?Val?Arg?Pro?Thr?Ala?Leu?His?Val

210 215 220

Gln?Asn?Ser?Ser?Thr?Ser?Asn?Val?Ala?Gln?Phe?Asp?Thr?Pro?Ser?Pro

225 230 235 240

Thr?Ala?Ala?Gln?Thr?Ser?Ser?Ile?Met?Pro?Pro?Pro?Leu?Phe?Arg?Asn

245 250 255

Val?His?Ala

<210>147

<211>1314

<212>DNA

<213> sugarcane

<220>

<221>misc_feature

<222>(416)..(416)

<223>n is a, c, g, or t

<220>

<221>misc_feature

<222>(881)..(881)

<223>n is a, c, g, or t

<400>147

attcaaattc?aaatacctgg?ggtttggagg?gaatggtaca?ggttattcgt?cagggaaatt 60

gcgagtaaac?tcgtccacac?catcaaaatg?gtgttaacca?ccatacgttc?cgtgcaagtt 120

aggaaaggaa?aaccacgggc?tacagaaaat?tttgatgaag?gaagtagata?tgaagtcatt 180

gatgaaatgt?ggacagacaa?tatatcagga?acttcatctt?ctgtaagtac?agctgatgga 240

agatcctttg?agcaagataa?agctgaacga?attctgttgc?aagactccaa?attggcactt 300

ggtattaggg?agatattggg?acttgtccga?acactcggtg?aaggttgtag?gctttcttgc 360

ttgtttaagt?gccatgaagc?cttggaagtc?tacagaagac?tccctgagac?ccattntagc 420

actggatgga?gcatatgcca?ggttggtaag?gcatatttcg?aattagttga?ttatttggaa 480

gctgatcgtt?actttgaatt?ggcacaccga?ctgtcgcctt?gtacgcttga?tggaatggac 540

atctattcta?ctgttcttta?tcatctgaat?gaggaaatga?gactaagcta?ccttgctcaa 600

gagcttattt?ccattgatcg?actatctcct?caagcatggt?gtgcagtggg?caattgcttt 660

gccttgagga?aagatcatga?gactgctttg?aagaattttc?aacgttcggt?acagcttgac 720

tcaagatttg?catatgctca?cactctatgt?ggtcatgagt?attctgcatt?ggaggattat 780

gagaatagta?tcaaattcta?ccggtgtgca?ctgcaggtag?atgaaaggca?ctacaatgcc 840

tggtatggcc?ttggggtggt?gtatcttcgc?caggaaaagt?ntgagtttgc?tgagcatcat 900

ttcagaaggg?catttcagat?aaatcctcgc?tcttctgttc?tcatgtgcta?tcttgggatg 960

gcgttgcatt?ctcttaagag?gaaggaggag?gcattggaaa?tgatggagaa?agctatagca 1020

gctgataaga?agaatccact?gcccaagtat?cagaaggcct?taatccttct?aggtcttcag 1080

aagtatcaag?aagctctgga?tgagttggag?cggctaaagg?agattgcacc?tcatgagagc 1140

agtatgtatg?cactgatggg?aaagatttac?aagcaactca?atatccttga?caaagctgtt 1200

ttctgctttg?gcattgccct?ggatttgaaa?cctcctgctg?ctgatcttgc?tataattaag 1260

tccgcaatgg?agaaagtaca?tctccctgat?gaactgatgg?aggatgacct?gtaa 1314

<210>148

<211>437

<212>PRT

<213> sugarcane

<220>

<221> is uncertain

<222>(139)..(139)

<223>Xaa can be any natural amino acid

<220>

<221> is uncertain

<222>(294)..(294)

<223>Xaa can be any natural amino acid

<400>148

Ile?Gln?Ile?Gln?Ile?Pro?Gly?Val?Trp?Arg?Glu?Trp?Tyr?Arg?Leu?Phe

1 5 10 15

Val?Arg?Glu?Ile?Ala?Ser?Lys?Leu?Val?His?Thr?Ile?Lys?Met?Val?Leu

20 25 30

Thr?Thr?Ile?Arg?Ser?Val?Gln?Val?Arg?Lys?Gly?Lys?Pro?Arg?Ala?Thr

35 40 45

Glu?Asn?Phe?Asp?Glu?Gly?Ser?Arg?Tyr?Glu?Val?Ile?Asp?Glu?Met?Trp

50 55 60

Thr?Asp?Asn?Ile?Ser?Gly?Thr?Ser?Ser?Ser?Val?Ser?Thr?Ala?Asp?Gly

65 70 75 80

Arg?Ser?Phe?Glu?Gln?Asp?Lys?Ala?Glu?Arg?Ile?Leu?Leu?Gln?Asp?Ser

85 90 95

Lys?Leu?Ala?Leu?Gly?Ile?Arg?Glu?Ile?Leu?Gly?Leu?Val?Arg?Thr?Leu

100 105 110

Gly?Glu?Gly?Cys?Arg?Leu?Ser?Cys?Leu?Phe?Lys?Cys?His?Glu?Ala?Leu

115 120 125

Glu?Val?Tyr?Arg?Arg?Leu?Pro?Glu?Thr?His?Xaa?Ser?Thr?Gly?Trp?Ser

130 135 140

Ile?Cys?Gln?Val?Gly?Lys?Ala?Tyr?Phe?Glu?Leu?Val?Asp?Tyr?Leu?Glu

145 150 155 160

Ala?Asp?Arg?Tyr?Phe?Glu?Leu?Ala?His?Arg?Leu?Ser?Pro?Cys?Thr?Leu

165 170 175

Asp?Gly?Met?Asp?Ile?Tyr?Ser?Thr?Val?Leu?Tyr?His?Leu?Asn?Glu?Glu

180 185 190

Met?Arg?Leu?Ser?Tyr?Leu?Ala?Gln?Glu?Leu?Ile?Ser?Ile?Asp?Arg?Leu

195 200 205

Ser?Pro?Gln?Ala?Trp?Cys?Ala?Val?Gly?Asn?Cys?Phe?Ala?Leu?Arg?Lys

210 215 220

Asp?His?Glu?Thr?Ala?Leu?Lys?Asn?Phe?Gln?Arg?Ser?Val?Gln?Leu?Asp

225 230 235 240

Ser?Arg?Phe?Ala?Tyr?Ala?His?Thr?Leu?Cys?Gly?His?Glu?Tyr?Ser?Ala

245 250 255

Leu?Glu?Asp?Tyr?Glu?Asn?Ser?Ile?Lys?Phe?Tyr?Arg?Cys?Ala?Leu?Gln

260 265 270

Val?Asp?Glu?Arg?His?Tyr?Asn?Ala?Trp?Tyr?Gly?Leu?Gly?Val?Val?Tyr

275 280 285

Leu?Arg?Gln?Glu?Lys?Xaa?Glu?Phe?Ala?Glu?His?His?Phe?Arg?Arg?Ala

290 295 300

Phe?Gln?Ile?Asn?Pro?Arg?Ser?Ser?Val?Leu?Met?Cys?Tyr?Leu?Gly?Met

305 310 315 320

Ala?Leu?His?Ser?Leu?Lys?Arg?Lys?Glu?Glu?Ala?Leu?Glu?Met?Met?Glu

325 330 335

Lys?Ala?Ile?Ala?Ala?Asp?Lys?Lys?Asn?Pro?Leu?Pro?Lys?Tyr?Gln?Lys

340 345 350

Ala?Leu?Ile?Leu?Leu?Gly?Leu?Gln?Lys?Tyr?Gln?Glu?Ala?Leu?Asp?Glu

355 360 365

Leu?Glu?Arg?Leu?Lys?Glu?Ile?Ala?Pro?His?Glu?Ser?Ser?Met?Tyr?Ala

370 375 380

Leu?Met?Gly?Lys?Ile?Tyr?Lys?Gln?Leu?Asn?Ile?Leu?Asp?Lys?Ala?Val

385 390 395 400

Phe?Cys?Phe?Gly?Ile?Ala?Leu?Asp?Leu?Lys?Pro?Pro?Ala?Ala?Asp?Leu

405 410 415

Ala?Ile?Ile?Lys?Ser?Ala?Met?Glu?Lys?Val?His?Leu?Pro?Asp?Glu?Leu

420 425 430

Met?Glu?Asp?Asp?Leu

435

<210>149

<211>54

<212>DNA

<213> artificial sequence

<220>

<223> primer: prm00778

<400>149

ggggacaagt?ttgtacaaaa?aagcaggctt?cacaatgcaa?caactgtcaa?cttc 54

<210>150

<211>49

<212>DNA

<213> artificial sequence

<220>

<223> primer: prm00779

<400>150

ggggaccact?ttgtacaaga?aagctgggtt?ggagtagcta?tggtttcac 49

<210>151

<211>1042

<212>DNA

<213> rice

<400>151

ggggagttag?gaaccttgac?atacaaccaa?tgataccatt?ttttttcaag?cagctagagg 60

tacagaggtt?catatttttt?agatggctca?ttagtgatat?tttagtcaaa?aatttcagaa 120

gtacggccac?gggtgatggc?ctgaactaat?attttattcg?aggtgccgct?acatcatcgt 180

ctaaagtaca?cgcaagattc?aacggaaaaa?agaaaccgat?cgatcgagat?cagttagtta 240

atgaaataac?tagatcaact?catgtcgtca?aaaacaaaag?atgctcatct?atggacaaca 300

cacgctgatg?attcgatcat?caaacaaagg?tggtagtagt?agtaaagcgt?atcgtgtttc 360

tcatcagaaa?gaagaattaa?agaaaaaact?aatcccgtct?cgcgagccag?agaaaattcc 420

ctacaaaagc?cactcctttg?atttgacatg?caaaagcaag?gctccactcc?tctactaccc 480

tacaactaca?caacactgtc?tctctatctc?caaaggcagt?agctgtattg?gcttccagct 540

tttcctctct?acctctaatg?atagcttgga?gcaagttcaa?tagtatagct?aactactagc 600

tctaattcat?ctataatcaa?tctaatagct?tattcataca?atagttatat?actacattat 660

taatatctgg?tcccatctat?catacacact?gagtctgtgc?tatagctgac?tacaaatctg 720

tagcccgctg?ctcttctctc?ttcatttatc?ttcttaaaat?atatttgcag?ctggcttatg 780

gcttatagct?tgatattgag?agggagagga?gtgagagcta?gctcagctca?gctcaaggta 840

aacaacaagg?cacactcttc?ctacctcttc?tccggttctt?cctttttcct?ctttctcttc 900

gtccaagaac?ttcacctcaa?tagctcgagc?tacggcctaa?cttttgcgtt?gcgcaggaga 960

gctcgatcgc?tgcaccaata?cttcactgga?gatcgcctag?ctgcagctag?ctagcttatc 1020

ctgcgtgtct?tgagcttctc?tc 1042

<210>152

<211>951

<212>DNA

<213> rice

<400>152

atggatccgg?tcacggcatc?aatacacggt?caccatcttc?ctccaccgtt?caacacccgc 60

gacttccatc?accatctcca?gcagcagcag?caccagctgc?atctcaagac?cgaggatgac 120

caaggcggcg?gcactccggg?tgtcttcggc?agccgcggca?ccaagcgcga?ccacgacgac 180

gacgagaaca?gtggcaacgg?ccatggaagc?ggtggtgacg?gcggtgacct?cgcgctggta 240

cccccctcgg?gtggcgggcc?ggacggcgcc?gggagcgaga?gcgccacgcg?ccgcccgagg 300

ggacgcccgg?cggggtccaa?gaacaagccg?aagccaccga?tcatcatcac?cagggacagc 360

gccaacacgc?tccggacgca?tgtcatggag?gtggccggcg?gctgcgacat?ctccgagagc 420

atcaccacgt?tcgcgcgacg?ccggcagcgc?ggggtttgcg?tgctcagcgg?cgccggcacc 480

gtcactaacg?tcacgctgcg?gcagcccgca?tcgcagggag?cggtcgttgc?gctccacggc 540

cggttcgaga?tactctccct?ctccggctcc?ttcctcccgc?cgcccgcccc?gccggaggcc 600

acggggctca?ccgtctacct?ggccggaggc?cagggccagg?tcgtgggcgg?cagcgtcgtc 660

ggcgcgctga?ccgcggctgg?gcctgtggtg?ataatggcgg?cgtcttttgc?gaacgcggtg 720

tacgagcggc?tgccgttgga?ggacgacgag?ctactggcgg?ctcaagggca?agccgacagc 780

gctgggttgc?tcgccgcggg?gcagcaagcg?gcgcagctcg?ccggcggggc?cgtcgatcca 840

agcctcttcc?aaggactacc?accaaaccta?ctcggaaacg?tgcagctgcc?gccggaagcc 900

gcctacggat?ggaaccctgg?cgccggcggt?ggccgcccgg?cgccgttctg?a 951

<210>153

<211>316

<212>PRT

<213> rice

<400>153

Met?Asp?Pro?Val?Thr?Ala?Ser?Ile?His?Gly?His?His?Leu?Pro?Pro?Pro

1 5 10 15

Phe?Asn?Thr?Arg?Asp?Phe?His?His?His?Leu?Gln?Gln?Gln?Gln?His?Gln

20 25 30

Leu?His?Leu?Lys?Thr?Glu?Asp?Asp?Gln?Gly?Gly?Gly?Thr?Pro?Gly?Val

35 40 45

Phe?Gly?Ser?Arg?Gly?Thr?Lys?Arg?Asp?His?Asp?Asp?Asp?Glu?Asn?Ser

50 55 60

Gly?Asn?Gly?His?Gly?Ser?Gly?Gly?Asp?Gly?Gly?Asp?Leu?Ala?Leu?Val

65 70 75 80

Pro?Pro?Ser?Gly?Gly?Gly?Pro?Asp?Gly?Ala?Gly?Ser?Glu?Ser?Ala?Thr

85 90 95

Arg?Arg?Pro?Arg?Gly?Arg?Pro?Ala?Gly?Ser?Lys?Asn?Lys?Pro?Lys?Pro

100 105 110

Pro?Ile?Ile?Ile?Thr?Arg?Asp?Ser?Ala?Asn?Thr?Leu?Arg?Thr?His?Val

115 120 125

Met?Glu?Val?Ala?Gly?Gly?Cys?Asp?Ile?Ser?Glu?Ser?Ile?Thr?Thr?Phe

130 135 140

Ala?Arg?Arg?Arg?Gln?Arg?Gly?Val?Cys?Val?Leu?Ser?Gly?Ala?Gly?Thr

145 150 155 160

Val?Thr?Asn?Val?Thr?Leu?Arg?Gln?Pro?Ala?Ser?Gln?Gly?Ala?Val?Val

165 170 175

Ala?Leu?His?Gly?Arg?Phe?Glu?Ile?Leu?Ser?Leu?Ser?Gly?Ser?Phe?Leu

180 185 190

Pro?Pro?Pro?Ala?Pro?Pro?Glu?Ala?Thr?Gly?Leu?Thr?Val?Tyr?Leu?Ala

195 200 205

Gly?Gly?Gln?Gly?Gln?Val?Val?Gly?Gly?Ser?Val?Val?Gly?Ala?Leu?Thr

210 215 220

Ala?Ala?Gly?Pro?Val?Val?Ile?Met?Ala?Ala?Ser?Phe?Ala?Asn?Ala?Val

225 230 235 240

Tyr?Glu?Arg?Leu?Pro?Leu?Glu?Asp?Asp?Glu?Leu?Leu?Ala?Ala?Gln?Gly

245 250 255

Gln?Ala?Asp?Ser?Ala?Gly?Leu?Leu?Ala?Ala?Gly?Gln?Gln?Ala?Ala?Gln

260 265 270

Leu?Ala?Gly?Gly?Ala?Val?Asp?Pro?Ser?Leu?Phe?Gln?Gly?Leu?Pro?Pro

275 280 285

Asn?Leu?Leu?Gly?Asn?Val?Gln?Leu?Pro?Pro?Glu?Ala?Ala?Tyr?Gly?Trp

290 295 300

Asn?Pro?Gly?Ala?Gly?Gly?Gly?Arg?Pro?Ala?Pro?Phe

305 310 315

<210>154

<211>918

<212>DNA

<213> rice

<400>154

atggcaggtc?tcgacctcgg?caccgccgcg?acgcgctacg?tccaccagct?ccaccacctc 60

caccccgacc?tccagctgca?gcacagctac?gccaagcagc?acgagccgtc?cgacgacgac 120

cccaacggca?gcggcggcgg?cggcaacagc?aacggcgggc?cgtacgggga?ccatgacggc 180

gggtcctcgt?cgtcaggccc?tgccaccgac?ggcgcggtcg?gcgggcccgg?cgacgtggtg 240

gcgcgccggc?cgcgggggcg?cccgcctggc?tccaagaaca?agccgaagcc?gccggtgatc 300

atcacgcggg?agagcgccaa?cacgctgcgc?gcccacatcc?tggaggtcgg?gagcggctgc 360

gacgtgttcg?agtgcgtctc?cacgtacgcg?cgccggcggc?agcgcggcgt?gtgcgtgctg 420

agcggcagcg?gcgtggtcac?caacgtgacg?ctgcgtcagc?cgtcggcgcc?cgcgggcgcc 480

gtcgtgtcgc?tgcacgggag?gttcgagatc?ctgtcgctct?cgggctcctt?cctcccgccg 540

ccggctcccc?ccggcgccac?cagcctcacc?atcttcctcg?ccgggggcca?gggacaggtc 600

gtcggcggca?acgtcgtcgg?cgcgctctac?gccgcgggcc?cggtcatcgt?catcgcggcg 660

tccttcgcca?acgtcgccta?cgagcgcctc?ccactggagg?aggaggaggc?gccgccgccg 720

caggccggcc?tgcagatgca?gcagcccggc?ggcggcgccg?atgctggtgg?catgggtggc 780

gcgttcccgc?cggacccgtc?tgccgccggc?ctcccgttct?tcaacctgcc?gctcaacaac 840

atgcccggtg?gcggcggctc?acagctccct?cccggcgccg?acggccatgg?ctgggccggc 900

gcacggccac?cgttctga 918

<210>155

<211>305

<212>PRT

<213> rice

<400>155

Met?Ala?Gly?Leu?Asp?Leu?Gly?Thr?Ala?Ala?Thr?Arg?Tyr?Val?His?Gln

1 5 10 15

Leu?His?His?Leu?His?Pro?Asp?Leu?Gln?Leu?Gln?His?Ser?Tyr?Ala?Lys

20 25 30

Gln?His?Glu?Pro?Ser?Asp?Asp?Asp?Pro?Asn?Gly?Ser?Gly?Gly?Gly?Gly

35 40 45

Asn?Ser?Asn?Gly?Gly?Pro?Tyr?Gly?Asp?His?Asp?Gly?Gly?Ser?Ser?Ser

50 55 60

Ser?Gly?Pro?Ala?Thr?Agp?Gly?Ala?Val?Gly?Gly?Pro?Gly?Asp?Val?Val

65 70 75 80

Ala?Arg?Arg?Pro?Arg?Gly?Arg?Pro?Pro?Gly?Ser?Lys?Asn?Lys?Pro?Lys

85 90 95

Pro?Pro?Val?Ile?Ile?Thr?Arg?Glu?Ser?Ala?Asn?Thr?Leu?Arg?Ala?His

100 105 110

Ile?Leu?Glu?Val?Gly?Ser?Gly?Cys?Asp?Val?Phe?Glu?Cys?Val?Ser?Thr

115 120 125

Tyr?Ala?Arg?Arg?Arg?Gln?Arg?Gly?Val?Cys?Val?Leu?Ser?Gly?Ser?Gly

130 135 140

Val?Val?Thr?Asn?Val?Thr?Leu?Arg?Gln?Pro?Ser?Ala?Pro?Ala?Gly?Ala

145 150 155 160

Val?Val?Ser?Leu?His?Gly?Arg?Phe?Glu?Ile?Leu?Ser?Leu?Ser?Gly?Ser

165 170 175

Phe?Leu?Pro?Pro?Pro?Ala?Pro?Pro?Gly?Ala?Thr?Ser?Leu?Thr?Ile?Phe

180 185 190

Leu?Ala?Gly?Gly?Gln?Gly?Gln?Val?Val?Gly?Gly?Asn?Val?Val?Gly?Ala

195 200 205

Leu?Tyr?Ala?Ala?Gly?Pro?Val?Ile?Val?Ile?Ala?Ala?Ser?Phe?Ala?Asn

210 215 220

Val?Ala?Tyr?Glu?Arg?Leu?Pro?Leu?Glu?Glu?Glu?Glu?Ala?Pro?Pro?Pro

225 230 235 240

Gln?Ala?Gly?Leu?Gln?Met?Gln?Gln?Pro?Gly?Gly?Gly?Ala?Asp?Ala?Gly

245 250 255

Gly?Met?Gly?Gly?Ala?Phe?Pro?Pro?Asp?Pro?Ser?Ala?Ala?Gly?Leu?Pro

260 265 270

Phe?Phe?Asn?Leu?Pro?Leu?Asn?Asn?Met?Pro?Gly?Gly?Gly?Gly?Ser?Gln

275 280 285

Leu?Pro?Pro?Gly?Ala?Asp?Gly?His?Gly?Trp?Ala?Gly?Ala?Arg?Pro?Pro

290 295 300

Phe

305

<210>156

<211>906

<212>DNA

<213> Root or stem of Littleleaf Indianmulberry (Lotus corniculatus)

<400>156

atggatccat?tatcagcaca?cggccactct?cttcctcctc?cttttctcca?tctgcaccac 60

caacaccaac?accagcagca?gcatcagcag?catcagttcc?actctttaca?gcagcagcaa 120

accccagcag?aagatgaaca?gagtggaagc?agcggcggca?tcaaaaggga?acgcgatgaa 180

aacaacaaca?gccatgacgg?caaagaaggc?tccggaggcg?gaggcgaaag?cgagaattca 240

agaagacctc?gaggaaggcc?cgccggatcg?aagaacaagc?ctaagccgcc?catcatcatc 300

acccgcgaca?gcgccaacgc?acttaagacc?cacgtcatgg?aggtcgccga?cggctgcgac 360

atcgtcgaca?gcgtctccaa?ctttgcaaga?cgccgccagc?gcggcgtctg?catcatgagc 420

ggcactggaa?ccgtcaccaa?cgtcactctc?aggcagccag?cttcttccgg?cgctgttgtc 480

accctccacg?gaaggtttga?gattctctcc?ctggcaggat?cgttcctgcc?gccgcctgct 540

ccaccggcag?catcaggttt?gaccatttac?ttggctggtg?gacaagggca?ggttgttgga 600

ggaagtgttg?tgggagctct?cattgcttcg?ggacctgtgg?ttatcatggc?agcttcgttc 660

agcaacgctg?cgtatgagag?gcttcctttg?gaagatgagg?acccttcatt?ggcaatgcaa 720

ggaggttcaa?tgggttcacc?acccggtggt?agtggtggtg?gtggtggagt?tggtcagcaa 780

cagcagcaac?agcttttagg?ggatgcaact?gccccacttt?ttcatggttt?gcctccgaat 840

cttctcaatt?ctgttcagat?gccaaactcc?gataacttct?ggccatctgg?ccgctctcct 900

tactga 906

<210>157

<211>301

<212>PRT

<213> Root or stem of Littleleaf Indianmulberry

<400>157

Met?Asp?Pro?Leu?Ser?Ala?His?Gly?His?Ser?Leu?Pro?Pro?Pro?Phe?Leu

1 5 10 15

His?Leu?His?His?Gln?His?Gln?His?Gln?Gln?Gln?His?Gln?Gln?His?Gln

20 25 30

Phe?His?Ser?Leu?Gln?Gln?Gln?Gln?Thr?Pro?Ala?Glu?Asp?Glu?Gln?Ser

35 40 45

Gly?Ser?Ser?Gly?Gly?Ile?Lys?Arg?Glu?Arg?Asp?Glu?Asn?Asn?Asn?Ser

50 55 60

His?Asp?Gly?Lys?Glu?Gly?Ser?Gly?Gly?Gly?Gly?Glu?Ser?Glu?Asn?Ser

65 70 75 80

Arg?Arg?Pro?Arg?Gly?Arg?Pro?Ala?Gly?Ser?Lys?Asn?Lys?Pro?Lys?Pro

85 90 95

Pro?Ile?Ile?Ile?Thr?Arg?Asp?Ser?Ala?Asn?Ala?Leu?Lys?Thr?His?Val

100 105 110

Met?Glu?Val?Ala?Asp?Gly?Cys?Asp?Ile?Val?Asp?Ser?Val?Ser?Asn?Phe

115 120 125

Ala?Arg?Arg?Arg?Gln?Arg?Gly?Val?Cys?Ile?Met?Ser?Gly?Thr?Gly?Thr

130 135 140

Val?Thr?Asn?Val?Thr?Leu?Arg?Gln?Pro?Ala?Ser?Ser?Gly?Ala?Val?Val

145 150 155 160

Thr?Leu?His?Gly?Arg?Phe?Glu?Ile?Leu?Ser?Leu?Ala?Gly?Ser?Phe?Leu

165 170 175

Pro?Pro?Pro?Ala?Pro?Pro?Ala?Ala?Ser?Gly?Leu?Thr?Ile?Tyr?Leu?Ala

180 185 190

Gly?Gly?Gln?Gly?Gln?Val?Val?Gly?Gly?Ser?Val?Val?Gly?Ala?Leu?Ile

195 200 205

Ala?Ser?Gly?Pro?Val?Val?Ile?Met?Ala?Ala?Ser?Phe?Ser?Asn?Ala?Ala

210 215 220

Tyr?Glu?Arg?Leu?Pro?Leu?Glu?Asp?Glu?Asp?Pro?Ser?Leu?Ala?Met?Gln

225 230 235 240

Gly?Gly?Ser?Met?Gly?Ser?Pro?Pro?Gly?Gly?Ser?Gly?Gly?Gly?Gly?Gly

245 250 255

Val?Gly?Gln?Gln?Gln?Gln?Gln?Gln?Leu?Leu?Gly?Asp?Ala?Thr?Ala?Pro

260 265 270

Leu?Phe?His?Gly?Leu?Pro?Pro?Asn?Leu?Leu?Asn?Ser?Val?Gln?Met?Pro

275 280 285

Asn?Ser?Asp?Asn?Phe?Trp?Pro?Ser?Gly?Arg?Ser?Pro?Tyr

290 295 300

<210>158

<211>1020

<212>DNA

<213> Arabidopis thaliana

<400>158

atggatccag?ttcaatctca?tggatcacaa?agctctcttc?ctcctccttt?ccatgctaga 60

gatttccaat?tacatcttca?acaacaacaa?caacatcaac?aacaacatca?acaacaacaa 120

caacaacagt?tctttctcca?ccatcatcag?caaccacaaa?gaaaccttga?tcaagatcac 180

gagcagcaag?gagggtcaat?attgaataga?tctatcaaga?tggatcgcga?agagacaagc 240

gataacatgg?acaacatcgc?taataccaac?agcggtagcg?aaggtaaaga?gatgagttta 300

cacggaggag?aaggaggaag?cggtggtgga?ggaagtggag?aacagatgac?aagaaggcca 360

agaggaagac?cagcaggatc?caagaacaaa?cctaaagctc?caataatcat?aacaagagac 420

agcgcaaacg?cgcttcgaac?tcacgtcatg?gagataggag?acggatgtga?catagttgac 480

tgtatggcta?cgttcgctag?acgccgccaa?agaggcgttt?gcgttatgag?cggtacagga 540

agcgttacta?acgtcactat?acgtcagcct?ggatcgccac?ctggctcggt?ggttagcctt 600

cacggccggt?ttgaaatcct?ctctctttcg?ggatctttct?tgcctccgcc?tgcgccgcct 660

gcagccaccg?gactaagcgt?ttacctagcc?ggaggacaag?ggcaggtcgt?tggaggtagt 720

gtggtgggac?ctttgttgtg?ttcgggtcct?gtggtggtta?tggcggcttc?ttttagcaat 780

gcggcgtacg?aaaggctgcc?tttggaagaa?gatgagatgc?agacgccagt?tcaaggaggc 840

ggtggaggag?gaggaggtgg?tggtggaatg?ggatctcccc?cgatgatggg?acagcaacaa 900

gctatggcag?ctatggcggc?ggctcaagga?ctaccaccga?atcttcttgg?ttcggttcag 960

ttgccaccgc?cacaacagaa?tgatcagcag?tattggtcta?cgggtcggcc?accgtattga 1020

<210>159

<211>339

<212>PRT

<213> Arabidopis thaliana

<400>159

Met?Asp?Pro?Val?Gln?Ser?His?Gly?Ser?Gln?Ser?Ser?Leu?Pro?Pro?Pro

1 5 10 15

Phe?His?Ala?Arg?Asp?Phe?Gln?Leu?His?Leu?Gln?Gln?Gln?Gln?Gln?His

20 25 30

Gln?Gln?Gln?His?Gln?Gln?Gln?Gln?Gln?Gln?Gln?Phe?Phe?Leu?His?His

35 40 45

His?Gln?Gln?Pro?Gln?Arg?Asn?Leu?Asp?Gln?Asp?His?Glu?Gln?Gln?Gly

50 55 60

Gly?Ser?Ile?Leu?Asn?Arg?Ser?Ile?Lys?Met?Asp?Arg?Glu?Glu?Thr?Ser

65 70 75 80

Asp?Asn?Met?Asp?Asn?Ile?Ala?Asn?Thr?Asn?Ser?Gly?Ser?Glu?Gly?Lys

85 90 95

Glu?Met?Ser?Leu?His?Gly?Gly?Glu?Gly?Gly?Ser?Gly?Gly?Gly?Gly?Ser

100 105 110

Gly?Glu?Gln?Met?Thr?Arg?Arg?Pro?Arg?Gly?Arg?Pro?Ala?Gly?Ser?Lys

115 120 125

Asn?Lys?Pro?Lys?Ala?Pro?Ile?Ile?Ile?Thr?Arg?Asp?Ser?Ala?Asn?Ala

130 135 140

Leu?Arg?Thr?His?Val?Met?Glu?Ile?Gly?Asp?Gly?Cys?Asp?Ile?Val?Asp

145 150 155 160

Cys?Met?Ala?Thr?Phe?Ala?Arg?Arg?Arg?Gln?Arg?Gly?Val?Cys?Val?Met

165 170 175

Ser?Gly?Thr?Gly?Ser?Val?Thr?Asn?Val?Thr?Ile?Arg?Gln?Pro?Gly?Ser

180 185 190

Pro?Pro?Gly?Ser?Val?Val?Ser?Leu?His?Gly?Arg?Phe?Glu?Ile?Leu?Ser

195 200 205

Leu?Ser?Gly?Ssr?Phe?Leu?Pro?Pro?Pro?Ala?Pro?Pro?Ala?Ala?Thr?Gly

210 215 220

Leu?Ser?Val?Tyr?Leu?Ala?Gly?Gly?Gln?Gly?Gln?Val?Val?Gly?Gly?Ser

225 230 235 240

Val?Val?Gly?Pro?Leu?Leu?Cys?Ser?Gly?Pro?Val?Val?Val?Met?Ala?Ala

245 250 255

Ser?Phe?Ser?Asn?Ala?Ala?Tyr?Glu?Arg?Leu?Pro?Leu?Glu?Glu?Asp?Glu

260 265 270

Met?Gln?Thr?Pro?Val?Gln?Gly?Gly?Gly?Gly?Gly?Gly?Gly?Gly?Gly?Gly

275 280 285

Gly?Met?Gly?Ser?Pro?Pro?Met?Met?Gly?Gln?Gln?Gln?Ala?Met?Ala?Ala

290 295 300

Met?Ala?Ala?Ala?Gln?Gly?Leu?Pro?Pro?Asn?Leu?Leu?Gly?Ser?Val?Gln

305 310 315 320

Leu?Pro?Pro?Pro?Gln?Gln?Asn?Asp?Gln?Gln?Tyr?Trp?Ser?Thr?Gly?Arg

325 330 335

Pro?Pro?Tyr

<210>160

<211>975

<212>DNA

<213> Arabidopis thaliana

<400>160

atggatccag?tacaatctca?tggatcacaa?agctctctac?ctcctccttt?ccacgcaaga 60

gactttcaat?tacatcttca?acaacagcaa?caagagttct?tcctccacca?tcaccagcaa 120

caaagaaacc?aaaccgatgg?tgaccaacaa?ggaggatcag?gaggaaaccg?acaaatcaag 180

atggatcgtg?aagagacaag?cgacaacata?gacaacatag?ctaacaacag?cggtagtgaa 240

ggtaaagaca?tagatataca?cggtggttca?ggagaaggag?gtggtggctc?cggaggagat 300

catcagatga?caagaagacc?aagaggaaga?ccagcgggat?ccaagaacaa?accaaaacca 360

ccgattatca?tcacacggga?cagcgcaaac?gcgcttagaa?cccacgtgat?ggagatcgga 420

gatggctgcg?acttagtcga?aagcgttgcc?acttttgcac?gaagacgcca?acgcggcgtt 480

tgcgttatga?gcggtactgg?aaatgttact?aacgtcacta?tacgtcagcc?tggatctcat 540

ccttctcctg?gctcggtagt?tagtcttcac?ggaaggttcg?agattctatc?tctctcagga 600

tcttttctcc?ctcctccggc?tcctcctaca?gccaccggat?tgagtgttta?cctcgctgga 660

ggacaaggac?aggtggttgg?aggaagcgta?gttggtccgt?tgttatgtgc?tggtcctgtc 720

gttgtcatgg?ctgcgtcttt?tagcaatgcg?gcgtacgaaa?ggttgccttt?agaggaagat 780

gagatgcaga?cgccggttca?tggcggagga?ggaggaggat?cattggagtc?gccgccaatg 840

atgggacaac?aactgcaaca?tcagcaacaa?gctatgtcag?gtcatcaagg?gttaccacct 900

aatcttcttg?gttcggttca?gttgcagcag?caacatgatc?agtcttattg?gtcaacggga 960

cgaccaccgt?attga 975

<210>161

<211>324

<212>PRT

<213> Arabidopis thaliana

<400>161

Met?Asp?Pro?Val?Gln?Ser?His?Gly?Ser?Gln?Ser?Ser?Leu?Pro?Pro?Pro

1 5 10 15

Phe?His?Ala?Arg?Asp?Phe?Gln?Leu?His?Leu?Gln?Gln?Gln?Gln?Gln?Glu

20 25 30

Phe?Phe?Leu?His?His?His?Gln?Gln?Gln?Arg?Asn?Gln?Thr?Asp?Gly?Asp

35 40 45

Gln?Gln?Gly?Gly?Ser?Gly?Gly?Asn?Arg?Gln?Ile?Lys?Met?Asp?Arg?Glu

50 55 60

Glu?Thr?Ser?Asp?Asn?Ile?Asp?Asn?Ile?Ala?Asn?Asn?Ser?Gly?Ser?Glu

65 70 75 80

Gly?Lys?Asp?Ile?Asp?Ile?His?Gly?Gly?Ser?Gly?Glu?Gly?Gly?Gly?Gly

85 90 95

Ser?Gly?Gly?Asp?His?Gln?Met?Thr?Arg?Arg?Pro?Arg?Gly?Arg?Pro?Ala

100 105 110

Gly?Ser?Lys?Asn?Lys?Pro?Lys?Pro?Pro?Ile?Ile?Ile?Thr?Arg?Asp?Ser

115 120 125

Ala?Asn?Ala?Leu?Arg?Thr?His?Val?Met?Glu?Ile?Gly?Asp?Gly?Cys?Asp

130 135 140

Leu?Val?Glu?Ser?Val?Ala?Thr?Phe?Ala?Arg?Arg?Arg?Gln?Arg?Gly?Val

145 150 155 160

Cys?Val?Met?Ser?Gly?Thr?Gly?Asn?Val?Thr?Asn?Val?Thr?Ile?Arg?Gln

165 170 175

Pro?Gly?Ser?His?Pro?Ser?Pro?Gly?Ser?Val?Val?Ser?Leu?His?Gly?Arg

180 185 190

Phe?Glu?Ile?Leu?Ser?Leu?Ser?Gly?Ser?Phe?Leu?Pro?Pro?Pro?Ala?Pro

195 200 205

Pro?Thr?Ala?Thr?Gly?Leu?Ser?Val?Tyr?Leu?Ala?Gly?Gly?Gln?Gly?Gln

210 215 220

Val?Val?Gly?Gly?Ser?Val?Val?Gly?Pro?Leu?Leu?Cys?Ala?Gly?Pro?Val

225 230 235 240

Val?Val?Met?Ala?Ala?Ser?Phe?Ser?Asn?Ala?Ala?Tyr?Glu?Arg?Leu?Pro

245 250 255

Leu?Glu?Glu?Asp?Glu?Met?Gln?Thr?Pro?Val?His?Gly?Gly?Gly?Gly?Gly

260 265 270

Gly?Ser?Leu?Glu?Ser?Pro?Pro?Met?Met?Gly?Gln?Gln?Leu?Gln?His?Gln

275 280 285

Gln?Gln?Ala?Met?Ser?Gly?His?Gln?Gly?Leu?Pro?Pro?Asn?Leu?Leu?Gly

290 295 300

Ser?Val?Gln?Leu?Gln?Gln?Gln?His?Asp?Gln?Ser?Tyr?Trp?Ser?Thr?Gly

305 310 315 320

Arg?Pro?Pro?Tyr

<210>162

<211>954

<212>DNA

<213> Arabidopis thaliana

<400>162

atggatcagg?tctctcgctc?tcttcctcca?ccttttctct?caagagatct?ccatcttcac 60

ccacaccatc?aattccagca?tcagcagcag?cagcagcaac?agaatcacgg?ccacgatata 120

gaccagcacc?gaatcggtgg?gctaaaacgt?gaccgagatg?ctgatatcga?tcccaacgag 180

cactcttcag?ccggaaaaga?tcaaagtact?cctggctccg?gtggagaaag?cggcggcgga 240

ggaggaggag?ataatcacat?cacgagaagg?ccacgtggca?gaccagcggg?atctaagaac 300

aaaccaaaac?cgccaatcat?catcactcga?gacagcgcaa?acgctctcaa?atctcatgtc 360

atggaagtag?caaacggatg?tgacgtcatg?gaaagtgtca?ccgtcttcgc?tcgccgtcgc 420

caacgtggca?tctgcgtttt?gagcggaaac?ggcgccgtta?ccaacgttac?cataagacaa 480

ccagcttcag?tacctggtgg?tggctcatct?gtcgttaact?tacacggacg?tttcgagatt 540

ctttctctct?cgggatcatt?ccttcctcct?ccggctccac?cagctgcgtc?aggtctaacg 600

atttacttag?ccggtggtca?gggacaggtt?gttggaggaa?gcgtggttgg?tccactcatg 660

gcttcaggac?ctgtagtgat?tatggcagct?tcgtttggaa?acgctgcgta?tgagagactg 720

ccgttggagg?aagacgatca?agaagagcaa?acagctggag?cggttgctaa?taatatcgat 780

ggaaacgcaa?caatgggtgg?tggaacgcaa?acgcaaactc?agacgcagca?gcaacagcaa 840

caacagttga?tgcaagatcc?gacgtcgttt?atacaagggt?tgcctccgaa?tcttatgaat 900

tctgttcaat?tgccagctga?agcttattgg?ggaactccga?gaccatcttt?ctaa 954

<210>163

<211>317

<212>PRT

<213> Arabidopis thaliana

<400>163

Met?Asp?Gln?Val?Ser?Arg?Ser?Leu?Pro?Pro?Pro?Phe?Leu?Ser?Arg?Asp

1 5 10 15

Leu?His?Leu?His?Pro?His?His?Gln?Phe?Gln?His?Gln?Gln?Gln?Gln?Gln

20 25 30

Gln?Gln?Asn?His?Gly?His?Asp?Ile?Asp?Gln?His?Arg?Ile?Gly?Gly?Leu

35 40 45

Lys?Arg?Asp?Arg?Asp?Ala?Asp?Ile?Asp?Pro?Asn?Glu?His?Ser?Ser?Ala

50 55 60

Gly?Lys?Asp?Gln?Ser?Thr?Pro?Gly?Ser?Gly?Gly?Glu?Ser?Gly?Gly?Gly

65 70 75 80

Gly?Gly?Gly?Asp?Asn?His?Ile?Thr?Arg?Arg?Pro?Arg?Gly?Arg?Pro?Ala

85 90 95

Gly?Ser?Lys?Asn?Lys?Pro?Lys?Pro?Pro?Ile?Ile?Ile?Thr?Arg?Asp?Ser

100 105 110

Ala?Asn?Ala?Leu?Lys?Ser?His?Val?Met?Glu?Val?Ala?Asn?Gly?Cys?Asp

115 120 125

Val?Met?Glu?Ser?Val?Thr?Val?Phe?Ala?Arg?Arg?Arg?Gln?Arg?Gly?Ile

130 135 140

Cys?Val?Leu?Ser?Gly?Asn?Gly?Ala?Val?Thr?Asn?Val?Thr?Ile?Arg?Gln

145 150 155 160

Pro?Ala?Ser?Val?Pro?Gly?Gly?Gly?Ser?Ser?Val?Val?Asn?Leu?His?Gly

165 170 175

Arg?Phe?Glu?Ile?Leu?Ser?Leu?Ser?Gly?Ser?Phe?Leu?Pro?Pro?Pro?Ala

180 185 190

Pro?Pro?Ala?Ala?Ser?Gly?Leu?Thr?Ile?Tyr?Leu?Ala?Gly?Gly?Gln?Gly

195 200 205

Gln?Val?Val?Gly?Gly?Ser?Val?Val?Gly?Pro?Leu?Met?Ala?Ser?Gly?Pro

210 215 220

Val?Val?Ile?Met?Ala?Ala?Ser?Phe?Gly?Asn?Ala?Ala?Tyr?Glu?Arg?Leu

225 230 235 240

Pro?Leu?Glu?Glu?Asp?Asp?Gln?Glu?Glu?Gln?Thr?Ala?Gly?Ala?Val?Ala

245 250 255

Asn?Asn?Ile?Asp?Gly?Asn?Ala?Thr?Met?Gly?Gly?Gly?Thr?Gln?Thr?Gln

260 265 270

Thr?Gln?Thr?Gln?Gln?Gln?Gln?Gln?Gln?Gln?Leu?Met?Gln?Asp?Pro?Thr

275 280 285

Ser?Phe?Ile?Gln?Gly?Leu?Pro?Pro?Asn?Leu?Met?Asn?Ser?Val?Gln?Leu

290 295 300

Pro?Ala?Glu?Ala?Tyr?Trp?Gly?Thr?Pro?Arg?Pro?Ser?Phe

305 310 315

<210>164

<211>798

<212>DNA

<213> Arabidopis thaliana

<400>164

atggatgagg?tatctcgttc?tcatacaccg?caatttctat?caagtgatca?tcagcactat 60

caccatcaaa?acgctggacg?acaaaaacgc?ggcagagaag?aagaaggagt?tgaacccaac 120

aatatagggg?aagacctagc?cacctttcct?tccggagaag?agaatatcaa?gaagagaagg 180

ccacgtggca?gacctgctgg?ttccaagaac?aaacccaaag?caccaatcat?agtcactcgc 240

gactccgcga?acgccttcag?atgtcacgtc?atggagataa?ccaacgcctg?cgatgtaatg 300

gaaagcctag?ccgtcttcgc?tagacgccgt?cagcgtggcg?tttgcgtctt?gaccggaaac 360

ggggccgtta?caaacgtcac?cgttagacaa?cctggcggag?gcgtcgtcag?tttacacgga 420

cggtttgaga?ttctttctct?ctcgggttcg?tttcttcctc?caccggcacc?accagctgcg 480

tctggtttaa?aggtttactt?agccggtggt?caaggtcaag?tgatcggagg?cagtgtggtg 540

ggaccgctta?cggcatcaag?tccggtggtc?gttatggcag?cttcatttgg?aaacgcatct 600

tacgagaggc?tgccactaga?ggaggaggag?gaaactgaaa?gagaaataga?tggaaacgcg 660

gctagggcga?ttggaacgca?aacgcagaaa?cagttaatgc?aagatgcgac?atcgtttatt 720

gggtcgccgt?cgaatttaat?taactctgtt?tcgttgccag?gtgaagctta?ttggggaacg 780

caacgaccgt?ctttctaa 798

<210>165

<211>265

<212>PRT

<213> Arabidopis thaliana

<400>165

Met?Asp?Glu?Val?Ser?Arg?Ser?His?Thr?Pro?Gln?Phe?Leu?Ser?Ser?Asp

1 5 10 15

His?Gln?His?Tyr?His?His?Gln?Asn?Ala?Gly?Arg?Gln?Lys?Arg?Gly?Arg

20 25 30

Glu?Glu?Glu?Gly?Val?Glu?Pro?Asn?Asn?Ile?Gly?Glu?Asp?Leu?Ala?Thr

35 40 45

Phe?Pro?Ser?Gly?Glu?Glu?Asn?Ile?Lys?Lys?Arg?Arg?Pro?Arg?Gly?Arg

50 55 60

Pro?Ala?Gly?Ser?Lys?Asn?Lys?Pro?Lys?Ala?Pro?Ile?Ile?Val?Thr?Arg

65 70 75 80

Asp?Ser?Ala?Asn?Ala?Phe?Arg?Cys?His?Val?Met?Glu?Ile?Thr?Asn?Ala

85 90 95

Cys?Asp?Val?Met?Glu?Ser?Leu?Ala?Val?Phe?Ala?Arg?Arg?Arg?Gln?Arg

100 105 110

Gly?Val?Cys?Val?Leu?Thr?Gly?Asn?Gly?Ala?Val?Thr?Asn?Val?Thr?Val

115 120 125

Arg?Gln?Pro?Gly?Gly?Gly?Val?Val?Ser?Leu?His?Gly?Arg?Phe?Glu?Ile

130 135 140

Leu?Ser?Leu?Ser?Gly?Ser?Phe?Leu?Pro?Pro?Pro?Ala?Pro?Pro?Ala?Ala

145 150 155 160

Ser?Gly?Leu?Lys?Val?Tyr?Leu?Ala?Gly?Gly?Gln?Gly?Gln?Val?Ile?Gly

165 170 175

Gly?Ser?Val?Val?Gly?Pro?Leu?Thr?Ala?Ser?Ser?Pro?Val?Val?Val?Met

180 185 190

Ala?Ala?Ser?Phe?Gly?Asn?Ala?Ser?Tyr?Glu?Arg?Leu?Pro?Leu?Glu?Glu

195 200 205

Glu?Glu?Glu?Thr?Glu?Arg?Glu?Ile?Asp?Gly?Asn?Ala?Ala?Arg?Ala?Ile

210 215 220

Gly?Thr?Gln?Thr?Gln?Lys?Gln?Leu?Met?Gln?Asp?Ala?Thr?Ser?Phe?Ile

225 230 235 240

Gly?Ser?Pro?Ser?Asn?Leu?Ile?Asn?Ser?Val?Ser?Leu?Pro?Gly?Glu?Ala

245 250 255

Tyr?Trp?Gly?Thr?Gln?Arg?Pro?Ser?Phe

260 265

<210>166

<211>933

<212>DNA

<213> Arabidopis thaliana

<400>166

atggcgaatc?cttggtgggt?agggaatgtt?gcgatcggtg?gagttgagag?tccagtgacg 60

tcatcagctc?cttctttgca?ccacagaaac?agtaacaaca?acaacccacc?gactatgact 120

cgttcggatc?caagattgga?ccatgacttc?accaccaaca?acagtggaag?ccctaatacc 180

cagactcaga?gccaagaaga?acagaacagc?agagacgagc?aaccagctgt?tgaacccgga 240

tccggatccg?ggtctacggg?tcgtcgtcct?agaggtagac?ctcctggttc?caagaacaaa 300

ccaaagagtc?cagttgttgt?taccaaagaa?agccctaact?ctctccagag?ccatgttctt 360

gagattgcta?cgggagctga?cgtggcggaa?agcttaaacg?cctttgctcg?tagacgcggc 420

cggggcgttt?cggtgctgag?cggtagtggt?ttggttacta?atgttactct?gcgtcagcct 480

gctgcatccg?gtggagttgt?tagtttacgt?ggtcagtttg?agatcttgtc?tatgtgtggg 540

gcttttcttc?ctacgtctgg?ctctcctgct?gcagccgctg?gtttaaccat?ttacttagct 600

ggagctcaag?gtcaagttgt?gggaggtgga?gttgctggcc?cgcttattgc?ctctggaccc 660

gttattgtga?tagctgctac?gttttgcaat?gccacttatg?agaggttacc?gattgaggaa 720

gaacaacagc?aagagcagcc?gcttcaacta?gaagatggga?agaagcagaa?agaagagaat 780

gatgataacg?agagtgggaa?taacggaaac?gaaggatcga?tgcagccgcc?gatgtataat 840

atgcctccta?attttatccc?aaatggtcat?caaatggctc?aacacgacgt?gtattggggt 900

ggtcctccgc?ctcgtgctcc?tccttcgtat?tga 933

<210>167

<211>310

<212>PRT

<213> Arabidopis thaliana

<400>167

Met?Ala?Asn?Pro?Trp?Trp?Val?Gly?Asn?Val?Ala?Ile?Gly?Gly?Val?Glu

1 5 10 15

Ser?Pro?Val?Thr?Ser?Ser?Ala?Pro?Ser?Leu?His?His?Arg?Asn?Ser?Asn

20 25 30

Asn?Asn?Asn?Pro?Pro?Thr?Met?Thr?Arg?Ser?Asp?Pro?Arg?Leu?Asp?His

35 40 45

Asp?Phe?Thr?Thr?Asn?Asn?Ser?Gly?Ser?Pro?Asn?Thr?Gln?Thr?Gln?Ser

50 55 60

Gln?Glu?Glu?Gln?Asn?Ser?Arg?Asp?Glu?Gln?Pro?Ala?Val?Glu?Pro?Gly

65 70 75 80

Ser?Gly?Ser?Gly?Ser?Thr?Gly?Arg?Arg?Pro?Arg?Gly?Arg?Pro?Pro?Gly

85 90 95

Ser?Lys?Asn?Lys?Pro?Lys?Ser?Pro?Val?Val?Val?Thr?Lys?Glu?Ser?Pro

100 105 110

Asn?Ser?Leu?Gln?Ser?His?Val?Leu?Glu?Ile?Ala?Thr?Gly?Ala?Asp?Val

115 120 125

Ala?Glu?Ser?Leu?Asn?Ala?Phe?Ala?Arg?Arg?Arg?Gly?Arg?Gly?Val?Ser

130 135 140

Val?Leu?Ser?Gly?Ser?Gly?Leu?Val?Thr?Asn?Val?Thr?Leu?Arg?Gln?Pro

145 150 155 160

Ala?Ala?Ser?Gly?Gly?Val?Val?Ser?Leu?Arg?Gly?Gln?Phe?Glu?Ile?Leu

165 170 175

Ser?Met?Cys?Gly?Ala?Phe?Leu?Pro?Thr?Ser?Gly?Ser?Pro?Ala?Ala?Ala

180 185 190

Ala?Gly?Leu?Thr?Ile?Tyr?Leu?Ala?Gly?Ala?Gln?Gly?Gln?Val?Val?Gly

195 200 205

Gly?Gly?Val?Ala?Gly?Pro?Leu?Ile?Ala?Ser?Gly?Pro?Val?Ile?Val?Ile

210 215 220

Ala?Ala?Thr?Phe?Cys?Asn?Ala?Thr?Tyr?Glu?Arg?Leu?Pro?Ile?Glu?Glu

225 230 235 240

Glu?Gln?Gln?Gln?Glu?Gln?Pro?Leu?Gln?Leu?Glu?Asp?Gly?Lys?Lys?Gln

245 250 255

Lys?Glu?Glu?Asn?Asp?Asp?Asn?Glu?Ser?Gly?Asn?Asn?Gly?Asn?Glu?Gly

260 265 270

Ser?Met?Gln?Pro?Pro?Met?Tyr?Asn?Met?Pro?Pro?Asn?Phe?Ile?Pro?Asn

275 280 285

Gly?His?Gln?Met?Ala?Gln?His?Asp?Val?Tyr?Trp?Gly?Gly?Pro?Pro?Pro

290 295 300

Arg?Ala?Pro?Pro?Ser?Tyr

305 310

<210>168

<211>987

<212>DNA

<213> rice

<400>168

atggatccgg?tgacggcggc?ggcggcgcat?gggggtgggc?accaccacca?ccaccacttc 60

ggagcgccac?cggtggcggc?gttccaccac?cacccgttcc?accacggcgg?cggggcgcac 120

tacccggcgg?cgttccagca?gtttcaggag?gagcagcagc?agcttgtggc?ggcggcggcg 180

gcggctggtg?ggatggcgaa?gcaggagctg?gtggatgaga?gcaacaacac?catcaacagc 240

ggcgggagca?acgggagcgg?cggggaggag?cagaggcagc?agtccgggga?ggagcagcac 300

cagcaagggg?cggcggcgcc?ggtggtgatc?cggcgtccca?ggggccgccc?cgccggctcc 360

aagaacaagc?ccaagcctcc?ggtcatcatc?acgcgcgaca?gcgccagcgc?gctgcgggcg 420

cacgtcctcg?aggtcgcctc?cgggtgcgac?ctcgtcgaca?gcgtcgccac?gttcgcgcgc 480

cgccgccagg?tcggtgtctg?cgtgctcagc?gccaccggcg?ccgtcaccaa?cgtctccgtc 540

cggcagcccg?gcgcgggccc?cggcgccgtc?gtcaacctca?ccggccgctt?cgacatcctc 600

tcgctgtccg?gctccttcct?cccgccgccg?gcgcctccct?ccgccaccgg?cctcaccgtc 660

tacgtctccg?gcggccaggg?gcaggtcgtg?ggcggcacgg?tcgccggacc?gctcatcgcc 720

gtcggccccg?tcgtcatcat?ggccgcctcg?ttcgggaacg?ccgcctacga?gcgcctcccg 780

ctcgaggacg?acgagccgcc?gcagcacatg?gcgggcggcg?gccagtcctc?gccgccgccg 840

ccgccgctgc?cattaccacc?acaccagcag?ccgattcttc?aagaccatct?gccacacaac 900

ctgatgaacg?gaatccacct?ccccggcgac?gccgcctacg?gctggaccag?cggcggcggc 960

ggcggcggcc?gcgcggcgcc?gtactga 987

<210>169

<211>328

<212>PRT

<213> rice

<400>169

Met?Asp?Pro?Val?Thr?Ala?Ala?Ala?Ala?His?Gly?Gly?Gly?His?His?His

1 5 10 15

His?His?His?Phe?Gly?Ala?Pro?Pro?Val?Ala?Ala?Phe?His?His?His?Pro

20 25 30

Phe?His?His?Gly?Gly?Gly?Ala?His?Tyr?Pro?Ala?Ala?Phe?Gln?Gln?Phe

35 40 45

Gln?Glu?Glu?Gln?Gln?Gln?Leu?Val?Ala?Ala?Ala?Ala?Ala?Ala?Gly?Gly

50 55 60

Met?Ala?Lys?Gln?Glu?Leu?Val?Asp?Glu?Ser?Asn?Asn?Thr?Ile?Asn?Ser

65 70 75 80

Gly?Gly?Ser?Asn?Gly?Ser?Gly?Gly?Glu?Glu?Gln?Arg?Gln?Gln?Ser?Gly

85 90 95

Glu?Glu?Gln?His?Gln?Gln?Gly?Ala?Ala?Ala?Pro?Val?Val?Ile?Arg?Arg

100 105 110

Pro?Arg?Gly?Arg?Pro?Ala?Gly?Ser?Lys?Asn?Lys?Pro?Lys?Pro?Pro?Val

115 120 125

Ile?Ile?Thr?Arg?Asp?Ser?Ala?Ser?Ala?Leu?Arg?Ala?His?Val?Leu?Glu

130 135 140

Val?Ala?Ser?Gly?Cys?Asp?Leu?Val?Asp?Ser?Val?Ala?Thr?Phe?Ala?Arg

145 150 155 160

Arg?Arg?Gln?Val?Gly?Val?Cys?Val?Leu?Ser?Ala?Thr?Gly?Ala?Val?Thr

165 170 175

Asn?Val?Ser?Val?Arg?Gln?Pro?Gly?Ala?Gly?Pro?Gly?Ala?Val?Val?Asn

180 185 190

Leu?Thr?Gly?Arg?Phe?Asp?Ile?Leu?Ser?Leu?Ser?Gly?Ser?Phe?Leu?Pro

195 200 205

Pro?Pro?Ala?Pro?Pro?Ser?Ala?Thr?Gly?Leu?Thr?Val?Tyr?Val?Ser?Gly

210 215 220

Gly?Gln?Gly?Gln?Val?Val?Gly?Gly?Thr?Val?Ala?Gly?Pro?Leu?Ile?Ala

225 230 235 240

Val?Gly?Pro?Val?Val?Ile?Met?Ala?Ala?Ser?Phe?Gly?Asn?Ala?Ala?Tyr

245 250 255

Glu?Arg?Leu?Pro?Leu?Glu?Asp?Asp?Glu?Pro?Pro?Gln?His?Met?Ala?Gly

260 265 270

Gly?Gly?Gln?Ser?Ser?Pro?Pro?Pro?Pro?Pro?Leu?Pro?Leu?Pro?Pro?His

275 280 285

Gln?Gln?Pro?Ile?Leu?Gln?Asp?His?Leu?Pro?His?Asn?Leu?Met?Asn?Gly

290 295 300

Ile?His?Leu?Pro?Gly?Asp?Ala?Ala?Tyr?Gly?Trp?Thr?Ser?Gly?Gly?Gly

305 310 315 320

Gly?Gly?Gly?Arg?Ala?Ala?Pro?Tyr

325

<210>170

<211>777

<212>DNA

<213> rice

<400>170

atggggagca?tcgacggcca?ctcgctgcag?cagcatcagg?ggtactccca?cggcggcggc 60

gcgggaggga?gcaacgagga?ggaggaggcg?tcgccgccgc?ccggcggtgg?ctcggctacg 120

gggtcggcgg?gccgccggcc?gagggggagg?ccgccgggct?ccaagaacaa?gccgaagccg 180

cccgtcgtgg?tgacgcggga?gagccccaac?gcgatgcgtt?cccacgtgct?ggagatcgcc 240

agcggcgccg?acatcgtcga?ggccatcgcg?ggcttctccc?gccgcaggca?gcgcggcgtc 300

tccgtgctca?gcgggagcgg?cgccgtcacc?aacgtcacgc?tccggcagcc?cgcggggact 360

ggggccgccg?ccgtcgcgct?gcgggggagg?ttcgagatat?tgtccatgtc?tggcgccttc 420

ctcccggcgc?cggcgccgcc?aggggccacg?gggctcgccg?tgtacctcgc?cggcgggcag 480

gggcaggtgg?tgggtgggag?cgtcatgggg?gagctgatcg?cgtcgggccc?cgtcatggtg 540

atcgcggcca?cgttcggcaa?cgccacgtac?gagaggctgc?cgctggacca?ggaaggcgag 600

gagggcgccg?tgctgtccgg?gtcggagggc?gccgccgcgc?agatggagca?gcagagcagc 660

ggaggcgccg?tcgtgccccc?gccgatgtac?gccgccgtcc?agcagacgcc?gccgcacgac 720

atgttcgggc?agtgggggca?tgcagcggtg?gctcggccgc?cgccgacatc?gttctag 777

<210>171

<211>258

<212>PRT

<213> rice

<400>171

Met?Gly?Ser?Ile?Asp?Gly?His?Ser?Leu?Gln?Gln?His?Gln?Gly?Tyr?Ser

1 5 10 15

His?Gly?Gly?Gly?Ala?Gly?Gly?Ser?Asn?Glu?Glu?Glu?Glu?Ala?Ser?Pro

20 25 30

Pro?Pro?Gly?Gly?Gly?Ser?Ala?Thr?Gly?Ser?Ala?Gly?Arg?Arg?Pro?Arg

35 40 45

Gly?Arg?Pro?Pro?Gly?Ser?Lys?Asn?Lys?Pro?Lys?Pro?Pro?Val?Val?Val

50 55 60

Thr?Arg?Glu?Ser?Pro?Asn?Ala?Met?Arg?Ser?His?Val?Leu?Glu?Ile?Ala

65 70 75 80

Ser?Gly?Ala?Asp?Ile?Val?Glu?Ala?Ile?Ala?Gly?Phe?Ser?Arg?Arg?Arg

85 90 95

Gln?Arg?Gly?Val?Ser?Val?Leu?Ser?Gly?Ser?Gly?Ala?Val?Thr?Asn?Val

100 105 110

Thr?Leu?Arg?Gln?Pro?Ala?Gly?Thr?Gly?Ala?Ala?Ala?Val?Ala?Leu?Arg

115 120 125

Gly?Arg?Phe?Glu?Ile?Leu?Ser?Met?Ser?Gly?Ala?Phe?Leu?Pro?Ala?Pro

130 135 140

Ala?Pro?Pro?Gly?Ala?Thr?Gly?Leu?Ala?Val?Tyr?Leu?Ala?Gly?Gly?Gln

145 150 155 160

Gly?Gln?Val?Val?Gly?Gly?Ser?Val?Met?Gly?Glu?Leu?Ile?Ala?Ser?Gly

165 170 175

Pro?Val?Met?Val?Ile?Ala?Ala?Thr?Phe?Gly?Asn?Ala?Thr?Tyr?Glu?Arg

180 185 190

Leu?Pro?Leu?Asp?Gln?Glu?Gly?Glu?Glu?Gly?Ala?Val?Leu?Ser?Gly?Ser

195 200 205

Glu?Gly?Ala?Ala?Ala?Gln?Met?Glu?Gln?Gln?Ser?Ser?Gly?Gly?Ala?Val

210 215 220

Val?Pro?Pro?Pro?Met?Tyr?Ala?Ala?Val?Gln?Gln?Thr?Pro?Pro?His?Asp

225 230 235 240

Met?Phe?Gly?Gln?Trp?Gly?His?Ala?Ala?Val?Ala?Arg?Pro?Pro?Pro?Thr

245 250 255

Ser?Phe

<210>172

<211>798

<212>DNA

<213> tomato

<400>172

atggctggtt?tggacttagg?ttccgcttct?catcatcgtt?ttctccctcg?tcatctccac 60

gatcctcaag?acgatgaaat?caatcgcaac?aacactcaat?tttccgatga?tgacaacaac 120

aacaacgata?acaataacaa?taatagcccc?ggggtagcac?gtagacctag?aggtcgtccc 180

gcggggtcca?aaaataagcc?taagcctccc?gtgatcataa?cacgggagag?cgctaacgcg 240

ctccgtgcgc?atattttaga?agtgagtagc?ggacatgatg?tctttgaatc?agttgctact 300

tatgctagaa?aaagacaaag?aggaatttgc?atactgagcg?ggagcggtac?ggtgaataac 360

gtcaccatac?ggcagccaca?ggctgccggt?tctgtggtga?cgttacacgg?aagattcgag 420

atattatctt?tatccggatc?tttcctacca?ccacccgctc?cccctggggc?caccagctta 480

acgatttatt?tagcgggtgg?tcaaggtcaa?gttgttggtg?gaaacgttgt?gggtgcgcta 540

attgcatcag?gaccggttat?tgttattgct?tcgtcattta?ctaatgttgc?ttatgagaga 600

ttgcctttgg?atgaagaaaa?tgagtcaatt?cagatgcagc?aacaaggaca?aagtggtaat 660

tttgctgatc?catctaatat?tggattacct?tttcttaatt?tgccattaaa?catgccaaat 720

ggtggtggtc?aactacaatt?ggaaagtgga?ggaggtgaag?gttggaatgg?aaacacaaca 780

aacaggccac?aatattag 798

<210>173

<211>265

<212>PRT

<213> tomato

<400>173

Met?Ala?Gly?Leu?Asp?Leu?Gly?Ser?Ala?Ser?His?His?Arg?Phe?Leu?Pro

1 5 10 15

Arg?His?Leu?His?Asp?Pro?Gln?Asp?Asp?Glu?Ile?Asn?Arg?Asn?Asn?Thr

20 25 30

Gln?Phe?Ser?Asp?Asp?Asp?Asn?Asn?Asn?Asn?Asp?Asn?Asn?Asn?Asn?Asn

35 40 45

Ser?Pro?Gly?Val?Ala?Arg?Arg?Pro?Arg?Gly?Arg?Pro?Ala?Gly?Ser?Lys

50 55 60

Asn?Lys?Pro?Lys?Pro?Pro?Val?Ile?Ile?Thr?Arg?Glu?Ser?Ala?Asn?Ala

65 70 75 80

Leu?Arg?Ala?His?Ile?Leu?Glu?Val?Ser?Ser?Gly?His?Asp?Val?Phe?Glu

85 90 95

Ser?Val?Ala?Thr?Tyr?Ala?Arg?Lys?Arg?Gln?Arg?Gly?Ile?Cys?Ile?Leu

100 105 110

Ser?Gly?Ser?Gly?Thr?Val?Asn?Asn?Val?Thr?Ile?Arg?Gln?Pro?Gln?Ala

115 120 125

Ala?Gly?Ser?Val?Val?Thr?Leu?His?Gly?Arg?Phe?Glu?Ile?Leu?Ser?Leu

130 135 140

Ser?Gly?Ser?Phe?Leu?Pro?Pro?Pro?Ala?Pro?Pro?Gly?Ala?Thr?Ser?Leu

145 150 155 160

Thr?Ile?Tyr?Leu?Ala?Gly?Gly?Gln?Gly?Gln?Val?Val?Gly?Gly?Asn?Val

165 170 175

Val?Gly?Ala?Leu?Ile?Ala?Ser?Gly?Pro?Val?Ile?Val?Ile?Ala?Ser?Ser

180 185 190

Phe?Thr?Asn?Val?Ala?Tyr?Glu?Arg?Leu?Pro?Leu?Asp?Glu?Glu?Asn?Glu

195 200 205

Ser?Ile?Gln?Met?Gln?Gln?Gln?Gly?Gln?Ser?Gly?Asn?Phe?Ala?Asp?Pro

210 215 220

Ser?Asn?Ile?Gly?Leu?Pro?Phe?Leu?Asn?Leu?Pro?Leu?Asn?Met?Pro?Asn

225 230 235 240

Gly?Gly?Gly?Gln?Leu?Gln?Leu?Glu?Ser?Gly?Gly?Gly?Glu?Gly?Trp?Asn

245 250 255

Gly?Asn?Thr?Thr?Asn?Arg?Pro?Gln?Tyr

260 265

<210>174

<211>813

<212>DNA

<213> Arabidopis thaliana

<400>174

atggaactta?acagatctga?agcagacgaa?gcaaaggccg?agaccactcc?caccggtgga 60

gccaccagct?cagccacagc?ctctggctct?tcctccggac?gtcgtccacg?tggtcgtcct 120

gcaggttcca?aaaacaaacc?caaacctccg?acgattataa?ctagagatag?tcctaacgtc 180

cttagatcac?acgttcttga?agtcacctcc?ggttcggaca?tatccgaggc?agtctccacc 240

tacgccactc?gtcgcggctg?cggcgtttgc?attataagcg?gcacgggtgc?ggtcactaac 300

gtcacgatac?ggcaacctgc?ggctccggct?ggtggaggtg?tgattaccct?gcatggtcgg 360

tttgacattt?tgtctttgac?cggtactgcg?cttccaccgc?ctgcaccacc?gggagcagga 420

ggtttgacgg?tgtatctagc?cggaggtcaa?ggacaagttg?taggagggaa?tgtggctggt 480

tcgttaattg?cttcgggacc?ggtagtgttg?atggctgctt?cttttgcaaa?cgcagtttat 540

gataggttac?cgattgaaga?ggaagaaacc?ccaccgccga?gaaccaccgg?ggtgcagcag 600

cagcagccgg?aggcgtctca?gtcgtcggag?gttacgggga?gtggggccca?ggcgtgtgag 660

tcaaacctcc?aaggtggaaa?tggtggagga?ggtgttgctt?tctacaatct?tggaatgaat 720

atgaacaatt?ttcaattctc?cgggggagat?atttacggta?tgagcggcgg?tagcggagga 780

ggtggtggcg?gtgcgactag?acccgcgttt?tag 813

<210>175

<211>270

<212>PRT

<213> Arabidopis thaliana

<400>175

Met?Glu?Leu?Asn?Arg?Ser?Glu?Ala?Asp?Glu?Ala?Lys?Ala?Glu?Thr?Thr

1 5 10 15

Pro?Thr?Gly?Gly?Ala?Thr?Ser?Ser?Ala?Thr?Ala?Ser?Gly?Ser?Ser?Ser

20 25 30

Gly?Arg?Arg?Pro?Arg?Gly?Arg?Pro?Ala?Gly?Ser?Lys?Asn?Lys?Pro?Lys

35 40 45

Pro?Pro?Thr?Ile?Ile?Thr?Arg?Asp?Ser?Pro?Asn?Val?Leu?Arg?Ser?His

50 55 60

Val?Leu?Glu?Val?Thr?Ser?Gly?Ser?Asp?Ile?Ser?Glu?Ala?Val?Ser?Thr

65 70 75 80

Tyr?Ala?Thr?Arg?Arg?Gly?Cys?Gly?Val?Cys IleIle?Ser?Gly?Thr?Gly

85 90 95

Ala?Val?Thr?Asn?Val?Thr?Ile?Arg?Gln?Pro?Ala?Ala?Pro?Ala?Gly?Gly

100 105 110

Gly?Val?Ile?Thr?Leu?His?Gly?Arg?Phe?Asp?Ile?Leu?Ser?Leu?Thr?Gly

115 120 125

Thr?Ala?Leu?Pro?Pro?Pro?Ala?Pro?Pro?Gly?Ala?Gly?Gly?Leu?Thr?Val

130 135 140

Tyr?Leu?Ala?Gly?Gly?Gln?Gly?Gln?Val?Val?Gly?Gly?Asn?Val?Ala?Gly

145 150 155 160

Ser?Leu?Ile?Ala?Ser?Gly?Pro?Val?Val?Leu?Met?Ala?Ala?Ser?Phe?Ala

165 170 175

Asn?Ala?Val?Tyr?Asp?Arg?Leu?Pro?Ile?Glu?Glu?Glu?Glu?Thr?Pro?Pro

180 185 190

Pro?Arg?Thr?Thr?Gly?Val?Gln?Gln?Gln?Gln?Pro?Glu?Ala?Ser?Gln?Ser

195 200 205

Ser?Glu?Val?Thr?Gly?Ser?Gly?Ala?Gln?Ala?Cys?Glu?Ser?Asn?Leu?Gln

210 215 220

Gly?Gly?Asn?Gly?Gly?Gly?Gly?Val?Ala?Phe?Tyr?Asn?Lan?Gly?Met?Asn

225 230 235 240

Met?Asn?Asn?Phe?Gln?Phe?Ser?Gly?Gly?Asp?Ile?Tyr?Gly?Met?Ser?Gly

245 250 255

Gly?Ser?Gly?Gly?Gly?Gly?Gly?Gly?Ala?Thr?Arg?Pro?Ala?Phe

260 265 270

<210>176

<211>948

<212>DNA

<213> Arabidopis thaliana

<400>176

atggcgaatc?catggtggac?aggacaagtg?aacctatccg?gcctcgaaac?gacgccgcct 60

ggttcctctc?agttaaagaa?accagatctc?cacatctcca?tgaacatggc?catggactca 120

ggtcacaata?atcatcacca?tcaccaagaa?gtcgataaca?acaacaacga?cgacgataga 180

gacaacttga?gtggagacga?ccacgagcca?cgtgaaggag?ccgtagaagc?ccccacgcgc 240

cgtccacgtg?gacgtcctgc?tggttccaag?aacaaaccaa?agccaccgat?cttcgtcact 300

cgcgattctc?caaatgctct?caagagccat?gtcatggaga?tcgctagtgg?gactgacgtc 360

atcgaaaccc?tagctacttt?tgctaggcgg?cgtcaacgtg?gcatctgcat?cttgagcgga 420

aatggcacag?tggctaacgt?caccctccgt?caaccctcga?ccgctgccgt?tgcggcggct 480

cctggtggtg?cggctgtttt?ggctttacaa?gggaggtttg?agattctttc?tttaaccggt 540

tctttcttgc?caggaccggc?tccacctggt?tccaccggtt?taacgattta?cttagccggt 600

ggtcaaggtc?aggttgttgg?aggaagcgtg?gtgggcccat?tgatggcagc?aggtccggtg 660

atgctgatcg?ccgccacgtt?ctctaacgcg?acttacgaga?gattgccatt?ggaggaggaa 720

gaggcagcag?agagaggcgg?tggtggaggc?agcggaggag?tggttccggg?gcagctcgga 780

ggcggaggtt?cgccactaag?cagcggtgct?ggtggaggcg?acggtaacca?aggacttccg 840

gtgtataata?tgccgggaaa?tcttgtttct?aatggtggca?gtggtggagg?aggacagatg 900

agcggccaag?aagcttatgg?ttgggctcaa?gctaggtcag?gattttaa 948

<210>177

<211>315

<212>PRT

<213> Arabidopis thaliana

<400>177

Met?Ala?Asn?Pro?Trp?Trp?Thr?Gly?Gln?Val?Asn?Leu?Ser?Gly?Leu?Glu

1 5 10 15

Thr?Thr?Pro?Pro?Gly?Ser?Ser?Gln?Leu?Lys?Lys?Pro?Asp?Leu?His?Ile

20 25 30

Ser?Met?Asn?Met?Ala?Met?Asp?Ser?Gly?His?Asn?Asn?His?His?His?His

35 40 45

Gln?Glu?Val?Asp?Asn?Asn?Asn?Asn?Asp?Asp?Asp?Arg?Asp?Asn?Leu?Ser

50 55 60

Gly?Asp?Asp?His?Glu?Pro?Arg?Glu?Gly?Ala?Val?Glu?Ala?Pro?Thr?Arg

65 70 75 80

Arg?Pro?Arg?Gly?Arg?Pro?Ala?Gly?Ser?Lys?Asn?Lys?Pro?Lys?Pro?Pro

85 90 95

Ile?Phe?Val?Thr?Arg?Asp?Ser?Pro?Asn?Ala?Leu?Lys?Ser?His?Val?Met

100 105 110

Glu?Ile?Ala?Ser?Gly?Thr?Asp?Val?Ile?Glu?Thr?Leu?Ala?Thr?Phe?Ala

115 120 125

Arg?Arg?Arg?Gln?Arg?Gly?Ile?Cys?Ile?Leu?Ser?Gly?Asn?Gly?Thr?Val

130 135 140

Ala?Asn?Val?Thr?Leu?Arg?Gln?Pro?Ser?Thr?Ala?Ala?Val?Ala?Ala?Ala

145 150 155 160

Pro?Gly?Gly?Ala?Ala?Val?Leu?Ala?Leu?Gln?Gly?Arg?Phe?Glu?Ile?Leu

165 170 175

Ser?Leu?Thr?Gly?Ser?Phe?Leu?Pro?Gly?Pro?Ala?Pro?Pro?Gly?Ser?Thr

180 185 190

Gly?Leu?Thr?Ile?Tyr?Leu?Ala?Gly?Gly?Gln?Gly?Gln?Val?Val?Gly?Gly

195 200 205

Ser?Val?Val?Gly?Pro?Leu?Met?Ala?Ala?Gly?Pro?Val?Met?Leu?Ile?Ala

210 215 220

Ala?Thr?Phe?Ser?Asn?Ala?Thr?Tyr?Glu?Arg?Leu?Pro?Leu?Glu?Glu?Glu

225 230 235 240

Glu?Ala?Ala?Glu?Arg?Gly?Gly?Gly?Gly?Gly?Ser?Gly?Gly?Val?Val?Pro

245 250 255

Gly?Gln?Leu?Gly?Gly?Gly?Gly?Ser?Pro?Leu?Ser?Ser?Gly?Ala?Gly?Gly

260 265 270

Gly?Asp?Gly?Asn?Gln?Gly?Leu?Pro?Val?Tyr?Asn?Met?Pro?Gly?Asn?Leu

275 280 285

Val?Ser?Asn?Gly?Gly?Ser?Gly?Gly?Gly?Gly?Gln?Met?Ser?Gly?Gln?Glu

290 295 300

Ala?Tyr?Gly?Trp?Ala?Gln?Ala?Arg?Ser?Gly?Phe

305 310 315

<210>178

<211>708

<212>DNA

<213> rice

<400>178

atggcgtcca?aggagccaag?cggcgaccac?gaccacgaga?tgaacgggac?cagcgccggg 60

ggcggcgagc?ccaaggacgg?cgcggtggtg?accggccgca?accggcgccc?ccgcggacgg 120

ccgccgggct?ccaagaacaa?gcccaagccg?cccatcttcg?tgacgcggga?cagcccgaac 180

gcgctgcgca?gccacgtcat?ggaggtggcc?ggcggcgccg?atgtcgccga?gtccatcgcg 240

cacttcgcgc?ggcggcggca?gcgcggcgtc?tgcgtgctca?gcggggccgg?caccgtgacc 300

gacgtggccc?tgcgccagcc?ggccgcgccg?agcgccgtgg?tggcgctccg?tgggcggttc 360

gagatcctgt?ccctgacggg?gacgttcctg?ccggggccgg?cgccgccggg?ctccaccggg 420

ctgaccgtgt?acctcgccgg?cgggcagggg?caggtggtgg?gcggcagcgt?ggtggggacg 480

ctcaccgcgg?cggggccggt?catggtgatc?gcctccacct?tcgccaacgc?cacctacgag 540

aggctgccgc?tggatcagga?ggaggaggaa?gcagcggcag?gcggcatgat?ggcgccgccg 600

ccactcatgg?ccggcgccgc?cgatccacta?cttttcggcg?ggggaatgca?cgacgccggg 660

cttgctgcat?ggcaccatgc?ccgccctccg?ccgccgccgc?cctactag 708

<210>179

<211>235

<212>PRT

<213> rice

<400>179

Met?Ala?Ser?Lys?Glu?Pro?Ser?Gly?Asp?His?Asp?His?Glu?Met?Asn?Gly

1 5 10 15

Thr?Ser?Ala?Gly?Gly?Gly?Glu?Pro?Lys?Asp?Gly?Ala?Val?Val?Thr?Gly

20 25 30

Arg?Asn?Arg?Arg?Pro?Arg?Gly?Arg?Pro?Pro?Gly?Ser?Lys?Asn?Lys?Pro

35 40 45

Lys?Pro?Pro?Ile?Phe?Val?Thr?Arg?Asp?Ser?Pro?Asn?Ala?Leu?Arg?Ser

50 55 60

His?Val?Met?Glu?Val?Ala?Gly?Gly?Ala?Asp?Val?Ala?Glu?Ser?Ile?Ala

65 70 75 80

His?Phe?Ala?Arg?Arg?Arg?Gln?Arg?Gly?Val?Cys?Val?Lau?Ser?Gly?Ala

85 90 95

Gly?Thr?Val?Thr?Asp?Val?Ala?Leu?Arg?Gln?Pro?Ala?Ala?Pro?Ser?Ala

100 105 110

Val?Val?Ala?Leu?Arg?Gly?Arg?Phe?Glu?Ile?Leu?Ser?Leu?Thr?Gly?Thr

115 120 125

Phe?Leu?Pro?Gly?Pro?Ala?Pro?Pro?Gly?Ser?Thr?Gly?Leu?Thr?Val?Tyr

130 135 140

Leu?Ala?Gly?Gly?Gln?Gly?Gln?Val?Val?Gly?Gly?Ser?Val?Val?Gly?Thr

145 150 155 160

Leu?Thr?Ala?Ala?Gly?Pro?Val?Met?Val?Ile?Ala?Ser?Thr?Phe?Ala?Asn

165 170 175

Ala?Thr?Tyr?Glu?Arg?Leu?Pro?Leu?Asp?Gln?Glu?Glu?Glu?Glu?Ala?Ala

180 185 190

Ala?Gly?Gly?Met?Met?Ala?Pro?Pro?Pro?Leu?Met?Ala?Gly?Ala?Ala?Asp

195 200 205

Pro?Leu?Leu?Phe?Gly?Gly?Gly?Met?His?Asp?Ala?Gly?Leu?Ala?Ala?Trp

210 215 220

His?His?Ala?Arg?Pro?Pro?Pro?Pro?Pro?Pro?Tyr

225 230 235

<210>180

<211>846

<212>DNA

<213> Arabidopis thaliana

<400>180

atggcaaacc?cttggtggac?gaaccagagt?ggtttagcgg?gcatggtgga?ccattcggtc 60

tcctcaggcc?atcaccaaaa?ccatcaccac?caaagtcttc?ttaccaaagg?agatcttgga 120

atagccatga?atcagagcca?agacaacgac?caagacgaag?aagatgatcc?tagagaagga 180

gccgttgagg?tggtcaaccg?tagaccaaga?ggtagaccac?caggatccaa?aaacaaaccc 240

aaagctccaa?tctttgtgac?aagagacagc?cccaacgcac?tccgtagcca?tgtcttggag 300

atctccgacg?gcagtgacgt?cgccgacaca?atcgctcact?tctcaagacg?caggcaacgc 360

ggcgtttgcg?ttctcagcgg?gacaggctca?gtcgctaacg?tcaccctccg?ccaagccgcc 420

gcaccaggag?gtgtggtctc?tctccaaggc?aggtttgaaa?tcttatcttt?aaccggtgct 480

ttcctccctg?gaccttcccc?acccgggtca?accggtttaa?cggtttactt?agccggggtc 540

cagggtcagg?tcgttggagg?tagcgttgta?ggcccactct?tagccatagg?gtcggtcatg 600

gtgattgctg?ctactttctc?taacgctact?tatgagagat?tgcccatgga?agaagaggaa 660

gacggtggcg?gctcaagaca?gattcacgga?ggcggtgact?caccgcccag?aatcggtagt 720

aacctgcctg?atctatcagg?gatggccggg?ccaggctaca?atatgccgcc?gcatctgatt 780

ccaaatgggg?ctggtcagct?agggcacgaa?ccatatacat?gggtccacgc?aagaccacct 840

tactga 846

<210>181

<211>281

<212>PRT

<213> Arabidopis thaliana

<400>181

Met?Ala?Asn?Pro?Trp?Trp?Thr?Asn?Gln?Ser?Gly?Leu?Ala?Gly?Met?Val

1 5 10 15

Asp?His?Ser?Val?Ser?Ser?Gly?His?His?Gln?Asn?His?His?His?Gln?Ser

20 25 30

Leu?Leu?Thr?Lys?Gly?Asp?Leu?Gly?Ile?Ala?Met?Asn?Gln?Ser?Gln?Asp

35 40 45

Asn?Asp?Gln?Asp?Glu?Glu?Asp?Asp?Pro?Arg?Glu?Gly?Ala?Val?Glu?Val

50 55 60

Val?Asn?Arg?Arg?Pro?Arg?Gly?Arg?Pro?Pro?Gly?Ser?Lys?Asn?Lys?Pro

65 70 75 80

Lys?Ala?Pro?Ile?Phe?Val?Thr?Arg?Asp?Ser?Pro?Asn?Ala?Lau?Arg?Ser

85 90 95

His?Val?Leu?Glu?Ile?Ser?Asp?Gly?Ser?Asp?Val?Ala?Asp?Thr?Ile?Ala

100 105 110

His?Phe?Ser?Arg?Arg?Arg?Gln?Arg?Gly?Val?Cys?Val?Leu?Ser?Gly?Thr

115 120 125

Gly?Ser?Val?Ala?Asn?Val?Thr?Leu?Arg?Gln?Ala?Ala?Ala?Pro?Gly?Gly

130 135 140

Val?Val?Ser?Leu?Gln?Gly?Arg?Phe?Glu?Ile?Leu?Ser?Leu?Thr?Gly?Ala

145 150 155 160

Phe?Leu?Pro?Gly?Pro?Ser?Pro?Pro?Gly?Ser?Thr?Gly?Leu?Thr?Val?Tyr

165 170 175

Leu?Ala?Gly?Val?Gln?Gly?Gln?Val?Val?Gly?Gly?Ser?Val?Val?Gly?Pro

180 185 190

Leu?Leu?Ala?Ile?Gly?Ser?Val?Met?Val?Ile?Ala?Ala?Thr?Phe?Ser?Asn

195 200 205

Ala?Thr?Tyr?Glu?Arg?Leu?Pro?Met?Glu?Glu?Glu?Glu?Asp?Gly?Gly?Gly

210 215 220

Ser?Arg?Gln?Ile?His?Gly?Gly?Gly?Asp?Ser?Pro?Pro?Arg?Ile?Gly?Ser

225 230 235 240

Asn?Leu?Pro?Asp?Leu?Ser?Gly?Met?Ala?Gly?Pro?Gly?Tyr?Asn?Met?Pro

245 250 255

Pro?His?Leu?Ile?Pro?Asn?Gly?Ala?Gly?Gln?Leu?Gly?His?Glu?Pro?Tyr

260 265 270

Thr?Trp?Val?His?Ala?Arg?Pro?Pro?Tyr

275 280

<210>182

<211>879

<212>DNA

<213> Arabidopis thaliana

<400>182

atggctggtc?ttgatctagg?cacagctttt?cgttacgtta?atcaccagct?ccatcgtccc 60

gatctccacc?ttcaccacaa?ttcctcctcc?gatgacgtca?ctcccggagc?cgggatgggt 120

catttcaccg?tcgacgacga?agacaacaac?aacaaccatc?aaggtcttga?cttagcctct 180

ggtggaggat?caggaagctc?tggaggagga?ggaggtcacg?gcgggggagg?agacgtcgtt 240

ggtcgtcgtc?cacgtggcag?accaccggga?tccaagaaca?aaccgaaacc?tccggtaatt 300

atcacgcgcg?agagcgcaaa?cactctaaga?gctcacattc?ttgaagtaac?aaacggctgc 360

gatgttttcg?actgcgttgc?gacttatgct?cgtcggagac?agcgagggat?ctgcgttctg 420

agcggtagcg?gaacggtcac?gaacgtcagc?atacgtcagc?catctgcggc?tggagcggtt 480

gtgacgctac?aaggaacgtt?cgagattctt?tctctctccg?gatcgtttct?tcctcctccg 540

gcacctcccg?gagcaacgag?tttgacaatt?ttcttagccg?gaggacaagg?tcaggtggtt 600

ggaggaagcg?ttgtgggtga?gcttacggcg?gctggaccgg?tgattgtgat?tgcagcttcg 660

tttactaatg?ttgcttatga?gagacttcct?ttagaagaag?atgagcagca?gcaacagctt 720

ggaggaggat?ctaacggcgg?aggtaatttg?tttccggagg?tggcagctgg?aggaggagga 780

ggacttccgt?tctttaattt?accgatgaat?atgcaaccaa?atgtgcaact?tccggtggaa 840

ggttggccgg?ggaattccgg?tggaagaggt?cctttctga 879

<210>183

<211>292

<212>PRT

<213> Arabidopis thaliana

<400>183

Met?Ala?Gly?Leu?Asp?Leu?Gly?Thr?Ala?Phe?Arg?Tyr?Val?Asn?His?Gln

1 5 10 15

Leu?His?Arg?Pro?Asp?Leu?His?Leu?His?His?Asn?Ser?Ser?Ser?Asp?Asp

20 25 30

Val?Thr?Pro?Gly?Ala?Gly?Met?Gly?His?Phe?Thr?Val?Asp?Asp?Glu?Asp

35 40 45

Asn?Asn?Asn?Asn?His?Gln?Gly?Leu?Asp?Leu?Ala?Ser?Gly?Gly?Gly?Ser

50 55 60

Gly?Ser?Ser?Gly?Gly?Gly?Gly?Gly?His?Gly?Gly?Gly?Gly?Asp?Val?Val

65 70 75 80

Gly?Arg?Arg?Pro?Arg?Gly?Arg?Pro?Pro?Gly?Ser?Lys?Asn?Lys?Pro?Lys

85 90 95

Pro?Pro?Val?Ile?Ile?Thr?Arg?Glu?Ser?Ala?Asn?Thr?Leu?Arg?Ala?His

100 105 110

Ile?Leu?Glu?Val?Thr?Asn?Gly?Cys?Asp?Val?Phe?Asp?Cys?Val?Ala?Thr

115 120 125

Tyr?Ala?Arg?Arg?Arg?Gln?Arg?Gly?Ile?Cys?Val?Leu?Ser?Gly?Ser?Gly

130 135 140

Thr?Val?Thr?Asn?Val?Ser?Ile?Arg?Gln?Pro?Ser?Ala?Ala?Gly?Ala?Val

145 150 155 160

Val?Thr?Leu?Gln?Gly?Thr?Phe?Glu?Ile?Leu?Ser?Leu?Ser?Gly?Ser?Phe

165 170 175

Leu?Pro?Pro?Pro?Ala?Pro?Pro?Gly?Ala?Thr?Ser?Leu?Thr?Ile?Phe?Leu

180 185 190

Ala?Gly?Gly?Gln?Gly?Gln?Val?Val?Gly?Gly?Ser?Val?Val?Gly?Glu?Leu

195 200 205

Thr?Ala?Ala?Gly?Pro?Val?Ile?Val?Ile?Ala?Ala?Ser?Phe?Thr?Asn?Val

210 215 220

Ala?Tyr?Glu?Arg?Leu?Pro?Leu?Glu?Glu?Asp?Glu?Gln?Gln?Gln?Gln?Leu

225 230 235 240

Gly?Gly?Gly?Ser?Asn?Gly?Gly?Gly?Asn?Leu?Phe?Pro?Glu?Val?Ala?Ala

245 250 255

Gly?Gly?Gly?Gly?Gly?Leu?Pro?Phe?Phe?Asn?Leu?Pro?Met?Asn?Met?Gln

260 265 270

Pro?Asn?Val?Gln?Leu?Pro?Val?Glu?Gly?Trp?Pro?Gly?Asn?Ser?Gly?Gly

275 280 285

Arg?Gly?Pro?Phe

290

<210>184

<211>918

<212>DNA

<213> rice

<400>184

atggcaggtc?tcgacctcgg?caccgccgcg?acgcgctacg?tccaccagct?ccaccacctc 60

caccccgacc?tccagctgca?gcacagctac?gccaagcagc?acgagccgtc?cgacgacgac 120

cccaacggca?gcggcggcgg?cggcaacagc?aacggcgggc?cgtacgggga?ccatgacggc 180

gggtcctcgt?cgtcaggtcc?tgccaccgac?ggcgcggtcg?gcgggcccgg?cgacgtggtg 240

gcgcgccggc?cgcgggggcg?cccgcctggc?tccaagaaca?agccgaagcc?gccggtgatc 300

atcacgcggg?agagcgccaa?cacgctgcgc?gcccacatcc?tggaggtcgg?gagcggctgc 360

gacgtgttcg?agtgcgtctc?cacgtacgcg?cgccggcggc?agcgcggcgt?gtgcgtgctg 420

agcggcagcg?gcgtggtcac?caacgtgacg?ctgcgtcagc?cgtcggcgcc?cgcgggcgcc 480

gtcgtgtcgc?tgcacgggag?gttcgagatc?ctgtcgctct?cgggctcctt?cctcccgccg 540

ccggctcccc?ccggcgccac?cagcctcacc?atcttcctcg?ccgggggcca?gggacaggtc 600

gtcggcggca?acgtcgtcgg?cgcgctctac?gccgcgggcc?cggtcatcgt?catcgcggcg 660

tccttcgcca?acgtcgccta?cgagcgcctc?ccactggagg?aggaggaggc?gccgccgccg 720

caggccggcc?tgcagatgca?gcagcccggc?ggcggcgccg?atgctggtgg?catgggtggc 780

gcgttcccgc?cggacccgtc?tgccgccggc?ctcccgttct?tcaacctgcc?gctcaacaac 840

atgcccggtg?gcggcggctc?acagctccct?cccggcgccg?acggccatgg?ctgggccggc 900

gcacggccac?cgttctga 918

<210>185

<211>305

<212>PRT

<213> rice

<400>185

Met?Ala?Gly?Leu?Asp?Leu?Gly?Thr?Ala?Ala?Thr?Arg?Tyr?Val?His?Gln

1 5 10 15

Leu?His?His?Leu?His?Pro?Asp?Leu?Gln?Leu?Gln?His?Ser?Tyr?Ala?Lys

20 25 30

Gln?His?Glu?Pro?Ser?Asp?Asp?Asp?Pro?Asn?Gly?Ser?Gly?Gly?Gly?Gly

35 40 45

Asn?Ser?Asn?Gly?Gly?Pro?Tyr?Gly?Asp?His?Asp?Gly?Gly?Ser?Ser?Ser

50 55 60

Ser?Gly?Pro?Ala?Thr?Asp?Gly?Ala?Val?Gly?Gly?Pro?Gly?Asp?Val?Val

65 70 75 80

Ala?Arg?Arg?Pro?Arg?Gly?Arg?Pro?Pro?Gly?Ser?Lys?Asn?Lys?Pro?Lys

85 90 95

Pro?Pro?Val?Ile?Ile?Thr?Arg?Glu?Ser?Ala?Asn?Thr?Leu?Arg?Ala?His

100 105 110

Ile?Leu?Glu?Val?Gly?Ser?Gly?Cys?Asp?Val?Phe?Glu?Cys?Val?Ser?Thr

115 120 125

Tyr?Ala?Arg?Arg?Arg?Gln?Arg?Gly?Val?Cys?Val?Leu?Ser?Gly?Ser?Gly

130 135 140

Val?Val?Thr?Asn?Val?Thr?Leu?Arg?Gln?Pro?Ser?Ala?Pro?Ala?Gly?Ala

145 150 155 160

Val?Val?Ser?Leu?His?Gly?Arg?Phe?Glu?Ile?Leu?Ser?Leu?Ser?Gly?Ser

165 170 175

Phe?Leu?Pro?Pro?Pro?Ala?Pro?Pro?Gly?Ala?Thr?Ser?Leu?Thr?Ile?Phe

180 185 190

Leu?Ala?Gly?Gly?Gln?Gly?Gln?Val?Val?Gly?Gly?Asn?Val?Val?Gly?Ala

195 200 205

Leu?Tyr?Ala?Ala?Gly?Pro?Val?Ile?Val?Ile?Ala?Ala?Ser?Phe?Ala?Asn

210 215 220

Val?Ala?Tyr?Glu?Arg?Leu?Pro?Leu?Glu?Glu?Glu?Glu?Ala?Pro?Pro?Pro

225 230 235 240

Gln?Ala?Gly?Leu?Gln?Met?Gln?Gln?Pro?Gly?Gly?Gly?Ala?Asp?Ala?Gly

245 250 255

Gly?Met?Gly?Gly?Ala?Phe?Pro?Pro?Asp?Pro?Ser?Ala?Ala?Gly?Leu?Pro

260 265 270

Phe?Phe?Asn?Leu?Pro?Leu?Asn?Asn?Met?Pro?Gly?Gly?Gly?Gly?Ser?Gln

275 280 285

Leu?Pro?Pro?Gly?Ala?Asp?Gly?His?Gly?Trp?Ala?Gly?Ala?Arg?Pro?Pro

290 295 300

Phe

305

<210>186

<211>858

<212>DNA

<213> Arabidopis thaliana

<400>186

atggctggtc?tcgatctagg?cacaacttct?cgctacgtcc?acaacgtcga?tggtggcggc 60

ggcggacagt?tcaccaccga?caaccaccac?gaagatgacg?gtggcgctgg?aggaaaccac 120

catcatcacc?atcataatca?taatcaccat?caaggtttag?atttaatagc?ttctaatgat 180

aactctggac?taggcggcgg?tggaggagga?gggagcggtg?acctcgtcat?gcgtcggcca 240

cgtggccgtc?cagctggatc?gaagaacaaa?ccgaagccgc?cggtgattgt?cacgcgcgag 300

agcgcaaaca?ctcttagggc?tcacattctt?gaagttggaa?gtggctgcga?cgttttcgaa 360

tgtatctcca?cttacgctcg?tcggagacag?cgcgggattt?gcgttttatc?cgggacggga 420

accgtcacta?acgtcagcat?ccgtcagcct?acggcggccg?gagctgttgt?gactctgcgg 480

ggtacttttg?agattctttc?cctctccgga?tcttttcttc?cgccacctgc?tcctccaggg 540

gcgactagct?tgacgatatt?cctcgctgga?gctcaaggac?aggtcgtcgg?aggtaacgta 600

gttggtgagt?taatggcggc?ggggccggta?atggtcatgg?cagcgtcttt?tacaaacgtg 660

gcttacgaaa?ggttgccttt?ggacgagcat?gaggagcact?tgcaaagtgg?cggcggcgga 720

ggtggaggga?atatgtactc?ggaagccact?ggcggtggcg?gagggttgcc?tttctttaat 780

ttgccgatga?gtatgcctca?gattggagtt?gaaagttggc?aggggaatca?cgccggcgcc 840

ggtagggctc?cgttttag 858

<210>187

<211>285

<212>PRT

<213> Arabidopis thaliana

<400>187

Met?Ala?Gly?Leu?Asp?Leu?Gly?Thr?Thr?Ser?Arg?Tyr?Val?His?Asn?Val

1 5 10 15

Asp?Gly?Gly?Gly?Gly?Gly?Gln?Phe?Thr?Thr?Asp?Asn?His?His?Glu?Asp

20 25 30

Asp?Gly?Gly?Ala?Gly?Gly?Asn?His?His?His?His?His?His?Asn?His?Asn

35 40 45

His?His?Gln?Gly?Leu?Asp?Leu?Ile?Ala?Ser?Asn?Asp?Asn?Ser?Gly?Leu

50 55 60

Gly?Gly?Gly?Gly?Gly?Gly?Gly?Ser?Gly?Asp?Leu?Val?Met?Arg?Arg?Pro

65 70 75 80

Arg?Gly?Arg?Pro?Ala?Gly?Ser?Lys?Asn?Lys?Pro?Lys?Pro?Pro?Val?Ile

85 90 95

Val?Thr?Arg?Glu?Ser?Ala?Asn?Thr?Leu?Arg?Ala?His?Ile?Leu?Glu?Val

100 105 110

Gly?Ser?Gly?Cys?Asp?Val?Phe?Glu?Cys?Ile?Ser?Thr?Tyr?Ala?Arg?Arg

115 120 125

Arg?Gln?Arg?Gly?Ile?Cys?Val?Leu?Ser?Gly?Thr?Gly?Thr?Val?Thr?Asn

130 135 140

Val?Ser?Ile?Arg?Gln?Pro?Thr?Ala?Ala?Gly?Ala?Val?Val?Thr?Leu?Arg

145 150 155 160

Gly?Thr?Phe?Glu?Ile?Leu?Ser?Leu?Ser?Gly?Ser?Phe?Leu?Pro?Pro?Pro

165 170 175

Ala?Pro?Pro?Gly?Ala?Thr?Ser?Leu?Thr?Ile?Phe?Leu?Ala?Gly?Ala?Gln

180 185 190

Gly?Gln?Val?Val?Gly?Gly?Asn?Val?Val?Gly?Glu?Leu?Met?Ala?Ala?Gly

195 200 205

Pro?Val?Met?Val?Met?Ala?Ala?Ser?Phe?Thr?Asn?Val?Ala?Tyr?Glu?Arg

210 215 220

Leu?Pro?Leu?Asp?Glu?His?Glu?Glu?His?Leu?Gln?Ser?Gly?Gly?Gly?Gly

225 230 235 240

Gly?Gly?Gly?Asn?Met?Tyr?Ser?Glu?Ala?Thr?Gly?Gly?Gly?Gly?Gly?Leu

245 250 255

Pro?Phe?Phe?Asn?Leu?Pro?Met?Ser?Met?Pro?Gln?Ile?Gly?Val?Glu?Ser

260 265 270

Trp?Gln?Gly?Asn?His?Ala?Gly?Ala?Gly?Arg?Ala?Pro?Phe

275 280 285

<210>188

<211>978

<212>DNA

<213> puncture vine clover

<400>188

atggatcaag?tagcacaagg?tcgtcctctt?ccacctccat?ttctcactag?agaccttcat 60

cttcatcctc?accatcaatt?tcacaccaac?caccaaacca?atgaagagga?acaacaaagt 120

ggcaatggga?gcttaagccg?aggccaaaaa?agagaacgaa?acaacgaaga?cggcaacaac 180

actcccaccg?gaggagaagg?aaaagacgac?ggtggtagcg?gaagtgctgg?tggaggaagt 240

ggtggtgaga?tgggaagaag?accaagagga?agaccagcag?gttcgaaaaa?caaaccaaaa 300

ccacctatca?tcatcacgag?ggacagcgcg?aacgcactcc?gatcccacgt?gatggaagtt 360

gcaaatggat?gtgacatcat?ggaaagtgtg?acggtctttg?cgcgaaggag?gcagcgtggt 420

gtctgcatcc?ttagcggaag?tgggaccgtc?acaaacgtga?ctctccgtca?accagcatcg 480

cctggtgcgg?tagtcacact?tcatggaaga?tttgagatat?tatcattatc?tggctctttc 540

ctgccgccgc?ctgctccacc?agcggcgtca?ggattagcca?tatatctagc?tggtggacaa 600

ggacaggtcg?tcggtggtag?cgtggtggga?ccgttgttag?cttccggtcc?ggttgttatc 660

atggcagctt?cctttggaaa?tgctgcttat?gaaaggctac?ctttagaaga?tgaagaaaca 720

ccagtgaatg?tgccaggaaa?tggagggtta?gggtcaccgg?gaaccatggg?aagtcaacaa 780

caacagcagc?agaaccagca?acagcaacaa?cttgtagcag?atcctaatgc?ttcatcactt 840

ttccatggag?ttcctcaaaa?tcttctcaat?tcatgccaat?taccagctga?aggttattgg 900

ggtggaagtg?ctcgtcctcc?ttttttaacc?aaaaatgtta?ttcacttaat?cacttttctc 960

atcatgtttt?tcgtttaa 978

<210>189

<211>325

<212>PRT

<213> puncture vine clover

<400>189

Met?Asp?Gln?Val?Ala?Gln?Gly?Arg?Pro?Leu?Pro?Pro?Pro?Phe?Leu?Thr

1 5 10 15

Arg?Asp?Leu?His?Leu?His?Pro?His?His?Gln?Phe?His?Thr?Asn?His?Gln

20 25 30

Thr?Asn?Glu?Glu?Glu?Gln?Gln?Ser?Gly?Asn?Gly?Ser?Leu?Ser?Arg?Gly

35 40 45

Gln?Lys?Arg?Glu?Arg?Asn?Asn?Glu?Asp?Gly?Asn?Asn?Thr?Pro?Thr?Gly

50 55 60

Gly?Glu?Gly?Lys?Asp?Asp?Gly?Gly?Ser?Gly?Ser?Ala?Gly?Gly?Gly?Ser

65 70 75 80

Gly?Gly?Glu?Met?Gly?Arg?Arg?Pro?Arg?Gly?Arg?Pro?Ala?Gly?Ser?Lys

85 90 95

Asn?Lys?Pro?Lys?Pro?Pro?Ile?Ile?Ile?Thr?Arg?Asp?Ser?Ala?Asn?Ala

100 105 110

Leu?Arg?Ser?His?Val?Met?Glu?Val?Ala?Asn?Gly?Cys?Asp?Ile?Met?Glu

115 120 125

Ser?Val?Thr?Val?Phe?Ala?Arg?Arg?Arg?Gln?Arg?Gly?Val?Cys?Ile?Leu

130 135 140

Ser?Gly?Ser?Gly?Thr?Val?Thr?Asn?Val?Thr?Leu?Arg?Gln?Pro?Ala?Ser

145 150 155 160

Pro?Gly?Ala?Val?Val?Thr?Leu?His?Gly?Arg?Phe?Glu?Ile?Leu?Ser?Leu

165 170 175

Ser?Gly?Ser?Phe?Leu?Pro?Pro?Pro?Ala?Pro?Pro?Ala?Ala?Ser?Gly?Leu

180 185 190

Ala?Ile?Tyr?Leu?Ala?Gly?Gly?Gln?Gly?Gln?Val?Val?Gly?Gly?Ser?Val

195 200 205

Val?Gly?Pro?Leu?Leu?Ala?Ser?Gly?Pro?Val?Val?Ile?Met?Ala?Ala?Ser

210 215 220

Phe?Gly?Asn?Ala?Ala?Tyr?Glu?Arg?Leu?Pro?Leu?Glu?Asp?Glu?Glu?Thr

225 230 235 240

Pro?Val?Asn?Val?Pro?Gly?Asn?Gly?Gly?Leu?Gly?Ser?Pro?Gly?Thr?Met

245 250 255

Gly?Ser?Gln?Gln?Gln?Gln?Gln?Gln?Asn?Gln?Gln?Gln?Gln?Gln?Leu?Val

260 265 270

Ala?Asp?Pro?Asn?Ala?Ser?Ser?Leu?Phe?His?Gly?Val?Pro?Gln?Asn?Leu

275 280 285

Leu?Asn?Ser?Cys?Gln?Leu?Pro?Ala?Glu?Gly?Tyr?Trp?Gly?Gly?Ser?Ala

290 295 300

Arg?Pro?Pro?Phe?Leu?Thr?Lys?Asn?Val?Ile?His?Leu?Ile?Thr?Phe?Leu

305 310 315 320

Ile?Met?Phe?Phe?Val

325

<210>190

<211>6

<212>PRT

<213> artificial sequence

<220>

<223> primitive 1

<220>

<221> variant

<222>(4)..(4)

<223>/ displacement=" Ile "

<400>190

Gln?Gly?Gln?Val?Gly?Gly

1 5

<210>191

<211>15

<212>PRT

<213> artificial sequence

<220>

<223> primitive 2

<400>191

Ile?Leu?Ser?Leu?Ser?Gly?Ser?Phe?Leu?Pro?Pro?Pro?Ala?Pro?Pro

1 5 10 15

<210>192

<211>8

<212>PRT

<213> artificial sequence

<220>

<223> primitive 3

<400>192

Asn?Ala?Thr?Tyr?Glu?Arg?Leu?Pro

1 5

<210>193

<211>12

<212>PRT

<213> artificial sequence

<220>

<223> primitive 4

<400>193

Ser?Phe?Thr?Asn?Val?Ala?Tyr?Glu?Arg?Leu?Pro?Leu

1 5 10

<210>194

<211>42

<212>PRT

<213> artificial sequence

<220>

<223> primitive 5

<400>194

Gly?Arg?Phe?Glu?Ile?Leu?Ser?Leu?Thr?Gly?Ser?Phe?Leu?Pro?Gly?Pro

1 5 10 15

Ala?Pro?Pro?Gly?Ser?Thr?Gly?Leu?Thr?Ile?Tyr?Leu?Ala?Gly?Gly?Gln

20 25 30

Gly?Gln?Val?Val?Gly?Gly?Ser?Val?Val?Gly

35 40

<210>195

<211>654

<212>DNA

<213> rice

<400>195

cttctacatc?ggcttaggtg?tagcaacacg?actttattat?tattattatt?attattatta 60

ttattttaca?aaaatataaa?atagatcagt?ccctcaccac?aagtagagca?agttggtgag 120

ttattgtaaa?gttctacaaa?gctaatttaa?aagttattgc?attaacttat?ttcatattac 180

aaacaagagt?gtcaatggaa?caatgaaaac?catatgacat?actataattt?tgtttttatt 240

attgaaatta?tataattcaa?agagaataaa?tccacatagc?cgtaaagttc?tacatgtggt 300

gcattaccaa?aatatatata?gcttacaaaa?catgacaagc?ttagtttgaa?aaattgcaat 360

ccttatcaca?ttgacacata?aagtgagtga?tgagtcataa?tattattttc?tttgctaccc 420

atcatgtata?tatgatagcc?acaaagttac?tttgatgatg?atatcaaaga?acatttttag 480

gtgcacctaa?cagaatatcc?aaataatatg?actcacttag?atcataatag?agcatcaagt 540

aaaactaaca?ctctaaagca?accgatggga?aagcatctat?aaatagacaa?gcacaatgaa 600

aatcctcatc?atccttcacc?acaattcaaa?tattatagtt?gaagcatagt?agta 654

<210>196

<211>51

<212>DNA

<213> artificial sequence

<220>

<223> primer

<400>196

ggggacaagt?ttgtacaaaa?aagcaggctt?aaacaatgga?tccggtcacg?g 51

<210>197

<211>49

<212>DNA

<213> artificial sequence

<220>

<223> primer

<400>197

ggggaccact?ttgtacaaga?aagctgggtg?gaatcgatcc?atctcagaa 49

<210>198

<211>828

<212>DNA

<213> Arabidopis thaliana

<400>198

atgggtggat?cgatgtcgga?gagagcaagg?caggccaaca?ttcctccact?agcgggaccc 60

ctaaagtgtc?ctcgatgcga?ctccagcaac?actaagttct?gttactacaa?caactataac 120

ctcactcagc?ctcgtcactt?ctgcaaaggt?tgccgtcgct?actggacaca?agggggcgcc 180

ctgagaaacg?tccctgtagg?tggaggctgc?cggaggaata?acaagaaggg?caaaaatgga 240

aatttaaaat?cttcttcttc?ttcgtccaaa?cagtcttcct?cggtcaacgc?tcaaagtcct 300

agctcaggac?agctaaggac?aaatcatcag?ttcccttttt?caccaactct?ttacaatctc 360

actcaactcg?gaggtattgg?tttgaactta?gccgctacta?atggcaacaa?ccaagctcac 420

cagatcggtt?ccagtttgat?gatgagcgat?ctagggtttc?tccatggacg?aaatacttca 480

actccgatga?cgggaaacat?tcatgaaaac?aacaacaata?ataacaatga?aaacaaccta 540

atggcatccg?ttggatcttt?gagccccttt?gctctcttcg?atccaacgac?ggggctatac 600

gctttccaga?acgacggtaa?tatcgggaac?aacgttggga?tatctggctc?ttctacttcc 660

atggttgatt?ctagggttta?tcagacgcct?ccggtgaaga?tggaagaaca?acctaatttg 720

gctaacttgt?ctagaccggt?ctccggtttg?acgtctcctg?ggaatcaaac?aaatcagtac 780

ttttggcctg?gttcggattt?ctcgggtcct?tctaatgatc?tcttgtga 828

<210>199

<211>275

<212>PRT

<213> Arabidopis thaliana

<400>199

Met?Gly?Gly?Ser?Met?Ser?Glu?Arg?Ala?Arg?Gln?Ala?Asn?Ile?Pro?Pro

1 5 10 15

Leu?Ala?Gly?Pro?Leu?Lys?Cys?Pro?Arg?Cys?Asp?Ser?Ser?Asn?Thr?Lys

20 25 30

Phe?Cys?Tyr?Tyr?Asn?Asn?Tyr?Asn?Leu?Thr?Gln?Pro?Arg?His?Phe?Cys

35 40 45

Lys?Gly?Cys?Arg?Arg?Tyr?Trp?Thr?Gln?Gly?Gly?Ala?Leu?Arg?Asn?Val

50 55 60

Pro?Val?Gly?Gly?Gly?Cys?Arg?Arg?Asn?Asn?Lys?Lys?Gly?Lys?Asn?Gly

65 70 75 80

Asn?Leu?Lys?Ser?Ser?Ser?Ser?Ser?Ser?Lys?Gln?Ser?Ser?Ser?Val?Asn

85 90 95

Ala?Gln?Ser?Pro?Ser?Ser?Gly?Gln?Leu?Arg?Thr?Asn?His?Gln?Phe?Pro

100 105 110

Phe?Ser?Pro?Thr?Leu?Tyr?Asn?Leu?Thr?Gln?Leu?Gly?Gly?Ile?Gly?Leu

115 120 125

Asn?Leu?Ala?Ala?Thr?Asn?Gly?Asn?Asn?Gln?Ala?His?Gln?Ile?Gly?Ser

130 135 140

Ser?Leu?Met?Met?Ser?Asp?Leu?Gly?Phe?Leu?His?Gly?Arg?Asn?Thr?Ser

145 150 155 160

Thr?Pro?Met?Thr?Gly?Asn?Ile?His?Glu?Asn?Asn?Asn?Asn?Asn?Asn?Asn

165 170 175

Glu?Asn?Asn?Leu?Met?Ala?Ser?Val?Gly?Ser?Leu?Ser?Pro?Phe?Ala?Leu

180 185 190

Phe?Asp?Pro?Thr?Thr?Gly?Leu?Tyr?Ala?Phe?Gln?Asn?Asp?Gly?Asn?Ile

195 200 205

Gly?Asn?Asn?Val?Gly?Ile?Ser?Gly?Ser?Ser?Thr?Ser?Met?Val?Asp?Ser

210 215 220

Arg?Val?Tyr?Gln?Thr?Pro?Pro?Val?Lys?Met?Glu?Glu?Gln?Pro?Asn?Leu

225 230 235 240

Ala?Asn?Leu?Ser?Arg?Pro?Val?Ser?Gly?Leu?Thr?Ser?Pro?Gly?Asn?Gln

245 250 255

Thr?Asn?Gln?Tyr?Phe?Trp?Pro?Gly?Ser?Asp?Phe?Ser?Gly?Pro?Ser?Asn

260 265 270

Asp?Leu?Leu

275

<210>200

<211>63

<212>PRT

<213> artificial sequence

<220>

<223>DoF structural domain

<400>200

Pro?Leu?Ala?Gly?Pro?Leu?Lys?Cys?Pro?Arg?Cys?Asp?Ser?Ser?Asn?Thr

1 5 10 15

Lys?Phe?Cys?Tyr?Tyr?Asn?Asn?Tyr?Asn?Leu?Thr?Gln?Pro?Arg?His?Phe

20 25 30

Cys?Lys?Gly?Cys?Arg?Arg?Tyr?Trp?Thr?Gln?Gly?Gly?Ala?Leu?Arg?Asn

35 40 45

Val?Pro?Val?Gly?Gly?Gly?Cys?Arg?Arg?Asn?Asn?Lys?Lys?Gly?Lys

50 55 60

<210>201

<211>684

<212>DNA

<213> Arabidopis thaliana

<400>201

atggcggaga?gagcaaggca?ggccaacatt?cctccactag?cgggacccct?aaagtgtcct 60

cgatgcgact?ccagcaacac?taagttctgt?tactacaaca?actataacct?cactcagcct 120

cgtcacttct?gcaaaggttg?ccgtcgctac?tggacacaag?ggggcgccct?gagaaacgtc 180

cctgtaggtg?gaggctgccg?gaggaataac?aagaagggca?aaaatggaaa?tttaaaatct 240

tcttcttctt?cgtccaaaca?gtcttcctcg?gtcaacgctc?aaagtcctag?ctcaggacag 300

ctaaggacaa?atcatcagtt?ccctttttca?ccaactcttt?acaatctcac?tcaactcgga 360

ggtattggtt?tgaacttagc?cgctactaat?ggcaacaacc?aagctcacca?gatcggttcc 420

agtttgatga?tgagcgatct?agggtttctc?catggacgaa?atacttcaac?tccgatgacg 480

ggaaacattc?atgaaaacaa?caacaataat?aacaatgaaa?acaacctaat?ggcatccgtt 540

ggatctttga?gcccctttgc?tctcttcgat?ccaacgacgg?ggctatacgc?tttccagaac 600

gacggtaata?tcgggaacaa?cgttgggata?tctggttctt?ctacttccat?ggttgattct 660

agggtttatc?agacgctccg?gtga 684

<210>202

<211>227

<212>PRT

<213> Arabidopis thaliana

<400>202

Met?Ala?Glu?Arg?Ala?Arg?Gln?Ala?Asn?Ile?Pro?Pro?Leu?Ala?Gly?Pro

1 5 10 15

Leu?Lys?Cys?Pro?Arg?Cys?Asp?Ser?Ser?Asn?Thr?Lys?Phe?Cys?Tyr?Tyr

20 25 30

Asn?Asn?Tyr?Asn?Leu?Thr?Gln?Pro?Arg?His?Phe?Cys?Lys?Gly?Cys?Arg

35 40 45

Arg?Tyr?Trp?Thr?Gln?Gly?Gly?Ala?Leu?Arg?Asn?Val?Pro?Val?Gly?Gly

50 55 60

Gly?Cys?Arg?Arg?Asn?Asn?Lys?Lys?Gly?Lys?Asn?Gly?Asn?Leu?Lys?Ser

65 70 75 80

Ser?Ser?Ser?Ser?Ser?Lys?Gln?Ser?Ser?Ser?Val?Asn?Ala?Gln?Ser?Pro

85 90 95

Ser?Ser?Gly?Gln?Leu?Arg?Thr?Asn?His?Gln?Phe?Pro?Phe?Ser?Pro?Thr

100 105 110

Leu?Tyr?Asn?Leu?Thr?Gln?Leu?Gly?Gly?Ile?Gly?Leu?Asn?Leu?Ala?Ala

115 120 125

Thr?Asn?Gly?Asn?Asn?Gln?Ala?His?Gln?Ile?Gly?Ser?Ser?Leu?Met?Met

130 135 140

Ser?Asp?Leu?Gly?Phe?Leu?His?Gly?Arg?Asn?Thr?Ser?Thr?Pro?Met?Thr

145 150 155 160

Gly?Asn?Ile?His?Glu?Asn?Asn?Asn?Asn?Asn?Asn?Asn?Glu?Asn?Asn?Leu

165 170 175

Met?Ala?Ser?Val?Gly?Ser?Leu?Ser?Pro?Phe?Ala?Leu?Phe?Asp?Pro?Thr

180 185 190

Thr?Gly?Leu?Tyr?Ala?Phe?Gln?Asn?Asp?Gly?Asn?Ile?Gly?Asn?Asn?Val

195 200 205

Gly?Ile?Ser?Gly?Ser?Ser?Thr?Ser?Met?Val?Asp?Ser?Arg?Val?Tyr?Gln

210 215 220

Thr?Leu?Arg

225

<210>203

<211>993

<212>DNA

<213> Arabidopis thaliana

<400>203

atgcctacga?attcgaatca?tcagcatcat?cttcaacacc?agcttaacga?aaatggaagt 60

ataataagtg?gccacggact?agtactctct?caccaacttc?cacctctcca?agcaaaccct 120

aaccctaacc?accaccatgt?cgctacctct?gctggtcttc?cgtcaaggat?gggtggatcg 180

atggcggaga?gagcaaggca?ggccaacatt?cctccactag?cgggacccct?aaagtgtcct 240

cgatgcgact?ccagcaacac?taagttctgt?tactacaaca?actataacct?cactcagcct 300

cgttacttct?gcaaaggttg?ccgtcgctac?tggacacaag?ggggcgccct?gagaaacgtc 360

cctgtaggtg?gaggctgccg?gaggaataac?aagaagggca?aaaatggaaa?tttaaaatct 420

tcttcttctt?cgtccaaaca?gtcttcctcg?gtcaacgctc?aaagtcctag?ctcaggacag 480

ctaaggacaa?atcatcagtt?ccctttttca?ccaactcttt?acaatctcac?tcaactcgga 540

ggtattggtt?tgaacttagc?cgctactaat?ggcaacaacc?aagctcacca?gatcggttcc 600

agtttgatga?tgagcgatct?agggtttctc?catggacgaa?atacttcaac?tccgatgacg 660

ggaaacattc?atgaaaacaa?caacaataat?aacaatgaaa?acaacctaat?ggcatccgtt 720

ggatctttga?gcccctttgc?tctcttcgat?ccaacgacgg?ggctatacgc?tttccagaac 780

gacggtaata?tcgggaacaa?cgttgggata?tctggttctt?ctacttccat?ggttgattct 840

agggtttatc?agacgcctcc?ggtgaagatg?gaagaacaac?ctaatttggc?taacttgtct 900

agaccggtct?ccggtttgac?gtctcctggg?aatcaaacaa?atcaatactt?ttggcctggt 960

tcggatttct?cgggtccttc?taatgatatc?ttg 993

<210>204

<211>331

<212>PRT

<213> Arabidopis thaliana

<400>204

Met?Pro?Thr?Asn?Ser?Asn?His?Gln?His?His?Leu?Gln?His?Gln?Leu?Asn

1 5 10 15

Glu?Asn?Gly?Ser?Ile?Ile?Ser?Gly?His?Gly?Leu?Val?Leu?Ser?His?Gln

20 25 30

Leu?Pro?Pro?Leu?Gln?Ala?Asn?Pro?Asn?Pro?Asn?His?His?His?Val?Ala

35 40 45

Thr?Ser?Ala?Gly?Leu?Pro?Ser?Arg?Met?Gly?Gly?Ser?Met?Ala?Glu?Arg

50 55 60

Ala?Arg?Gln?Ala?Asn?Ile?Pro?Pro?Leu?Ala?Gly?Pro?Leu?Lys?Cys?Pro

65 70 75 80

Arg?Cys?Asp?Ser?Ser?Asn?Thr?Lys?Phe?Cys?Tyr?Tyr?Asn?Asn?Tyr?Asn

85 90 95

Leu?Thr?Gln?Pro?Arg?Tyr?Phe?Cys?Lys?Gly?Cys?Arg?Arg?Tyr?Trp?Thr

100 105 110

Gln?Gly?Gly?Ala?Leu?Arg?Asn?Val?Pro?Val?Gly?Gly?Gly?Cys?Arg?Arg

115 120 125

Asn?Asn?Lys?Lys?Gly?Lys?Asn?Gly?Asn?Leu?Lys?Ser?Ser?Ser?Ser?Ser

130 135 140

Ser?Lys?Gln?Ser?Ser?Ser?Val?Asn?Ala?Gln?Ser?Pro?Ser?Ser?Gly?Gln

145 150 155 160

Leu?Arg?Thr?Asn?His?Gln?Phe?Pro?Phe?Ser?Pro?Thr?Leu?Tyr?Asn?Leu

165 170 175

Thr?Gln?Leu?Gly?Gly?Ile?Gly?Leu?Asn?Leu?Ala?Ala?Thr?Asn?Gly?Asn

180 185 190

Asn?Gln?Ala?His?Gln?Ile?Gly?Ser?Ser?Leu?Met?Met?Ser?Asp?Leu?Gly

195 200 205

Phe?Leu?His?Gly?Arg?Asn?Thr?Ser?Thr?Pro?Met?Thr?Gly?Asn?Ile?His

210 215 220

Glu?Asn?Asn?Asn?Asn?Asn?Asn?Asn?Glu?Asn?Asn?Leu?Met?Ala?Ser?Val

225 230 235 240

Gly?Ser?Leu?Ser?Pro?Phe?Ala?Leu?Phe?Asp?Pro?Thr?Thr?Gly?Leu?Tyr

245 250 255

Ala?Phe?Gln?Asn?Asp?Gly?Asn?Ile?Gly?Asn?Asn?Val?Gly?Ile?Ser?Gly

260 265 270

Ser?Ser?Thr?Ser?Met?Val?Asp?Ser?Arg?Val?Tyr?Gln?Thr?Pro?Pro?Val

275 280 285

Lys?Met?Glu?Glu?Gln?Pro?Asn?Leu?Ala?Asn?Leu?Ser?Arg?Pro?Val?Ser

290 295 300

Gly?Leu?Thr?Ser?Pro?Gly?Asn?Gln?Thr?Asn?Gln?Tyr?Phe?Trp?Pro?Gly

305 310 315 320

Ser?Asp?Phe?Ser?Gly?Pro?Ser?Asn?Asp?Ile?Leu

325 330

<210>205

<211>873

<212>DNA

<213> rice

<400>205

atgattccgg?gcacgcttgc?cgatggcggc?ggcggaggcg?gcgcggtggg?gccggcgaag 60

ccgatgtcga?tgtcggagag?ggcgcggctg?gcgaggatcc?cgctgccgga?gccggggctc 120

aagtgcccgc?gctgcgactc?caccaacacc?aagttctgct?acttcaacaa?ctactccctc 180

tcccagcccc?gccacttctg?ccgcgcctgc?cgccgctact?ggacccgcgg?cggcgcgctc 240

cgcaacgtcc?ccgtcggcgg?cggctaccgc?cgccacgcca?agcgcgccaa?gcccaagccg 300

gcgtccgcgg?cgggctccgc?ctcagccgcc?accaccaccg?ccggctcgac?gccagcgggg 360

tcgacgacga?cgacgacgac?gtcctccacc?tgcgccacgc?ccaacgcgcc?cgccctcccg 420

gcgatgctgg?gcggcaacct?ctccatcctg?ccgccgctgc?tccgcctcgc?cgacttcgac 480

gccatgagcc?tcggctccac?cttctctggc?atggcggcgg?ccgccggcaa?gccaccgccc 540

gtcgacgcgg?ccggctgcta?ctccgtcggc?gccgccaccg?gcctcgagca?atggagacta 600

cagcagatgc?agagcttccc?gttcttccac?gccatggatc?accaggcggc?gatggcggcg 660

ccaccgccgg?caatggcaat?gccggggatg?ttccagctag?gcctagacgg?cgacggccat 720

ggcagcggcg?gcggcgaaga?cggtggagag?ctccaccatg?cgatgccatc?atcgaagaga 780

gaaggctacc?caaggggcat?gtatggcgat?catcacctcg?ctggaggata?cacctcctac 840

tccagtgcaa?ccacaggtaa?ccatctcttg?taa 873

<210>206

<211>290

<212>PRT

<213> rice

<400>206

Met?Ile?Pro?Gly?Thr?Leu?Ala?Asp?Gly?Gly?Gly?Gly?Gly?Gly?Ala?Val

1 5 10 15

Gly?Pro?Ala?Lys?Pro?Met?Ser?Met?Ser?Glu?Arg?Ala?Arg?Leu?Ala?Arg

20 25 30

Ile?Pro?Leu?Pro?Glu?Pro?Gly?Leu?Lys?Cys?Pro?Arg?Cys?Asp?Ser?Thr

35 40 45

Asn?Thr?Lys?Phe?Cys?Tyr?Phe?Asn?Asn?Tyr?Ser?Leu?Ser?Gln?Pro?Arg

50 55 60

His?Phe?Cys?Arg?Ala?Cys?Arg?Arg?Tyr?Trp?Thr?Arg?Gly?Gly?Ala?Leu

65 70 75 80

Arg?Asn?Val?Pro?Val?Gly?Gly?Gly?Tyr?Arg?Arg?His?Ala?Lys?Arg?Ala

85 90 95

Lys?Pro?Lys?Pro?Ala?Ser?Ala?Ala?Gly?Ser?Ala?Ser?Ala?Ala?Thr?Thr

100 105 110

Thr?Ala?Gly?Ser?Thr?Pro?Ala?Gly?Ser?Thr?Thr?Thr?Thr?Thr?Thr?Ser

115 120 125

Ser?Thr?Cys?Ala?Thr?Pro?Asn?Ala?Pro?Ala?Leu?Pro?Ala?Met?Leu?Gly

130 135 140

Gly?Asn?Leu?Ser?Ile?Leu?Pro?Pro?Leu?Leu?Arg?Leu?Ala?Asp?Phe?Asp

145 150 155 160

Ala?Met?Ser?Leu?Gly?Ser?Thr?Phe?Ser?Gly?Met?Ala?Ala?Ala?Ala?Gly

165 170 175

Lys?Pro?Pro?Pro?Val?Asp?Ala?Ala?Gly?Cys?Tyr?Ser?Val?Gly?Ala?Ala

180 185 190

Thr?Gly?Leu?Glu?Gln?Trp?Arg?Leu?Gln?Gln?Met?Gln?Ser?Phe?Pro?Phe

195 200 205

Phe?His?Ala?Met?Asp?His?Gln?Ala?Ala?Met?Ala?Ala?Pro?Pro?Pro?Ala

210 215 220

Met?Ala?Met?Pro?Gly?Met?Phe?Gln?Leu?Gly?Leu?Asp?Gly?Asp?Gly?His

225 230 235 240

Gly?Ser?Gly?Gly?Gly?Glu?Asp?Gly?Gly?Glu?Leu?His?His?Ala?Met?Pro

245 250 255

Ser?Ser?Lys?Arg?Glu?Gly?Tyr?Pro?Arg?Gly?Met?Tyr?Gly?Asp?His?His

260 265 270

Leu?Ala?Gly?Gly?Tyr?Thr?Ser?Tyr?Ser?Ser?Ala?Thr?Thr?Gly?Asn?His

275 280 285

Leu?Leu

290

<210>207

<211>1068

<212>DNA

<213> rice

<400>207

atgccgccgc?atcacggcgg?cctcatggcg?cctcggcctg?acatggtagc?agcggccgtc 60

gcggcgagcg?gcggcggcgg?tggcggcggc?ggcccgaccg?gcggcacggc?ggtgcggccg 120

ggctcgatga?cggaacgggc?tcggctggcg?aagatcccgc?agccggagcc?ggggctcaag 180

tgcccgcgct?gcgagtccac?caacaccaag?ttctgctact?tcaacaacta?ctcgctctcg 240

cagccgcgcc?acttctgcaa?gacgtgccgc?cgctactgga?cgcgcggcgg?agcgctccgc 300

aacgtccccg?tcggcggcgg?gtgccgccgc?aacaagcgca?ccaagtcgtc?caagtcgtcc 360

tcgtcgacgt?cggccgccgg?ctcggcctcc?gccaccggcg?gcacgtcgtc?gtccacatcg 420

tcgaccgcca?cgggtggcag?cagcagcgcc?gcggcggccg?cggcgatgat?gccgccgcag 480

gcgcagctgc?cgttcctggc?ctcgttgcac?cacccgctcg?gcggcggcga?tcactacagc 540

tccggtgcgt?ccaggctagg?gtttcccgga?ttgagctcgc?tggatcccgt?cgactaccag 600

ctcggcggcg?gcgccgccgc?cgccgccgcc?atcgggctag?agcagtggcg?cctcccgcag 660

atacagcaat?tccccttctt?gagccgcaac?gacgccatgc?cgccgccaat?gtccggcatt 720

tacccgttcg?acgcggaggc?cgccgccgac?gccgccggct?tcgccggcca?gttgctggcc 780

ggcaccaagg?tgcccggctc?gtcgggcctg?atcacgcagc?tcgcatccgt?caagatggag 840

gacagcaacg?ctcagtccgc?ggcgatgaac?agctcgccga?gggagttctt?gggcctcccc 900

ggcaacctcc?aattctgggg?cggtggcaac?ggcgcgggac?ccggcggcaa?tggagacggc 960

gccaccggcg?gcagcggcgc?cggtgtcgct?ccgggaggcg?gcggcagcgg?cggcggatgg 1020

gctgatctct?ccggattcaa?ctcgtcgtcg?tcggggaaca?tactgtga 1068

<210>208

<211>355

<212>PRT

<213> rice

<400>208

Met?Pro?Pro?His?His?Gly?Gly?Leu?Met?Ala?Pro?Arg?Pro?Asp?Met?Val

1 5 10 15

Ala?Ala?Ala?Val?Ala?Ala?Ser?Gly?Gly?Gly?Gly?Gly?Gly?Gly?Gly?Pro

20 25 30

Thr?Gly?Gly?Thr?Ala?Val?Arg?Pro?Gly?Ser?Met?Thr?Glu?Arg?Ala?Arg

35 40 45

Leu?Ala?Lys?Ile?Pro?Gln?Pro?Glu?Pro?Gly?Leu?Lys?Cys?Pro?Arg?Cys

50 55 60

Glu?Ser?Thr?Asn?Thr?Lys?Phe?Cys?Tyr?Phe?Asn?Asn?Tyr?Ser?Leu?Ser

65 70 75 80

Gln?Pro?Arg?His?Phe?Cys?Lys?Thr?Cys?Arg?Arg?Tyr?Trp?Thr?Arg?Gly

85 90 95

Gly?Ala?Leu?Arg?Asn?Val?Pro?Val?Gly?Gly?Gly?Cys?Arg?Arg?Asn?Lys

100 105 110

Arg?Thr?Lys?Ser?Ser?Lys?Ser?Ser?Ser?Ser?Thr?Ser?Ala?Ala?Gly?Ser

115 120 125

Ala?Ser?Ala?Thr?Gly?Gly?Thr?Ser?Ser?Ser?Thr?Ser?Ser?Thr?Ala?Thr

130 135 140

Gly?Gly?Ser?Ser?Ser?Ala?Ala?Ala?Ala?Ala?Ala?Met?Met?Pro?Pro?Gln

145 150 155 160

Ala?Gln?Leu?Pro?Phe?Leu?Ala?Ser?Leu?His?His?Pro?Leu?Gly?Gly?Gly

165 170 175

Asp?His?Tyr?Ser?Ser?Gly?Ala?Ser?Arg?Leu?Gly?Phe?Pro?Gly?Leu?Ser

180 185 190

Ser?Leu?Asp?Pro?Val?Asp?Tyr?Gln?Leu?Gly?Gly?Gly?Ala?Ala?Ala?Ala

195 200 205

Ala?Ala?Ile?Gly?Leu?Glu?Gln?Trp?Arg?Leu?Pro?Gln?Ile?Gln?Gln?Phe

210 215 220

Pro?Phe?Leu?Ser?Arg?Asn?Asp?Ala?Met?Pro?Pro?Pro?Met?Ser?Gly?Ile

225 230 235 240

Tyr?Pro?Phe?Asp?Ala?Glu?Ala?Ala?Ala?Asp?Ala?Ala?Gly?Phe?Ala?Gly

245 250 255

Gln?Leu?Leu?Ala?Gly?Thr?Lys?Val?Pro?Gly?Ser?Ser?Gly?Leu?Ile?Thr

260 265 270

Gln?Leu?Ala?Ser?Val?Lys?Met?Glu?Asp?Ser?Asn?Ala?Gln?Ser?Ala?Ala

275 280 285

Met?Asn?Ser?Ser?Pro?Arg?Glu?Phe?Leu?Gly?Leu?Pro?Gly?Asn?Leu?Gln

290 295 300

Phe?Trp?Gly?Gly?Gly?Asn?Gly?Ala?Gly?Pro?Gly?Gly?Asn?Gly?Asp?Gly

305 310 315 320

Ala?Thr?Gly?Gly?Ser?Gly?Ala?Gly?Val?Ala?Pro?Gly?Gly?Gly?Gly?Ser

325 330 335

Gly?Gly?Gly?Trp?Ala?Asp?Leu?Ser?Gly?Phe?Asn?Ser?Ser?Ser?Ser?Gly

340 345 350

Asn?Ile?Leu

355

<210>209

<211>1000

<212>DNA

<213> common wheat

<400>209

ctcctagctc?gtcgacaagc?atgcccacaa?agccactgat?aacaagcgca?tagcagcgca 60

cgctctctta?tagtagaatg?ttctgaactc?cacaccagcc?catgcaagac?ttccagtcca 120

tcccgggcct?cgccgggcgg?ctgttcggcg?gcgcggccgc?ggcagacatc?cggcgcgtgc 180

agggcccggc?gtcccggtgc?ggcgtgttct?cgcaggcggc?gtccgcgcag?ccggaggcgg 240

ccgtcaagtg?cccgcggtgc?gagtccacca?acaccaagtt?ctgctactac?aacaactaca 300

acctgtcgca?gccgcgccac?ttctgcaaga?gctgccgccg?gtactggacc?aagggcggcg 360

tcctccgcaa?cgtccccgtc?ggcggcggct?gccgcaaggc?caagcgcagc?tcctcgtcgg 420

cgtccgcacc?gtcgacgccc?gcggccacgg?acgccaagag?ccagcggcgc?gcgtccgcgt 480

cgtcctcctc?ccgctccaac?agcggcagcg?gcagcgccag?ccccacggcc?gctgcggaag 540

agacgacgac?aacggagacc?gagccccctc?ctccgcccac?gccgtcgtcc?aactccaact 600

ccaacgcggt?ctccttcgcc?aaccgcatga?cgaactaccc?cttcgcggca?gacgtgccac 660

ctctggcgcc?gatattcgcc?gaccaggccg?ccgcgctcgc?gtccctcttc?gcgccgcctc 720

ctccaccgcc?tctcccggtg?ttcagcttct?cggcggagcc?caagatggag?gaggcgatcg 780

ggtcactgct?gctcccgggg?caggaggcgt?cgcaggagcc?agaggagccc?acctgcacct 840

ccaccgtcgc?ggacatggcg?ccgttcatgt?cgctggacgc?ggggatcttc?gagctcggcg 900

acgcgtcgcc?ggccgattac?tggaacggcg?ggagctgctg?gacggacgtc?caggacccgt 960

ccgtctacct?accctagttt?ggcttagttc?ctcatcacga 1000

<210>210

<211>291

<212>PRT

<213> common wheat

<400>210

Met?Gln?Asp?Phe?Gln?Ser?Ile?Pro?Gly?Leu?Ala?Gly?Arg?Leu?Phe?Gly

1 5 10 15

Gly?Ala?Ala?Ala?Ala?Asp?Ile?Arg?Arg?Val?Gln?Gly?Pro?Ala?Ser?Arg

20 25 30

Cys?Gly?Val?Phe?Ser?Gln?Ala?Ala?Ser?Ala?Gln?Pro?Glu?Ala?Ala?Val

35 40 45

Lys?Cys?Pro?Arg?Cys?Glu?Ser?Thr?Asn?Thr?Lys?Phe?Cys?Tyr?Tyr?Asn

50 55 60

Asn?Tyr?Asn?Leu?Sar?Gln?Pro?Arg?His?Phe?Cys?Lys?Ser?Cys?Arg?Arg

65 70 75 80

Tyr?Trp?Thr?Lys?Gly?Gly?Val?Leu?Arg?Asn?Val?Pro?Val?Gly?Gly?Gly

85 90 95

Cys?Arg?Lys?Ala?Lys?Arg?Ser?Ser?Ser?Ser?Ala?Ser?Ala?Pro?Ser?Thr

100 105 110

Pro?Ala?Ala?Thr?Asp?Ala?Lys?Ser?Gln?Arg?Arg?Ala?Ser?Ala?Ser?Ser

115 120 125

Ser?Ser?Arg?Ser?Asn?Ser?Gly?Ser?Gly?Ser?Ala?Ser?Pro?Thr?Ala?Ala

130 135 140

Ala?Glu?Glu?Thr?Thr?Thr?Thr?Glu?Thr?Glu?Pro?Pro?Pro?Pro?Pro?Thr

145 150 155 160

Pro?Ser?Ser?Asn?Ser?Asn?Ser?Asn?Ala?Val?Ser?Phe?Ala?Asn?Arg?Met

165 170 175

Thr?Asn?Tyr?Pro?Phe?Ala?Ala?Asp?Val?Pro?Pro?Leu?Ala?Pro?Ile?Phe

180 185 190

Ala?Asp?Gln?Ala?Ala?Ala?Leu?Ala?Ser?Leu?Phe?Ala?Pro?Pro?Pro?Pro

195 200 205

Pro?Pro?Leu?Pro?Val?Phe?Ser?Phe?Ser?Ala?Glu?Pro?Lys?Met?Glu?Glu

210 215 220

Ala?Ile?Gly?Ser?Leu?Leu?Leu?Pro?Gly?Gln?Glu?Ala?Ser?Gln?Glu?Pro

225 230 235 240

Glu?Glu?Pro?Thr?Cys?Thr?Ser?Thr?Val?Ala?Asp?Met?Ala?Pro?Phe?Met

245 250 255

Ser?Leu?Asp?Ala?Gly?Ile?Phe?Glu?Leu?Gly?Asp?Ala?Ser?Pro?Ala?Asp

260 265 270

Tyr?Trp?Asn?Gly?Gly?Ser?Cys?Trp?Thr?Asp?Val?Gln?Asp?Pro?Ser?Val

275 280 285

Tyr?Leu?Pro

290

<210>211

<211>1230

<212>DNA

<213> Zea mays

<400>211

aggtggtggc?gggggacagg?ttgggggccc?cgccaagccc?atgtccatgg?cggagcgcgc 60

gcgcctcgcg?aggatcccac?tgccggagcc?gggactcaag?tgcccgcgct?gcgactcaac 120

caacaccaag?ttctgctact?tcaacaacta?ctccctcacg?cagccgcgcc?acttctgccg 180

ggcctgccgc?cgctactgga?cgcgtggcgg?cgcgctccgc?aacgtgccgg?tcggtggcgg 240

ataccgccgc?cacgccaagc?gcgccaagcc?caagcagcag?cagcagcacg?cggccgccgg 300

gaccggagct?gccaacggcg?cgatgcagca?gcctcccgct?gggtctatgg?cgtcgtcggc 360

cgccgcctgc?accgcgacca?cgacgatgac?gaccaacgcg?ctggacgccg?ggcccggcgg 420

catgctgccc?atgctgccgc?cgctcgtccg?cctagcagac?ttcgacgcaa?tgagcctcgg 480

ctccagcttc?tccgggatat?cgtccatggg?gaagcccgga?tccatcggcg?cggcctgcta 540

cccgcactct?gtcggcgggc?tggagcagtg?gagggtgcag?cagatgcaga?gcttcccgtt 600

cttgcatgcg?atggaccagg?gcccgctggg?gccacctctg?gccatggcga?tggcggcgcc 660

aggagggatg?ttccagctag?gtctagacac?caccagtgat?aacagccgtg?gcggtggcgg 720

cggcggctgc?ggcgaagacg?ggtcgtctgc?gggagaggcg?ctccatatga?tgcaagcagc 780

caccaagagg?gagagctacc?cggcaccacc?aagagccatg?tacggcgacc?aacaccacaa 840

tcacctcgct?gctgctggtg?gctacacttc?ctattccacc?aatgctgctg?caggtaacca 900

tctcttgtaa?tggccggccg?atcgatcgat?cgagagctca?acaattcaag?tgtcctgcta 960

tagctagcta?ctacgacgtc?gtgctacgat?cgtatcggtt?tcggttcgtt?cctacaaata 1020

tagcctagag?atagagtgtc?tctgtctgtg?tgatcgatgg?tattgttatg?atcatataga 1080

aaagaccagt?gtagcatgca?tgcacttgtt?gcaatgtttg?ctttcaagaa?gaaactggag 1140

ggaggagagg?ctcggtttgg?atgctgatca?tgcacaaata?ttactagtgt?ctacagctgc 1200

tacttcatta?taaaaaaaaa?aaaaaaaaaa 1230

<210>212

<211>302

<212>PRT

<213> Zea mays

<400>212

Gly?Gly?Gly?Gly?Gly?Gln?Val?Gly?Gly?Pro?Ala?Lys?Pro?Met?Ser?Met

1 5 10 15

Ala?Glu?Arg?Ala?Arg?Leu?Ala?Arg?Ile?Pro?Leu?Pro?Glu?Pro?Gly?Leu

20 25 30

Lys?Cys?Pro?Arg?Cys?Asp?Ser?Thr?Asn?Thr?Lys?Phe?Cys?Tyr?Phe?Asn

35 40 45

Asn?Tyr?Ser?Leu?Thr?Gln?Pro?Arg?His?Phe?Cys?Arg?Ala?Cys?Arg?Arg

50 55 60

Tyr?Trp?Thr?Arg?Gly?Gly?Ala?Leu?Arg?Asn?Val?Pro?Val?Gly?Gly?Gly

65 70 75 80

Tyr?Arg?Arg?His?Ala?Lys?Arg?Ala?Lys?Pro?Lys?Gln?Gln?Gln?Gln?His

85 90 95

Ala?Ala?Ala?Gly?Thr?Gly?Ala?Ala?Asn?Gly?Ala?Met?Gln?Gln?Pro?Pro

100 105 110

Ala?Gly?Ser?Met?Ala?Ser?Ser?Ala?Ala?Ala?Cys?Thr?Ala?Thr?Thr?Thr

115 120 125

Met?Thr?Thr?Asn?Ala?Leu?Asp?Ala?Gly?Pro?Gly?Gly?Met?Leu?Pro?Met

130 135 140

Leu?Pro?Pro?Leu?Val?Arg?Leu?Ala?Asp?Phe?Asp?Ala?Met?Ser?Leu?Gly

145 150 155 160

Ser?Ser?Phe?Ser?Gly?Ile?Ser?Ser?Met?Gly?Lys?Pro?Gly?Ser?Ile?Gly

165 170 175

Ala?Ala?Cys?Tyr?Pro?His?Ser?Val?Gly?Gly?Leu?Glu?Gln?Trp?Arg?Val

180 185 190

Gln?Gln?Met?Gln?Ser?Phe?Pro?Phe?Leu?His?Ala?Met?Asp?Gln?Gly?Pro

195 200 205

Leu?Gly?Pro?Pro?Leu?Ala?Met?Ala?Met?Ala?Ala?Pro?Gly?Gly?Met?Phe

210 215 220

Gln?Leu?Gly?Leu?Asp?Thr?Thr?Ser?Asp?Asn?Ser?Arg?Gly?Gly?Gly?Gly

225 230 235 240

Gly?Gly?Cys?Gly?Glu?Asp?Gly?Ser?Ser?Ala?Gly?Glu?Ala?Leu?His?Met

245 250 255

Met?Gln?Ala?Ala?Thr?Lys?Arg?Glu?Ser?Tyr?Pro?Ala?Pro?Pro?Arg?Ala

260 265 270

Met?Tyr?Gly?Asp?Gln?His?His?Asn?His?Leu?Ala?Ala?Ala?Gly?Gly?Tyr

275 280 285

Thr?Ser?Tyr?Ser?Thr?Asn?Ala?Ala?Ala?Gly?Asn?His?Leu?Leu

290 295 300

<210>213

<211>1243

<212>DNA

<213> potato

<400>213

gaggacttat?caaccttttt?atataaaaga?gataaagatc?aaagagatca?aagaaagaaa 60

atcatggttt?tctcatcttt?tcctgtgtat?ctagatcatc?ccaatttgca?tcagttacaa 120

cagccagacg?gccatcaaca?aggaaatact?gggctggaga?atccaactct?gcagccccca 180

cctatgcagg?tgggggctag?tccgggctca?atcagaccag?gttctatggt?ggatcgagcc 240

cggttagcta?agattccact?accggaagct?ggattaaagt?gtccaaggtg?tgattcaaca 300

aacacaaagt?tctgctactt?caacaactac?aacctttccc?aaccaagaca?cttctgcaag 360

acctgtcgcc?ggtactggac?tagagggggc?gccttgagaa?gcgtgccggt?aggaggagga 420

tgccggagga?acaagagaag?caaaagtaat?aacaacaaca?acagctcaaa?gacagctggc 480

agtaatgtca?atactaatac?tattgcttcc?ggtacttcaa?caagtgcaag?tccttcaagc 540

tgcagcacgg?aaataatgaa?tggtcgccat?cacttctctc?atgagcaacc?accgcagtta 600

actcctctca?tggctgcttt?ccaaaatctt?aatcatcact?atggcggatt?tcaacctcct 660

cctttggttt?caacacacca?tgggaatgga?accggcgcgc?ttggtcatca?tcatgaaatg 720

ggatttcaaa?tagggagtag?tactaatact?aacaatttac?ctgtaccccc?aggaggagga 780

tctgatcatc?agtggagatt?accatctttg?gcagcaaaca?caaatttgta?cccttttcaa 840

cacggtactg?atcaaggaat?tcatgaatca?tcatctgtta?acaataataa?tattaatgct 900

catgatgacc?aagggttaaa?ttcgaccaaa?cagtttttgg?gaacaatgga?aaataatact 960

aatcaatatt?ggggtggaaa?cgcatggaca?gggttttctg?gattaaactc?atcttcttca 1020

gcaagccatc?tactttgatt?tcattcatgt?aagtcaattt?gtgtacttga?ctctcaacga 1080

ttaaaatgtt?gtatgtgttg?ggaggggggt?ctaaattaga?tatatagtat?actgggggca 1140

tgtttaagtc?tttgttattc?catggtcatt?atcaccactt?gtaattttac?tggatgtttt 1200

ttttttataa?cttaggtgtg?tgaagttgta?ttgtgagttt?taa 1243

<210>214

<211>324

<212>PRT

<213> potato

<400>214

Met?Val?Phe?Ser?Ser?Phe?Pro?Val?Tyr?Leu?Asp?His?Pro?Asn?Leu?His

1 5 10 15

Gln?Leu?Gln?Gln?Pro?Asp?Gly?His?Gln?Gln?Gly?Asn?Thr?Gly?Leu?Glu

20 25 30

Asn?Pro?Thr?Leu?Gln?Pro?Pro?Pro?Met?Gln?Val?Gly?Ala?Ser?Pro?Gly

35 40 45

Ser?Ile?Arg?Pro?Gly?Ser?Met?Val?Asp?Arg?Ala?Arg?Leu?Ala?Lys?Ile

50 55 60

Pro?Leu?Pro?Glu?Ala?Gly?Leu?Lys?Cys?Pro?Arg?Cys?Asp?Ser?Thr?Asn

65 70 75 80

Thr?Lys?Phe?Cys?Tyr?Phe?Asn?Asn?Tyr?Asn?Leu?Ser?Gln?Pro?Arg?His

85 90 95

Phe?Cys?Lys?Thr?Cys?Arg?Arg?Tyr?Trp?Thr?Arg?Gly?Gly?Ala?Leu?Arg

100 105 110

Ser?Val?Pro?Val?Gly?Gly?Gly?Cys?Arg?Arg?Asn?Lys?Arg?Ser?Lys?Ser

115 120 125

Asn?Asn?Asn?Asn?Asn?Ser?Ser?Lys?Thr?Ala?Gly?Ser?Asn?Val?Asn?Thr

130 135 140

Asn?Thr?Ile?Ala?Ser?GlV?Thr?Ser?Thr?Ser?Ala?Ser?Pro?Ser?Ser?Cys

145 150 155 160

Ser?Thr?Glu?Ile?Met?Asn?Gly?Arg?His?His?Phe?Ser?His?Glu?Gln?Pro

165 170 175

Pro?Gln?Leu?Thr?Pro?Leu?Met?Ala?Ala?Phe?Gln?Asn?Leu?Asn?His?His

180 185 190

Tyr?Gly?Gly?Phe?Gln?Pro?Pro?Pro?Leu?Val?Ser?Thr?His?His?Gly?Asn

195 200 205

Gly?Thr?Gly?Ala?Leu?Gly?His?His?His?Glu?Met?Gly?Phe?Gln?Ile?Gly

210 215 220

Ser?Ser?Thr?Asn?Thr?Asn?Asn?Leu?Pro?Val?Pro?Pro?Gly?Gly?Gly?Ser

225 230 235 240

Asp?His?Gln?Trp?Arg?Leu?Pro?Ser?Leu?Ala?Ala?Asn?Thr?Asn?Leu?Tyr

245 250 255

Pro?Phe?Gln?His?Gly?Thr?Asp?Gln?Gly?Ile?His?Glu?Ser?Ser?Ser?Val

260 265 270

Asn?Asn?Asn?Asn?Ile?Asn?Ala?His?Asp?Asp?Gln?Gly?Leu?Asn?Ser?Thr

275 280 285

Lys?Gln?Phe?Leu?Gly?Thr?Met?Glu?Asn?Asn?Thr?Asn?Gln?Tyr?Trp?Gly

290 295 300

Gly?Asn?Ala?Trp?Thr?Gly?Phe?Ser?Gly?Leu?Asn?Ser?Ser?Ser?Ser?Ala

305 310 315 320

Ser?His?Leu?Leu

<210>215

<211>996

<212>PRT

<213> Arabidopis thaliana

<400>215

Ala?Thr?Gly?Cys?Cys?Thr?Ala?Cys?Gly?Ala?Ala?Thr?Thr?Cys?Gly?Ala

1 5 10 15

Ala?Thr?Cys?Ala?Thr?Cys?Ala?Gly?Cys?Ala?Thr?Cys?Ala?Thr?Cys?Thr

20 25 30

Thr?Cys?Ala?Ala?Cys?Ala?Cys?Cys?Ala?Gly?Cys?Thr?Thr?Ala?Ala?Cys

35 40 45

Gly?Ala?Ala?Ala?Ala?Thr?Gly?Gly?Ala?Ala?Gly?Thr?Ala?Thr?Ala?Ala

50 55 60

Thr?Ala?Ala?Gly?Thr?Gly?Gly?Cys?Cys?Ala?Cys?Gly?Gly?Ala?Cys?Thr

65 70 75 80

Ala?Gly?Thr?Ala?Cys?Thr?Cys?Thr?Cys?Thr?Cys?Ala?Cys?Cys?Ala?Ala

85 90 95

Cys?Thr?Thr?Cys?Cys?Ala?Cys?Cys?Thr?Cys?Thr?Cys?Cys?Ala?Ala?Gly

100 105 110

Cys?Ala?Ala?Ala?Cys?Cys?Cys?Thr?Ala?Ala?Cys?Cys?Cys?Thr?Ala?Ala

115 120 125

Cys?Cys?Ala?Cys?Cys?Ala?Cys?Cys?Ala?Thr?Gly?Thr?Cys?Gly?Cys?Thr

130 135 140

Ala?Cys?Cys?Thr?Cys?Thr?Gly?Cys?Thr?Gly?Gly?Thr?Cys?Thr?Thr?Cys

145 150 155 160

Cys?Gly?Thr?Cys?Ala?Ala?Gly?Gly?Ala?Thr?Gly?Gly?Gly?Thr?Gly?Gly

165 170 175

Ala?Thr?Cys?Gly?Ala?Thr?Gly?Gly?Cys?Gly?Gly?Ala?Gly?Ala?Gly?Ala

180 185 190

Gly?Cys?Ala?Ala?Gly?Gly?Cys?Ala?Gly?Gly?Cys?Cys?Ala?Ala?Cys?Ala

195 200 205

Thr?Thr?Cys?Cys?Thr?Cys?Cys?Ala?Cys?Thr?Ala?Gly?Cys?Gly?Gly?Gly

210 215 220

Ala?Cys?Cys?Cys?Cys?Thr?Ala?Ala?Ala?Gly?Thr?Gly?Thr?Cys?Cys?Thr

225 230 235 240

Cys?Gly?Ala?Thr?Gly?Cys?Gly?Ala?Cys?Thr?Cys?Cys?Ala?Gly?Cys?Ala

245 250 255

Ala?Cys?Ala?Cys?Thr?Ala?Ala?Gly?Thr?Thr?Cys?Thr?Gly?Thr?Thr?Ala

260 265 270

Cys?Thr?Ala?Cys?Ala?Ala?Cys?Ala?Ala?Cys?Thr?Ala?Thr?Ala?Ala?Cys

275 280 285

Cys?Thr?Cys?Ala?Cys?Thr?Cys?Ala?Gly?Cys?Cys?Thr?Cys?Gly?Thr?Cys

290 295 300

Ala?Cys?Thr?Thr?Cys?Thr?Gly?Cys?Ala?Ala?Ala?Gly?Gly?Thr?Thr?Gly

305 310 315 320

Cys?Cys?Gly?Thr?Cys?Gly?Cys?Thr?Ala?Cys?Thr?Gly?Gly?Ala?Cys?Ala

325 330 335

Cys?Ala?Ala?Gly?Gly?Gly?Gly?Gly?Cys?Gly?Cys?Cys?Cys?Thr?Gly?Ala

340 345 350

Gly?Ala?Ala?Ala?Cys?Gly?Thr?Cys?Cys?Cys?Thr?Gly?Thr?Ala?Gly?Gly

355 360 365

Thr?Gly?Gly?Ala?Gly?Gly?Cys?Thr?Gly?Cys?Cys?Gly?Gly?Ala?Gly?Gly

370 375 380

Ala?Ala?Thr?Ala?Ala?Cys?Ala?Ala?Gly?Ala?Ala?Gly?Gly?Gly?Cys?Ala

385 390 395 400

Ala?Ala?Ala?Ala?Thr?Gly?Gly?Ala?Ala?Ala?Thr?Thr?Thr?Ala?Ala?Ala

405 410 415

Ala?Thr?Cys?Thr?Thr?Cys?Thr?Thr?Cys?Thr?Thr?Cys?Thr?Thr?Cys?Gly

420 425 430

Thr?Cys?Cys?Ala?Ala?Ala?Cys?Ala?Gly?Thr?Cys?Thr?Thr?Cys?Cys?Thr

435 440 445

Cys?Gly?Gly?Thr?Cys?Ala?Ala?Cys?Gly?Cys?Thr?Cys?Ala?Ala?Ala?Gly

450 455 460

Thr?Cys?Cys?Thr?Ala?Gly?Cys?Thr?Cys?Ala?Gly?Gly?Ala?Cys?Ala?Gly

465 470 475 480

Cys?Thr?Ala?Ala?Gly?Gly?Ala?Cys?Ala?Ala?Ala?Thr?Cys?Ala?Thr?Cys

485 490 495

Ala?Gly?Thr?Thr?Cys?Cys?Cys?Thr?Thr?Thr?Thr?Thr?Cys?Ala?Cys?Cys

500 505 510

Ala?Ala?Cys?Thr?Cys?Thr?Thr?Thr?Ala?Cys?Ala?Ala?Thr?Cys?Thr?Cys

515 520 525

Ala?Cys?Thr?Cys?Ala?Ala?Cys?Thr?Cys?Gly?Gly?Ala?Gly?Gly?Thr?Ala

530 535 540

Thr?Thr?Gly?Gly?Thr?Thr?Thr?Gly?Ala?Ala?Cys?Thr?Thr?Ala?Gly?Cys

545 550 555 560

Cys?Gly?Cys?Thr?Ala?Cys?Thr?Ala?Ala?Thr?Gly?Gly?Cys?Ala?Ala?Cys

565 570 575

Ala?Ala?Cys?Cys?Ala?Ala?Gly?Cys?Thr?Cys?Ala?Cys?Cys?Ala?Gly?Ala

580 585 590

Thr?Cys?Gly?Gly?Thr?Thr?Cys?Cys?Ala?Gly?Thr?Thr?Thr?Gly?Ala?Thr

595 600 605

Gly?Ala?Thr?Gly?Ala?Gly?Cys?Gly?Ala?Thr?Cys?Thr?Ala?Gly?Gly?Gly

610 615 620

Thr?Thr?Thr?Cys?Thr?Cys?Cys?Ala?Thr?Gly?Gly?Ala?Cys?Gly?Ala?Ala

625 630 635 640

Ala?Thr?Ala?Cys?Thr?Thr?Cys?Ala?Ala?Cys?Thr?Cys?Cys?Gly?Ala?Thr

645 650 655

Gly?Ala?Cys?Gly?Gly?Gly?Ala?Ala?Ala?Cys?Ala?Thr?Thr?Cys?Ala?Thr

660 665 670

Gly?Ala?Ala?Ala?Ala?Cys?Ala?Ala?Cys?Ala?Ala?Cys?Ala?Ala?Thr?Ala

675 680 685

Ala?Thr?Ala?Ala?Cys?Ala?Ala?Thr?Gly?Ala?Ala?Ala?Ala?Cys?Ala?Ala

690 695 700

Cys?Cys?Thr?Ala?Ala?Thr?Gly?Gly?Cys?Ala?Thr?Cys?Cys?Gly?Thr?Thr

705 710 715 720

Gly?Gly?Ala?Thr?Cys?Thr?Thr?Thr?Gly?Ala?Gly?Cys?Cys?Cys?Cys?Thr

725 730 735

Thr?Thr?Gly?Cys?Thr?Cys?Thr?Cys?Thr?Thr?Cys?Gly?Ala?Thr?Cys?Cys

740 745 750

Ala?Ala?Cys?Gly?Ala?Cys?Gly?Gly?Gly?Gly?Cys?Thr?Ala?Thr?Ala?Cys

755 760 765

Gly?Cys?Thr?Thr?Thr?Cys?Cys?Ala?Gly?Ala?Ala?Cys?Gly?Ala?Cys?Gly

770 775 780

Gly?Thr?Ala?Ala?Thr?Ala?Thr?Cys?Gly?Gly?Gly?Ala?Ala?Cys?Ala?Ala

785 790 795 800

Cys?Gly?Thr?Thr?Gly?Gly?Gly?Ala?Thr?Ala?Thr?Cys?Thr?Gly?Gly?Thr

805 810 815

Thr?Cys?Thr?Thr?Cys?Thr?Ala?Cys?Thr?Thr?Cys?Cys?Ala?Thr?Gly?Gly

820 825 830

Thr?Thr?Gly?Ala?Thr?Thr?Cys?Thr?Ala?Gly?Gly?Gly?Thr?Thr?Thr?Ala

835 840 845

Thr?Cys?Ala?Gly?Ala?Cys?Gly?Cys?Cys?Thr?Cys?Cys?Gly?Gly?Thr?Gly

850 855 860

Ala?Ala?Gly?Ala?Thr?Gly?Gly?Ala?Ala?Gly?Ala?Ala?Cys?Ala?Ala?Cys

865 870 875 880

Cys?Thr?Ala?Ala?Thr?Thr?Thr?Gly?Gly?Cys?Thr?Ala?Ala?Cys?Thr?Thr

885 890 895

Gly?Thr?Cys?Thr?Ala?Gly?Ala?Cys?Cys?Gly?Gly?Thr?Cys?Thr?Cys?Cys

900 905 910

Gly?Gly?Thr?Thr?Thr?Gly?Ala?Cys?Gly?Thr?Cys?Thr?Cys?Cys?Thr?Gly

915 920 925

Gly?Gly?Ala?Ala?Thr?Cys?Ala?Ala?Ala?Cys?Ala?Ala?Ala?Thr?Cys?Ala

930 935 940

Gly?Thr?Ala?Cys?Thr?Thr?Thr?Thr?Gly?Gly?Cys?Cys?Thr?Gly?Gly?Thr

945 950 955 960

Thr?Cys?Gly?Gly?Ala?Thr?Thr?Thr?Cys?Thr?Cys?Gly?Gly?Gly?Thr?Cys

965 970 975

Cys?Thr?Thr?Cys?Thr?Ala?Ala?Thr?Gly?Ala?Thr?Cys?Thr?Cys?Thr?Thr

980 985 990

Gly?Thr?Gly?Ala

995

<210>216

<211>275

<212>PRT

<213> Arabidopis thaliana

<400>216

Met?Gly?Gly?Ser?Met?Ala?Glu?Arg?Ala?Arg?Gln?Ala?Asn?Ile?Pro?Pro

1 5 10 15

Leu?Ala?Gly?Pro?Leu?Lys?Cys?Pro?Arg?Cys?Asp?Ser?Ser?Asn?Thr?Lys

20 25 30

Phe?Cys?Tyr?Tyr?Asn?Asn?Tyr?Asn?Leu?Thr?Gln?Pro?Arg?His?Phe?Cys

35 40 45

Lys?Gly?Cys?Arg?Arg?Tyr?Trp?Thr?Gln?Gly?Gly?Ala?Leu?Arg?Asn?Val

50 55 60

Pro?Val?Gly?Gly?Gly?Cys?Arg?Arg?Asn?Asn?Lys?Lys?Gly?Lys?Asn?Gly

65 70 75 80

Asn?Leu?Lys?Ser?Ser?Ser?Ser?Ser?Ser?Lys?Gln?Ser?Ser?Ser?Val?Asn

85 90 95

Ala?Gln?Ser?Pro?Ser?Ser?Gly?Gln?Leu?Arg?Thr?Asn?His?Gln?Phe?Pro

100 105 110

Phe?Ser?Pro?Thr?Leu?Tyr?Asn?Leu?Thr?Gln?Leu?Gly?Gly?Ile?Gly?Leu

115 120 125

Asn?Leu?Ala?Ala?Thr?Asn?Gly?Asn?Asn?Gln?Ala?His?Gln?Ile?Gly?Ser

130 135 140

Ser?Leu?Met?Met?Ser?Asp?Leu?Gly?Phe?Leu?His?Gly?Arg?Asn?Thr?Ser

145 150 155 160

Thr?Pro?Met?Thr?Gly?Asn?Ile?His?Glu?Asn?Asn?Asn?Asn?Asn?Asn?Asn

165 170 175

Glu?Asn?Asn?Leu?Met?Ala?Ser?Val?Gly?Ser?Leu?Ser?Pro?Phe?Ala?Leu

180 185 190

Phe?Asp?Pro?Thr?Thr?Gly?Leu?Tyr?Ala?Phe?Gln?Asn?Asp?Gly?Asn?Ile

195 200 205

Gly?Asn?Asn?Val?Gly?Ile?Ser?Gly?Ser?Ser?Thr?Ser?Met?Val?Asp?Ser

210 215 220

Arg?Val?Tyr?Gln?Thr?Pro?Pro?Val?Lys?Met?Glu?Glu?Gln?Pro?Asn?Leu

225 230 235 240

Ala?Asn?Leu?Ser?Arg?Pro?Val?Ser?Gly?Leu?Thr?Ser?Pro?Gly?Asn?Gln

245 250 255

Thr?Asn?Gln?Tyr?Phe?Trp?Pro?Gly?Ser?Asp?Phe?Ser?Gly?Pro?Ser?Asn

260 265 270

Asp?Leu?Leu

275

<210>217

<211>993

<212>DNA

<213> Arabidopis thaliana

<400>217

atggttttct?cctccatcca?agcctatctt?gattcatcca?actggcaaca?ggctcctccg 60

agcaattata?atcatgacgg?aacaggcgcc?tcagcaaatg?gaggtcatgt?tcttcgtcct 120

cagctgcagc?cacagcagca?gccacagcag?cagccgcatc?ctaatgggag?cgggggcgga 180

ggtggaggtg?gaggcggctc?gatccgagca?ggatcaatgg?tggacagagc?aagacaagca 240

aacgtagcct?tgccagaagc?agcactgaaa?tgtccgagat?gcgaatccac?caacaccaag 300

ttctgctact?tcaacaacta?cagcctcact?caaccacgcc?acttctgcaa?gacctgccgg 360

agatactgga?cacgtggcgg?agctctccgc?aacgtcccag?tcggcggtgg?ctgccggaga 420

aacaggcgta?ccaaaagcaa?cagcaacaac?aacaataaca?gcactgctac?tagcaataac 480

accagtttct?cctccgggaa?tgcatccacc?atcagcacga?ttctctcctc?ccactatgga 540

ggaaaccaag?agagtatctt?aagccagatt?ttgtctccgg?cgaggctaat?gaatcctact 600

tacaatcatc?tcggagatct?cacaagtaat?acaaaaacag?acaacaacat?gagcttgttg 660

aactatggag?gattgagtca?agacttgagg?tcaatccaca?tgggagcttc?tggtggctcg 720

cttatgagct?gtgttgatga?atggagatcg?gcgtcttatc?atcagcagtc?aagtatgggc 780

ggtgggaact?tggaggattc?ttctaatcct?aatccatccg?caaatgggtt?ttactctttt 840

gagtcgccga?ggataacttc?agcgtcaatc?tcttctgctt?tagcatcgca?gttttcttcg 900

gttaaagttg?aagataatcc?ttacaaatgg?gttaatgtca?atggtaattg?ctcttcctgg 960

aatgatcttt?ctgctttcgg?ctcttctcgt?tga 993

<210>218

<211>330

<212>PRT

<213> Arabidopis thaliana

<400>218

Met?Val?Phe?Ser?Ser?Ile?Gln?Ala?Tyr?Leu?Asp?Ser?Ser?Asn?Trp?Gln

1 5 10 15

Gln?Ala?Pro?Pro?Ser?Asn?Tyr?Asn?His?Asp?Gly?Thr?Gly?Ala?Ser?Ala

20 25 30

Asn?Gly?Gly?His?Val?Leu?Arg?Pro?Gln?Leu?Gln?Pro?Gln?Gln?Gln?Pro

35 40 45

Gln?Gln?Gln?Pro?His?Pro?Asn?Gly?Ser?Gly?Gly?Gly?Gly?Gly?Gly?Gly

50 55 60

Gly?Gly?Ser?Ile?Arg?Ala?Gly?Ser?Met?Val?Asp?Arg?Ala?Arg?Gln?Ala

65 70 75 80

Asn?Val?Ala?Leu?Pro?Glu?Ala?Ala?Leu?Lys?Cys?Pro?Arg?Cys?Glu?Ser

85 90 95

Thr?Asn?Thr?Lys?Phe?Cys?Tyr?Phe?Asn?Asn?Tyr?Ser?Leu?Thr?Gln?Pro

100 105 110

Arg?His?Phe?Cys?Lys?Thr?Cys?Arg?Arg?Tyr?Trp?Thr?Arg?Gly?Gly?Ala

115 120 125

Leu?Arg?Asn?Val?Pro?Val?Gly?Gly?Gly?Cys?Arg?Arg?Asn?Arg?Arg?Thr

130 135 140

Lys?Ser?Asn?Ser?Asn?Asn?Asn?Asn?Asn?Ser?Thr?Ala?Thr?Ser?Asn?Asn

145 150 155 160

Thr?Ser?Phe?Ser?Ser?Gly?Asn?Ala?Ser?Thr?Ile?Ser?Thr?Ile?Leu?Ser

165 170 175

Ser?His?Tyr?Gly?Gly?Asn?Gln?Glu?Ser?Ile?Leu?Ser?Gln?Ile?Leu?Ser

180 185 190

Pro?Ala?Arg?Leu?Met?Asn?Pro?Thr?Tyr?Asn?His?Leu?Gly?Asp?Leu?Thr

195 200 205

Ser?Asn?Thr?Lys?Thr?Asp?Asn?Asn?Met?Ser?Leu?Leu?Asn?Tyr?Gly?Gly

210 215 220

Leu?Ser?Gln?Asp?Leu?Arg?Ser?Ile?His?Met?Gly?Ala?Ser?Gly?Gly?Ser

225 230 235 240

Leu?Met?Ser?Cys?Val?Asp?Glu?Trp?Arg?Ser?Ala?Ser?Tyr?His?Gln?Gln

245 250 255

Ser?Ser?Met?Gly?Gly?Gly?Asn?Leu?Glu?Asp?Ser?Ser?Asn?Pro?Asn?Pro

260 265 270

Ser?Ala?Asn?Gly?Phe?Tyr?Ser?Phe?Glu?Ser?Pro?Arg?Ile?Thr?Ser?Ala

275 280 285

Ser?Ile?Ser?Ser?Ala?Leu?Ala?Ser?Gln?Phe?Ser?Ser?Val?Lys?Val?Glu

290 295 300

Asp?Asn?Pro?Tyr?Lys?Trp?Val?Asn?Val?Asn?Gly?Asn?Cys?Ser?Ser?Trp

305 310 315 320

Asn?Asp?Leu?Ser?Ala?Phe?Gly?Ser?Ser?Arg

325 330

<210>219

<211>972

<212>DNA

<213> Arabidopis thaliana

<400>219

atggttttct?catctcttcc?agtgaatcag?ttcgattccc?aaaattggca?gcagcaaggg 60

aaccaacatc?agctagaatg?tgtcacaact?gaccagaacc?ctaataatta?cttacggcag 120

ctctcatcac?caccgacttc?tcaggttgca?ggttcgagtc?aagctagagt?gaattcaatg 180

gtggaacgtg?ctcggatcgc?aaaagtccca?ttgcctgaag?cagctctaaa?ttgccctaga 240

tgtgactcaa?ccaatactaa?gttctgttac?ttcaataact?atagccttac?tcaacctcgc 300

catttctgca?aaacatgtcg?tcgctattgg?acacgtggcg?gttccttgag?gaatgttcct 360

gttggaggag?gctttaggag?gaacaagaga?agcaaatcca?gatcgaaatc?tacggtcgtg 420

gtctcgactg?ataatactac?tagtacttca?tcacttactt?ctcgcccaag?ttactcaaac 480

cctagcaagt?ttcatagcta?cggtcaaatc?ccggagttta?attccaactt?gcccatcttg 540

cctcctctcc?aaagccttgg?agattacaat?tcaagcaaca?ctggattaga?ttttggtgga 600

actcaaataa?gcaacatgat?aagtggtatg?agttctagtg?gtgggatctt?ggatgcatgg 660

agaatacctc?catcacaaca?agctcagcaa?ttccctttct?tgatcaacac?taccggattg 720

gtgcaatctt?caaacgcgtt?atatccatta?ctagaaggcg?gggttagcgc?cacgcaaaca 780

agaaatgtga?aggcggaaga?gaatgatcag?gatcggggta?gggatgggga?tggagtgaat 840

aacttatcaa?gaaacttttt?gggtaatatc?aacataaact?caggcaggaa?cgaggaatac 900

acatcatggg?gaggtaacag?ttcttggacc?ggtttcacct?ccaacaactc?aacaggccat 960

ctctcattct?aa 972

<210>220

<211>323

<212>PRT

<213> Arabidopis thaliana

<400>220

Met?Val?Phe?Ser?Ser?Leu?Pro?Val?Asn?Gln?Phe?Asp?Ser?Gln?Asn?Trp

1 5 10 15

Gln?Gln?Gln?Gly?Asn?Gln?His?Gln?Leu?Glu?Cys?Val?Thr?Thr?Asp?Gln

20 25 30

Asn?Pro?Asn?Asn?Tyr?Leu?Arg?Gln?Leu?Ser?Ser?Pro?Pro?Thr?Ser?Gln

35 40 45

Val?Ala?Gly?Ser?Ser?Gln?Ala?Arg?Val?Asn?Ser?Met?Val?Glu?Arg?Ala

50 55 60

Arg?Ile?Ala?Lys?Val?Pro?Leu?Pro?Glu?Ala?Ala?Leu?Asn?Cys?Pro?Arg

65 70 75 80

Cys?Asp?Ser?Thr?Asn?Thr?Lys?Phe?Cys?Tyr?Phe?Asn?Asn?Tyr?Ser?Leu

85 90 95

Thr?Gln?Pro?Arg?His?Phe?Cys?Lys?Thr?Cys?Arg?Arg?Tyr?Trp?Thr?Arg

100 105 110

Gly?Gly?Ser?Leu?Arg?Asn?Val?Pro?Val?Gly?Gly?Gly?Phe?Arg?Arg?Asn

115 120 125

Lys?Arg?Ser?Lys?Ser?Arg?Ser?Lys?Ser?Thr?Val?Val?Val?Ser?Thr?Asp

130 135 140

Asn?Thr?Thr?Ser?Thr?Ser?Ser?Leu?Thr?Ser?Arg?Pro?Ser?Tyr?Ser?Asn

145 150 155 160

Pro?Ser?Lys?Phe?His?Ser?Tyr?Gly?Gln?Ile?Pro?Glu?Phe?Asn?Ser?Asn

165 170 175

Leu?Pro?Ile?Leu?Pro?Pro?Leu?Gln?Ser?Leu?Gly?Asp?Tyr?Asn?Ser?Ser

180 185 190

Asn?Thr?Gly?Leu?Asp?Phe?Gly?Gly?Thr?Gln?Ile?Ser?Asn?Met?Ile?Ser

195 200 205

Gly?Met?Ser?Ser?Ser?Gly?Gly?Ile?Leu?Asp?Ala?Trp?Arg?Ile?Pro?Pro

210 215 220

Ser?Gln?Gln?Ala?Gln?Gln?Phe?Pro?Phe?Leu?Ile?Asn?Thr?Thr?Gly?Leu

225 230 235 240

Val?Gln?Ser?Ser?Asn?Ala?Leu?Tyr?Pro?Leu?Leu?Glu?Gly?Gly?Val?Ser

245 250 255

Ala?Thr?Gln?Thr?Arg?Asn?Val?Lys?Ala?Glu?Glu?Asn?Asp?Gln?Asp?Arg

260 265 270

Gly?Arg?Asp?Gly?Asp?Gly?Val?Asn?Asn?Leu?Ser?Arg?Asn?Phe?Leu?Gly

275 280 285

Asn?Ile?Asn?Ile?Asn?Ser?Gly?Arg?Asn?Glu?Glu?Tyr?Thr?Ser?Trp?Gly

290 295 300

Gly?Asn?Ser?Ser?Trp?Thr?Gly?Phe?Thr?Ser?Asn?Asn?Ser?Thr?Gly?His

305 310 315 320

Leu?Ser?Phe

<210>221

<211>1200

<212>DNA

<213> Arabidopis thaliana

<400>221

atggtttttt?cttcatttcc?tacttatcct?gatcattcat?caaactggca?acaacaacat 60

caaccaatca?caaccaccgt?tggattcacg?ggaaataaca?tcaaccaaca?gtttcttcct 120

caccatcccc?tcccaccgca?acagcaacaa?acgcctccgc?agcttcacca?caacaacggt 180

aacggcggag?tcgctgttcc?cggtggacct?ggcgggttaa?tccgaccagg?ttcgatggcg 240

gaaagagcaa?ggctagccaa?cataccatta?cctgaaacag?ccttgaagtg?tccaagatgt 300

gactcaacta?acaccaaatt?ctgttacttc?aacaactaca?gtctcactca?acctcgccac 360

ttctgcaaag?catgccgtcg?ttactggaca?cgtggcggtg?ctctaaggag?cgttcccgtc 420

ggtggcggtt?gccgtagaaa?caaaagaacc?aaaaacagca?gcggtggagg?tggcggtagc 480

accagtagcg?gtaacagcaa?gtcacaagac?agcgccacga?gcaacgacca?ataccaccac 540

cgagccatgg?ctaacaatca?gatgggacca?ccttcttcgt?catcgtctct?aagctcgttg 600

ctgtcttctt?acaacgcagg?gttaatcccc?ggacatgatc?ataacagcaa?taacaacaac 660

atacttggac?ttggatcatc?tttgcctcct?cttaagctta?tgcctccttt?agacttcaca 720

gacaacttca?ccttacaata?cggtgccgtt?tcagctcctt?cttatcatat?aggcggtgga 780

agcagtggag?gagcggcggc?tcttttaaac?ggttttgacc?agtggagatt?cccggcaaca 840

aaccaacttc?ctttaggcgg?tttagacccg?tttgatcaac?aacatcaaat?ggagcagcag 900

aatccaggtt?acggattggt?taccgggtcg?ggtcagtatc?gacctaagaa?cattttccat 960

aaccttatct?cctcttcttc?gtctgcttca?tcagctatgg?ttacagccac?cgcgtcgcaa 1020

ttagcttcag?tgaaaatgga?agatagtaac?aatcagctca?acttgtctag?acaacttttt 1080

ggagacgaac?aacagctctg?gaatattcat?ggcgctgctg?cagcatccac?cgcagctgca 1140

acaagttcgt?ggagtgaagt?ctctaataat?ttcagttctt?cttctactag?caatatataa 1200

<210>222

<211>399

<212>PRT

<213> Arabidopis thaliana

<400>222

Met?Val?Phe?Ser?Ser?Phe?Pro?Thr?Tyr?Pro?Asp?His?Ser?Ser?Asn?Trp

1 5 10 15

Gln?Gln?Gln?His?Gln?Pro?Ile?Thr?Thr?Thr?Val?Gly?Phe?Thr?Gly?Asn

20 25 30

Asn?Ile?Asn?Gln?Gln?Phe?Leu?Pro?His?His?Pro?Leu?Pro?Pro?Gln?Gln

35 40 45

Gln?Gln?Thr?Pro?Pro?Gln?Leu?His?His?Asn?Asn?Gly?Asn?Gly?Gly?Val

50 55 60

Ala?Val?Pro?Gly?Gly?Pro?Gly?Gly?Leu?Ile?Arg?Pro?Gly?Ser?Met?Ala

65 70 75 80

Glu?Arg?Ala?Arg?Leu?Ala?Asn?Ile?Pro?Leu?Pro?Glu?Thr?Ala?Leu?Lys

85 90 95

Cys?Pro?Arg?Cys?Asp?Ser?Thr?Asn?Thr?Lys?Phe?Cys?Tyr?Phe?Asn?Asn

100 105 110

Tyr?Ser?Leu?Thr?Gln?Pro?Arg?His?Phe?Cys?Lys?Ala?Cys?Arg?Arg?Tyr

115 120 125

Trp?Thr?Arg?Gly?Gly?Ala?Leu?Arg?Ser?Val?Pro?Val?Gly?Gly?Gly?Cys

130 135 140

Arg?Arg?Asn?Lys?Arg?Thr?Lys?Asn?Ser?Ser?Gly?Gly?Gly?Gly?Gly?Ser

145 150 155 160

Thr?Ser?Ser?Gly?Asn?Ser?Lys?Ser?Gln?Asp?Ser?Ala?Thr?Ser?Asn?Asp

165 170 175

Gln?Tyr?His?His?Arg?Ala?Met?Ala?Asn?Asn?Gln?Met?Gly?Pro?Pro?Ser

180 185 190

Ser?Ser?Ser?Ser?Leu?Ser?Ser?Leu?Leu?Ser?Ser?Tyr?Asn?Ala?Gly?Leu

195 200 205

Ile?Pro?Gly?His?Asp?His?Asn?Ser?Asn?Asn?Asn?Asn?Ile?Leu?Gly?Leu

210 215 220

Gly?Ser?Ser?Leu?Pro?Pro?Leu?Lys?Leu?Met?Pro?Pro?Leu?Asp?Phe?Thr

225 230 235 240

Asp?Asn?Phe?Thr?Leu?Gln?Tyr?Gly?Ala?Val?Ser?Ala?Pro?Ser?Tyr?His

245 250 255

Ile?Gly?Gly?Gly?Ser?Ser?Gly?Gly?Ala?Ala?Ala?Leu?Leu?Asn?Gly?Phe

260 265 270

Asp?Gln?Trp?Arg?Phe?Pro?Ala?Thr?Asn?Gln?Leu?Pro?Leu?Gly?Gly?Leu

275 280 285

Asp?Pro?Phe?Asp?Gln?Gln?His?Gln?Met?Glu?Gln?Gln?Asn?Pro?Gly?Tyr

290 295 300

Gly?Leu?Val?Thr?Gly?Ser?Gly?Gln?Tyr?Arg?Pro?Lys?Asn?Ile?Phe?His

305 310 315 320

Asn?Leu?Ile?Ser?Ser?Ser?Ser?Ser?Ala?Ser?Ser?Ala?Met?Val?Thr?Ala

325 330 335

Thr?Ala?Ser?Gln?Leu?Ala?Ser?Val?Lys?Met?Glu?Asp?Ser?Asn?Asn?Gln

340 345 350

Leu?Asn?Leu?Ser?Arg?Gln?Leu?Phe?Gly?Asp?Glu?Gln?Gln?Leu?Trp?Asn

355 360 365

Ile?His?Gly?Ala?Ala?Ala?Ala?Ser?Thr?Ala?Ala?Ala?Thr?Ser?Ser?Trp

370 375 380

Ser?Glu?Val?Ser?Asn?Asn?Phe?Ser?Ser?Ser?Ser?Thr?Ser?Asn?Ile

385 390 395

<210>223

<211>52

<212>DNA

<213> artificial sequence

<220>

<223> primer: prm07315

<400>223

ggggacaagt?ttgtacaaaa?aagcaggctt?aaacaatggg?tggatcgatg?gc 52

<210>224

<211>50

<212>DNA

<213> artificial sequence

<220>

<223> primer: prm07316

<400>224

ggggaccact?ttgtacaaga?aagctgggtc?gttaatgatc?cgacaaaaca 50

<210>225

<211>2193

<212>DNA

<213> rice

<400>225

aatccgaaaa?gtttctgcac?cgttttcacc?ccctaactaa?caatataggg?aacgtgtgct 60

aaatataaaa?tgagacctta?tatatgtagc?gctgataact?agaactatgc?aagaaaaact 120

catccaccta?ctttagtggc?aatcgggcta?aataaaaaag?agtcgctaca?ctagtttcgt 180

tttccttagt?aattaagtgg?gaaaatgaaa?tcattattgc?ttagaatata?cgttcacatc 240

tctgtcatga?agttaaatta?ttcgaggtag?ccataattgt?catcaaactc?ttcttgaata 300

aaaaaatctt?tctagctgaa?ctcaatgggt?aaagagagag?atttttttta?aaaaaataga 360

atgaagatat?tctgaacgta?ttggcaaaga?tttaaacata?taattatata?attttatagt 420

ttgtgcattc?gtcatatcgc?acatcattaa?ggacatgtct?tactccatcc?caatttttat 480

ttagtaatta?aagacaattg?acttattttt?attatttatc?ttttttcgat?tagatgcaag 540

gtacttacgc?acacactttg?tgctcatgtg?catgtgtgag?tgcacctcct?caatacacgt 600

tcaactagca?acacatctct?aatatcactc?gcctatttaa?tacatttagg?tagcaatatc 660

tgaattcaag?cactccacca?tcaccagacc?acttttaata?atatctaaaa?tacaaaaaat 720

aattttacag?aatagcatga?aaagtatgaa?acgaactatt?taggtttttc?acatacaaaa 780

aaaaaaagaa?ttttgctcgt?gcgcgagcgc?caatctccca?tattgggcac?acaggcaaca 840

acagagtggc?tgcccacaga?acaacccaca?aaaaacgatg?atctaacgga?ggacagcaag 900

tccgcaacaa?ccttttaaca?gcaggctttg?cggccaggag?agaggaggag?aggcaaagaa 960

aaccaagcat?cctcctcctc?ccatctataa?attcctcccc?ccttttcccc?tctctatata 1020

ggaggcatcc?aagccaagaa?gagggagagc?accaaggaca?cgcgactagc?agaagccgag 1080

cgaccgcctt?cttcgatcca?tatcttccgg?tcgagttctt?ggtcgatctc?ttccctcctc 1140

cacctcctcc?tcacagggta?tgtgcccttc?ggttgttctt?ggatttattg?ttctaggttg 1200

tgtagtacgg?gcgttgatgt?taggaaaggg?gatctgtatc?tgtgatgatt?cctgttcttg 1260

gatttgggat?agaggggttc?ttgatgttgc?atgttatcgg?ttcggtttga?ttagtagtat 1320

ggttttcaat?cgtctggaga?gctctatgga?aatgaaatgg?tttagggtac?ggaatcttgc 1380

gattttgtga?gtaccttttg?tttgaggtaa?aatcagagca?ccggtgattt?tgcttggtgt 1440

aataaaagta?cggttgtttg?gtcctcgatt?ctggtagtga?tgcttctcga?tttgacgaag 1500

ctatcctttg?tttattccct?attgaacaaa?aataatccaa?ctttgaagac?ggtcccgttg 1560

atgagattga?atgattgatt?cttaagcctg?tccaaaattt?cgcagctggc?ttgtttagat 1620

acagtagtcc?ccatcacgaa?attcatggaa?acagttataa?tcctcaggaa?caggggattc 1680

cctgttcttc?cgatttgctt?tagtcccaga?attttttttc?ccaaatatct?taaaaagtca 1740

ctttctggtt?cagttcaatg?aattgattgc?tacaaataat?gcttttatag?cgttatccta 1800

gctgtagttc?agttaatagg?taatacccct?atagtttagt?caggagaaga?acttatccga 1860

tttctgatct?ccatttttaa?ttatatgaaa?tgaactgtag?cataagcagt?attcatttgg 1920

attatttttt?ttattagctc?tcaccccttc?attattctga?gctgaaagtc?tggcatgaac 1980

tgtcctcaat?tttgttttca?aattcacatc?gattatctat?gcattatcct?cttgtatcta 2040

cctgtagaag?tttctttttg?gttattcctt?gactgcttga?ttacagaaag?aaatttatga 2100

agctgtaatc?gggatagtta?tactgcttgt?tcttatgatt?catttccttt?gtgcagttct 2160

tggtgtagct?tgccactttc?accagcaaag?ttc 2193

<210>226

<211>1344

<212>DNA

<213> Arabidopis thaliana

<220>

<221>misc_feature

<222>(196)..(196)

<223>n is a, c, g, or t

<220>

<221>misc_feature

<222>(461)..(461)

<223>n is a, c, g, or t

<400>226

atgatgatgg?agactagaga?tccagctatt?aagcttttcg?gtatgaaaat?cccttttccg 60

tcggtttttg?aatcggcagt?tacggtggag?gatgacgaag?aagatgactg?gagcggcgga 120

gatgacaaat?caccagagaa?ggtaactcca?gagttatcag?ataagaacaa?caacaactgt 180

aacgacaaca?gttttnacaa?ttcgaaaccc?gaaaccttgg?acaaagagga?agcgacatca 240

actgatcaga?tagagagtag?tgacacgcct?gaggataatc?agcagacgac?acctgatggt 300

aaaaccctaa?agaaaccgac?taagattcta?ccgtgtccga?gatgcaaaag?catggagacc 360

aagttctgtt?attacaacaa?ctacaacata?aaccagcctc?gtcatttctg?caaggcttgt 420

cagagatatt?ggactgctgg?agggactatg?aggaatgttc?ntgtgggggc?aggacgtcgt 480

aagaacaaaa?gcttatcttc?tcattaccgt?cacatcacta?tttccgaggc?tcttgaggct 540

gcgaggcttg?acccgggctt?acaggcaaac?acaagggtct?tgagttttgg?tctcgaagct 600

cagcagcagc?acgttgctgc?tcccatgaca?cctgtgatga?agctacaaga?agatcaaaag 660

gtctcaaacg?gtgctaggaa?caggtttcac?gggttagcgg?atcaacggct?tgtagctcgg 720

gtagagaatg?gagatgattg?ctcaagcgga?tcctctgtga?ccacctctaa?caatcactca 780

gtggatgaat?caagagcaca?aagcggcagt?gttgttgaag?cacaaatgaa?caacaacaac 840

aataacatga?atggttatgc?ttgcatccca?ggtgttccat?ggccttacac?gtggaatcca 900

gcgatgcctc?caccaggttt?ttacccgcct?ccagggtatc?caatgccgtt?ttacccttac 960

tggaccatcc?caatgctacc?accgcatcaa?tcctcatcgc?ctataagcca?aaagtgttca 1020

aatacaaact?ctccgactct?cggaaagcat?ccgagagatg?aaggatcatc?gaaaaaggac 1080

aacgagacag?agcgaaaaca?gaaggccggg?tgcgttctgg?tcccgaaaac?gttgagaata 1140

gatgatccta?acgaagcagc?aaagagctcg?atatggacaa?cattgggaat?caagaacgag 1200

gcgatgtgca?aagccggtgg?tatgttcaaa?gggtttgatc?ataagacaaa?gatgtataac 1260

aacgacaaag?ctgagaactc?ccctgttctt?tctgctaacc?ctgctgctct?atcaagatca 1320

cacaatttcc?atgaacagat?ttag 1344

<210>227

<211>447

<212>PRT

<213> Arabidopis thaliana

<220>

<221> is uncertain

<222>(66)..(66)

<223>Xaa can be any natural amino acid

<220>

<221> is uncertain

<222>(154)..(154)

<223>Xaa can be any natural amino acid

<400>227

Met?Met?Met?Glu?Thr?Arg?Asp?Pro?Ala?Ile?Lys?Leu?Phe?Gly?Met?Lys

1 5 10 15

Ile?Pro?Phe?Pro?Ser?Val?Phe?Glu?Ser?Ala?Val?Thr?Val?Glu?Asp?Asp

20 25 30

Glu?Glu?Asp?Asp?Trp?Ser?Gly?Gly?Asp?Asp?Lys?Ser?Pro?Glu?Lys?Val

35 40 45

Thr?Pro?Glu?Leu?Ser?Asp?Lys?Asn?Asn?Asn?Asn?Cys?Asn?Asp?Asn?Ser

50 55 60

Phe?Xaa?Asn?Ser?Lys?Pro?Glu?Thr?Leu?Asp?Lys?Glu?Glu?Ala?Thr?Ser

65 70 75 80

Thr?Asp?Gln?Ile?Glu?Ser?Ser?Asp?Thr?Pro?Glu?Asp?Asn?Gln?Gln?Thr

85 90 95

Thr?Pro?Asp?Gly?Lys?Thr?Leu?Lys?Lys?Pro?Thr?Lys?Ile?Leu?Pro?Cys

100 105 110

Pro?Arg?Cys?Lys?Ser?Met?Glu?Thr?Lys?Phe?Cys?Tyr?Tyr?Asn?Asn?Tyr

115 120 125

Asn?Ile?Asn?Gln?Pro?Arg?His?Phe?Cys?Lys?Ala?Cys?Gln?Arg?Tyr?Trp

130 135 140

Thr?Ala?Gly?Gly?Thr?Met?Arg?Asn?Val?Xaa?Val?Gly?Ala?Gly?Arg?Arg

145 150 155 160

Lys?Asn?Lys?Ser?Leu?Ser?Ser?His?Tyr?Arg?His?Ile?Thr?Ile?Ser?Glu

165 170 175

Ala?Leu?Glu?Ala?Ala?Arg?Leu?Asp?Pro?Gly?Leu?Gln?Ala?Asn?Thr?Arg

180 185 190

Val?Leu?Ser?Phe?Gly?Leu?Glu?Ala?Gln?Gln?Gln?His?Val?Ala?Ala?Pro

195 200 205

Met?Thr?Pro?Val?Met?Lys?Leu?Gln?Glu?Asp?Gln?Lys?Val?Ser?Asn?Gly

210 215 220

Ala?Arg?Asn?Arg?Phe?His?Gly?Leu?Ala?Asp?Gln?Arg?Leu?Val?Ala?Arg

225 230 235 240

Val?Glu?Asn?Gly?Asp?Asp?Cys?Ser?Ser?Gly?Ser?Ser?Val?Thr?Thr?Ser

245 250 255

Asn?Asn?His?Ser?Val?Asp?Glu?Ser?Arg?Ala?Gln?Ser?Gly?Ser?Val?Val

260 265 270

Glu?Ala?Gln?Met?Asn?Asn?Asn?Asn?Asn?Asn?Met?Asn?Gly?Tyr?Ala?Cys

275 280 285

Ile?Pro?Gly?Val?Pro?Trp?Pro?Tyr?Thr?Trp?Asn?Pro?Ala?Met?Pro?Pro

290 295 300

Pro?Gly?Phe?Tyr?Pro?Pro?Pro?Gly?Tyr?Pro?Met?Pro?Phe?Tyr?Pro?Tyr

305 310 315 320

Trp?Thr?Ile?Pro?Met?Leu?Pro?Pro?His?Gln?Ser?Ser?Ser?Pro?Ile?Ser

325 330 335

Gln?Lys?Cys?Ser?Asn?Thr?Asn?Ser?Pro?Thr?Leu?Gly?Lys?His?Pro?Arg

340 345 350

Asp?Glu?Gly?Ser?Ser?Lys?Lys?Asp?Asn?Glu?Thr?Glu?Arg?Lys?Gln?Lys

355 360 365

Ala?Gly?Cys?Val?Leu?Val?Pro?Lys?Thr?Leu?Arg?Ile?Asp?Asp?Pro?Asn

370 375 380

Glu?Ala?Ala?Lys?Ser?Ser?Ile?Trp?Thr?Thr?Leu?Gly?Ile?Lys?Asn?Glu

385 390 395 400

Ala?Met?Cys?Lys?Ala?Gly?Gly?Met?Phe?Lys?Gly?Phe?Asp?His?Lys?Thr

405 410 415

Lys?Met?Tyr?Asn?Asn?Asp?Lys?Ala?Glu?Asn?Ser?Pro?Val?Leu?Ser?Ala

420 425 430

Asn?Pro?Ala?Ala?Leu?Ser?Arg?Ser?His?Asn?Phe?His?Glu?Gln?Ile

435 440 445

<210>228

<211>63

<212>PRT

<213> artificial sequence

<220>

<223>DOF structural domain

<220>

<221> is uncertain

<222>(50)..(50)

<223>Xaa can be any natural amino acid

<400>228

Lys?Pro?Thr?Lys?Ile?Leu?Pro?Cys?Pro?Arg?Cys?Lys?Ser?Met?Glu?Thr

1 5 10 15

Lys?Phe?Cys?Tyr?Tyr?Asn?Asn?Tyr?Asn?Ile?Asn?Gln?Pro?Arg?His?Phe

20 25 30

Cys?Lys?Ala?Cys?Gln?Arg?Tyr?Trp?Thr?Ala?Gly?Gly?Thr?Met?Arg?Asn

35 40 45

Val?Xaa?Val?Gly?Ala?Gly?Arg?Arg?Lys?Asn?Lys?Ser?Leu?Ser?Ser

50 55 60

<210>229

<211>11

<212>PRT

<213> artificial sequence

<220>

<223> primitive 1

<400>229

Lys?Ala?Leu?Lys?Lys?Pro?Asp?Lys?Ile?Leu?Pro

1 5 10

<210>230

<211>14

<212>PRT

<213> artificial sequence

<220>

<223> primitive 2

<400>230

Asp?Asp?Pro?Gly?Ile?Lys?Leu?Phe?Gly?Lys?Thr?Ile?Pro?Phe

1 5 10

<210>231

<211>11

<212>PRT

<213> artificial sequence

<220>

<223> primitive 3

<400>231

Ser?Pro?Thr?Leu?Gly?Lys?His?Ser?Arg?Asp?Glu

1 5 10

<210>232

<211>16

<212>PRT

<213> artificial sequence

<220>

<223> primitive 4

<400>232

Leu?Gln?Ala?Asn?Pro?Ala?Ala?Leu?Ser?Arg?Ser?Gln?Asn?Phe?Gln?Glu

1 5 10 15

<210>233

<211>32

<212>PRT

<213> artificial sequence

<220>

<223> primitive 5

<400>233

Lys?Gly?Glu?Gly?Cys?Leu?Trp?Val?Pro?Lys?Thr?Leu?Arg?Ile?Asp?Asp

1 5 10 15

Pro?Asp?Glu?Ala?Ala?Lys?Ser?Ser?Ile?Trp?Thr?Thr?Leu?Gly?Ile?Lys

20 25 30

<210>234

<211>1263

<212>DNA

<213> rice

<400>234

atgaacaacg?ttgaagagaa?agcagcatca?gactcaaaag?atgaaaatga?aaagacagca 60

aatgatgaat?caggccagga?caaagtactt?aagaagccag?ataagattct?cccttgccct 120

cggtgcaaca?gtatggacac?aaagttttgt?tattacaaca?actacaatgt?taatcaaccc 180

aggcacttct?gtaagaactg?ccaaaggtat?tggactgccg?ggggaaccat?gagaaatgta 240

cctgttggtg?ctgggaggcg?caaaagcaag?agctcatcgt?tgcactaccg?tcacttactg 300

atggcccctg?attgcatgat?ggggtctaga?gtggaaatat?ccaagtcaat?gaaccctgaa 360

gctttcgcat?ctgcgcattc?gacccctata?caaccaattg?gcagaaacga?aacagttctc 420

aaatttgggc?ctgaggtgcc?actctgtgaa?tcgatggcat?cagtgctgaa?cattcaggag 480

cagaatggaa?ccaatgctgc?agcagtacca?acgggtgaaa?atcaggaaga?taactcttgc 540

atctcttcaa?tcacatcaca?caacgtgtta?cctgaaaatg?cagcccaagt?tgacaagaac 600

agcacgccgg?tgtattgcaa?cggagtcggc?ccagtgccgc?agtactacct?tggagctcct 660

tacatgtacc?catggaacat?aggatggaac?aacgttccta?tgatggtgcc?aggtacaagc 720

atgccagagt?ctgcttccca?atctgagagc?tgcagcacca?gttcagctcc?atggatgaac 780

atgaactccc?ccatgatgcc?ggttgcctcg?aggctttctg?caccaccatt?tccataccct 840

ctagtgccac?ctgcactatg?gggttgctta?tccagctggc?cggccacggc?atggaacata 900

ccgtggatca?gaacgaatgg?cggctgcatg?tctccatcgt?cgtcgagcaa?cagcagctgt 960

tcaggcaatg?gctcccctct?ggggaagcat?tccagggact?cctctctccc?actgaaggag 1020

gacaaggagg?agaaatcact?gtgggttccc?aagacgctcc?gcatcgacga?tcccgacgag 1080

gcggcgaaga?gctccatctg?ggccaccctg?gggatcaagc?ctggagaccc?tggcatcttc 1140

aagccgttcc?agtccaaagg?tgagagcaaa?ggccaagcag?catcagagac?tcgtcctgct 1200

cgtgctctta?aggcaaaccc?agctgcattg?tcgcggtcgc?agtcgttcca?ggagacttct 1260

tga 1263

<210>235

<211>420

<212>PRT

<213> rice

<400>235

Met?Asn?Asn?Val?Glu?Glu?Lys?Ala?Ala?Ser?Asp?Ser?Lys?Asp?Glu?Asn

1 5 10 15

Glu?Lys?Thr?Ala?Asn?Asp?Glu?Ser?Gly?Gln?Asp?Lys?Val?Leu?Lys?Lys

20 25 30

Pro?Asp?Lys?Ile?Leu?Pro?Cys?Pro?Arg?Cys?Asn?Ser?Met?Asp?Thr?Lys

35 40 45

Phe?Cys?Tyr?Tyr?Asn?Asn?Tyr?Asn?Val?Asn?Gln?Pro?Arg?His?Phe?Cys

50 55 60

Lys?Asn?Cys?Gln?Arg?Tyr?Trp?Thr?Ala?Gly?Gly?Thr?Met?Arg?Asn?Val

65 70 75 80

Pro?Val?Gly?Ala?Gly?Arg?Arg?Lys?Ser?Lys?Ser?Ser?Ser?Leu?His?Tyr

85 90 95

Arg?His?Leu?Leu?Met?Ala?Pro?Asp?Cys?Met?Met?Gly?Ser?Arg?Val?Glu

100 105 110

Ile?Ser?Lys?Ser?Met?Asn?Pro?Glu?Ala?Phe?Ala?Ser?Ala?His?Ser?Thr

115 120 125

Pro?Ile?Gln?Pro?Ile?Gly?Arg?Asn?Glu?Thr?Val?Leu?Lys?Phe?Gly?Pro

130 135 140

Glu?Val?Pro?Leu?Cys?Glu?Ser?Met?Ala?Ser?Val?Leu?Asn?Ile?Gln?Glu

145 150 155 160

Gln?Asn?Gly?Thr?Asn?Ala?Ala?Ala?Val?Pro?Thr?Gly?Glu?Asn?Gln?Glu

165 170 175

Asp?Asn?Ser?Cys?Ile?Ser?Ser?Ile?Thr?Ser?His?Asn?Val?Leu?Pro?Glu

180 185 190

Asn?Ala?Ala?Gln?Val?Asp?Lys?Asn?Ser?Thr?Pro?Val?Tyr?Cys?Asn?Gly

195 200 205

Val?Gly?Pro?Val?Pro?Gln?Tyr?Tyr?Leu?Gly?Ala?Pro?Tyr?Met?Tyr?Pro

210 215 220

Trp?Asn?Ile?Gly?Trp?Asn?Asn?Val?Pro?Met?Met?Val?Pro?Gly?Thr?Ser

225 230 235 240

Met?Pro?Glu?Ser?Ala?Ser?Gln?Ser?Glu?Ser?Cys?Ser?Thr?Ser?Ser?Ala

245 250 255

Pro?Trp?Met?Asn?Met?Asn?Ser?Pro?Met?Met?Pro?Val?Ala?Ser?Arg?Leu

260 265 270

Ser?Ala?Pro?Pro?Phe?Pro?Tyr?Pro?Leu?Val?Pro?Pro?Ala?Leu?Trp?Gly

275 280 285

Cys?Leu?Ser?Ser?Trp?Pro?Ala?Thr?Ala?Trp?Asn?Ile?Pro?Trp?Ile?Arg

290 295 300

Thr?Asn?Gly?Gly?Cys?Met?Ser?Pro?Ser?Ser?Ser?Ser?Asn?Ser?Ser?Cys

305 310 315 320

Ser?Gly?Asn?Gly?Ser?Pro?Leu?Gly?Lys?His?Ser?Arg?Asp?Ser?Ser?Leu

325 330 335

Pro?Leu?Lys?Glu?Asp?Lys?Glu?Glu?Lys?Ser?Leu?Trp?Val?Pro?Lys?Thr

340 345 350

Leu?Arg?Ile?Asp?Asp?Pro?Asp?Glu?Ala?Ala?Lys?Ser?Ser?Ile?Trp?Ala

355 360 365

Thr?Leu?Gly?Ile?Lys?Pro?Gly?Asp?Pro?Gly?Ile?Phe?Lys?Pro?Phe?Gln

370 375 380

Ser?Lys?Gly?Glu?Ser?Lys?Gly?Gln?Ala?Ala?Ser?Glu?Thr?Arg?Pro?Ala

385 390 395 400

Arg?Ala?Leu?Lys?Ala?Asn?Pro?Ala?Ala?Leu?Ser?Arg?Ser?Gln?Ser?Phe

405 410 415

Gln?Glu?Thr?Ser

420

<210>236

<211>1365

<212>DNA

<213> rice

<400>236

atgcctaatt?taggaaatgg?tgtaaaaacc?aataatgact?tacctttagt?ctcagacaag 60

cttttgattg?tcaaaggtat?tcctttttgt?cccaacaata?gtaagaaaaa?tgatttacaa 120

ggcatcagca?gaccggatgg?aagaatagaa?atcgattcca?tgactgagga?tgttaagact 180

gagcctgatg?gatctgtccc?tgagaagata?ctcaagaagc?cagataagat?tctgccatgt 240

ccacgctgca?atagcatgga?aacaaagttc?tgctacttca?acaactacaa?tgttcaccag 300

cccaggcact?tctgcaggaa?ctgccaaaga?tattggaccg?ctggtggagc?tatgaggaat 360

gtcccagttg?gtgctggaag?acgcagaaat?aagcatgtgt?caaaatactg?tcaggcgatg 420

atgacgtgca?ataatactgt?agctcctgga?gatgtttctg?atgtggttca?ccatcaggtt 480

attacacatg?gatcttctct?ccttccagca?acactgaagg?aaaatgaaac?acctacagaa 540

ttcatatcag?aagtaccacc?atgtaagtct?tcagcttcaa?tccttgatat?tggagagccg 600

aatgatactg?accttgttcc?cttggcctct?ggtgataaca?aggaagaaaa?atcatgtgca 660

tcttctgtgg?tagtatccag?ctgttcagag?aatctgatgc?cagataatgc?aattatgaaa 720

gagccaaaca?acaggtcagg?atgttgtaat?ggtgtggcat?tgcctttccc?tactggacct 780

gctttggtgc?tcccctggag?tcttggatgg?aacagtgttg?ctctcatgcc?agctacccag 840

tgctcgatgc?agcccgttct?tgggttaaaa?gatgggatac?cctgcccgcc?ttcatggcca 900

ccgcaactga?tggtgccggc?cccaggaatc?tgtactcctg?ttgttccaat?ccctcttgtg 960

ccacctctgt?ggagctgctt?ccctggctgg?cctaatggaa?tgtggaatgc?acaatgccct 1020

ggaggtaata?ctactgtgct?gccgtcaacc?gctccaaaca?aaatttcttg?ttcaggaagc 1080

agttctctgg?tgttgggaaa?gcattcaaga?gaagaaagct?tgcaggaaga?agagaagacg 1140

agaaattact?tatgggtacc?taaaactctt?aggattgatg?atccagctga?ggctgcaaag 1200

agttcaatct?gggcgaccct?tggcatcaag?cctgacgata?aaggcatatt?caagtctttc 1260

cagccaaatg?ttgcgaaaaa?tggcacggca?ccagaatcgc?ctcaggctct?gcaggccaat 1320

ccagcagcat?tttcgcgttc?tcaatcgttt?caagagacga?cttga 1365

<210>237

<211>454

<212>PRT

<213> rice

<400>237

Met?Pro?Asn?Leu?Gly?Asn?Gly?Val?Lys?Thr?Asn?Asn?Asp?Leu?Pro?Leu

1 5 10 15

Val?Ser?Asp?Lys?Leu?Leu?Ile?Val?Lys?Gly?Ile?Pro?Phe?Cys?Pro?Asn

20 25 30

Asn?Ser?Lys?Lys?Asn?Asp?Leu?Gln?Gly?Ile?Ser?Arg?Pro?Asp?Gly?Arg

35 40 45

Ile?Glu?Ile?Asp?Ser?Met?Thr?Glu?Asp?Val?Lys?Thr?Glu?Pro?Asp?Gly

50 55 60

Ser?Val?Pro?Glu?Lys?Ile?Leu?Lys?Lys?Pro?Asp?Lys?Ile?Leu?Pro?Cys

65 70 75 80

Pro?Arg?Cys?Asn?Ser?Met?Glu?Thr?Lys?Phe?Cys?Tyr?Phe?Asn?Asn?Tyr

85 90 95

Asn?Val?His?Gln?Pro?Arg?His?Phe?Cys?Arg?Asn?Cys?Gln?Arg?Tyr?Trp

100 105 110

Thr?Ala?Gly?Gly?Ala?Met?Arg?Asn?Val?Pro?Val?Gly?Ala?Gly?Arg?Arg

115 120 125

Arg?Asn?Lys?His?Val?Ser?Lys?Tyr?Cys?Gln?Ala?Met?Met?Thr?Cys?Asn

130 135 140

Asn?Thr?Val?Ala?Pro?Gly?Asp?Val?Ser?Asp?Val?Val?His?His?Gln?Val

145 150 155 160

Ile?Thr?His?Gly?Ser?Ser?Leu?Leu?Pro?Ala?Thr?Leu?Lys?Glu?Asn?Glu

165 170 175

Thr?Pro?Thr?Glu?Phe?Ile?Ser?Glu?Val?Pro?Pro?Cys?Lys?Ser?Ser?Ala

180 185 190

Ser?Ile?Leu?Asp?Ile?Gly?Glu?Pro?Asn?Asp?Thr?Asp?Leu?Val?Pro?Leu

195 200 205

Ala?Ser?Gly?Asp?Asn?Lys?Glu?Glu?Lys?Ser?Cys?Ala?Ser?Ser?Val?Val

210 215 220

Val?Ser?Ser?Cys?Ser?Glu?Asn?Leu?Met?Pro?Asp?Asn?Ala?Ile?Met?Lys

225 230 235 240

Glu?Pro?Asn?Asn?Arg?Ser?Gly?Cys?Cys?Asn?Gly?Val?Ala?Leu?Pro?Phe

245 250 255

Pro?Thr?Gly?Pro?Ala?Leu?Val?Leu?Pro?Trp?Ser?Leu?Gly?Trp?Asn?Ser

260 265 270

Val?Ala?Leu?Met?Pro?Ala?Thr?Gln?Cys?Ser?Met?Gln?Pro?Val?Leu?Gly

275 280 285

Leu?Lys?Asp?Gly?Ile?Pro?Cys?Pro?Pro?Ser?Trp?Pro?Pro?Gln?Leu?Met

290 295 300

Val?Pro?Ala?Pro?Gly?Ile?Cys?Thr?Pro?Val?Val?Pro?Ile?Pro?Leu?Val

305 310 315 320

Pro?Pro?Leu?Trp?Ser?Cys?Phe?Pro?Gly?Trp?Pro?Asn?Gly?Met?Trp?Asn

325 330 335

Ala?Gln?Cys?Pro?Gly?Gly?Asn?Thr?Thr?Val?Leu?Pro?Ser?Thr?Ala?Pro

340 345 350

Asn?Lys?Ile?Ser?Cys?Ser?Gly?Ser?Ser?Ser?Leu?Val?Leu?Gly?Lys?His

355 360 365

Ser?Arg?Glu?Glu?Ser?Leu?Gln?Glu?Glu?Glu?Lys?Thr?Arg?Asn?Tyr?Leu

370 375 380

Trp?Val?Pro?Lys?Thr?Leu?Arg?Ile?Asp?Asp?Pro?Ala?Glu?Ala?Ala?Lys

385 390 395 400

Ser?Ser?Ile?Trp?Ala?Thr?Leu?Gly?Ile?Lys?Pro?Asp?Asp?Lys?Gly?Ile

405 410 415

Phe?Lys?Ser?Phe?Gln?Pro?Asn?Val?Ala?Lys?Asn?Gly?Thr?Ala?Pro?Glu

420 425 430

Ser?Pro?Gln?Ala?Leu?Gln?Ala?Asn?Pro?Ala?Ala?Phe?Ser?Arg?Ser?Gln

435 440 445

Ser?Phe?Gln?Glu?Thr?Thr

450

<210>238

<211>1461

<212>DNA

<213> rice

<400>238

atgggagggg?gtggtaagtg?caaaagaggg?aaaagaggaa?agattgcagc?caagcgaaga 60

aggggccagt?gttgcagcag?cagcagcagc?agcggaggcg?caagaagacg?agctagagag 120

agagaatcag?aggagagctt?gggtgagatg?ggtgagtgca?gaggaggagg?aggaggagga 180

gatgggctga?tcaagctgtt?cgggaagacg?atcccggtgc?agccggatgc?caaggatgtt 240

cagcagcata?gtggcagtag?cagcagctca?accgaatccg?acgtccaaga?aaccgccgct 300

gtcgccgtcg?ccgacccctc?cccgcggtcg?gaggtcgtcg?acggcgagag?cccgccgcag 360

ccgggcggcg?aggcggcgag?ccatcagcag?cagcagaagg?agatgaagct?gaagaagccg 420

gacaagatcc?tgccatgccc?gcggtgcagc?agcatggaca?ccaagttctg?ctacttcaac 480

aactacaacg?tcaaccagcc?tcgccacttc?tgcaagcact?gccagcgcta?ctggaccgcc 540

ggcggcgcca?tgcgcaacgt?ccccgtcggc?gccggccgcc?gcaagaacaa?gaacgccacc 600

gccgccgccc?acttcctcca?ccgcgtccgc?gcctgcgccg?ccgccgccgc?catgcccgcg 660

gcgccccacg?acgccaccaa?cgccaccgtg?ctcagcttcg?gcggcggcgg?aggcggacac 720

gacgcgccgc?cggtcaccct?ggacctcgcc?gacaagatga?cgcgcctcgg?caaggagggg 780

ctcgtcgccc?atgcccggaa?cgccgacgcc?gccgccgcgt?gcagcgaggt?gtcgagcaac 840

agggacgacg?agcagatcgg?caacactgta?gcaaaacctg?caaacgggtt?gcagcagcat 900

cctcctcctc?ctcatcatca?tcatcattca?gccatgaacg?gtggcggcat?ctggccctac 960

tacacctcgg?ggatcgcgat?cccgatatac?ccggcggcgc?cggcgtactg?gggctgcatg 1020

attccacctc?ctggagcttg?gagcctccca?tggccggcca?cagtccagtc?tcaggccatc 1080

tcatcatcat?caccacctac?aagtgctaca?ccttcagtct?cctccttcac?actaggcaag 1140

catcccagag?agggtggtga?tcatgaggca?agagatcacc?atggcaatgg?taaagtgtgg 1200

gtgccgaaga?cgatccggat?cgacaacgcc?gacgaggttg?cccggagctc?aatccggtca 1260

ctcttcgcct?tcagaggcgg?cgacaaggcg?gatgataaca?acgacgacga?tggcaccggc 1320

gtgcacaagc?tcgccaccac?ggtgttcgag?ccaaagaggg?acagcaagac?ggcgaaacat 1380

ccggcgatca?cgagcttgcc?gctcttgcac?accaaccccg?tcgcgcttac?ccgatccgcg 1440

accttccagg?agggatcttg?a 1461

<210>239

<211>486

<212>PRT

<213> rice

<400>239

Met?Gly?Gly?Gly?Gly?Lys?Cys?Lys?Arg?Gly?Lys?Arg?Gly?Lys?Ile?Ala

1 5 10 15

Ala?Lys?Arg?Arg?Arg?Gly?Gln?Cys?Cys?Ser?Ser?Ser?Ser?Ser?Ser?Gly

20 25 30

Gly?Ala?Arg?Arg?Arg?Ala?Arg?Glu?Arg?Glu?Ser?Glu?Glu?Ser?Leu?Gly

35 40 45

Glu?Met?Gly?Glu?Cys?Arg?Gly?Gly?Gly?Gly?Gly?Gly?Asp?Gly?Leu?Ile

50 55 60

Lys?Leu?Phe?Gly?Lys?Thr?Ile?Pro?Val?Gln?Pro?Asp?Ala?Lys?Asp?Val

65 70 75 80

Gln?Gln?His?Ser?Gly?Ser?Ser?Ser?Ser?Ser?Thr?Glu?Ser?Asp?Val?Gln

85 90 95

Glu?Thr?Ala?Ala?Val?Ala?Val?Ala?Asp?Pro?Ser?Pro?Arg?Ser?Glu?Val

100 105 110

Val?Asp?Gly?Glu?Ser?Pro?Pro?Gln?Pro?Gly?Gly?Glu?Ala?Ala?Ser?His

115 120 125

Gln?Gln?Gln?Gln?Lys?Glu?Met?Lys?Leu?Lys?Lys?Pro?Asp?Lys?Ile?Leu

130 135 140

Pro?Cys?Pro?Arg?Cys?Ser?Ser?Met?Asp?Thr?Lys?Phe?Cys?Tyr?Phe?Asn

145 150 155 160

Asn?Tyr?Asn?Val?Asn?Gln?Pro?Arg?His?Phe?Cys?Lys?His?Cys?Gln?Arg

165 170 175

Tyr?Trp?Thr?Ala?Gly?Gly?Ala?Met?Arg?Asn?Val?Pro?Val?Gly?Ala?Gly

180 185 190

Arg?Arg?Lys?Asn?Lys?Asn?Ala?Thr?Ala?Ala?Ala?His?Phe?Leu?His?Arg

195 200 205

Val?Arg?Ala?Cys?Ala?Ala?Ala?Ala?Ala?Met?Pro?Ala?Ala?Pro?His?Asp

210 215 220

Ala?Thr?Asn?Ala?Thr?Val?Leu?Ser?Phe?Gly?Gly?Gly?Gly?Gly?Gly?His

225 230 235 240

Asp?Ala?Pro?Pro?Val?Thr?Leu?Asp?Leu?Ala?Asp?Lys?Met?Thr?Arg?Leu

245 250 255

Gly?Lys?Glu?Gly?Leu?Val?Ala?His?Ala?Arg?Asn?Ala?Asp?Ala?Ala?Ala

260 265 270

Ala?Cys?Ser?Glu?Val?Ser?Ser?Asn?Arg?Asp?Asp?Glu?Gln?Ile?Gly?Asn

275 280 285

Thr?Val?Ala?Lys?Pro?Ala?Asn?Gly?Leu?Gln?Gln?His?Pro?Pro?Pro?Pro

290 295 300

His?His?His?His?His?Ser?Ala?Met?Asn?Gly?Gly?Gly?Ile?Trp?Pro?Tyr

305 310 315 320

Tyr?Thr?Ser?Gly?Ile?Ala?Ile?Pro?Ile?Tyr?Pro?Ala?Ala?Pro?Ala?Tyr

325 330 335

Trp?Gly?Cys?Met?Ile?Pro?Pro?Pro?Gly?Ala?Trp?Ser?Leu?Pro?Trp?Pro

340 345 350

Ala?Thr?Val?Gln?Ser?Gln?Ala?Ile?Ser?Ser?Ser?Ser?Pro?Pro?Thr?Ser

355 360 365

Ala?Thr?Pro?Ser?Val?Ser?Ser?Phe?Thr?Leu?Gly?Lys?His?Pro?Arg?Glu

370 375 380

Gly?Gly?Asp?His?Glu?Ala?Arg?Asp?His?His?Gly?Asn?Gly?Lys?Val?Trp

385 390 395 400

Val?Pro?Lys?Thr?Ile?Arg?Ile?Asp?Asn?Ala?Asp?Glu?Val?Ala?Arg?Ser

405 410 415

Ser?Ile?Arg?Ser?Leu?Phe?Ala?Phe?Arg?Gly?Gly?Asp?Lys?Ala?Asp?Asp

420 425 430

Asn?Asn?Asp?Asp?Asp?Gly?Thr?Gly?Val?His?Lys?Leu?Ala?Thr?Thr?Val

435 440 445

Phe?Glu?Pro?Lys?Arg?Asp?Ser?Lys?Thr?Ala?Lys?His?Pro?Ala?Ile?Thr

450 455 460

Ser?Leu?Pro?Leu?Leu?His?Thr?Asn?Pro?Val?Ala?Leu?Thr?Arg?Ser?Ala

465 470 475 480

Thr?Phe?Gln?Glu?Gly?Ser

485

<210>240

<211>1461

<212>DNA

<213> rice

<400>240

atgggagggg?gtggtaagtg?caaaagaggg?aaaagaggaa?agattgcagc?caagcgaaga 60

aggggccagt?gttgcagcag?cagcagcagc?agcggaggcg?caagaagacg?agctagagag 120

agagaatcag?aggagagctt?gggtgagatg?ggtgagtgca?gaggaggagg?aggaggagga 180

gatgggctga?tcaagctgtt?cgggaagacg?atcccggtgc?agccggatgc?caaggatgtt 240

cagcagcata?gtggcagtag?cagcagctca?accgaatccg?acgtccaaga?aaccgccgct 300

gtcgccgtcg?ccgacccctc?cccgcggtcg?gaggtcgtcg?acggcgagag?cccgccgcag 360

ccgggcggcg?aggcggcgag?ccatcagcag?cagcagaagg?agatgaagct?gaagaagccg 420

gacaagatcc?tgccatgccc?gcggtgcagc?agcatggaca?ccaagttctg?ctacttcaac 480

aactacaacg?tcaaccagcc?tcgccacttc?tgcaagcact?gccagcgcta?ctggaccgcc 540

ggcggcgcca?tgcgcaacgt?ccccgtcggc?gccggccgcc?gcaagaacaa?gaacgccacc 600

gccgccgccc?acttcctcca?ccgcgtccgc?gcctgcgccg?ccgccgccgc?catgcccgcg 660

gcgccccacg?acgccaccaa?cgccaccgtg?ctcagcttcg?gcggcggcgg?aggcggacac 720

gacgcgccgc?cggtcaccct?ggacctcgcc?gacaagatga?cgcgcctcgg?caaggagggg 780

ctcgtcgccc?atgcccggaa?cgccgacgcc?gccgccgcgt?gcagcgaggt?gtcgagcaac 840

agggacgacg?agcagatcgg?caacactgta?gcaaaacctg?caaacgggtt?gcagcagcat 900

cctcctcctc?ctcatcatca?tcatcattca?gccatgaacg?gtggcggcat?ctggccctac 960

tacacctcgg?ggatcgcgat?cccgatatac?ccggcggcgc?cggcgtactg?gggctgcatg 1020

attccacctc?ctggagcttg?gagcctccca?tggccggcca?cagtccagtc?tcaggccatc 1080

tcatcatcat?caccacctac?aagtgctaca?ccttcagtct?cctccttcac?actaggcaag 1140

catcccagag?agggtggtga?tcatgaggca?agagatcacc?atggcaatgg?taaagtgtgg 1200

gtgccgaaga?cgatccggat?cgacaacgcc?gacgaggttg?cccggagctc?aatccggtca 1260

ctcttcgcct?tcagaggcgg?cgacaaggcg?gatgataaca?acgacgacga?tggcaccggc 1320

gtgcacaagc?tcgccaccac?ggtgttcgag?ccaaagaggg?acagcaagac?ggcgaaacat 1380

ccggcgatca?cgagcttgcc?gctcttgcac?accaaccccg?tcgcgcttac?ccgatccgcg 1440

accttccagg?agggatcttg?a 1461

<210>241

<211>440

<212>PRT

<213> rice

<400>241

Met?Gly?Glu?Cys?Lys?Val?Gly?Gly?Gly?Gly?Gly?Gly?Gly?Asp?Cys?Leu

1 5 10 15

Ile?Lys?Leu?Phe?Gly?Lys?Thr?Ile?Pro?Val?Pro?Glu?Pro?Gly?Ala?Cys

20 25 30

Ala?Ala?Gly?Asp?Val?Asp?Lys?Asp?Leu?Gln?His?Ser?Gly?Ser?Ser?Thr

35 40 45

Thr?Glu?Pro?Lys?Thr?Gln?Glu?Asn?Thr?Val?Gln?Asp?Ser?Thr?Ser?Pro

50 55 60

Pro?Pro?Gln?Pro?Glu?Val?Val?Asp?Thr?Glu?Asp?Ser?Ser?Ala?Asp?Lys

65 70 75 80

Asn?Ser?Ser?Glu?Asn?Gln?Gln?Gln?Gln?Gly?Asp?Thr?Ala?Asn?Gln?Lys

85 90 95

Glu?Lys?Leu?Lys?Lys?Pro?Asp?Lys?Ile?Leu?Pro?Cys?Pro?Arg?Cys?Ser

100 105 110

Ser?Met?Asp?Thr?Lys?Phe?Cys?Tyr?Tyr?Asn?Asn?Tyr?Asn?Ile?Asn?Gln

115 120 125

Pro?Arg?His?Phe?Cys?Lys?Asn?Cys?Gln?Arg?Tyr?Trp?Thr?Ala?Gly?Gly

130 135 140

Ala?Met?Arg?Asn?Val?Pro?Val?Gly?Ala?Gly?Arg?Arg?Lys?Ser?Lys?Ser

145 150 155 160

Val?Ser?Ala?Ala?Ser?His?Phe?Leu?Gln?Arg?Val?Arg?Ala?Ala?Leu?Pro

165 170 175

Gly?Asp?Pro?Pro?Leu?Tyr?Ala?Pro?Val?Lys?Thr?Asn?Gly?Thr?Val?Leu

180 185 190

Ser?Phe?Gly?Ser?Asp?Leu?Ser?Thr?Leu?Asp?Leu?Thr?Glu?Gln?Met?Lys

195 200 205

His?Leu?Lys?Asp?Lys?Phe?Ile?Pro?Thr?Thr?Gly?Ile?Lys?Asn?Thr?Asp

210 215 220

Glu?Met?Pro?Val?Gly?Leu?Cys?Ala?Glu?Gly?Leu?Ser?Lys?Thr?Glu?Glu

225 230 235 240

Ser?Asn?Gln?Thr?Asn?Leu?Lys?Glu?Lys?Val?Ser?Ala?Asp?Arg?Ser?Pro

245 250 255

Asn?Val?Ala?Gln?His?Pro?Cys?Met?Asn?Gly?Gly?Ala?Met?Trp?Pro?Phe

260 265 270

Gly?Val?Ala?Pro?Pro?Pro?Ala?Tyr?Tyr?Thr?Ser?Ser?Ile?Ala?Ile?Pro

275 280 285

Phe?Tyr?Pro?Ala?Ala?Ala?Ala?Ala?Val?Ala?Ala?Tyr?TrP?Gly?Cys?Met

290 295 300

Val?Pro?Gly?Ala?Trp?Asn?Ala?Pro?Trp?Pro?Pro?Gln?Ser?Gln?Ser?Gln

305 310 315 320

Ser?Val?Ser?Ser?Ser?Ser?Ala?Ala?Ser?Pro?Val?Ser?Thr?Met?Thr?Asn

325 330 335

Cys?Phe?Arg?Leu?Gly?Lys?His?Pro?Arg?Asp?Gly?Asp?Glu?Glu?Leu?Asp

340 345 350

Ser?Lys?Gly?Asn?Gly?Lys?Val?Trp?Val?Pro?Lys?Thr?Val?Arg?Ile?Asp

355 360 365

Asp?Val?Asp?Glu?Val?Ala?Arg?Ser?Ser?Ile?Trp?Ser?Leu?Ile?Gly?Ile

370 375 380

Lys?Gly?Asp?Lys?Val?Gly?Ala?Asp?His?Gly?Arg?Gly?Cys?Lys?Leu?Ala

385 390 395 400

Lys?Val?Phe?Glu?Ser?Lys?Asp?Glu?Ala?Lys?Ala?Ser?Thr?His?Thr?Ala

405 410 415

Ile?Ser?Ser?Leu?Pro?Phe?Met?Gln?Gly?Asn?Pro?Ala?Ala?Leu?Thr?Arg

420 425 430

Ser?Val?Thr?Phe?Gln?Glu?Gly?Ser

435 440

<210>242

<211>1803

<212>DNA

<213> rice

<400>242

acttgtcgga?tctctctctc?tctctctctc?tccctctctc?tctcgcccat?gtaccatctc 60

catggacgac?ctcgccgccg?cctcccctcc?tcacccgccg?ccgccgccgc?cggaatccca 120

cgtgcctccg?cccccgcaga?cgccggagaa?ggattcatgt?gaggatacag?gagacatgag 180

gatcagtgaa?gaaaagccat?gcacagatca?ggagttagat?gctgatcaga?tgaatagttc 240

tagctttaat?agttccagcg?agtgtgagaa?tcaaacacct?agcaatgatg?aaatgactgg 300

atcagagtcc?aaatctgagg?cagctcaaac?agagggtggt?ggatcgagtg?aagagaaggt 360

cctgaagaag?ccagacaaga?tcctgccttg?tcctcgttgc?aacagcatgg?atacaaagtt 420

ctgctactac?aacaactaca?acattaacca?gccaagacat?ttttgcaaga?gttgtcagag 480

atattggacg?gcaggtggaa?gcatgaggaa?cctccctgtt?ggtgctggta?ggcgcaagag 540

taagagctcc?actgcaaatt?accgcagtat?attaatcacg?ggcagcaatc?tagctgctcc 600

tgctggagat?gctcccctct?atcaactctc?tataaaagga?gatcaaacag?caacggcagt 660

taaatttgca?cctgattccc?cactctgtaa?ttccatggcc?tctgtgctga?aaattggaga 720

gcagagtaag?aatgccaagc?ctacctcaac?agcacaaccc?agaaatggag?aaacccagac 780

ctgcccggct?tcaggaacaa?cttcagatag?tccccggaat?gaaccagtta?atggagcagt 840

tagtgggcat?caaaatggaa?ttgttgggca?tagtggagtc?cctcccatgc?atcccatacc 900

atgcttccct?ggtcctcctt?ttgtgtaccc?atggagtcca?gcatggaatg?gcattcctgc 960

catggcacca?ccggtatgca?cagcaccagc?tgaaccagca?aattcttcag?acaatggaag 1020

cacagctagt?gttcagtgga?gcatgccacc?agtgatgccg?gtaccaggat?actttccggt 1080

aattccatct?tcagtttggc?ccttcatttc?tccctggcca?aatggtgcat?ggagctcgcc 1140

atggattcaa?cctaattgca?gcgtgtcagc?ttcatctcct?acaagcacta?gtacatgttc 1200

agacaacggc?tctcctgtcc?taggaaagca?ctccagggac?tccaaaccgc?aaggagatga 1260

caaggcagag?aaaaacttgt?ggattccgaa?aacgcttcgg?atcgatgatc?ctgacgaagc 1320

tgcaaagagc?tcaatctgga?caacccttgg?cattgaacct?ggtgaccgta?gcatgttcag 1380

atcattccag?tcgaaacctg?aaagcaggga?gcagatatcc?ggtgctgcac?gagtcctgca 1440

ggcgaatcca?gcagctctat?ctcgatctca?atctttccag?gagacaacgt?gatgtatatt 1500

gaagaaatcg?tgtgacaatt?gtagaacatg?ttactactat?aatttaagca?agtgctacag 1560

cctgaaggat?gattggcgat?gtaggcgctg?ctgcaaacat?ggaggcagcg?tgatctgtac 1620

tattgaaacc?tgaagagtac?tattcttgac?atttttctat?aatttgcctg?tggagcatgc 1680

accagtctac?tgggttcatg?atcaggctgt?cagcatatgt?tttgttgtac?aataataata 1740

attgttaata?gctttgccta?aaggatactg?atagtattct?gctgatcctt?cagctctgtg 1800

atc 1803

<210>243

<211>476

<212>PRT

<213> rice

<400>243

Met?Asp?Asp?Leu?Ala?Ala?Ala?Ser?Pro?Pro?His?Pro?Pro?Pro?Pro?Pro

1 5 10 15

Pro?Glu?Ser?His?Val?Pro?Pro?Pro?Pro?Gln?Thr?Pro?Glu?Lys?Asp?Ser

20 25 30

Cys?Glu?Asp?Thr?Gly?Asp?Met?Arg?Ile?Ser?Glu?Glu?Lys?Pro?Cys?Thr

35 40 45

Asp?Gln?Glu?Leu?Asp?Ala?Asp?Gln?Met?Asn?Ser?Ser?Ser?Phe?Asn?Ser

50 55 60

Ser?Ser?Glu?Cys?Glu?Asn?Gln?Thr?Pro?Ser?Asn?Asp?Glu?Met?Thr?Gly

65 70 75 80

Ser?Glu?Ser?Lys?Ser?Glu?Ala?Ala?Gln?Thr?Glu?Gly?Gly?Gly?Ser?Ser

85 90 95

Glu?Glu?Lys?Val?Leu?Lys?Lys?Pro?Asp?Lys?Ile?Leu?Pro?Cys?Pro?Arg

100 105 110

Cys?Asn?Ser?Met?Asp?Thr?Lys?Phe?Cys?Tyr?Tyr?Asn?Asn?Tyr?Asn?Ile

115 120 125

Asn?Gln?Pro?Arg?His?Phe?Cys?Lys?Ser?Cys?Gln?Arg?Tyr?Trp?Thr?Ala

130 135 140

Gly?Gly?Ser?Met?Arg?Asn?Leu?Pro?Val?Gly?Ala?Gly?Arg?Arg?Lys?Ser

145 150 155 160

Lys?Ser?Ser?Thr?Ala?Asn?Tyr?Arg?Ser?Ile?Leu?Ile?Thr?Gly?Ser?Asn

165 170 175

Leu?Ala?Ala?Pro?Ala?Gly?Asp?Ala?Pro?Leu?Tyr?Gln?Leu?Ser?Ile?Lys

180 185 190

Gly?Asp?Gln?Thr?Ala?Thr?Ala?Val?Lys?Phe?Ala?Pro?Asp?Ser?Pro?Leu

195 200 205

Cys?Asn?Ser?Met?Ala?Ser?Val?Leu?Lys?Ile?Gly?Glu?Gln?Ser?Lys?Asn

210 215 220

Ala?Lys?Pro?Thr?Ser?Thr?Ala?Gln?Pro?Arg?Asn?Gly?Glu?Thr?Gln?Thr

225 230 235 240

Cys?Pro?Ala?Ser?Gly?Thr?Thr?Ser?Asp?Ser?Pro?Arg?Asn?Glu?Pro?Val

245 250 255

Asn?Gly?Ala?Val?Ser?Gly?His?Gln?Asn?Gly?Ile?Val?Gly?His?Ser?Gly

260 265 270

Val?Pro?Pro?Met?His?Pro?Ile?Pro?Cys?Phe?Pro?Gly?Pro?Pro?Phe?Val

275 280 285

Tyr?Pro?Trp?Ser?Pro?Ala?Trp?Asn?Gly?Ile?Pro?Ala?Met?Ala?Pro?Pro

290 295 300

Val?Cys?Thr?Ala?Pro?Ala?Glu?Pro?Ala?Asn?Ser?Ser?Asp?Asn?Gly?Ser

305 310 315 320

Thr?Ala?Ser?Val?Gln?Trp?Ser?Met?Pro?Pro?Val?Met?Pro?Val?Pro?Gly

325 330 335

Tyr?Phe?Pro?Val?Ile?Pro?Ser?Ser?Val?Trp?Pro?Phe?Ile?Ser?Pro?Trp

340 345 350

Pro?Asn?Gly?Ala?Trp?Ser?Ser?Pro?Trp?Ile?Gln?Pro?Asn?Cys?Ser?Val

355 360 365

Ser?Ala?Ser?Ser?Pro?Thr?Ser?Thr?Ser?Thr?Cys?Ser?Asp?Asn?Gly?Ser

370 375 380

Pro?Val?Leu?Gly?Lys?His?Ser?Arg?Asp?Ser?Lys?Pro?Gln?Gly?Asp?Asp

385 390 395 400

Lys?Ala?Glu?Lys?Asn?Leu?Trp?Ile?Pro?Lys?Thr?Leu?Arg?Ile?Asp?Asp

405 410 415

Pro?Asp?Glu?Ala?Ala?Lys?Ser?Ser?Ile?Trp?Thr?Thr?Leu?Gly?Ile?Glu

420 425 430

Pro?Gly?Asp?Arg?Ser?Met?Phe?Arg?Ser?Phe?Gln?Ser?Lys?Pro?Glu?Ser

435 440 445

Arg?Glu?Gln?Ile?Ser?Gly?Ala?Ala?Arg?Val?Leu?Gln?Ala?Asn?Pro?Ala

450 455 460

Ala?Leu?Ser?Arg?Ser?Gln?Ser?Phe?Gln?Glu?Thr?Thr

465 470 475

<210>244

<211>1817

<212>DNA

<213> barley

<400>244

ctagacatga?ttgccaagct?cgaaaataac?cctcacaaag?ggaacaaaac?tggtaccggg 60

ccccccctcg?aggtcgacaa?ggtcggtgtc?catgccccct?ccccctcctc?ctttgtgttc 120

ttgtgtatga?aatcccggga?attttgattg?gtttctaata?gagcctgtga?aaaaaaaaaa 180

ggccatttcg?aggcctgctt?tctttggctt?tggagccgat?catggcgacg?agtcgtgttt 240

ggtctagtca?tcaggtctta?agcatggagt?tccctgcctg?ttttgggagg?tactagtaag 300

cgctaagcag?gcaggtttag?cttccattag?caagggaatt?tcgcctttgc?tggtctctaa 360

taataatagc?agtttcaaca?gttttagtat?tgcatgatct?agtcgtctga?acatctggac 420

ttctgaaaga?caggcctttc?taggttatta?tcttgcctct?tttaataggt?cgttttcgcg 480

tgctcccaag?gattttgctg?aaagtggcta?ctgatatgtg?ttgccgtaac?ctactggact 540

tcagaagttc?agatgcgtcc?gactctgagt?acatcaccca?ctgcaaatca?aagcaccata 600

gcttcttttt?ttcattaaca?agatataaga?actgggaata?tgaacaaact?ttgtcaaatt 660

ttacacttgg?gtcagatggg?ggaaagcatg?ttgtaatcac?cggtcaataa?cccgaatatt 720

acaccgtgtt?tgtggacctc?taattcacaa?caaaattatt?tcaaagttag?actatatata 780

tatacaagga?actcatcgag?attttctgaa?tgtttacagg?accttcagca?cagaggaagc 840

accacggctg?aaccgaaagt?acaagaaagc?gccccacagg?actccacggg?ctcgcctccg 900

cagccggagg?ttgtggacgt?cgaggatcca?tctgctgtca?agaactcagc?agcagatcaa 960

caagaagaag?aagaagaaca?gggtgacacg?gccaaccaga?aggagaagct?caagaagcct 1020

gacaagatcc?tgccctgccc?acgctgtagc?agcatggaca?ccaagttctg?ctactacaac 1080

aactacaaca?tcaaccagcc?gcgccacttc?tgcaagaact?gccagaggta?ctggacggcc 1140

ggcggggcca?tgcgcaacgt?gcccgtgggc?gcgggccgcc?gcaagagcaa?gagcatatcg 1200

gcagcgtccc?acttccttca?gaggataagg?gccgctctgc?ccggtgatcc?tctctgcacc 1260

ccggtcaaca?ctaacggcac?ggtgctcagc?ttcggctccg?acgcatccac?cttggacgtc 1320

gtctcagaac?agatgaagca?catgaaggag?ctcagctcag?taacccggac?cgagaacacc 1380

gatgccccgt?cagtagggtc?ttgtgctgaa?ggatgggcaa?agggagaaga?gtcgagccag 1440

atgaactcga?gggagagagt?tgcagcagat?agatcgccaa?attttgcgca?gcacccgtgc 1500

atgaacgggg?cagccatgtg?gccattcagt?tgtgcaccat?cgcctgccta?tttcacccca 1560

aacgtagcaa?ttccattcta?tccagctgct?gctgctgcct?actggggctg?catggttccg 1620

ggagcctgga?acactccatg?gcagccgcag?ccgcagccgc?agtctcagtg?tcaatctagc 1680

tcaccaccta?gtgccgcttc?tccggtatca?acaatgtcca?gttgcttcca?atcccggaag 1740

catcctagag?atggtgatga?ggaaagagat?accaagggta?atggcaaggt?gtgggtgccc 1800

aagacgatcg?agtcgac 1817

<210>245

<211>270

<212>PRT

<213> barley

<400>245

Leu?Lys?Lys?Pro?Asp?Lys?Ile?Leu?Pro?Cys?Pro?Arg?Cys?Ser?Ser?Met

1 5 10 15

Asp?Thr?Lys?Phe?Cys?Tyr?Tyr?Asn?Asn?Tyr?Asn?Ile?Asn?Gln?Pro?Arg

20 25 30

His?Phe?Cys?Lys?Asn?Cys?Gln?Arg?Tyr?Trp?Thr?Ala?Gly?Gly?Ala?Met

35 40 45

Arg?Asn?Val?Pro?Val?Gly?Ala?Gly?Arg?Arg?Lys?Ser?Lys?Ser?Ile?Ser

50 55 60

Ala?Ala?ger?His?Phe?Leu?Gln?Arg?Ile?Arg?Ala?Ala?Leu?Pro?Gly?Asp

65 70 75 80

Pro?Leu?Cys?Thr?Pro?Val?Asn?Thr?Asn?Gly?Thr?Val?Leu?Ser?Phe?Gly

85 90 95

Ser?Asp?Ala?Ser?Thr?Leu?Asp?Val?Val?Ser?Glu?Gln?Met?Lys?His?Met

100 105 110

Lys?Glu?Leu?Ser?Ser?Val?Thr?Arg?Thr?Glu?Asn?Thr?Asp?Ala?Pro?Ser

115 120 125

Val?Gly?Ser?Cys?Ala?Glu?Gly?Trp?Ala?Lys?Gly?Glu?Glu?Ser?Ser?Gln

130 135 140

Met?Asn?Ser?Arg?Glu?Arg?Val?Ala?Ala?Asp?Arg?Ser?Pro?Asn?Phe?Ala

145 150 155 160

Gln?His?Pro?Cys?Met?Asn?Gly?Ala?Ala?Met?Trp?Pro?Phe?Ser?Cys?Ala

165 170 175

Pro?Ser?Pro?Ala?Tyr?Phe?Thr?Pro?Asn?Val?Ala?Ile?Pro?Phe?Tyr?Pro

180 185 190

Ala?Ala?Ala?Ala?Ala?Tyr?Trp?Gly?Cys?Met?Val?Pro?Gly?Ala?Trp?Asn

195 200 205

Thr?Pro?Trp?Gln?Pro?Gln?Pro?Gln?Pro?Gln?Ser?Gln?Cys?Gln?Ser?Ser

210 215 220

Ser?Pro?Pro?Ser?Ala?Ala?Ser?Pro?Val?Ser?Thr?Met?Ser?Ser?Cys?Phe

225 230 235 240

Gln?Ser?Arg?Lys?His?Pro?Arg?Asp?Gly?Asp?Glu?Glu?Arg?Asp?Thr?Lys

245 250 255

Gly?Asn?Gly?Lys?Val?Trp?Val?Pro?Lys?Thr?Ile?Glu?Ser?Thr

260 265 270

<210>246

<211>1485

<212>DNA

<213> winter squash (Cucurbita maxima)

<400>246

cagctgcaaa?agaggaaact?cttcatgatt?cagaggatta?tgcatgtgta?aaaacagcaa 60

atgaggcgca?catgaatcct?gaagtgttat?caacagatga?aaatgataag?ctcgcaacaa 120

ggaaaactga?gaaagaacag?aatgatgccc?ccaactcgaa?agagaaactg?aagaaaccag 180

ataagatact?tccatgtccc?cgctgcaata?gcatggaaac?caagttttgt?tattataata 240

attataatgt?caatcaacca?cgccattttt?gcaaagcctg?tcaaagatat?tggactgaag 300

gcggtaccat?caggaatgtc?cctgttggag?ctggccgccg?aaaaaacaag?aactcagcct 360

cacactaccg?acacattaca?atctcagagg?ctctccgagc?tgcacaaatt?gatgttccta 420

ttgaggtcaa?ccacctagca?tcaaaaggca?atggacgagt?cctcaatttc?agtgtaagcc 480

cacctgtatg?tgaatctatg?gtcaatgtat?cacatcctgc?agaaagaaag?gtcttgaatg 540

gaacaaggaa?tgaatttgag?ggagccaaag?gaccttgtga?gggtggggaa?actggtgatg 600

attgttctag?tgcatcttca?gtaacaatgt?caagctcaat?gaagaatgga?gccaggaggt 660

tccctcaaga?accacatatg?cagaacatca?atggttttcc?ttctcaaatc?ccatgtcttc 720

ctggtgttcc?ttggccttgt?tcatggactg?caccaatacc?tccaccagcc?ttgtgccctc 780

ctggagttcc?tttatcattc?taccctgcaa?catattggag?ttgcagtgct?tcaggttctt 840

ggaatattcc?ttgggtcact?ccacaaccct?gtcctccaat?ccctggtcca?aattctccga 900

cgctaggcaa?gcattcgaga?gatggcgatg?aactccaggc?tgataattct?gagatgaaag 960

atcctccaaa?acagaaaaat?ggatctgttt?tggttcccaa?aactttaagg?attgatgatc 1020

caaacgaagc?tgctaagagt?tcaatatggg?agacacttgg?tattaagaat?gattcaatca 1080

aagctgttga?tctgtctaat?gttttccaat?caaagggcga?cctaaagagt?aacgtttctg 1140

aagtgttgtc?tccagttttg?caagccaacc?ctgcagcctt?gtcaagatct?cttactttcc 1200

acgagcggtc?gtgaatggta?tttttgattt?tccaggttca?ttgtaaaaga?aatctttaag 1260

ttaagaagct?taagcatgaa?gtggatacaa?gcatcaatct?caagcttctt?ctgctcaaga 1320

agcaatccag?tttttcaaga?atcccggaat?tgttctctct?atagaaagag?tagctgccat 1380

tatcaagcca?tccttttgta?cataacttta?catatgtgaa?taaccgatgt?agagtggcag 1440

ctaaagattc?tcagatgtat?aaaaatgcag?ccaaaagttt?gcttc 1485

<210>247

<211>380

<212>PRT

<213> winter squash

<400>247

Met?Asn?Pro?Glu?Val?Leu?Ser?Thr?Asp?Glu?Asn?Asp?Lys?Leu?Ala?Thr

1 5 10 15

Arg?Lys?Thr?Glu?Lys?Glu?Gln?Asn?Asp?Ala?Pro?Asn?Ser?Lys?Glu?Lys

20 25 30

Leu?Lys?Lys?Pro?Asp?Lys?Ile?Leu?Pro?Cys?Pro?Arg?Cys?Asn?Ser?Met

35 40 45

Glu?Thr?Lys?Phe?Cys?Tyr?Tyr?Asn?Asn?Tyr?Asn?Val?Asn?Gln?Pro?Arg

50 55 60

His?Phe?Cys?Lys?Ala?Cys?Gln?Arg?Tyr?Trp?Thr?Glu?Gly?Gly?Thr?Ile

65 70 75 80

Arg?Asn?Val?Pro?Val?Gly?Ala?Gly?Arg?Arg?Lys?Asn?Lys?Asn?Ser?Ala

85 90 95

Ser?His?Tyr?Arg?His?Ile?Thr?Ile?Ser?Glu?Ala?Leu?Arg?Ala?Ala?Gln

100 105 110

Ile?Asp?Val?Pro?Ile?Glu?Val?Asn?His?Leu?Ala?Ser?Lys?Gly?Asn?Gly

115 120 125

Arg?Val?Leu?Asn?Phe?Ser?Val?Ser?Pro?Pro?Val?Cys?Glu?Ser?Met?Val

130 135 140

Asn?Val?Ser?His?Pro?Ala?Glu?Arg?Lys?Val?Leu?Asn?Gly?Thr?Arg?Asn

145 150 155 160

Glu?Phe?Glu?Gly?Ala?Lys?Gly?Pro?Cys?Glu?Gly?Gly?Glu?Thr?Gly?Asp

165 170 175

Asp?Cys?Ser?Ser?Ala?Ser?Ser?Val?Thr?Met?Ser?Ser?Ser?Met?Lys?Asn

180 185 190

Gly?Ala?Arg?Arg?Phe?Pro?Gln?Glu?Pro?His?Met?Gln?Asn?Ile?Asn?Gly

195 200 205

Phe?Pro?Ser?Gln?Ile?Pro?Cys?Leu?Pro?Gly?Val?Pro?Trp?Pro?Cys?Ser

210 215 220

Trp?Thr?Ala?Pro?Ile?Pro?Pro?Pro?Ala?Leu?Cys?Pro?Pro?Gly?Val?Pro

225 230 235 240

Leu?Ser?Phe?Tyr?Pro?Ala?Thr?Tyr?Trp?Ser?Cys?Ser?Ala?Ser?Gly?Ser

245 250 255

Trp?Asn?Ile?Pro?Trp?Val?Thr?Pro?Gln?Pro?Cys?Pro?Pro?Ile?Pro?Gly

260 265 270

Pro?Asn?Ser?Pro?Thr?Leu?Gly?Lys?His?Ser?Arg?Asp?Gly?Asp?Glu?Leu

275 280 285

Gln?Ala?Asp?Asn?Ser?Glu?Met?Lys?Asp?Pro?Pro?Lys?Gln?Lys?Asn?Gly

290 295 300

Ser?Val?Leu?Val?Pro?Lys?Thr?Leu?Arg?Ile?Asp?Asp?Pro?Asn?Glu?Ala

305 310 315 320

Ala?Lys?Ser?Ser?Ile?Trp?Glu?Thr?Leu?Gly?Ile?Lys?Asn?Asp?Ser?Ile

325 330 335

Lys?Ala?Val?Asp?Leu?Ser?Asn?Val?Phe?Gln?Ser?Lys?Gly?Asp?Leu?Lys

340 345 350

Ser?Asn?Val?Ser?Glu?Val?Leu?Ser?Pro?Val?Leu?Gln?Ala?Asn?Pro?Ala

355 360 365

Ala?Leu?Ser?Arg?Ser?Leu?Thr?Phe?His?Glu?Arg?Ser

370 375 380

<210>248

<211>1191

<212>DNA

<213> Arabidopis thaliana

<400>248

atgtggctct?ctcatctctt?catgtccctc?tctaagctga?cgtgtaattt?ctccattttc 60

tctgtcttta?tggcttgtgg?ctctattggt?atgtctcaag?ttagagatac?tccggttaaa 120

ttgtttggct?ggacaattac?accggtttct?catgatccat?actcttcttc?gtcccatgtt 180

cttcctgatt?cttcctcgtc?ttcctcgtct?tcttctctat?cacttcgacc?acacatgatg 240

aataaccaat?ctgttactga?caatacaagt?cttaagctgt?catctaatct?taacaacgag 300

tcaaaagaaa?catctgagaa?cagtgatgac?caacacagcg?agatcacaac?aattacatcg 360

gaagaagaga?aaacaactga?actgaagaaa?ccagacaaga?ttcttccatg?tccgagatgc 420

aacagcgcag?acaccaaatt?ctgttactac?aacaactaca?acgttaacca?gccacgtcac 480

ttctgtagaa?aatgccagag?gtattggacc?gctggtggat?ccatgaggat?cgtcccggtt 540

ggctcaggcc?gtcgcaagaa?caagggatgg?gtttcttcag?accagtacct?gcacatcact 600

tccgaggata?ctgacaatta?caatagctcc?tcaacaaaga?ttctaagctt?cgagtcttcg 660

gactctttgg?taactgagag?gcctaagcat?caatcaaacg?aagtgaagat?aaacgctgaa 720

cctgtttcac?aagaacccaa?caacttccaa?gggttacttc?ctccccaagc?atcccctgtt 780

tcgcctcctt?ggccttacca?ataccctcca?aaccctagtt?tctaccacat?gcccgtctac 840

tggggctgcg?cgataccggt?ttggtctacc?ctcgacactt?ctacatgtct?tgggaaaagg 900

acaagagacg?aaacttctca?tgaaactgtt?aaagagagta?aaaatgcttt?tgagagaaca 960

agcttgcttt?tggaatctca?gagcatcaaa?aatgaaacaa?gtatggctac?aaataaccat 1020

gtgtggtatc?cagtaccgat?gacccgcgag?aagacacaag?aattcagctt?tttcagtaat 1080

ggagctgaaa?caaagagcag?caacaacaga?ttcgtccctg?aaacgtatct?taacctgcaa 1140

gcaaaccctg?cagccatggc?aagatctatg?aacttcagag?agagcatata?a 1191

<210>249

<211>396

<212>PRT

<213> Arabidopis thaliana

<400>249

Met?Trp?Leu?Ser?His?Leu?Phe?Met?Ser?Leu?Ser?Lys?Leu?Thr?Cys?Asn

1 5 10 15

Phe?Ser?Ile?Phe?Ser?Val?Phe?Met?Ala?Cys?Gly?Ser?Ile?Gly?Met?Ser

20 25 30

Gln?Val?Arg?Asp?Thr?Pro?Val?Lys?Leu?Phe?Gly?Trp?Thr?Ile?Thr?Pro

35 40 45

Val?Ser?His?Asp?Pro?Tyr?Ser?Ser?Ser?Ser?His?Val?Leu?Pro?Asp?Ser

50 55 60

Ser?Ser?Ser?Ser?Ser?Ser?Ser?Ser?Leu?Ser?Leu?Arg?Pro?His?Met?Met

65 70 75 80

Asn?Asn?Gln?Ser?Val?Thr?Asp?Asn?Thr?Ser?Leu?Lys?Leu?Ser?Ser?Asn

85 90 95

Leu?Asn?Asn?Glu?Ser?Lys?Glu?Thr?Ser?Glu?Asn?Ser?Asp?Asp?Gln?His

100 105 110

Ser?Glu?Ile?Thr?Thr?Ile?Thr?Ser?Glu?Glu?Glu?Lys?Thr?Thr?Glu?Leu

115 120 125

Lys?Lys?Pro?Asp?Lys?Ile?Leu?Pro?Cys?Pro?Arg?Cys?Asn?Ser?Ala?Asp

130 135 140

Thr?Lys?Phe?Cys?Tyr?Tyr?Asn?Asn?Tyr?Asn?Val?Asn?Gln?Pro?Arg?His

145 150 155 160

Phe?Cys?Arg?Lys?Cys?Gln?Arg?Tyr?Trp?Thr?Ala?Gly?Gly?Ser?Met?Arg

165 170 175

Ile?Val?Pro?Val?Gly?Ser?Gly?Arg?Arg?Lys?Asn?Lys?Gly?Trp?Val?Ser

180 185 190

Ser?Asp?Gln?Tyr?Leu?His?Ile?Thr?Ser?Glu?Asp?Thr?Asp?Asn?Tyr?Asn

195 200 205

Ser?Ser?Ser?Thr?Lys?Ile?Leu?Ser?Phe?Glu?Ser?Ser?Asp?Ser?Leu?Val

210 215 220

Thr?Glu?Arg?Pro?Lys?His?Gln?Ser?Asn?Glu?Val?Lys?Ile?Asn?Ala?Glu

225 230 235 240

Pro?Val?Ser?Gln?Glu?Pro?Asn?Asn?Phe?Gln?Gly?Leu?Leu?Pro?Pro?Gln

245 250 255

Ala?Ser?Pro?Val?Ser?Pro?Pro?Trp?Pro?Tyr?Gln?Tyr?Pro?Pro?Asn?Pro

260 265 270

Ser?Phe?Tyr?His?Met?Pro?Val?Tyr?Trp?Gly?Cys?Ala?Ile?Pro?Val?Trp

275 280 285

Ser?Thr?Leu?Asp?Thr?Ser?Thr?Cys?Leu?Gly?Lys?Arg?Thr?Arg?Asp?Glu

290 295 300

Thr?Ser?His?Glu?Thr?Val?Lys?Glu?Ser?Lys?Asn?Ala?Phe?Glu?Arg?Thr

305 310 315 320

Ser?Leu?Leu?Leu?Glu?Ser?Gln?Ser?Ile?Lys?Asn?Glu?Thr?Ser?Met?Ala

325 330 335

Thr?Asn?Asn?His?Val?Trp?Tyr?Pro?Val?Pro?Met?Thr?Arg?Glu?Lys?Thr

340 345 350

Gln?Glu?Phe?Ser?Phe?Phe?Ser?Asn?Gly?Ala?Glu?Thr?Lys?Ser?Ser?Asn

355 360 365

Asn?Arg?Phe?Val?Pro?Glu?Thr?Tyr?Leu?Asn?Leu?Gln?Ala?Asn?Pro?Ala

370 375 380

Ala?Met?Ala?Arg?Ser?Met?Asn?Phe?Arg?Glu?Ser?Ile

385 390 395

<210>250

<211>1200

<212>DNA

<213> Arabidopis thaliana

<400>250

atgtctaaat?ctagagatac?ggagataaag?ttgtttggga?ggacaatcac?atctctttta 60

gatgtgaatt?gttatgatcc?gtcgtcgttg?tcccctgttc?acgatgtttc?ttctgatcca 120

agcaaggagg?attcgtcttc?ttcttcatct?tcttgttctc?caactattgg?accaatcagg 180

gttccggtta?aaaaaagtga?gcaagagagt?aacaaattca?aagatccata?tatattatcc 240

gatctaaacg?aaccaccaaa?agcagtatct?gagatttcat?caccaagaag?ttccaagaac 300

aactgtgatc?aacagagcga?gatcacaaca?acaactacca?caagtactac?atcaggagag 360

aaatcaacgg?ctctcaagaa?accggacaag?cttattccat?gtcctagatg?tgaaagcgca 420

aacaccaaat?tctgttatta?caacaactac?aacgtgaacc?agccacgtta?cttctgcagg 480

aactgtcaga?ggtattggac?agctggtgga?tctatgagga?acgttcctgt?tggctcaggt 540

cgtcgcaaga?acaaaggatg?gccttcttca?aaccattact?tgcaagtcac?ttctgaggat 600

tgtgataata?ataactcggg?gacgatcctt?agtttcggtt?cttcggagtc?ttcggttaca 660

gagactggta?agcatcagtc?aggtgataca?gcaaagataa?gtgctgattc?agtttctcaa 720

gaaaataaaa?gctaccaagg?gtttcttcct?ccgcaagtaa?tgttacctaa?taattcttct 780

ccttggcctt?accaatggag?tccaacgggt?cctaacgcta?gtttctaccc?tgtccccttc 840

tactggggat?gcacggttcc?gatataccct?acctcagaga?cttcatcatg?tttaggaaaa 900

cggtcaagag?atcaaactga?aggaagaatc?aatgatacta?atacaacaat?aactactaca 960

agagcaagat?tggtctcaga?atctcttaga?atgaatatcg?aagctagtaa?gagcgctgtg 1020

tggtctaagt?taccgacaaa?acccgagaaa?aaaacgcaag?gattcagttt?gttcaatgga 1080

tttgacacaa?agggaaacag?caacagaagt?agcttggtct?ccgaaacttc?tcacagtcta 1140

caagcaaacc?ctgcagcgat?gtctagagct?atgaacttca?gggagagcat?gcaacaataa 1200

<210>251

<211>399

<212>PRT

<213> Arabidopis thaliana

<400>251

Met?Ser?Lys?Ser?Arg?Asp?Thr?Glu?Ile?Lys?Leu?Phe?Gly?Arg?Thr?Ile

1 5 10 15

Thr?Ser?Leu?Leu?Asp?Val?Asn?Cys?Tyr?Asp?Pro?Ser?Ser?Leu?Ser?Pro

20 25 30

Val?His?Asp?Val?Ser?Ser?Asp?Pro?Ser?Lys?Glu?Asp?Ser?Ser?Ser?Ser

35 40 45

Ser?Ser?Ser?Cys?Ser?Pro?Thr?Ile?Gly?Pro?Ile?Arg?Val?Pro?Val?Lys

50 55 60

Lys?Ser?Glu?Gln?Glu?Ser?Asn?Lys?Phe?Lys?Asp?Pro?Tyr?Ile?Leu?Ser

65 70 75 80

Asp?Leu?Asn?Glu?Pro?Pro?Lys?Ala?Val?Ser?Glu?Ile?Ser?Ser?Pro?Arg

85 90 95

Ser?Ser?Lys?Asn?Asn?Cys?Asp?Gln?Gln?Ser?Glu?Ile?Thr?Thr?Thr?Thr

100 105 110

Thr?Thr?Ser?Thr?Thr?Ser?Gly?Glu?Lys?Ser?Thr?Ala?Leu?Lys?Lys?Pro

115 120 125

Asp?Lys?Leu?Ile?Pro?Cys?Pro?Arg?Cys?Glu?Ser?Ala?Asn?Thr?Lys?Phe

130 135 140

Cys?Tyr?Tyr?Asn?Asn?Tyr?Asn?Val?Asn?Gln?Pro?Arg?Tyr?Phe?Cys?Arg

145 150 155 160

Asn?Cys?Gln?Arg?Tyr?Trp?Thr?Ala?Gly?Gly?Ser?Met?Arg?Asn?Val?Pro

165 170 175

Val?Gly?Ser?Gly?Arg?Arg?Lys?Asn?Lys?Gly?Trp?Pro?Ser?Ser?Asn?His

180 185 190

Tyr?Leu?Gln?Val?Thr?Ser?Glu?Asp?Cys?Asp?Asn?Asn?Asn?Ser?Gly?Thr

195 200 205

Ile?Leu?Ser?Phe?Gly?Ser?Ser?Glu?Ser?Ser?Val?Thr?Glu?Thr?Gly?Lys

210 215 220

His?Gln?Ser?Gly?Asp?Thr?Ala?Lys?Ile?Ser?Ala?Asp?Ser?Val?Ser?Gln

225 230 235 240

Glu?Asn?Lys?Ser?Tyr?Gln?Gly?Phe?Leu?Pro?Pro?Gln?Val?Met?Leu?Pro

245 250 255

Asn?Asn?Ser?Ser?Pro?Trp?Pro?Tyr?Gln?Trp?Ser?Pro?Thr?Gly?Pro?Asn

260 265 270

Ala?Ser?Phe?Tyr?Pro?Val?Pro?Phe?Tyr?Trp?Gly?Cys?Thr?Val?Pro?Ile

275 280 285

Tyr?Pro?Thr?Ser?Glu?Thr?Ser?Ser?Cys?Leu?Gly?Lys?Arg?Ser?Arg?Asp

290 295 300

Gln?Thr?Glu?Gly?Arg?Ile?Asn?Asp?Thr?Asn?Thr?Thr?Ile?Thr?Thr?Thr

305 310 315 320

Arg?Ala?Arg?Leu?Val?Ser?Glu?Ser?Lau?Arg?Met?Asn?Ile?Glu?Ala?Ser

325 330 335

Lys?Ser?Ala?Val?Trp?Ser?Lys?Leu?Pro?Thr?Lys?Pro?Glu?Lys?Lys?Thr

340 345 350

Gln?Gly?Phe?Ser?Leu?Phe?Asn?Gly?Phe?Asp?Thr?Lys?Gly?Asn?Ser?Asn

355 360 365

Arg?Ser?Ser?Leu?Val?Ser?Glu?Thr?Ser?His?Ser?Leu?Gln?Ala?Asn?Pro

370 375 380

Ala?Ala?Met?Ser?Arg?Ala?Met?Asn?Phe?Arg?Glu?Ser?Met?Gln?Gln

385 390 395

<210>252

<211>1347

<212>DNA

<213> Arabidopis thaliana

<400>252

atgatgatgg?agactagaga?tccagctatt?aagcttttcg?gtatgaaaat?cccttttccg 60

tcggtttttg?aatcggcagt?tacggtggag?gatgacgaag?aagatgactg?gagcggcgga 120

gatgacaaat?caccagagaa?ggtaactcca?gagttatcag?ataagaacaa?caacaactgt 180

aacgacaaca?gttttaacaa?ttcgaaaccc?gaaaccttgg?acaaagagga?agcgacatca 240

actgatcaga?tagagagtag?tgacacgcct?gaggataatc?agcagacgac?acctgatggt 300

aaaaccctaa?agaaaccgac?taagattcta?ccgtgtccga?gatgcaaaag?catggagacc 360

aagttctgtt?attacaacaa?ctacaacata?aaccagcctc?gtcatttctg?caaggcttgt 420

cagagatatt?ggactgctgg?agggactatg?aggaatgttc?ctgtgggggc?aggacgtcgt 480

aagaacaaaa?gctcatcttc?tcattaccgt?cacatcacta?tttccgaggc?tcttgaggct 540

gcgaggcttg?acccgggctt?acaggcaaac?acaagggtct?tgagttttgg?tctcgaagct 600

cagcagcagc?acgttgctgc?tcccatgaca?cctgtgatga?agctacaaga?agatcaaaag 660

gtctcaaacg?gtgctaggaa?caggtttcac?gggttagcgg?atcaacggct?tgtagctcgg 720

gtagagaatg?gagatgattg?ctcaagcgga?tcctctgtga?ccacctctaa?caatcactca 780

gtggatgaat?caagagcaca?aagcggcagt?gttgttgaag?cacaaatgaa?caacaacaac 840

aacaataaca?tgaatggtta?tgcttgcatc?ccaggtgttc?catggcctta?cacgtggaat 900

ccagcgatgc?ctccaccagg?tttttacccg?cctccagggt?atccaatgcc?gttttaccct 960

tactggacca?tcccaatgct?accaccgcat?caatcctcat?cgcctataag?ccaaaagtgt 1020

tcaaatacaa?actctccgac?tctcggaaag?catccgagag?atgaaggatc?atcgaaaaag 1080

gacaacgaga?cagagcgaaa?acagaaggcc?gggtgcgttc?tggtcccgaa?aacgttgaga 1140

atagatgatc?ctaacgaagc?agcaaagagc?tcgatatgga?caacattggg?aatcaagaac 1200

gaggcgatgt?gcaaagccgg?tggtatgttc?aaagggtttg?atcataagac?aaagatgtat 1260

aacaacgaca?aagctgagaa?ctcccctgtt?ctttctgcta?accctgctgc?tctatcaaga 1320

tcacacaatt?tccatgaaca?gatttag 1347

<210>253

<211>448

<212>PRT

<213> Arabidopis thaliana

<400>253

Met?Met?Met?Glu?Thr?Arg?Asp?Pro?Ala?Ile?Lys?Leu?Phe?Gly?Met?Lys

1 5 10 15

Ile?Pro?Phe?Pro?Ser?Val?Phe?Glu?Ser?Ala?Val?Thr?Val?Glu?Asp?Asp

20 25 30

Glu?Glu?Asp?Asp?Trp?Ser?Gly?Gly?Asp?Asp?Lys?Ser?Pro?Glu?Lys?Val

35 40 45

Thr?Pro?Glu?Leu?Ser?Asp?Lys?Asn?Asn?Asn?Asn?Cys?Asn?Asp?Asn?Ser

50 55 60

Phe?Asn?Asn?Ser?Lys?Pro?Glu?Thr?Leu?Asp?Lys?Glu?Glu?Ala?Thr?Ser

65 70 75 80

Thr?Asp?Gln?Ile?Glu?Ser?Ser?Asp?Thr?Pro?Glu?Asp?Asn?Gln?Gln?Thr

85 90 95

Thr?Pro?Asp?Gly?Lys?Thr?Leu?Lys?Lys?Pro?Thr?Lys?Ile?Leu?Pro?Cys

100 105 110

Pro?Arg?Cys?Lys?Ser?Met?Glu?Thr?Lys?Phe?Cys?Tyr?Tyr?Asn?Asn?Tyr

115 120 125

Asn?Ile?Asn?Gln?Pro?Arg?His?Phe?Cys?Lys?Ala?Cys?Gln?Arg?Tyr?Trp

130 135 140

Thr?Ala?Gly?Gly?Thr?Met?Arg?Asn?Val?Pro?Val?Gly?Ala?Gly?Arg?Arg

145 150 155 160

Lys?Asn?Lys?Ser?Ser?Ser?Ser?His?Tyr?Arg?His?Ile?Thr?Ile?Ser?Glu

165 170 175

Ala?Leu?Glu?Ala?Ala?Arg?Leu?Asp?Pro?Gly?Leu?Gln?Ala?Asn?Thr?Arg

180 185 190

Val?Leu?Ser?Phe?Gly?Leu?Glu?Ala?Gln?Gln?Gln?His?Val?Ala?Ala?Pro

195 200 205

Met?Thr?Pro?Val?Met?Lys?Leu?Gln?Glu?Asp?Gln?Lys?Val?Ser?Asn?Gly

210 215 220

Ala?Arg?Asn?Arg?Phe?His?Gly?Leu?Ala?Asp?Gln?Arg?Leu?Val?Ala?Arg

225 230 235 240

Val?Glu?Asn?Gly?Asp?Asp?Cys?Ser?Ser?Gly?Ser?Ser?Val?Thr?Thr?Ser

245 250 255

Asn?Asn?His?Ser?Val?Asp?Glu?Ser?Arg?Ala?Gln?Ser?Gly?Ser?Val?Val

260 265 270

Glu?Ala?Gln?Met?Asn?Asn?Asn?Asn?Asn?Asn?Asn?Met?Asn?Gly?Tyr?Ala

275 280 285

Cys?Ile?Pro?Gly?Val?Pro?Trp?Pro?Tyr?Thr?Trp?Asn?Pro?Ala?Met?Pro

290 295 300

Pro?Pro?Gly?Phe?Tyr?Pro?Pro?Pro?Gly?Tyr?Pro?Met?Pro?Phe?Tyr?Pro

305 310 315 320

Tyr?Trp?Thr?Ile?Pro?Met?Leu?Pro?Pro?His?Gln?Ser?Ser?Ser?Pro?Ile

325 330 335

Ser?Gln?Lys?Cys?Ser?Asn?Thr?Asn?Ser?Pro?Thr?Leu?Gly?Lys?His?Pro

340 345 350

Arg?Asp?Glu?Gly?Ser?Ser?Lys?Lys?Asp?Asn?Glu?Thr?Glu?Arg?Lys?Gln

355 360 365

Lys?Ala?Gly?Cys?Val?Leu?Val?Pro?Lys?Thr?Leu?Arg?Ile?Asp?Asp?Pro

370 375 380

Asn?Glu?Ala?Ala?Lys?Ser?Ser?Ile?Trp?Thr?Thr?Leu?Gly?Ile?Lys?Asn

385 390 395 400

Glu?Ala?Met?Cys?Lys?Ala?Gly?Gly?Met?Phe?Lys?Gly?Phe?Asp?His?Lys

405 410 415

Thr?Lys?Met?Tyr?Asn?Asn?Asp?Lys?Ala?Glu?Asn?Ser?Pro?Val?Leu?Ser

420 425 430

Ala?Asn?Pro?Ala?Ala?Leu?Ser?Arg?Ser?His?Asn?Phe?His?Glu?Gln?Ile

435 440 445

<210>254

<211>1374

<212>DNA

<213> Arabidopis thaliana

<400>254

atggctgatc?cggcgattaa?gctctttgga?aagacgattc?ctttacctga?gcttggtgtt 60

gttgattctt?cttctagcta?taccggattt?ttaaccgaaa?ctcagattcc?tgttcggtta 120

tcagattcgt?gtaccggcga?tgatgatgat?gaagagatgg?gtgattccgg?tttaggacga 180

gaagaaggtg?atgatgttgg?tgatggtgga?ggagagagcg?agactgataa?aaaggaagaa 240

aaagatagtg?agtgtcagga?agagtcattg?aggaatgaat?ctaatgatgt?tactactact 300

acatcgggta?taactgaaaa?aacggaaaca?acaaaagctg?caaagacgaa?tgaagagtca 360

ggtggtactg?cttgctctca?agaggggaag?ttaaagaaac?ctgataagat?tctaccgtgt 420

ccgcgatgta?acagcatgga?aaccaagttc?tgttactaca?acaactataa?tgttaaccaa 480

cctcgccatt?tctgcaagaa?atgtcagaga?tattggacag?ctggtggaac?gatgaggaat 540

gttccggttg?gtgctgggag?acgtaagaat?aagagtccag?cttctcatta?taaccgtcat 600

gtaagtataa?catctgcgga?agctatgcag?aaggtggcga?gaactgatct?tcaacatcct 660

aatggtgcaa?atcttctcac?ttttggctct?gattctgtgc?tttgtgaatc?tatggcttct 720

ggattgaatc?ttgttgagaa?gtcattgttg?aagacacaaa?ctgtattgca?agaacccaat 780

gaaggcttga?agattacggt?tccgttaaac?cagacaaacg?aagaagctgg?aacagtcagc 840

ccgttaccaa?aagttccatg?ctttccagga?ccaccaccaa?cttggcctta?cgcttggaac 900

ggagtttcgt?ggacgatttt?accgttttac?cctccaccgg?cttactggag?ctgcccgggg 960

gtttcaccgg?gggcatggaa?cagcttcaca?tggatgccac?aacccaattc?accatctggt 1020

tccaatccaa?attctcctac?actaggtaaa?cattcacgtg?acgagaacgc?tgctgaacca 1080

ggaaccgctt?ttgatgaaac?cgagtcactt?ggtagggaga?aaagcaaacc?cgagagatgc 1140

ttgtgggttc?ccaagacgct?gaggattgat?gatccagagg?aagctgctaa?aagttccatc 1200

tgggaaacat?tagggatcaa?aaaagacgaa?aatgcggata?ctttcggagc?tttcagatca 1260

tcaaccaaag?aaaaaagcag?tctttctgaa?ggaagacttc?cgggaagaag?accggagttg 1320

caagcgaatc?ctgctgctct?ttctaggtca?gcaaacttcc?atgagagctc?atag 1374

<210>255

<211>457

<212>PRT

<213> Arabidopis thaliana

<400>255

Met?Ala?Asp?Pro?Ala?Ile?Lys?Leu?Phe?Gly?Lys?Thr?Ile?Pro?Leu?Pro

1 5 10 15

Glu?Leu?Gly?Val?Val?Asp?Ser?Ser?Ser?Ser?Tyr?Thr?Gly?Phe?Leu?Thr

20 25 30

Glu?Thr?Gln?Ile?Pro?Val?Arg?Leu?Ser?Asp?Ser?Cys?Thr?Gly?Asp?Asp

35 40 45

Asp?Asp?Glu?Glu?Met?Gly?Asp?Ser?Gly?Leu?Gly?Arg?Glu?Glu?Gly?Asp

50 55 60

Asp?Val?Gly?Asp?Gly?Gly?Gly?Glu?Ser?Glu?Thr?Asp?Lys?Lys?Glu?Glu

65 70 75 80

Lys?Asp?Ser?Glu?Cys?Gln?Glu?Glu?Ser?Leu?Arg?Asn?Glu?Ser?Asn?Asp

85 90 95

Val?Thr?Thr?Thr?Thr?Ser?Gly?Ile?Thr?Glu?Lys?Thr?Glu?Thr?Thr?Lys

100 105 110

Ala?Ala?Lys?Thr?Asn?Glu?Glu?Ser?Gly?Gly?Thr?Ala?Cys?Ser?Gln?Glu

115 120 125

Gly?Lys?Leu?Lys?Lys?Pro?Asp?Lys?Ile?Leu?Pro?Cys?Pro?Arg?Cys?Asn

130 135 140

Ser?Met?Glu?Thr?Lys?Phe?Cys?Tyr?Tyr?Asn?Asn?Tyr?Asn?Val?Asn?Gln

145 150 155 160

Pro?Arg?His?Phe?Cys?Lys?Lys?Cys?Gln?Arg?Tyr?Trp?Thr?Ala?Gly?Gly

165 170 175

Thr?Met?Arg?Asn?Val?Pro?Val?Gly?Ala?Gly?Arg?Arg?Lys?Asn?Lys?Ser

180 185 190

Pro?Ala?Ser?His?Tyr?Asn?Arg?His?Val?Ser?Ile?Thr?Ser?Ala?Glu?Ala

195 200 205

Met?Gln?Lys?Val?Ala?Arg?Thr?Asp?Leu?Gln?His?Pro?Asn?Gly?Ala?Asn

210 215 220

Leu?Leu?Thr?Phe?Gly?Ser?Asp?Ser?Val?Leu?Cys?Glu?Ser?Met?Ala?Ser

225 230 235 240

Gly?Leu?Asn?Leu?Val?Glu?Lys?Ser?Leu?Leu?Lys?Thr?Gln?Thr?Val?Leu

245 250 255

Gln?Glu?Pro?Asn?Glu?Gly?Leu?Lys?Ile?Thr?Val?Pro?Leu?Asn?Gln?Thr

260 265 270

Asn?Glu?Glu?Ala?Gly?Thr?Val?Ser?Pro?Leu?Pro?Lys?Val?Pro?Cys?Phe

275 280 285

Pro?Gly?Pro?Pro?Pro?Thr?Trp?Pro?Tyr?Ala?Trp?Asn?Gly?Val?Ser?Trp

290 295 300

Thr?Ile?Leu?Pro?Phe?Tyr?Pro?Pro?Pro?Ala?Tyr?Trp?Ser?Cys?Pro?Gly

305 310 315 320

Val?Ser?Pro?Gly?Ala?Trp?Asn?Ser?Phe?Thr?Trp?Met?Pro?Gln?Pro?Asn

325 330 335

Ser?Pro?Ser?Gly?Ser?Asn?Pro?Asn?Ser?Pro?Thr?Leu?Gly?Lys?His?Ser

340 345 350

Arg?Asp?Glu?Asn?Ala?Ala?Glu?Pro?Gly?Thr?Ala?Phe?Asp?Glu?Thr?Glu

355 360 365

Ser?Leu?Gly?Arg?Glu?Lys?Ser?Lys?Pro?Glu?Arg?Cys?Leu?Trp?Val?Pro

370 375 380

Lys?Thr?Leu?Arg?Ile?Asp?Asp?Pro?Glu?Glu?Ala?Ala?Lys?Ser?Ser?Ile

385 390 395 400

Trp?Glu?Thr?Leu?Gly?Ile?Lys?Lys?Asp?Glu?Asn?Ala?Asp?Thr?Phe?Gly

405 410 415

Ala?Phe?Arg?Ser?Ser?Thr?Lys?Glu?Lys?Ser?Ser?Leu?Ser?Glu?Gly?Arg

420 425 430

Leu?Pro?Gly?Arg?Arg?Pro?Glu?Leu?Gln?Ala?Asn?Pro?Ala?Ala?Leu?Ser

435 440 445

Arg?Ser?Ala?Asn?Phe?His?Glu?Ser?Ser

450 455

<210>256

<211>57

<212>DNA

<213> artificial sequence

<220>

<223> primer: prm07303

<400>256

ggggacaagt?ttgtacaaaa?aagcaggctt?aaacaatgat?gatggagact?agagatc 57

<210>257

<211>53

<212>DNA

<213> artificial sequence

<220>

<223> primer: prm07304

<400>257

ggggaccact?ttgtacaaga?aagctgggtc?atatgtaact?ctaaatctgt?tca 53

<210>258

<211>654

<212>DNA

<213> rice

<400>258

cttctacatc?ggcttaggtg?tagcaacacg?actttattat?tattattatt?attattatta 60

ttattttaca?aaaatataaa?atagatcagt?ccctcaccac?aagtagagca?agttggtgag 120

ttattgtaaa?gttctacaaa?gctaatttaa?aagttattgc?attaacttat?ttcatattac 180

aaacaagagt?gtcaatggaa?caatgaaaac?catatgacat?actataattt?tgtttttatt 240

attgaaatta?tataattcaa?agagaataaa?tccacatagc?cgtaaagttc?tacatgtggt 300

gcattaccaa?aatatatata?gcttacaaaa?catgacaagc?ttagtttgaa?aaattgcaat 360

ccttatcaca?ttgacacata?aagtgagtga?tgagtcataa?tattattttc?tttgctaccc 420

atcatgtata?tatgatagcc?acaaagttac?tttgatgatg?atatcaaaga?acatttttag 480

gtgcacctaa?cagaatatcc?aaataatatg?actcacttag?atcataatag?agcatcaagt 540

aaaactaaca?ctctaaagca?accgatggga?aagcatctat?aaatagacaa?gcacaatgaa 600

aatcctcatc?atccttcacc?acaattcaaa?tattatagtt?gaagcatagt?agta 654

<210>259

<211>1828

<212>DNA

<213> rice

<400>259

gcttgagtca?tagggagaaa?acaaatcgat?catatttgac?tcttttccct?ccatctctct 60

taccggcaaa?aaaagtagta?ctggtttata?tgtaaagtaa?gattctttaa?ttatgtgaga 120

tccggcttaa?tgcttttctt?ttgtcacata?tactgcattg?caacaattgc?catatattca 180

cttctgccat?cccattatat?agcaactcaa?gaatggattg?atatatcccc?tattactaat 240

ctagacatgt?taaggctgag?ttgggcagtc?catcttccca?acccaccacc?ttcgtttttc 300

gcgcacatac?ttttcaaact?actaaatggt?gtgtttttta?aaaatatttt?caatacaaaa 360

gttgctttaa?aaaattatat?tgatccattt?ttttaaaaaa?aatagctaat?acttaattaa 420

tcacgtgtta?aaagaccgct?ccgttttgcg?tgcaggaggg?ataggttcac?atcctgcatt 480

accgaacaca?gcctaaatct?tgttgtctag?attcgtagta?ctggatatat?taaatcatgt 540

tctaagttac?tatatactga?gatgaataga?ataagtaaaa?ttagacccac?cttaagtctt 600

gatgaagtta?ctactagctg?cgtttgggag?gacttcccaa?aaaaaaaagt?attagccatt 660

agcacgtgat?taattaagta?ctagtttaaa?aaacttaaaa?aataaattaa?tatgattctc 720

ttaagtaact?ctcctataga?aaacttttac?aaaattacac?cgtttaatag?tttggaaaat 780

atgtcagtaa?aaaataagag?agtagaagtt?atgaaagtta?gaaaaagaat?tgttttagta 840

gtatacagtt?ataaactatt?ccctctgttc?taaaacataa?gggattatgg?atggattcga 900

catgtaccag?taccatgaat?cgaatccaga?caagtttttt?atgcatattt?attctactat 960

aatatatcac?atctgctcta?aatatcttat?atttcgaggt?ggagactgtc?gctatgtttt 1020

tctgcccgtt?gctaagcaca?cgccaccccc?gatgcgggga?cgcctctggc?cttcttgcca 1080

cgataattga?atggaacttc?cacattcaga?ttcgataggt?gaccgtcgac?tccaagtgct 1140

ttgcacaaaa?caactccggc?ctcccggcca?ccagtcacac?gactcacggc?actaccaccc 1200

ctgactccct?gaggcggacc?tgccactgtt?ctgcatgcga?agctatctaa?aattctgaag 1260

caaagaaagc?acagcacatg?ctccgggaca?cgcgccaccc?ggcggaaaag?ggctcggtgt 1320

ggcgatctca?cagccgcata?tcgcatttca?caagccgccc?atctccaccg?gcttcacgag 1380

gctcatcgcg?gcacgaccgc?gcacggaacg?cacgcggccg?acccgcgcgc?ctcgatgcgc 1440

gagcccatcc?gccgcgtcct?ccctttgcct?ttgccgctat?cctctcggtc?gtatcccgtt 1500

tctctgtctt?ttgctccccg?gcgcgcgcca?gttcggagta?ccagcgaaac?ccggacacct 1560

ggtacacctc?cgccggccac?aacgcgtgtc?ccccctacgt?ggccgcgcag?cacatgccca 1620

tgcgcgacac?gtgcacctcc?tcatccaaac?tctcaagtct?caacggtcct?ataaatgcac 1680

ggatagcctc?aagctgctcg?tcacaaggca?agaggcaaga?ggcaagagca?tccgtattaa 1740

ccagcctttt?gagacttgag?agtgtgtgtg?actcgatcca?gcgtagtttc?agttcgtgtg 1800

ttggtgagtg?attccagcca?agtttgcg 1828

<210>260

<211>1243

<212>DNA

<213> rice

<400>260

aaaaccaccg?agggacctga?tctgcaccgg?ttttgatagt?tgagggaccc?gttgtgtctg 60

gttttccgat?cgagggacga?aaatcggatt?cggtgtaaag?ttaagggacc?tcagatgaac 120

ttattccgga?gcatgattgg?gaagggagga?cataaggccc?atgtcgcatg?tgtttggacg 180

gtccagatct?ccagatcact?cagcaggatc?ggccgcgttc?gcgtagcacc?cgcggtttga 240

ttcggcttcc?cgcaaggcgg?cggccggtgg?ccgtgccgcc?gtagcttccg?ccggaagcga 300

gcacgccgcc?gccgccgacc?cggctctgcg?tttgcaccgc?cttgcacgcg?atacatcggg 360

atagatagct?actactctct?ccgtttcaca?atgtaaatca?ttctactatt?ttccacattc 420

atattgatgt?taatgaatat?agacatatat?atctatttag?attcattaac?atcaatatga 480

atgtaggaaa?tgctagaatg?acttacattg?tgaattgtga?aatggacgaa?gtacctacga 540

tggatggatg?caggatcatg?aaagaattaa?tgcaagatcg?tatctgccgc?atgcaaaatc 600

ttactaattg?cgctgcatat?atgcatgaca?gcctgcatgc?gggcgtgtaa?gcgtgttcat 660

ccattaggaa?gtaaccttgt?cattacttat?accagtacta?catactatat?agtattgatt 720

tcatgagcaa?atctacaaaa?ctggaaagca?ataagaaata?cgggactgga?aaagactcaa 780

cattaatcac?caaatatttc?gccttctcca?gcagaatata?tatctctcca?tcttgatcac 840

tgtacacact?gacagtgtac?gcataaacgc?agcagccagc?ttaactgtcg?tctcaccgtc 900

gcacactggc?cttccatctc?aggctagctt?tctcagccac?ccatcgtaca?tgtcaactcg 960

gcgcgcgcac?aggcacaaat?tacgtacaaa?acgcatgacc?aaatcaaaac?caccggagaa 1020

gaatcgctcc?cgcgcgcggc?ggcgacgcgc?acgtacgaac?gcacgcacgc?acgcccaacc 1080

ccacgacacg?atcgcgcgcg?acgccggcga?caccggccgt?ccacccgcgc?cctcacctcg 1140

ccgactataa?atacgtaggc?atctgcttga?tcttgtcatc?catctcacca?ccaaaaaaaa 1200

aaggaaaaaa?aaacaaaaca?caccaagcca?aataaaagcg?aca 1243

<210>261

<211>8

<212>PRT

<213> artificial sequence

<220>

<223> primitive 1

<220>

<221> is uncertain

<222>(2)..(3)

<223>Xaa can be any natural amino acid

<400>261

Phe?Xaa?Xaa?Lys?Tyr?Asn?Phe?Asp

1 5

<210>262

<211>8

<212>PRT

<213> artificial sequence

<220>

<223> primitive 2

<220>

<221> variant

<222>(1)..(1)

<223>/ displacement=" Leu "

<220>

<221> is uncertain

<222>(3)..(3)

<223>Xaa can be any natural amino acid

<400>262

Pro?Leu?Xaa?Gly?Arg?Tyr?Glu?Trp

1 5

<210>263

<211>10

<212>PRT

<213> artificial sequence

<220>

<223> primitive 3

<220>

<221> is uncertain

<222>(2)..(2)

<223>Xaa can be any natural amino acid

<220>

<221> variant

<222>(4)..(4)

<223>/ displacement=" Glu "

<220>

<221> is uncertain

<222>(7)..(9)

<223>Xaa can be any natural amino acid

<400>263

Glu?Xaa?Glu?Asp?Phe?Phe?Xaa?Xaa?Xaa?Glu

1 5 10

<210>264

<211>8

<212>PRT

<213> artificial sequence

<220>

<223> primitive 4

<220>

<221> is uncertain

<222>(2)..(2)

<223>Xaa can be any natural amino acid

<400>264

Tyr?Xaa?Gln?Leu?Arg?Ser?Arg?Arg

1 5

<210>265

<211>9

<212>PRT

<213> artificial sequence

<220>

<223> primitive 5

<220>

<221> variant

<222>(5)..(5)

<223>/ displacement=" Ile "

<220>

<221> variant

<222>(6)..(6)

<223>/ displacement=" Arg "

<220>

<221> is uncertain

<222>(8)..(8)

<223>Xaa can be any natural amino acid

<220>

<221> variant

<222>(9)..(9)

<223>/ displacement=" Arg "

<400>265

Met?Gly?Lys?Tyr?Met?Lys?Lys?Xaa?Lys

1 5

<210>266

<211>8

<212>PRT

<213> artificial sequence

<220>

<223> primitive 6

<220>

<221> is uncertain

<222>(2)..(2)

<223>Xaa can be any natural amino acid

<400>266

Ser?Xaa?Gly?Val?Arg?Thr?Arg?Ala

1 5

<210>267

<211>585

<212>DNA

<213> rice

<400>267

atgggcaagt?acatgcgcaa?ggccaaggtg?gtggtctccg?gcgaggtggt?ggccgccgcc 60

gtcatggagc?tcgccgcggc?gccgctcggg?gtgcgcaccc?gcgcccgctc?cctcgcgctg 120

cagaagaggc?agggcgggga?gtacctcgag?ctcaggagcc?gcaggctcga?gaagctccct 180

cctcccccgc?cgccgccgcc?gaggaggagg?gcgacggctg?cggctgcgac?tgctgatgcg 240

acggcgacgg?agagcgcgga?ggcggaggtg?tcgttcgggg?gggagaacgt?cctcgagctg 300

gaggccatgg?aaaggaatac?cagggagacg?acaccttgca?gcttgatcag?ggaccccgat 360

acgattagca?cccctggatc?taccacaagg?cgcagccact?cgagttctca?ttgcaaggtg 420

caaacacccg?tgcgccacaa?cattattcca?gcatcagcag?agctggaagc?gttcttcgcc 480

gccgaagagc?aacggcaacg?acaggctttc?atcgacaagt?ataactttga?tcctgtgaat 540

gactgccctc?ttcccggccg?atttgaatgg?gtcaagctag?actga 585

<210>268

<211>194

<212>PRT

<213> rice

<400>268

Met?Gly?Lys?Tyr?Met?Arg?Lys?Ala?Lys?Val?Val?Val?Ser?Gly?Glu?Val

1 5 10 15

Val?Ala?Ala?Ala?Val?Met?Glu?Leu?Ala?Ala?Ala?Pro?Leu?Gly?Val?Arg

20 25 30

Thr?Arg?Ala?Arg?Ser?Leu?Ala?Leu?Gln?Lys?Arg?Gln?Gly?Gly?Glu?Tyr

35 40 45

Leu?Glu?Leu?Arg?Ser?Arg?Arg?Leu?Glu?Lys?Leu?Pro?Pro?Pro?Pro?Pro

50 55 60

Pro?Pro?Pro?Arg?Arg?Arg?Ala?Thr?Ala?Ala?Ala?Ala?Thr?Ala?Asp?Ala

65 70 75 80

Thr?Ala?Thr?Glu?Ser?Ala?Glu?Ala?Glu?Val?Ser?Phe?Gly?Gly?Glu?Asn

85 90 95

Val?Leu?Glu?Leu?Glu?Ala?Met?Glu?Arg?Asn?Thr?Arg?Glu?Thr?Thr?Pro

100 105 110

Cys?Ser?Leu?Ile?Arg?Asp?Pro?Asp?Thr?Ile?Ser?Thr?Pro?Gly?Ser?Thr

115 120 125

Thr?Arg?Arg?Ser?His?Ser?Ser?Ser?His?Cys?Lys?Val?Gln?Thr?Pro?Val

130 135 140

Arg?His?Asn?Ile?Ile?Pro?Ala?Ser?Ala?Glu?Leu?Glu?Ala?Phe?Phe?Ala

145 150 155 160

Ala?Glu?Glu?Gln?Arg?Gln?Arg?Gln?Ala?Phe?Ile?Asp?Lys?Tyr?Asn?Phe

165 170 175

Asp?Pro?Val?Asn?Asp?Cys?Pro?Leu?Pro?Gly?Arg?Phe?Glu?Trp?Val?Lys

180 185 190

Leu?Asp

<210>269

<211>573

<212>DNA

<213> Zea mays

<400>269

atgggcaagt?acatgcgcaa?ggccaaggct?tccagcgagg?ttgtcatcat?ggatgtcgcc 60

gccgctccgc?tcggagtccg?cacccgagcg?cgcgccctcg?cgctgcagcg?tctgcaggag 120

caacagacgc?agtgggaaga?aggtgctggc?ggcgagtacc?tggagctaag?gaaccggagg 180

ctcgagaagc?tgccgccgcc?gccggcgacc?actaggaggt?cgggcgggag?gaaagcggca 240

gccgaggccg?ccgcaactaa?ggaggctgag?gcgtcgtacg?gggagaacat?gctcgagttg 300

gaggccatgg?agaggattac?cagggagacg?acgccttgca?gcttgattaa?cacccagatg 360

actagcactc?ctgggtccac?gagatccagc?cactcttgcc?accgcagggt?gaacgctcct 420

ccggtgcacg?ccgtcccaag?ttctagggag?atgaatgagt?acttcgctgc?cgaacagcga 480

cggcaacagc?aggatttcat?tgacaagtac?aacttcgatc?ctgcaaacga?ctgccctctc 540

ccaggcaggt?ttgagtgggt?gaagctagac?tga 573

<210>270

<211>190

<212>PRT

<213> Zea mays

<400>270

Met?Gly?Lys?Tyr?Met?Arg?Lys?Ala?Lys?Ala?Ser?Ser?Glu?Val?Val?Ile

1 5 10 15

Met?Asp?Val?Ala?Ala?Ala?Pro?Leu?Gly?Val?Arg?Thr?Arg?Ala?Arg?Ala

20 25 30

Leu?Ala?Leu?Gln?Arg?Leu?Gln?Glu?Gln?Gln?Thr?Gln?Trp?Glu?Glu?Gly

35 40 45

Ala?Gly?Gly?Glu?Tyr?Leu?Glu?Leu?Arg?Asn?Arg?Arg?Leu?Glu?Lys?Leu

50 55 60

Pro?Pro?Pro?Pro?Ala?Thr?Thr?Arg?Arg?Ser?Gly?Gly?Arg?Lys?Ala?Ala

65 70 75 80

Ala?Glu?Ala?Ala?Ala?Thr?Lys?Glu?Ala?Glu?Ala?Ser?Tyr?Gly?Glu?Asn

85 90 95

Met?Leu?Glu?Leu?Glu?Ala?Met?Glu?Arg?Ile?Thr?Arg?Glu?Thr?Thr?Pro

100 105 110

Cys?Ser?Leu?Ile?Asn?Thr?Gln?Met?Thr?Ser?Thr?Pro?Gly?Ser?Thr?Arg

115 120 125

Ser?Gly?His?Ser?Cys?His?Arg?Arg?Val?Asn?Ala?Pro?Pro?Val?His?Ala

130 135 140

Val?Pro?Ser?Ser?Arg?Glu?Met?Asn?Glu?Tyr?Phe?Ala?Ala?Glu?Gln?Arg

145 150 155 160

Arg?Gln?Gln?Gln?Asp?Phe?Ile?Asp?Lys?Tyr?Asn?Phe?Asp?Pro?Ala?Asn

165 170 175

Asp?Cys?Pro?Leu?Pro?Gly?Arg?Phe?Glu?Trp?Val?Lys?Leu?Asp

180 185 190

<210>271

<211>755

<212>DNA

<213> common wheat

<400>271

atgggcaagt?acatgcgcaa?gcccaaggtc?tccggcgagg?tggccgtcat?ggaggtcgcc 60

gccgcgccgc?taggggtccg?cacccgcgca?cgagcgctcg?cgatgcagag?gcagccgcag 120

ggggcggcgg?tggccaagga?ccagggggag?tacctggagc?tcaggagtcg?gaagctcgag 180

aagctgcccc?cgccgccgcc?ggcggcgagg?aggagggcgg?ccgcggcgga?gcgtgtcgag 240

gccgaggccg?aggccgacga?ggtgtccttc?ggtgagaacg?tgctcgagtc?ggaggccatg 300

gggaggggta?ccagggagac?gacgccctgc?agcttgatta?gggactcggg?aacgataagc 360

actcctggat?ccacaacaag?accgagccac?tcgaattccc?atcgcagggt?gcaagctcca 420

gcgcgccata?ttattccatg?ttcagcagag?atgaatgagt?tcttctctgc?tgcggagcaa 480

ccgcaacagc?aagccttcat?tgacaagtac?aactttgatc?ctgtgaacga?ctgtcctctc 540

ccaggccgat?acgagtgggt?gaagctagac?tgataattct?ccaggaagga?gagcaccatg 600

tacttctccg?ctccctccac?cttagcgtcg?tggtaaaggc?cgccccgtcg?tgtagctttg 660

tttccgttgt?aaaaagaata?gttagctgta?gtagcctcaa?tggcgttaca?tacagagtaa 720

tgctgattac?acctaatcct?caaaccatgt?acgtt 755

<210>272

<211>190

<212>PRT

<213> common wheat

<400>272

Met?Gly?Lys?Tyr?Met?Arg?Lys?Pro?Lys?Val?Ser?Gly?Glu?Val?Ala?Val

1 5 10 15

Met?Glu?Val?Ala?Ala?Ala?Pro?Leu?Gly?Val?Arg?Thr?Arg?Ala?Arg?Ala

20 25 30

Leu?Ala?Met?Gln?Arg?Gln?Pro?Gln?Gly?Ala?Ala?Val?Ala?Lys?Asp?Gln

35 40 45

Gly?Glu?Tyr?Leu?Glu?Leu?Arg?Ser?Arg?Lys?Leu?Glu?Lys?Leu?Pro?Pro

50 55 60

Pro?Pro?Pro?Ala?Ala?Arg?Arg?Arg?Ala?Ala?Ala?Ala?Glu?Arg?Val?Glu

65 70 75 80

Ala?Glu?Ala?Glu?Ala?Asp?Glu?Val?Ser?Phe?Gly?Glu?Asn?Val?Leu?Glu

85 90 95

Ser?Glu?Ala?Met?Gly?Arg?Gly?Thr?Arg?Glu?Thr?Thr?Pro?Cys?Ser?Leu

100 105 110

Ile?Arg?Asp?Ser?Gly?Thr?Ile?Ser?Thr?Pro?Gly?Ser?Thr?Thr?Arg?Pro

115 120 125

Ser?His?Ser?Asn?Ser?His?Arg?Arg?Val?Gln?Ala?Pro?Ala?Arg?His?Ile

130 135 140

Ile?Pro?Cys?Ser?Ala?Glu?Met?Asn?Glu?Phe?Phe?Ser?Ala?Ala?Glu?Gln

145 150 155 160

Pro?Gln?Gln?Gln?Ala?Phe?Ile?Asp?Lys?Tyr?Asn?Phe?Asp?Pro?Val?Asn

165 170 175

Asp?Cys?Pro?Leu?Pro?Gly?Arg?Tyr?Glu?Trp?Val?Lys?Leu?Asp

180 185 190

<210>273

<211>666

<212>DNA

<213> rice

<400>273

atggggaagt?acatgcggaa?ggggaaggtg?tcgggggagg?tggcggtgat?ggaggtgggc 60

ggggcgctgc?tcggcgtccg?cacccgctcc?cgcacgctcg?cgctgcagcg?gacgacctcg 120

tcgcagaagc?cgccggagaa?gggggagggg?gaccccggtg?cgggcgcggg?cgcgggggcg 180

gagtacctcg?agctcaggag?ccggaggctc?gagaagccgc?ctccgcacac?gccgccggcc 240

aaggagaagg?agaccgccag?gagggcttcc?gccgccgccg?ccgccgccgt?gaggatgccg 300

gcggcgccgc?aagcggccga?ggagttcgag?gcggaggtcg?aggtgtcctt?cggcgacaac 360

gttcttgacc?tcgacggcga?cgccatggag?aggagtacca?gggagacaac?gccttgcagt 420

ttaattagga?gctcagaaat?gataagcacc?cctggctcca?caactaaaac?caacacctcg 480

atcagttccc?ggcgcagaat?ggagacctct?gtttgtcgtt?acgttccgag?ttctcttgag 540

atggaagagt?tctttgcagc?tgctgaacaa?cagcaacatc?aggctttcag?agagaggtat 600

aacttctgtc?ctgtgaacga?ctgcccactt?cctggacggt?acgaatggac?aaggctagac 660

tgctag 666

<210>274

<211>221

<212>PRT

<213> rice

<400>274

Met?Gly?Lys?Tyr?Met?Arg?Lys?Gly?Lys?Val?Ser?Gly?Glu?Val?Ala?Val

1 5 10 15

Met?Glu?Val?Gly?Gly?Ala?Leu?Leu?Gly?Val?Arg?Thr?Arg?Ser?Arg?Thr

20 25 30

Lau?Ala?Leu?Gln?Arg?Thr?Thr?Ser?Ser?Gln?Lys?Pro?Pro?Glu?Lys?Gly

35 40 45

Glu?Gly?Asp?Pro?Gly?Ala?Gly?Ala?Gly?Ala?Gly?Ala?Glu?Tyr?Leu?Glu

50 55 60

Leu?Arg?Ser?Arg?Arg?Leu?Glu?Lys?Pro?Pro?Pro?His?Thr?Pro?Pro?Ala

65 70 75 80

Lys?Glu?Lys?Glu?Thr?Ala?Arg?Arg?Ala?Ser?Ala?Ala?Ala?Ala?Ala?Ala

85 90 95

Val?Arg?Met?Pro?Ala?Ala?Pro?Gln?Ala?Ala?Glu?Glu?Phe?Glu?Ala?Glu

100 105 110

Val?Glu?Val?Ser?Phe?Gly?Asp?Asn?Val?Leu?Asp?Leu?Asp?Gly?Asp?Ala

115 120 125

Met?Glu?Arg?Ser?Thr?Arg?Glu?Thr?Thr?Pro?Cys?Ser?Leu?Ile?Arg?Ser

130 135 140

Ser?Glu?Met?Ile?Ser?Thr?Pro?Gly?Ser?Thr?Thr?Lys?Thr?Asn?Thr?Ser

145 150 155 160

Ile?Ser?Ser?Arg?Arg?Arg?Met?Glu?Thr?Ser?Val?Cys?Arg?Tyr?Val?Pro

165 170 175

Ser?Ser?Leu?Glu?Met?Glu?Glu?Phe?Phe?Ala?Ala?Ala?Glu?Gln?Gln?Gln

180 185 190

His?Gln?Ala?Phe?Arg?Glu?Arg?Tyr?Asn?Phe?Cys?Pro?Val?Asn?Asp?Cys

195 200 205

Pro?Leu?Pro?Gly?Arg?Tyr?Glu?Trp?Thr?Arg?Leu?Asp?Cys

210 215 220

<210>275

<211>642

<212>DNA

<213> Zea mays

<400>275

atggggaagt?acatgcgcaa?gggcaaggtg?tccggggagg?tcgccgtcat?ggaggtaccc 60

ggcggcgcgc?tgctcggcgt?ccgcacccgc?tcccgcacgc?tcgcgctgca?gcgcgcgcag 120

aggccgctcg?acaagggcga?cgcggaggac?gccgccgcgg?agtacctcga?gctcaggagc 180

cggaggctcg?agaagccgca?caaggagcat?ccgtcgccgc?ccgcgaccgc?gaccaagagg 240

ggcgccggga?ggaaggccgc?cgccgccgcc?gcggtgcagc?acgtgctgat?gcaggacgag 300

gtcgaggtcg?aggtctcgtt?cggggacaac?gtgcttgact?tggacaccat?ggaaaggagt 360

accagagaga?caacaccgtg?cagcctgatt?aggaacccag?agatgataag?caccccagga 420

tccacaacta?aaagcaaaac?cagcagcaac?tcgacgactt?cccgccgcag?aacggaggaa 480

accccgagct?gccggttcat?accgagctcg?ctcgagatgg?aggagttctt?ctcggcggcc 540

gagcaacagg?agcagcatag?cttcagggag?aagtacaact?tctgtcccgt?gaacgactgt 600

cctctccctg?gccggtacga?atgggcgagg?ctagactgct?ag 642

<210>276

<211>213

<212>PRT

<213> Zea mays

<400>276

Met?Gly?Lys?Tyr?Met?Arg?Lys?Gly?Lys?Val?Ser?Gly?Glu?Val?Ala?Val

1 5 10 15

Met?Glu?Val?Pro?Gly?Gly?Ala?Lau?Leu?Gly?Val?Arg?Thr?Arg?Ser?Arg

20 25 30

Thr?Leu?Ala?Leu?Gln?Arg?Ala?Gln?Arg?Pro?Leu?Asp?Lys?Gly?Asp?Ala

35 40 45

Glu?Asp?Ala?Ala?Ala?Glu?Tyr?Leu?Glu?Leu?Arg?Ser?Arg?Arg?Leu?Glu

50 55 60

Lys?Pro?His?Lys?Glu?His?Pro?Ser?Pro?Pro?Ala?Thr?Ala?Thr?Lys?Arg

65 70 75 80

Gly?Ala?Gly?Arg?Lys?Ala?Ala?Ala?Ala?Ala?Ala?Val?Gln?His?Val?Leu

85 90 95

Met?Gln?Asp?Glu?Val?Glu?Val?Glu?Val?Ser?Phe?Gly?Asp?Asn?Val?Leu

100 105 110

Asp?Leu?Asp?Thr?Met?Glu?Arg?Ser?Thr?Arg?Glu?Thr?Thr?Pro?Cys?Ser

115 120 125

Leu?Ile?Arg?Asn?Pro?Glu?Met?Ile?Ser?Thr?Pro?Gly?Ser?Thr?Thr?Lys

130 135 140

Ser?Lys?Thr?Ser?Ser?Asn?Ser?Thr?Thr?Ser?Arg?Arg?Arg?Thr?Glu?Glu

145 150 155 160

Thr?Pro?Ser?Cys?Arg?Phe?Ile?Pro?Ser?Ser?Leu?Glu?Met?Glu?Glu?Phe

165 170 175

Phe?Ser?Ala?Ala?Glu?Gln?Gln?Glu?Gln?His?Ser?Phe?Arg?Glu?Lys?Tyr

180 185 190

Asn?Phe?Cys?Pro?Val?Asn?Asp?Cys?Pro?Leu?Pro?Gly?Arg?Tyr?Glu?Trp

195 200 205

Ala?Arg?Leu?Asp?Cys

210

<210>277

<211>642

<212>DNA

<213> Chinese sorghum

<400>277

atggggaagt?acatgcgcaa?gggcaaggtg?tccggggagg?tcgccgtcat?ggaggtcccc 60

ggcggcgcgc?tgctcggcgt?ccgcacccgc?tcccgcacgc?tcgcgctgca?gcgcgcgcag 120

aggccgctcg?acaagggcga?cgccgaggac?gccgctgcgg?agtacctcga?gctcaggagc 180

cggaggctcg?agaagccgca?caaggacccg?ttaccgccgc?cgtctgcgcc?tgcgaccaag 240

aggggcgccg?ggaggaaggt?cgccaccgcc?gccgccgccg?ccgcggcgcc?gcacgggctg 300

gcggaggacg?acgtcgaggt?ctccttcggc?gagaacgtgc?tcgacttcga?cgccatggaa 360

aggagtacca?gagagacaac?accgtgcagt?ttgattagga?acccagagat?gataagcacc 420

ccaggatcca?caactaagag?taaaaccagc?aactcgatga?cctcccgtcg?cagaatggaa 480

acctcaatct?gccgtttcat?accaagttcg?catgagatgg?aagagttctt?ctcagcagct 540

gaaaaacagg?agcagcaaag?cttcagggag?aagtataact?tctgtcctgt?gaacgactgt 600

cctcttccgg?gtcggtatga?atgggcgagg?ctagactgct?ag 642

<210>278

<211>213

<212>PRT

<213> Chinese sorghum

<400>278

Met?Gly?Lys?Tyr?Met?Arg?Lys?Gly?Lys?Val?Ser?Gly?Glu?Val?Ala?Val

1 5 10 15

Met?Glu?Val?Pro?Gly?Gly?Ala?Lau?Lau?Gly?Val?Arg?Thr?Arg?Ser?Arg

20 25 30

Thr?Leu?Ala?Lau?Gln?Arg?Ala?Gln?Arg?Pro?Leu?Asp?Lys?Gly?Asp?Ala

35 40 45

Glu?Asp?Ala?Ala?Ala?Glu?Tyr?Leu?Glu?Leu?Arg?Ser?Arg?Arg?Leu?Glu

50 55 60

Lys?Pro?His?Lys?Asp?Pro?Lau?Pro?Pro?Pro?Ser?Ala?Pro?Ala?Thr?Lys

65 70 75 80

Arg?Gly?Ala?Gly?Arg?Lys?Val?Ala?Thr?Ala?Ala?Ala?Ala?Ala?Ala?Ala

85 90 95

Pro?His?Gly?Leu?Ala?Glu?Asp?Asp?Val?Glu?Val?Ser?Phe?Gly?Glu?Asn

100 105 110

Val?Leu?Asp?Phe?Asp?Ala?Met?Glu?Arg?Ser?Thr?Arg?Glu?Thr?Thr?Pro

115 120 125

Cys?Ser?Lau?Ile?Arg?Asn?Pro?Glu?Met?Ile?Ser?Thr?Pro?Gly?Ser?Thr

130 135 140

Thr?Lys?Ser?Lys?Thr?Ser?Asn?Ser?Met?Thr?Ser?Arg?Arg?Arg?Met?Glu

145 150 155 160

Thr?Ser?Ile?Cys?Arg?Phe?Ile?Pro?Ser?Ser?His?Glu?Met?Glu?Glu?Phe

165 170 175

Phe?Ser?Ala?Ala?Glu?Lys?Gln?Glu?Gln?Gln?Ser?Phe?Arg?Glu?Lys?Tyr

180 185 190

Asn?Phe?Cys?Pro?Val?Asn?Asp?Cys?Pro?Leu?Pro?Gly?Arg?Tyr?Glu?Trp

195 200 205

Ala?Arg?Leu?Asp?Cys

210

<210>279

<211>397

<212>DNA

<213> sugarcane

<220>

<221>misc_feature

<222>(342)..(343)

<223>n is a, c, g, or t

<400>279

gtcgacccac?gcgtccggta?cttcgctgct?gaacagcgac?gccaacaaca?ggctttcatt 60

gacaagtaca?actttgatcc?tgtaaatgac?tgccctctcc?caggcaggtt?tgaatgggtg 120

aagctagact?gattgattca?gaggacaaga?gagcagcagc?atggaactca?cctccgctcc 180

ctccaccacc?gcagtgttgt?ggcagaggcg?cataccgtcg?tgttagcttt?gtttctgttg 240

taaaaactta?gtgttagcct?gtagccttaa?ttgtcgtgtg?ttacagtaca?aaactgatgc 300

tgagttacaa?caccctgatc?tgatctgatc?cctcaactca?gnngtaaccc?ttaacagctt 360

attctgtaag?gaaccttacc?cacccttgtt?accagtt 397

<210>280

<211>37

<212>PRT

<213> sugarcane

<400>280

Tyr?Phe?Ala?Ala?Glu?Gln?Arg?Arg?Gln?Gln?Gln?Ala?Phe?Ile?Asp?Lys

1 5 10 15

Tyr?Asn?Phe?Asp?Pro?Val?Asn?Asp?Cys?Pro?Leu?Pro?Gly?Arg?Phe?Glu

20 25 30

Trp?Val?Lys?Leu?Asp

35

<210>281

<211>654

<212>DNA

<213> rice

<400>281

cttctacatc?ggcttaggtg?tagcaacacg?actttattat?tattattatt?attattatta 60

ttattttaca?aaaatataaa?atagatcagt?ccctcaccac?aagtagagca?agttggtgag 120

ttattgtaaa?gttctacaaa?gctaatttaa?aagttattgc?attaacttat?ttcatattac 180

aaacaagagt?gtcaatggaa?caatgaaaac?catatgacat?actataattt?tgtttttatt 240

attgaaatta?tataattcaa?agagaataaa?tccacatagc?cgtaaagttc?tacatgtggt 300

gcattaccaa?aatatatata?gcttacaaaa?catgacaagc?ttagtttgaa?aaattgcaat 360

ccttatcaca?ttgacacata?aagtgagtga?tgagtcataa?tattattttc?tttgctaccc 420

atcatgtata?tatgatagcc?acaaagttac?tttgatgatg?atatcaaaga?acatttttag 480

gtgcacctaa?cagaatatcc?aaataatatg?actcacttag?atcataatag?agcatcaagt 540

aaaactaaca?ctctaaagca?accgatggga?aagcatctat?aaatagacaa?gcacaatgaa 600

aatcctcatc?atccttcacc?acaattcaaa?tattatagtt?gaagcatagt?agta 654

<210>282

<211>1243

<212>DNA

<213> rice

<400>282

aaaaccaccg?agggacctga?tctgcaccgg?ttttgatagt?tgagggaccc?gttgtgtctg 60

gttttccgat?cgagggacga?aaatcggatt?cggtgtaaag?ttaagggacc?tcagatgaac 120

ttattccgga?gcatgattgg?gaagggagga?cataaggccc?atgtcgcatg?tgtttggacg 180

gtccagatct?ccagatcact?cagcaggatc?ggccgcgttc?gcgtagcacc?cgcggtttga 240

ttcggcttcc?cgcaaggcgg?cggccggtgg?ccgtgccgcc?gtagcttccg?ccggaagcga 300

gcacgccgcc?gccgccgacc?cggctctgcg?tttgcaccgc?cttgcacgcg?atacatcggg 360

atagatagct?actactctct?ccgtttcaca?atgtaaatca?ttctactatt?ttccacattc 420

atattgatgt?taatgaatat?agacatatat?atctatttag?attcattaac?atcaatatga 480

atgtaggaaa?tgctagaatg?acttacattg?tgaattgtga?aatggacgaa?gtacctacga 540

tggatggatg?caggatcatg?aaagaattaa?tgcaagatcg?tatctgccgc?atgcaaaatc 600

ttactaattg?cgctgcatat?atgcatgaca?gcctgcatgc?gggcgtgtaa?gcgtgttcat 660

ccattaggaa?gtaaccttgt?cattacttat?accagtacta?catactatat?agtattgatt 720

tcatgagcaa?atctacaaaa?ctggaaagca?ataagaaata?cgggactgga?aaagactcaa 780

cattaatcac?caaatatttc?gccttctcca?gcagaatata?tatctctcca?tcttgatcac 840

tgtacacact?gacagtgtac?gcataaacgc?agcagccagc?ttaactgtcg?tctcaccgtc 900

gcacactggc?cttccatctc?aggctagctt?tctcagccac?ccatcgtaca?tgtcaactcg 960

gcgcgcgcac?aggcacaaat?tacgtacaaa?acgcatgacc?aaatcaaaac?caccggagaa 1020

gaatcgctcc?cgcgcgcggc?ggcgacgcgc?acgtacgaac?gcacgcacgc?acgcccaacc 1080

ccacgacacg?atcgcgcgcg?acgccggcga?caccggccgt?ccacccgcgc?cctcacctcg 1140

ccgactataa?atacgtaggc?atctgcttga?tcttgtcatc?catctcacca?ccaaaaaaaa 1200

aaggaaaaaa?aaacaaaaca?caccaagcca?aataaaagcg?aca 1243

<210>283

<211>315

<212>DNA

<213> tobacco (Nicotiana tabacum)

<400>283

ctgccattct?ttagagggga?tgcttgttta?agaacaaaaa?atatatcact?ttcttttgtt 60

ccaagtcatt?gcgtattttt?ttaaaaatat?ttgttccttc?gtatatttcg?agcttcaatc 120

actttatggt?tctttgtatt?ctggctttgc?tgtaaatcgt?agctaacctt?cttcctagca 180

gaaattatta?atacttggga?tattttttta?gaatcaagta?aattacatat?taccaccaca 240

tcgagctgct?tttaaattca?tattacagcc?atataggctt?gattcatttt?gcaaaatttc 300

caggatattg?acaac 315

<210>284

<211>53

<212>DNA

<213> artificial sequence

<220>

<223> primer: prm00472

<400>284

ggggacaagt?ttgtacaaaa?aagcaggctt?cacaatgggc?aagtacatgc?gca 53

<210>285

<211>53

<212>DNA

<213> artificial sequence

<220>

<223> primer: prm00473

<400>285

ggggaccact?ttgtacaaga?aagctgggtg?gagcagagag?gtccatggtg?ccc 53

Officinalis

Euphorbia esula L

Ceratopteris?richardii

Orchid at the age of one hundred years old

1. for compare the method that increases monocotyledonous seed production and/or increase monocotyledonous growth velocity with corresponding wild-type monocotyledons, the method is included in the expression that regulates nucleic acid in monocotyledons, and optionally selects to have the plant of the growth characteristics of improvement;

The adjusting of wherein said expression realizes by import and express the SYR nucleic acid of the aminoacid sequence of coding SEQ ID NO:2 in plant,

Wherein monocotyledons is sugarcane or cereal.

2. the process of claim 1 wherein that described nucleic acid is the sequence of SEQ ID NO:1.

3. the process of claim 1 wherein that described SYR nucleic acid cross to express in monocotyledons.

4. the method for any one of claims 1 to 3, wherein said SYR nucleic acid is plant origin.

5. the method for claim 4, wherein said SYR nucleic acid is from grass.

6. the method for any one of claims 1 to 3, wherein said SYR nucleic acid is effectively connected with constitutive promoter.

7. the method for claim 6, wherein said constitutive promoter is GOS2 promotor or high mobility group protein promotor.

8. the method for any one of claims 1 to 3, the seed production of wherein said increase is selected from: the harvest index of the seed gross weight of increase, the full seed number of increase, the full rate of seed or increase.

9. the method for any one of claims 1 to 3, the growth velocity of wherein said increase is at least included in the seed production of the increase obtaining in the situation that flowering time do not postpone.

10. the method for any one of claims 1 to 3, described plant wherein grows under non-stress condition.

11. the method for any one of claims 1 to 3, described plant wherein grows under abiotic stress condition.

The method of 12. claims 11, wherein said abiotic stress condition is osmotic stress condition.

13. 1 kinds of constructs, it comprises:

(i) the SYR nucleic acid of the aminoacid sequence of coding SEQ ID NO:2;

(ii) can drive one or more control sequences of the nucleotide sequence expression of (i), this control sequence is GOS2 promotor or high mobility group protein HMGP promotor; Optionally

(iii) transcription termination sequence.

The construct of 14. claims 13, wherein said GOS2 promotor is the promotor being represented by SEQ ID NO:5.

The construct of 15. claims 13, wherein said HMGP promotor is the promotor being represented by SEQ ID NO:33.

16. for generation of comparing the method for the transgenic plant of the output with increase with corresponding wild-type plant, the method comprises:

(a) in plant or vegetable cell, import and express the SYR nucleic acid of the aminoacid sequence of coding SEQ ID NO:2, described nucleic acid is effectively connected with GOS2 promotor or high mobility group protein promotor; With

(b) culturing plants cell under the condition of Promoting plant growth and growth,

Wherein said plant is sugarcane or cereal.

The method of 17. claims 16, wherein said plant is rice, corn, wheat, barley, grain, rye, oat or Chinese sorghum.

The plant of the transgenic plant that 18. methods according to claim 16 or 17 obtain can be gathered in the crops part, and described to gather in the crops part be not propagulum, and the described SYR nucleic acid of gathering in the crops the aminoacid sequence that part comprises coding SEQ ID NO:2.

19. are directed to the transgenic plant that obtain according to the method for claim 16 or 17 and/or derive from the product that can gather in the crops part according to the plant of the transgenic plant of the method acquisition of claim 16 or 17.

SYR nucleic acid/the gene of 20. coding SYR polypeptide or SYR polypeptide are for comparing the purposes that improves seed production with corresponding wild-type plant, wherein said SYR polypeptide is the aminoacid sequence of SEQ ID NO:2, and wherein said plant is sugarcane or cereal.

The purposes of 21. claims 20, wherein said seed production is: one or more in the harvest index of the seed gross weight of increase, the full seed number of increase or increase.

SYR nucleic acid/the gene of 22. coding SYR polypeptide or SYR polypeptide improve the purposes of plant to the resistance of abiotic stress for comparing with corresponding wild-type plant, wherein said SYR polypeptide is the aminoacid sequence of SEQ ID NO:2, and wherein said plant is sugarcane or cereal.

SYR nucleic acid/the gene of 23. coding SYR polypeptide or SYR polypeptide are as the purposes of the molecule marker of the plant seed output increasing, and wherein said SYR polypeptide is the aminoacid sequence of SEQ ID NO:2, and wherein said plant is sugarcane or cereal.