WO2024106939A1 - B7-h3에 특이적으로 결합하는 항체 - Google Patents

B7-h3에 특이적으로 결합하는 항체 Download PDF

Info

Publication number
WO2024106939A1
WO2024106939A1 PCT/KR2023/018360 KR2023018360W WO2024106939A1 WO 2024106939 A1 WO2024106939 A1 WO 2024106939A1 KR 2023018360 W KR2023018360 W KR 2023018360W WO 2024106939 A1 WO2024106939 A1 WO 2024106939A1
Authority
WO
WIPO (PCT)
Prior art keywords
antibody
cancer
antigen
binding fragment
vector
Prior art date
Application number
PCT/KR2023/018360
Other languages
English (en)
French (fr)
Inventor
주안나
김민구
이보람
이상은
전영하
이송재
송성원
이지철
민성원
가원혜
권형선
이경희
배공득
김남혁
이진의
Original Assignee
주식회사 셀랩메드
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority claimed from KR1020230154552A external-priority patent/KR20240072932A/ko
Application filed by 주식회사 셀랩메드 filed Critical 주식회사 셀랩메드
Publication of WO2024106939A1 publication Critical patent/WO2024106939A1/ko

Links

Images

Classifications

    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00—Antineoplastic agents
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants

Definitions

  • the present invention relates to an antibody or antigen-binding fragment thereof that specifically binds to B7-H3.
  • the global solid anticancer drug market is expected to grow at an average annual rate of 12.5% from approximately $101 billion (approximately KRW 126 trillion) in 2021 to approximately $252 billion (approximately KRW 310 trillion) in 2028.
  • the market size by detailed disease in 2028 was approximately $52 billion (approximately KRW 65 trillion) for non-small cell lung cancer, approximately $46 billion (approximately KRW 57 trillion) for breast cancer, and approximately $46 billion (approximately KRW 57 trillion) for breast cancer.
  • breast cancer stomach cancer, colon cancer, liver cancer, lung cancer, and cervical cancer
  • five of the six major cancer types are lung cancer, colon cancer, liver cancer, stomach cancer, and cervical cancer.
  • the incidence rate shows a decreasing trend or no significant increase over the past 10 years.
  • the incidence rate of the remaining breast cancers has been continuously increasing for the past 20 years.
  • Breast cancer is classified based on three indicators: estrogen receptor, progesterone receptor, and epidermal growth factor (HER2). If all three indicators are tested negative (not detected), triple negative breast cancer is diagnosed.
  • the five-year survival rate after diagnosis for breast cancer is over 90%, but for triple-negative breast cancer, it is around 70%.
  • the 5-year survival rate for stage 3-4 triple negative breast cancer patients is only about 30%. This is a low figure compared to the 5-year survival rate of about 50% for other stage 3 and 4 breast cancer patients, excluding triple-negative breast cancer.
  • the progression of triple-negative breast cancer is rapid and aggressive, with approximately 30% of patients diagnosed early experiencing the risk of death within 5 years after surgery.
  • triple-negative breast cancer In the case of triple-negative breast cancer, there are many mutations in cancer cells, and because metastasis to other organs is faster than that of other breast cancers, there are several limitations in treatment. In addition, triple-negative breast cancer has a poor prognosis, with approximately 50% of patients experiencing recurrence even if treated early. Current breast cancer treatments target estrogen, progesterone, and epidermal growth factor receptors. Therefore, it is difficult for triple-negative breast cancer patients who are negative for these receptors to expect treatment effects using the drug.
  • childhood cancer occurs at a significant rate.
  • the incidence of childhood cancer is similar throughout the world, and in Korea, about 1,000 to 1,200 people are diagnosed with childhood cancer every year. This means that approximately 1 per 100,000 children are diagnosed with childhood cancer each year, accounting for approximately 1% of all cancer patients.
  • Pediatric cancer is a very dangerous disease that ranks first in disease mortality among children between the ages of 1 and 9, exceeding the number of children who die in traffic accidents.
  • lymphoblastic leukemia a leukemia in which lymphoid white blood cells do not mature properly and turn into cancer cells
  • has very good treatment results with a cure rate of about 80-90%
  • acute myeloid leukemia also shows a cure rate of 70%.
  • the prognosis for pediatric brain tumors is poor, so the development of new treatments is necessary.
  • 247,952 new cases of cancer occurred in Korea in 2020, of which brain tumors were confirmed to account for 1,795 cases, or 0.7% of all cancer cases.
  • brain tumors that occur frequently in children and adolescents include medulloblastoma, astrocytoma, ependymoma, craniopharyngioma, brainstem glioma, and germ cell tumor. cell tumor), and brain tumors can be classified according to their malignancy, location, and constituent cells.
  • brainstem glioma is a glioma that occurs in the midbrain, pons, and medulla of the brain. It causes multiple cranial nerve disorders such as dysarthria, dysphagia, strabismus, and facial paralysis, as well as hemiparesis, and has a 2-year survival rate of less than 10%. is the worst pediatric brain tumor.
  • the most basic treatment for brain tumors is surgery or a combination of surgery and radiation therapy, and chemotherapy may also be attempted depending on the tumor tissue results.
  • Cerebellar mutism syndrome CMS occurs in 25% of surgical patients. Cerebellar mutism syndrome is a condition that can occur in patients who have undergone surgery to remove a tumor from a specific part of the brain, including the cerebellum. Symptoms appear about 1 to 2 days after surgery and include decreased speech, difficulty walking due to difficulty maintaining balance, and loss of muscle tension. Symptoms of cerebellar mutism syndrome gradually disappear over time. However, there are also difficulties in conducting radiation irradiation immediately after surgery. Postoperative adjuvant craniospinal radiotherapy is used to treat the entire brain and spine for vesicles to prevent their spread in the cerebrospinal fluid (CSF). Craniospinal radiotherapy undoubtedly prolongs survival. Unfortunately, radiation therapy comes at the cost of a 2-4 point decline in Intelligence Quotient (IQ) per year.
  • IQ Intelligence Quotient
  • Leptomeningeal metastatic cancer is known to occur in approximately 5-20% of all solid cancers, of which lung cancer, breast cancer, and melanoma account for a large proportion.
  • the proportion of patients with leptomeningeal metastasis is also frequently found in lung cancer, breast cancer, and melanoma (Cancers (Basel). 2021;13).
  • Cancers (Basel). 2021;13) According to the 2020 national cancer registration statistics, it is known that 28,949 people were diagnosed with lung cancer and 24,923 people with breast cancer in 2020, so the number of patients with leptomeningeal metastasis from the above two cancers is expected to be at least 2,500 per year in Korea.
  • Tagrisso which effectively crosses the blood-brain barrier, are known to be effective in leptomeningeal metastasis cancer, but the number of patients to whom they can be applied is limited and the targeted treatments have the problem of developing resistance (Neurotherapeutics. 2022;19:1782- 1798).
  • B7-H3 is known to be highly expressed in various carcinomas, including pediatric brain cancer, leptomeningeal metastasis cancer, and triple-negative breast cancer, and such high expression of B7-H3 is associated with negative clinical treatment results.
  • treatment of human triple-negative breast cancer cell lines with a monoclonal antibody that specifically binds to B7-H3 resulted in inhibition of the growth of triple-negative breast cancer cells. Therefore, the present inventor confirmed the relationship of B7-H3, which is highly expressed in cancer, to various cancers and its potential as a therapeutic agent for triple-negative breast cancer, etc., and came to the present invention.
  • the present inventors attempted to develop an antibody targeting B7-H3, which is highly expressed in solid tumors.
  • the present inventors completed the present invention by discovering an anti-B7-H3 antibody that specifically binds to various types of cancer cell lines expressing B7-H3 and exhibits a T cell-mediated cancer cell killing effect.
  • the purpose of the present invention is to provide an anti-B7-H3 antibody or antigen-binding fragment thereof that specifically binds to B7-H3.
  • Another object of the present invention is to provide an anti-B7-H3 antibody or antigen-binding fragment thereof that binds to a specific epitope located within the amino acid sequence of the domain of B7-H3.
  • Another object of the present invention is to provide a nucleic acid encoding the anti-B7-H3 antibody or antigen-binding fragment thereof.
  • Another object of the present invention is to provide a vector containing the above nucleic acid.
  • Another object of the present invention is to provide cells containing the vector.
  • Another object of the present invention is to provide cells transformed with the vector.
  • Another object of the present invention is the anti-B7-H3 antibody or antigen-binding fragment thereof, the nucleic acid encoding the antibody or antigen-binding fragment thereof, the vector comprising the nucleic acid, and the transformation comprising the vector or the vector.
  • the aim is to provide a composition comprising a component selected from the group consisting of cells.
  • Another object of the present invention is the anti-B7-H3 antibody or antigen-binding fragment thereof, the nucleic acid encoding the antibody or antigen-binding fragment thereof, the vector comprising the nucleic acid, and the transformation comprising the vector or the vector.
  • the aim is to provide a pharmaceutical composition for preventing or treating cancer, comprising an ingredient selected from the group consisting of cells and a pharmaceutically acceptable carrier.
  • Another object of the present invention is to provide the anti-B7-H3 antibody or antigen-binding fragment thereof, a nucleic acid encoding the antibody or antigen-binding fragment thereof, a vector comprising the nucleic acid, and the vector to a subject in need thereof.
  • the aim is to provide a method of treating cancer, comprising administering a component selected from the group consisting of cells transformed with the vector.
  • Another object of the present invention is the anti-B7-H3 antibody or antigen-binding fragment thereof, the nucleic acid encoding the antibody or antigen-binding fragment thereof, the vector comprising the nucleic acid, and the transformation comprising the vector or the vector.
  • the aim is to provide a composition for diagnosing cancer, which is characterized in that it contains a component selected from the group consisting of cells.
  • the present invention provides an anti-B7-H3 antibody or antigen-binding fragment thereof that specifically binds to B7-H3.
  • B7-family proteins are expressed on the surface of antigen presenting cells (APC), including cancer cells, and regulate T cell actions through interaction with T cell surface proteins.
  • APC antigen presenting cells
  • B7-H3 is one of the B7 family proteins expressed in APC and is known as an immune checkpoint that inhibits the action of T cells (Front Immunol. 2021; 12: 701006). Since B7 family proteins regulate T cell actions through different mechanisms, the specificity of antibodies targeting B7-H3 for B7-H3 is very important.
  • an “antibody” is a term in the art and can be used interchangeably herein, and refers to a molecule having an antigen binding site that specifically binds to an antigen. As used herein, the term includes whole antibodies and any antigen-binding fragments (i.e., “antigen-binding portions”) or single chains thereof. In one embodiment, an “antibody” refers to a glycoprotein, or an antigen-binding portion thereof, comprising at least two heavy (H) and two light (L) chains interconnected by disulfide bonds. In other embodiments, “antibody” refers to a single chain antibody comprising a single variable domain, e.g., a VHH domain.
  • Each heavy chain consists of a heavy chain variable region (abbreviated as VH) and a heavy chain constant region.
  • the heavy chain constant region consists of three domains CH1, CH2, and CH3.
  • each light chain consists of a light chain variable region (abbreviated as VL) and a light chain constant region.
  • the light chain constant region consists of one domain CL.
  • VH and VL regions can be further subdivided into regions of hypervariability, called complementarity-determining regions (CDR), interspersed with more conserved regions, called framework regions (FR).
  • CDR complementarity-determining regions
  • FR framework regions
  • Each VH and VL consists of three CDRs and four FRs, arranged from amino-terminus to carboxy-terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, and FR4.
  • the variable regions of the heavy and light chains contain binding domains that interact with antigen.
  • the constant region of the antibody may mediate the binding of the immunoglobulin to host tissues or factors, including various cells of the immune system (e.g., effector cells) and the first component of the orthodox complement system (C1q).
  • Antibodies may be of any type (e.g., IgG, IgE, IgM, IgD, IgA, or IgY), any type (e.g., IgD, IgG2, IgG3, IgG4, IgA1, or IgA2), or any subtype of immunoglobulin molecule. (e.g., IgG1, IgG2, IgG3, and IgG4 in humans; and IgG1, IgG2a, IgG2b, and IgG3 in mice). Immunoglobulins, such as IgG1, exist in several allotypes, which differ from each other by up to several amino acids.
  • Antibodies disclosed herein may be derived from any of the commonly known isotypes, types, subtypes, or allotypes.
  • the antibodies disclosed herein are of the IgG1, IgG2, IgG3, or IgG4 subtype or any hybrid thereof.
  • the antibody is of the human IgG1 subtype or the human IgG2 or human IgG4 subtype.
  • Antibody includes, for example, naturally-occurring and non-naturally-occurring antibodies; monoclonal and polyclonal antibodies; chimeric and humanized antibodies; Human and non-human antibodies, fully synthetic antibodies; single chain antibody; monospecific antibodies; multispecific antibodies (including bispecific antibodies); Tetrameric antibodies containing two heavy and two light chain molecules; antibody light chain monomer; antibody heavy chain monomer; antibody light chain dimer; antibody heavy chain dimer; antibody light chain-antibody heavy chain pair; intrabody; heteroconjugate antibodies; monovalent antibody; Camelized antibodies; apibody; A combination consisting of an anti-idiotypic (anti-Id) antibody (including, for example, an anti-anti-Id antibody) and a single monomeric variable antibody domain (e.g., a VH domain or a VL domain) sufficiently capable of antigen binding. Includes single-domain antibodies (sdAb) containing molecules (Harmen M. M. and Haard H. J. Appl Microbiol Biotechnol. 77(1): 13-22 (2007)
  • antigen-binding portion of an antibody, i.e., “antigen-binding fragment,” refers to an antigen (e.g., a domain of human Ig-like-V-type 1 or Ig-like-V-type 2). refers to one or more fragments of an antibody that has the ability to specifically bind to.
  • fragments may be, for example, from about 8 to about 1500 amino acids long, suitably from about 8 to about 745 amino acids long, more suitably from about 8 to about 300 amino acids long, for example from about 8 to about 200 amino acids long. amino acids, or about 10 to about 50 or 100 amino acids in length.
  • binding fragments encompassed by the term “antigen-binding portion” or “antigen-binding fragment” of an antibody, e.g., an anti-B7-H3 antibody disclosed herein, include (i) the VL, VH, CL, and CH1 domains; (ii) the F(ab')2 fragment, which is a bivalent fragment comprising two Fab fragments connected by a disulfide bridge at the hinge region; (iii) the Fd fragment, which is composed of VH and CH1 domains; (iv) an Fv fragment consisting of the VL and VH domains of a single arm of an antibody, and (v) a dAb fragment consisting of a disulfide-linked Fvs (sdFv) VH domain (Ward et al., (1989) Nature 341: 544) -546); and (vi) a separate complementarity
  • VL and VH are encoded by separate genes, they can be joined by synthetic linkers and using recombinant methods, whereby the VL and VH regions are paired to form a single protein chain to form a monovalent molecule.
  • short-chain Fv scFv
  • Such single chain antibodies are also included within the term “antigen-binding portion” or “antigen-binding fragment” of an antibody.
  • the antigen-binding portion can be produced by recombinant DNA techniques, or by enzymatic or chemical cleavage of intact immunoglobulins.
  • variable region typically refers to a portion of an antibody, usually a portion of the light or heavy chain, typically about 110 to 120 amino acids in the mature heavy chain and about 90 to 115 amino acids in the mature light chain, which differ extensively in sequence from the antibody. It is used because of the binding and specificity of specific antibodies to specific antigens. Sequence variability is concentrated in regions called complementarity-determining regions (CDRs), while the more highly conserved regions in the variable domains are called framework regions (FRs).
  • CDRs complementarity-determining regions
  • FRs framework regions
  • variable region is a human variable region.
  • variable region includes rodent or murine CDRs and human framework regions (FR).
  • FR human framework regions
  • variable region is a primate (eg, non-human primate) variable region.
  • variable region includes rodent or murine CDRs and primate (e.g., non-human primate) framework regions (FR).
  • the term "heavy chain" when used in reference to an antibody may be of any of the different types, e.g., alpha ( ⁇ ), delta ( ⁇ ), epsilon ( ⁇ ), etc., based on the amino acid sequence of the constant domain.
  • gamma ( ⁇ ) and mu ( ⁇ ) which give rise to the IgA, IgD, IgE, IgG, and IgM types of antibodies, including subtypes of IgG, such as IgG1, IgG2, IgG3, and IgG4, respectively.
  • the term “light chain” when used in reference to an antibody can refer to any of the different types, such as kappa ( ⁇ ) and lambda ( ⁇ ), based on the amino acid sequence of the constant domain. Light chain amino acid sequences are well known in the art. In certain embodiments, the light chain is a human light chain.
  • VL and “VL domain” are used interchangeably and refer to the light chain variable region of an antibody.
  • VH and “VH domain” are used interchangeably and refer to the heavy chain variable region of an antibody.
  • constant region or “constant domain” used in this specification are interchangeable and have common meanings in the art.
  • the constant domain is the portion of the antibody, e.g., the carboxy-terminal portion of the light and/or heavy chain that is not directly involved in the binding of the antibody to antigen but may exhibit various effector functions, such as interaction with Fc receptors.
  • the constant regions of immunoglobulin molecules generally have more conserved amino acid sequences than the immunoglobulin variable domains.
  • Fc region fragment crystallizable region
  • Fc domain Fc domain
  • Fc refers to the Fc receptor located on various cells of the immune system (e.g. effector cells) or the first component (C1q) of the orthodox complement system.
  • C1q the first component of the orthodox complement system.
  • the Fc region comprises the constant region of the antibody excluding the first constant region immunoglobulin domain (eg CH1 or CL).
  • the Fc region contains two identical protein fragments derived from the second (CH2) and third (CH3) constant domains of the antibody's two heavy chains;
  • the IgM and IgE Fc regions contain three heavy chain constant domains (CH domains 2-4) in each polypeptide chain.
  • the Fc region includes the immunoglobulin domains C ⁇ 2 and C ⁇ 3 and the hinge between C ⁇ 1 and C ⁇ 2.
  • the human IgG heavy chain Fc region is generally defined as extending from the amino acid residue at position C226 or P230 (or the amino acid between these two amino acids) to the carboxy-terminus of the heavy chain, where Numbering follows the EU index as in Kabat.
  • the CH2 domain of the human IgG Fc region extends from about amino acid 231 to about amino acid 340, and the CH3 domain is located on the C-terminal side of the Cm domain in the Fc region, i.e. it extends from about amino acid 341 to about amino acid 447 of the IgG. .
  • the Fc region may be a native sequence Fc, including any allotype variant, or a variant Fc (eg, a non-naturally-occurring Fc). Additionally, Fc refers to the region in isolation or to an Fc-containing protein polypeptide, such as a "binding protein comprising an Fc region", also called an "Fc fusion protein” (e.g., an antibody or immunoadhesion). refers to the area related to
  • “Hinge”, “hinge domain” or “hinge region” or “antibody hinge region” refers to the domain of the heavy chain constant region that connects the CH1 domain to the CH2 domain and includes the upper, middle, and lower portions of the hinge (Roux et al. Immunol 1998 161:4083).
  • the hinge changes the level of flexibility between the binding and effector regions of the antibody and also provides a site for intermolecular disulfide bonds between the two heavy chain constant regions.
  • IgG1, IgG2, IgG3, and IgG4 hinges are known in the art (e.g., Kabat EA et al., (1991) Sequences of Proteins of Immunological Interest, Fifth Edition, US Department of Health and Human Services, NIH Publication No. 91-3242; Vidarsson G. et al., Front Immunol. 5:520 (published online October 20, 2014).
  • isotype refers to the antibody type (e.g., IgG1, IgG2, IgG3, IgG4, IgM, IgA1, IgA2, IgD, and IgE antibodies) encoded by the heavy chain constant region genes.
  • Allotype refers to a naturally-occurring variant within a specific isotype group that differs by several amino acids (see, e.g., Jefferis et al. (2009) mAbs 1:1). Antibodies presented herein may have any allotype. Allotypes of IgG1, IgG2, IgG3, and IgG4 are known in the art (e.g., Kabat EA et al., (1991) (ibid.); Vidarsson G. et al., Front Immunol . 5:520 ( published online October 20, 2014); and Lefranc MP, mAbs 1:4, 1-7 (2009).
  • antibody that recognizes an antigen and “antibody specific for an antigen” are used interchangeably herein with the term “antibody that specifically binds to an antigen.”
  • isolated antibody refers to an antibody that is substantially free of other antibodies with a different antigen specificity (e.g., an isolated antibody that specifically binds to B7-H3 may bind to an antigen other than B7-H3). There are practically no antibodies that bind specifically). However, isolated antibodies that specifically bind to epitopes of B7-H3 may have cross-reactivity to other B7-H3 proteins from different species.
  • Binding affinity generally refers to the overall combined strength of non-covalent interactions between a single binding site on a molecule (e.g., an antibody) and its binding partner (e.g., an antigen). Unless otherwise specified, “binding affinity” as used herein refers to the intrinsic binding affinity that reflects a 1:1 interaction between members of a binding pair (e.g., antibody and antigen).
  • the affinity of molecule X for partner Y can generally be expressed by the dissociation constant (KD). Affinity can be measured and/or expressed in a number of ways known in the art, including, but not limited to, equilibrium dissociation constant (KD), and equilibrium association constant (KA).
  • KD is calculated from the quotient of koff/kon and expressed in molar concentration (M)
  • KA is calculated from the quotient of kon/koff.
  • kon refers to the association rate constant of an antibody, for example, to an antigen
  • koff for example, refers to the dissociation rate constant of an antibody to an antigen.
  • kon and koff can be determined by techniques known to those skilled in the art, such as immunoassays (e.g. enzyme-linked immunosorbent assay (ELISA)), BIACORE ® or kinetic exclusion assays (KinExA ® ).
  • the terms “specifically binds,” “specifically recognizes,” “specifically binds,” “selectively binds,” and “selectively binds” refer to similar terms in relation to an antibody, such as an antigen (e.g. A term relating to a molecule (e.g. an antibody) that binds to an epitope (e.g. an epitope or an immune complex), as such binding is understood by those skilled in the art.
  • a molecule that specifically binds to an antigen as determined, for example, by immunoassay, BIACORE ® , KinExA ® 3000 instrument (Sapidyne Instruments, Boise, ID), or other assays known in the art. , can bind to other peptides or polypeptides, generally with lower affinity.
  • Antibodies specifically bind to their cognate antigen with high affinity, reflected by a dissociation constant of typically 10 -5 to 10 -11 M or less. A KD exceeding about 10 -4 M is generally considered to indicate nonspecific binding.
  • An antibody that “specifically binds” an antigen is one that binds with high affinity to the antigen and to an antigen that is substantially identical to the antigen, for example by immunoassay (e.g. ELISA) or BIACORE ® 2000 instrument using a defined antigen. 10 -7 M or less, preferably 10 -8 M or less, even more preferably 10 -9 M or less, more preferably 10 -10 M or less or 10 -11 M, as determined by surface plasmon resonance (SPR) technology. It means having a KD of less than or equal to the following, which means that it does not bind to unrelated antigens with high affinity.
  • SPR surface plasmon resonance
  • the term “antigen” refers to any natural or synthetic immunogenic substance, such as a protein, peptide, or hapten.
  • the antigen may be B7-H3 or a fragment thereof.
  • epitope is a term in the art and refers to a localized region of an antigen to which an antibody can specifically bind.
  • An epitope may be, for example, contiguous amino acids of a polypeptide (a linear or continuous epitope), or an epitope may be, for example, a combination of two or more non-contiguous regions of a polypeptide or polypeptides (a conformational may be a linear, non-linear, discontinuous, or non-contiguous epitope).
  • Epitopes formed from sequential amino acids are typically, but not always, retained upon exposure to denaturing solvents, and epitopes formed by tertiary folding are typically lost upon treatment with denaturing solvents.
  • Epitopes typically contain at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, or 20 amino acids in unique spatial configurations.
  • Methods for determining which epitopes are bound by a given antibody i.e. epitope mapping
  • epitope mapping include, for example, immunoblotting and immunoprecipitation analyses, where overlapping or consecutive peptides are bound by a given antibody (e.g. tested for reactivity with anti-B7-H3 antibodies).
  • Methods for determining the spatial conformation of an epitope include those skilled in the art and disclosed herein, including, for example, X-ray crystallography, two-dimensional nuclear magnetic resonance, and HDX-MS (e.g., Epitope Mapping Protocols in Methods in Molecular Biology, Vol. 66, G. E. Morris, Ed.
  • the term “binds to the same epitope” in relation to two or more antibodies means that the antibodies bind to the same segment of amino acid residues as determined by a given method.
  • Techniques for determining whether antibodies bind to the "same epitope on B7-H3" as an antibody presented herein include, for example, epitope mapping methods, such as X-ray determination of antigen:antibody complexes that provide atomic resolution of the epitope. Includes analysis and hydrogen/deuterium exchange mass spectrometry (HDX-MS). Other methods monitor the binding of antibodies to antigen fragments or mutated variants of the antigen, where loss of binding due to modifications of amino acid residues within the antigen sequence is primarily considered an indication of epitope components.
  • an antibody that “cross-competes with another antibody for binding to the target” refers to an antibody that (partially or completely) inhibits the binding of the remaining antibodies to the target. Whether two antibodies compete with each other for binding to the target, that is, whether and to what extent one antibody inhibits the binding of the remaining antibody to the target can be determined using a known competition experiment. In certain embodiments, the antibody competes with another antibody for binding to the target and reduces this binding by at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, or 100%. It hinders. The level of inhibition or competition may differ depending on whether the antibody is a “blocking antibody” (i.e., a cold antibody that has been first incubated with the target). Competitive analysis, for example, E.d.
  • reference antibody refers to an antibody that serves as a standard for analysis of competing antibodies that bind to the same epitope, overlapping epitope, or adjacent epitope, and that cross-competition (cross) in binding between the competing antibody and the epitope. -compete).
  • the term “monoclonal antibody” refers to an antibody that exhibits a single binding specificity and affinity for a specific epitope or a composition of antibodies in which all antibodies exhibit a single binding specificity and affinity to a specific epitope.
  • the term “human monoclonal antibody” refers to an antibody or antibody composition that exhibits a single binding specificity and has variable and optional constant regions derived from human dotline immunoglobulin sequences.
  • the human monoclonal antibody comprises B cells obtained from a transgenic non-human animal, e.g., a transgenic mouse, with a genome comprising human heavy and light chain transgenes fused to immortalized cells. It is produced by a hybridoma that
  • recombinant human antibody refers to (a) an antibody isolated from, or a hybridoma prepared from, an animal (e.g., a mouse) that is transgenic or transchromosomal for human immunoglobulin genes, (b) an antibody. antibodies isolated from host cells transformed to express, for example, transfectomas, (c) antibodies isolated from recombinant, combinatorial human antibody libraries, and (d) human immunoglobulin genes for other DNA sequences. It includes all human antibodies made, expressed, produced or isolated by recombinant means, such as antibodies made, expressed, produced or isolated by any other means involving splicing of sequences.
  • variable regions utilizing specific human dotline immunoglobulin sequences, including subsequent rearrangements and mutations that occur, for example, during antibody maturation.
  • the variable region is encoded by various genes that rearrange to form antibodies specific for foreign antigens. Contains an antigen binding domain.
  • variable regions can be further modified by multiple single amino acid changes (somatic mutations or hypermutations) to increase the affinity of the antibody for foreign antigens.
  • the constant region will change in further response to antigen (i.e. isotype switch).
  • a rearranged and somatically mutated nucleic acid molecule encoding light and heavy chain immunoglobulin polypeptides in response to antigen may not have sequence identity with the original nucleic acid molecule, but will instead be substantially identical or similar (i.e., at least 80% identity). has).
  • Human antibodies refer to antibodies with variable regions in which both the framework and CDR regions are derived from human dotline immunoglobulin sequences. Additionally, if the antibody contains a constant region, the constant region is also derived from a human dotline immunoglobulin sequence. Antibodies provided herein may contain amino acid residues that are not encoded by human dotline immunoglobulin sequences (e.g., mutations introduced by random or site-directed mutagenesis in vitro or by somatic mutation in vivo). . However, the term “human antibody” does not include antibodies in which CDR sequences derived from the dot lines of other mammalian species, such as mouse, have been grafted onto human framework sequences. The terms “human” antibody and “fully human” antibody are used synonymously.
  • humanized antibody refers to an antibody in which some, most or all of the amino acids outside the CDR domains of a non-human antibody have been replaced with corresponding amino acids derived from human immunoglobulins. In one embodiment of the humanized form of the antibody, some, most or all of the amino acids outside the CDR domains are replaced with amino acids from human immunoglobulins, and some, most or all of the amino acids within one or more CDR regions remain intact. Additions, deletions, insertions, substitutions or modifications of amino acids are permitted as long as they do not abolish the ability of the antibody to bind to the specific antigen. “Humanized” antibodies possess antigenic specificity similar to that of the original antibody.
  • Chimeric antibody refers to an antibody whose variable region is derived from one species and whose constant region is derived from another species, such as an antibody whose variable region is derived from a mouse antibody and whose constant region is derived from a human antibody.
  • cross-react refers to the ability of an antibody provided herein to bind B7-H3 from different species.
  • an antibody provided herein that binds human B7-H3 may also bind B7-H3 of other species (e.g., mouse B7-H3).
  • This cross-reactivity is measured by detecting specific reactivity with purified antigen in a binding assay (e.g. SPR, ELISA) or by detecting binding or functional interaction with cells physiologically expressing B7-H3. It can be.
  • Methods for determining cross-reactivity include standard binding assays disclosed herein, such as BIACORE ® surface plasmon resonance (SPR) analysis using a BIACORE ® 2000 SPR instrument (Biacore AB, Uppsala, Sweden), or flow cytometry techniques. do.
  • SPR surface plasmon resonance
  • conservative amino acid substitution refers to the substitution of an amino acid residue with an amino acid residue having a similar side chain.
  • Families of amino acid residues with similar side chains are defined in the art. These families include basic side chains (e.g. lysine, arginine, histidine), acidic side chains (e.g. aspartic acid, glutamic acid), and uncharged polar side chains (e.g. glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine, tryptophan), nonpolar side chains (e.g.
  • a predicted non-essential amino acid residue in an anti-B7-H3 antibody is replaced with another amino acid residue from the same side chain family.
  • substantially homology indicates that two polypeptides, or their designated sequences, are identical when optimally aligned and compared, with at least about 80% of the amino acids, at least about 90% to 95%, or at least about 98% of the amino acids. % to 99.5% have the appropriate amino acid insertion or deletion.
  • the percent identity between two amino acid sequences can be determined using the Needleman and Wunsch ( J. Mol. Biol. (48):444-453 (1970)) algorithm incorporated in the GAP program of the GCG software package (http://www. available at .gcg.com), which uses a Blossum 62 matrix or a PAM250 matrix, and gap weights of 16, 14, 12, 10, 8, 6, or 4, and length weights of 1, 2, 3, 4, 5, or 6. use.
  • Nucleic acid and protein sequences presented herein can be used, for example, as “query sequences” to perform searches in public databases to identify related sequences. These searches can be performed using the NBLAST and XBLAST programs (version 2.0) from Altschul, et al. (1990) J. Mol. Biol. 215:403-10.
  • Gapped BLAST can be used as described in Altschul et al., (1997) Nucleic Acids Res . 25(17): 3389-3402.
  • the default variables for each program e.g., XBLAST and NBLAST
  • XBLAST and NBLAST can be used (see worldwideweb.ncbi.nlm.nih.gov).
  • the anti-B7-H3 antibody or antigen-binding fragment thereof of the present invention is a domain of B7-H3, Ig-like-V-type, Ig-like-V-type 1, and/or Binds to an epitope located within the amino acid sequence of the Ig-like-V-type 2 domain.
  • the anti-B7-H3 antibody or antigen-binding fragment thereof of the present invention has the Ig-like-V-type 1 sequence of SEQ ID NO: 36 and the Ig-like-V-type 2 sequence of SEQ ID NO: 38. It binds to an epitope located within the amino acid sequence of the B7-H3 domain selected from the group consisting of the sequence and the Ig-like-V-type sequence of SEQ ID NO: 40.
  • the anti-B7-H3 antibody or antigen-binding fragment thereof of the present invention has amino acid residues 2 to 6 of SEQ ID NO: 36 (i.e. EVQVP), amino acid residues 6 to 10 of SEQ ID NO: 38 (i.e. , EVQVP) and one or more amino acids corresponding to amino acid residues 2 to 6 of SEQ ID NO: 40 (i.e., EVQVS).
  • the anti-B7-H3 antibody or antigen-binding fragment thereof is contained within the amino acid sequence of the human-derived Ig-like-V-type 1, and/or Ig-like-V-type 2 domain. It binds to both the located epitope (e.g. EVQVP) and the epitope located within the amino acid sequence of the mouse-derived Ig-like-V-type domain (e.g. EVQVS), showing a T cell-mediated cancer cell killing effect (Example 8 and 9), when developed as a therapeutic antibody, it is expected to show efficient anticancer effects in preclinical tests.
  • the located epitope e.g. EVQVP
  • EVQVS mouse-derived Ig-like-V-type domain
  • the anti-B7-H3 antibody or antigen-binding fragment thereof of the invention comprises light chain CDR1, CDR2, and CDR3 and heavy chain CDR1, CDR2, and CDR3, wherein light chain CDR1, CDR2, and CDR3 consists of SEQ ID NOs: 3, 4, and 5, respectively, and heavy chain CDR1, CDR2, and CDR3 consists of SEQ ID NOs: 6, 7, and 8, respectively.
  • the anti-B7-H3 antibody or antigen-binding fragment thereof of the present invention includes a light chain variable region and a heavy chain variable region.
  • the light chain variable region has an amino acid sequence that is at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to the sequence shown in SEQ ID NO: 9. may include.
  • the light chain variable region includes light chain CDR1, CDR2, and CDR3 consisting of SEQ ID NOs: 3, 4, and 5, and is at least 80%, at least 85%, at least 90%, at least 95%, or at least identical to the sequence shown in SEQ ID NO: 9. and may comprise amino acid sequences that are 96%, at least 97%, at least 98%, at least 99%, or 100% identical.
  • the heavy chain variable region has an amino acid sequence that is at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to the sequence shown in SEQ ID NO: 10. may include.
  • the heavy chain variable region includes heavy chain CDR1, CDR2, and CDR3 consisting of SEQ ID NOs: 6, 7, and 8, and is at least 80%, at least 85%, at least 90%, at least 95%, or at least identical to the sequence shown in SEQ ID NO: 10. and may comprise amino acid sequences that are 96%, at least 97%, at least 98%, at least 99%, or 100% identical.
  • the anti-B7-H3 antibody or antigen-binding fragment thereof of the present invention includes a light chain variable region consisting of SEQ ID NO: 9.
  • the anti-B7-H3 antibody or antigen-binding fragment thereof of the present invention includes a heavy chain variable region consisting of SEQ ID NO: 10.
  • the light chain variable region is at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to the sequence shown in SEQ ID NO: 21. It may contain an amino acid sequence.
  • the light chain variable region includes light chain CDR1, CDR2, and CDR3 consisting of SEQ ID NOs: 3, 4, and 5, and is at least 80%, at least 85%, at least 90%, at least 95%, or at least identical to the sequence shown in SEQ ID NO: 21. and may comprise amino acid sequences that are 96%, at least 97%, at least 98%, at least 99%, or 100% identical.
  • the heavy chain variable region has an amino acid sequence that is at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to the sequence shown in SEQ ID NO: 22. may include.
  • the heavy chain variable region includes heavy chain CDR1, CDR2, and CDR3 consisting of SEQ ID NOs: 6, 7, and 8, and is at least 80%, at least 85%, at least 90%, at least 95%, or at least identical to the sequence shown in SEQ ID NO: 22. and may comprise amino acid sequences that are 96%, at least 97%, at least 98%, at least 99%, or 100% identical.
  • the anti-B7-H3 antibody or antigen-binding fragment thereof of the present invention includes a light chain variable region consisting of SEQ ID NO: 21.
  • the anti-B7-H3 antibody or antigen-binding fragment thereof of the present invention includes a heavy chain variable region consisting of SEQ ID NO: 22.
  • the anti-B7-H3 antibody or antigen-binding fragment thereof of the present invention is a reference antibody comprising a light chain variable region consisting of SEQ ID NO: 9 and a heavy chain variable region consisting of SEQ ID NO: 10, and the epitope compete with each other in combination with
  • the anti-B7-H3 antibody or antigen-binding fragment thereof of the present invention comprises a reference antibody comprising a light chain variable region consisting of SEQ ID NO: 21 and a heavy chain variable region consisting of SEQ ID NO: 22, and the epitope compete with each other in combination with
  • the present invention provides a nucleic acid encoding the anti-B7-H3 antibody or antigen-binding fragment thereof.
  • nucleic acid molecule is meant to comprehensively include DNA (gDNA and cDNA) and RNA molecules, and nucleotides, which are the basic structural units in nucleic acid molecules, include not only natural nucleotides but also analogs with modified sugar or base sites. (analogue) is also included (Scheit, Nucleotide Analogs, John Wiley, New York (1980); Uhlman and Peyman, Chemical Reviews, (1990) 90:543-584).
  • sequences of nucleic acid molecules encoding the heavy and light chain variable regions of the present invention may be modified. The modifications include additions, deletions, or non-conservative or conservative substitutions of nucleotides.
  • the nucleic acid molecule of the present invention is interpreted to also include a nucleotide sequence showing substantial identity to the above-described nucleotide sequence.
  • the above substantial identity is at least 80% when the nucleotide sequence of the present invention and any other sequence are aligned to correspond as much as possible, and the aligned sequence is analyzed using an algorithm commonly used in the art.
  • Homology in one specific example, means a nucleotide sequence showing at least 90% homology, and in another specific example, at least 95% homology.
  • the present invention provides a vector containing a nucleic acid molecule encoding the above-described antibody or antigen-binding fragment thereof of the present invention.
  • vector refers to a carrier capable of inserting a polynucleotide sequence for introduction into cells capable of replicating the polynucleotide (nucleic acid) sequence.
  • Polynucleotide sequences may be exogenous or heterologous.
  • Vectors include, but are not limited to, plasmids, cosmid vectors, and viral vectors (retrovirus, adenovirus, and adeno-associated virus vectors, etc.).
  • expression vector refers to a vector containing a nucleotide sequence encoding at least a portion of the gene product to be transcribed. In some cases, the RNA molecule is then translated into a protein, polypeptide, or peptide. Expression vectors may contain various control sequences. In addition to regulatory sequences that regulate transcription and translation, vectors and expression vectors may also contain nucleic acid sequences that also serve other functions.
  • the present invention provides a cell containing the above-described vector.
  • the present invention provides cells transformed with the above-described vector.
  • the term “cell” includes eukaryotic cells and prokaryotic cells, and refers to any transformable cell that can contain the vector, replicate the vector, or express the gene encoded by the vector. it means.
  • Cells may be transfected, transduced, or transformed by the vector, which refers to a process in which an exogenous polynucleotide (nucleic acid molecule) is transferred or introduced into a host cell.
  • transformation is used to include transfected and transduced.
  • the (host) cells of the present invention are not limited, but are preferably insect cells or mammalian cells, more preferably Sf9 for insect cells, HEK293 cells, HeLa cells, ARPE-19 cells, RPE- 1 cells, HepG2 cells, Hep3B cells, Huh-7 cells, C8D1a cells, Neuro2A cells, CHO cells, MES13 cells, BHK-21 cells, COS7 cells, COP5 cells, A549 cells, MCF-7 cells, HC70 cells, HCC1428 cells , BT-549 cells, PC3 cells, LNCaP cells, Capan-1 cells, Panc-1 cells, MIA PaCa-2 cells, SW480 cells, HCT166 cells, LoVo cells, A172 cells, MKN-45 cells, MKN-74 cells, Kato-III cells, NCI-N87 cells, HT-144 cells, SK-MEL-2 cells, SH-SY5Y cells, C6 cells, HT-22 cells, PC-12 cells, NIH3T3 cells
  • the antigen-binding fragment of the anti-B7-H3 antibody of the present invention can be used to genetically modify immune cells to express chimeric antigen receptors.
  • immune cells refers to cells of the immune system that can be classified into lymphocytes (e.g., T cells, B cells, and NK cells), neutrophils, and monocytes/macrophages.
  • lymphocytes e.g., T cells, B cells, and NK cells
  • neutrophils e.g., neutrophils, and monocytes/macrophages.
  • monocytes e.g., monocytes/macrophages.
  • the immune cells are T cells.
  • the immune cells are NK cells.
  • Immune cells can be modified in one or more ways. Immune cells (e.g., T cells) may express at least one non-natural molecule that is a receptor for an antigen present on the surface of one or more types of cells.
  • the immune cells include immune cells not found in nature (e.g., T cells) because they contain or are engineered to express at least one synthetic molecule not found in nature.
  • immune cells e.g., T cells
  • CAR chimeric antigen receptor
  • the immune cells are T cells, e.g., CD4+ T cells, CD8+ T cells, Treg cells, Th1 T cells, Th2 T cells, Th17 T cells, non-specific T cells, or a combination of any of the foregoing. It may be a population of T cells containing.
  • Immune cells e.g., T cells
  • CARs receptors can be programmed to recognize an antigen and, when bound, activate immune cells to kill cells expressing that antigen. Accordingly, immune cells expressing CAR(s) against antigens expressed on tumor cells can target and kill tumor cells.
  • CD19-targeted CAR-transduced T cells CD19-CAR T cells
  • CD19-CAR T cells CD19-targeted CAR-transduced T cells
  • the cells of the present invention are preferably isolated cells.
  • the cells of the present invention are preferably in-vitro cells.
  • the cells of the present invention are preferably ex-vivo cells.
  • the present invention includes the above-described anti-B7-H3 antibody or antigen-binding fragment thereof, a nucleic acid encoding the antibody or antigen-binding fragment thereof, a vector comprising the nucleic acid, and the vector, or It provides for use as a medicament of a component selected from the group consisting of cells transformed with the vector.
  • the present invention includes the above-described anti-B7-H3 antibody or antigen-binding fragment thereof, a nucleic acid encoding the antibody or antigen-binding fragment thereof, a vector comprising the nucleic acid, and the vector, or A composition comprising a component selected from the group consisting of cells transformed with the vector is provided.
  • the composition of the present invention is a pharmaceutical composition for preventing or treating cancer.
  • the present invention provides to a subject in need thereof, a nucleic acid encoding the anti-B7-H3 antibody or an antigen-binding fragment thereof, a nucleic acid encoding the antibody or an antigen-binding fragment thereof, and a vector comprising the nucleic acid. and administering a component selected from the group consisting of cells containing the vector or transformed with the vector.
  • a method of treating cancer (or tumor) in a subject comprising the anti-B7-H3 antibody or antigen-binding fragment thereof, a nucleic acid encoding the antibody or antigen-binding fragment thereof, and the nucleic acid It includes administering to a subject a component selected from the group consisting of a vector and cells containing the vector or transformed with the vector.
  • the anti-B7-H3 antibody or antigen-binding fragment thereof specifically binds to B7-H3 and exerts a T cell-mediated cancer cell killing effect.
  • the methods disclosed herein inhibit and/or reduce the growth of cancer (or tumor) in a subject.
  • tumor growth e.g., tumor volume or weight
  • baseline e.g., the corresponding tumor volume or weight in a subject who had not received a composition disclosed herein.
  • the methods disclosed herein reduce the frequency of the disease by at least 5%, at least 10%, at least 20%, at least 30% compared to baseline (e.g., the corresponding frequency in subjects who did not receive a composition disclosed herein).
  • TGI tumor growth inhibition
  • administration of a composition disclosed herein is administered to patients who have not received a composition disclosed herein, e.g., said anti-B7-H3 antibody.
  • tumors that can be treated with the methods disclosed herein are derived from cancers that are typically responsive to existing anti-cancer agents and cancers that are typically non-responsive to existing anti-cancer agents.
  • the cancer is a solid tumor or cancer with hematological malignancy (liquid tumor).
  • Non-limiting examples of cancers requiring treatment include brain tumor, medulloblastoma, leptomeningeal metastasis, squamous cell carcinoma, small-cell lung cancer (SCLC), non-small cell lung cancer, squamous non-small cell lung cancer (NSCLC), non-squamous NSCLC, gastrointestinal cancer, renal cancer (e.g. clear cell carcinoma), ovarian cancer, liver cancer, biliary tract cancer, nasopharyngeal cancer, colorectal cancer, endometrial cancer, kidney cancer (e.g.
  • renal cell carcinoma (RCC)
  • prostate cancer For example, hormone-refractory prostate adenocarcinoma), thyroid cancer, parathyroid cancer, pancreatic cancer, cervical cancer, stomach cancer, bladder cancer, hepatocellular carcinoma, breast cancer, colon carcinoma, head and neck cancer (or carcinoma), laryngeal cancer, germ cell tumor, childhood cancer, nasal natural killer, Melanoma (e.g.
  • metastatic malignant melanoma such as cutaneous or intraocular malignant melanoma
  • bone cancer skin cancer, uterine cancer, cancer of the anal area, testicular cancer, carcinoma of the fallopian tubes, carcinoma of the endometrium, carcinoma of the cervix, carcinoma of the vagina, Carcinoma of the vulva, esophageal cancer, small intestine cancer, colon cancer, colon cancer, mast cell tumor, cancer of the endocrine system, cancer of the parathyroid gland, cancer of the adrenal gland, sarcoma of soft tissue, cancer of the urethra, cancer of the genitals, solid tumor in children, cancer of the ureter.
  • carcinoma of the renal pelvis carcinoma of the renal pelvis, neoplastic angiogenesis, pituitary adenoma, Kaposi's sarcoma, carcinoma in situ, squamous cell carcinoma, T-cell lymphoma, environmentally induced cancers, including those caused by asbestos, virus-related cancers or cancers of viral origin (e.g. For example, human papillomavirus (HPV-related or -originating tumor), and the two major blood cell lineages: the myeloid cell line (which produces granulocytes, erythrocytes, platelets, macrophages, and mast cells) or the lymphoid cell line.
  • myeloid cell line which produces granulocytes, erythrocytes, platelets, macrophages, and mast cells
  • lymphoid cell line lymphoid cell line.
  • Hematologic malignancies derived from any of the following which produce B, T, NK, and plasma cells
  • all types of leukemia, lymphoma, and myeloma including acute, chronic, lymphocytic, and/or myeloid leukemia , such as acute leukemia (ALL), acute myeloid leukemia (AML), chronic lymphocytic leukemia (CLL) and chronic myelogenous leukemia (CML), undifferentiated AML (MO), myeloblastic leukemia (M1), myeloblastic leukemia ( M2; with cell maturation), promyelocytic leukemia (M3 or M3 variant [M3V]), myelomonocytic leukemia (M4 or M4 variant with eosinophilia [M4E]), monocytic leukemia (M5), erythroleukemia (M6).
  • ALL acute leukemia
  • AML acute myeloid leukemia
  • CLL chronic lymph
  • lymphomas such as Hodgkin's lymphoma (HL), non-Hodgkin's lymphoma (NHL), B cell hematological malignancies, such as B-cell lymphoma, T-cell lymphoma, lymphoblastoma lymphoma, monocytic B-cell lymphoma , mucosa-associated lymphoid tissue (MALT) lymphoma, anaplastic (e.g.
  • Ki 1+ large-cell lymphoma, adult T-cell lymphoma/leukemia, mantle cell lymphoma, angio-immunoblastic T-cell lymphoma, vascular Central lymphoma, intestinal T-cell lymphoma, primary mediastinal B-cell lymphoma, precursor T-lymphoblastic lymphoma, T-lymphoblastic; and lymphoma/leukemia (T-Lbly/T-ALL), peripheral T-cell lymphoma, lymphoblastic lymphoma, post-transplant lymphoproliferative disorder, histiocytic true lymphoma, primary effusion lymphoma, B-cell lymphoma, lymphoblastic lymphoma (LBL).
  • T-Lbly/T-ALL lymphoma/leukemia
  • peripheral T-cell lymphoma lymphoblastic lymphoma
  • post-transplant lymphoproliferative disorder histiocytic true lymphoma
  • lymphoid system acute lymphoblastic leukemia, diffuse large B-cell lymphoma, Burkitt lymphoma, follicular lymphoma, diffuse histiocytic lymphoma (DHL), immunoblastic large cell lymphoma, precursor B-lymphoblastic Lymphoma, cutaneous T-cell lymphoma (CTLC) (also called mycosis fungoides or Sizary syndrome), and lymphoblastoma lymphoma with Waldenström macroglobulinemia (LPL); Myeloma, such as IgG myeloma, light chain myeloma, nonsecretory myeloma, asymptomatic multiple myeloma (also called indolent myeloma), solitary plasmocytoma, and multiple myeloma, chronic lymphocytic leukemia (CLL), clast cell lymphoma; Tumors
  • T-cells and T-cell tumors including T-cell disorders such as T-prolymphocytic leukemia (T-PLL); Large granular lymphocytic leukemia of T-cell type (LGL); a/d T-NHL hepatosplenic lymphoma; Peripheral/post-thymic T cell lymphoma (pleomorphic and immunoblastic subtypes); Angiocentric (nasal) T-cell lymphoma; Cancer of the head or neck, kidney, rectum, or thyroid gland; acute myeloid lymphoma, and any combination thereof.
  • the cancer includes brain tumor, pediatric cancer, medulloblastoma, leptomeningeal metastasis cancer, breast cancer, lung cancer, pancreatic cancer, colon cancer, liver cancer, prostate cancer, ovarian cancer, stomach cancer, esophageal cancer, lymphoma, melanoma, Kidney cancer, fibrosarcoma, colon cancer, colorectal cancer, endometrial cancer, thyroid cancer, parathyroid cancer, cervical cancer, bladder cancer, head and neck cancer, bone cancer, skin cancer, uterine cancer, testicular cancer, biliary tract cancer, bronchial cancer, nasopharyngeal cancer, laryngeal cancer, and ureteral cancer. It is one or more cancers selected from the group consisting of.
  • the methods disclosed herein also provide treatment for metastatic cancer, unresectable, refractory cancer (e.g., conventional cancer therapy, e.g., immunotherapy, e.g., therapy with a blocking PD-(L)1 antibody. cancer that is resistant to cancer), and/or recurrent cancer.
  • the methods disclosed herein can be used to treat recurrent cancer.
  • the pharmaceutical composition may be used in combination with additional cancer agents including immunotherapy agents, chemotherapy agents, targeted therapies, or radiotherapy agents.
  • the methods disclosed herein include chemotherapy as an existing cancer therapy.
  • the methods disclosed herein effectively increase the duration of survival of a subject (e.g., affected by a tumor).
  • the duration of survival of a subject can be at least about 1 month, at least about 2 months, compared to a reference subject (e.g., another subject not treated with a composition disclosed herein, e.g., the antibody-drug conjugate).
  • a reference subject e.g., another subject not treated with a composition disclosed herein, e.g., the antibody-drug conjugate.
  • the methods disclosed herein determine the duration of survival of a subject by determining the survival of a reference subject (e.g., another subject not treated with a composition disclosed herein, e.g., said anti-B7-H3 antibody). At a level longer than the duration (about 1 month longer, about 2 months longer, about 3 months longer, about 4 months longer, about 5 months longer, about 6 months longer, about 7 months longer, about 8 months longer, about 9 months longer, about 10 months longer, about 11 months longer, or about 1 year longer).
  • the methods of the invention increase the duration of disease progression-free survival of a subject.
  • the subject's duration of disease progression-free survival is at least about 1 month compared to a reference subject (e.g., another subject not treated with a composition disclosed herein, e.g., said anti-B7-H3 antibody).
  • a reference subject e.g., another subject not treated with a composition disclosed herein, e.g., said anti-B7-H3 antibody.
  • the methods disclosed herein effectively increase the rate of reaction in a group of subjects.
  • the response rate in a group of subjects is at least about 2% when compared to a reference subject (e.g., other subjects not treated with a composition disclosed herein, e.g., said anti-B7-H3 antibody); at least about 3%, at least about 4%, at least about 5%, at least about 10%, at least about 15%, at least about 20%, at least about 25%, at least about 30%, at least about 35%, at least about 40%, at least about 45%, at least about 50%, at least about 55%, at least about 60%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, increased by at least about 99% or at least about 100%.
  • the subject to be treated in the methods is a non-human animal, such as a rat or mouse. In some embodiments, the subject to be treated in the methods is a human.
  • the invention also includes methods of treating cancer in a subject in combination with other cancer agents.
  • the anti-B7-H3 antibody useful in the methods of the invention is administered in combination therapy, i.e., with at least one other anti-cancer agent and/or immunomodulatory agent, such as a T-cell stimulating (e.g. activating) agent.
  • T-cell stimulating agent e.g. activating
  • anti-B7-H3 antibodies useful in the methods of the invention may be administered in combination with other compounds, drugs, and/or agents used in the treatment of cancer.
  • Such compounds, drugs, and/or agents may include, for example, chemotherapy drugs, small molecule drugs, or antibodies that stimulate an immune response against cancer.
  • the methods disclosed herein are used in combination with standard treatments (e.g., surgery, radiation, and chemotherapy). In other embodiments, the methods disclosed herein are used as maintenance therapy, for example, therapy intended to prevent the development or recurrence of a tumor.
  • the anti-B7-H3 antibodies disclosed herein are used in combination with one or more additional cancer agents, including immunotherapy agents, chemotherapy agents, targeted therapies, radiotherapy agents, or any combination thereof. can be used.
  • the anti-B7-H3 antibody or antigen-binding fragment thereof disclosed herein, having the desired degree of purity, is prepared in a pharmaceutically acceptable carrier, excipient, or stabilizer (Remington's Pharmaceutical Sciences (1990) Mack Publishing Co., Easton, PA).
  • compositions comprising: Acceptable carriers, excipients, or stabilizers are nontoxic to recipients at the dosages and concentrations employed and include buffers such as phosphate, citrate, and other organic acids; Antioxidants including ascorbic acid and methionine; Preservatives (such as octadecyldimethylbenzylammonium chloride; hexamethonium chloride; benzalkonium chloride; phenol, butyl or benzyl alcohol; alkyl parabens such as methyl or propyl paraben; catechol; resorcinol; cyclohexanol; 3-pentanol ; and m-cresol); low molecular weight (less than about 10 residues) polypeptides; Proteins such as serum albumin, gelatin, or immunoglobulins; Hydrophilic polymers such as polyvinylpyrrolidone; Amino acids such as glycine, glutamine, asparagine, his
  • the pharmaceutical composition comprises an anti-B7-H3 antibody or antigen-binding fragment thereof disclosed herein, a nucleic acid encoding the antibody or antigen-binding fragment thereof, a vector comprising the nucleic acid, and the vector or A component selected from the group consisting of cells transformed with a vector is contained in a pharmaceutically acceptable carrier.
  • the pharmaceutical composition comprises an effective amount of an anti-B7-H3 antibody disclosed herein, and optionally one or more additional prophylactic or therapeutic agents, in a pharmaceutically acceptable carrier.
  • an anti-B7-H3 antibody or antigen-binding fragment thereof a nucleic acid encoding the antibody or antigen-binding fragment thereof, a vector comprising the nucleic acid, and a cell comprising the vector or transformed with the vector.
  • the ingredient selected from the group is the only active ingredient included in the pharmaceutical composition.
  • Pharmaceutically acceptable carriers used in parenteral preparations include aqueous vehicles, non-aqueous vehicles, antibacterial agents, isotonic agents, buffers, antioxidants, local anesthetics, suspending and dispersing agents, emulsifiers, sequestering or chelating agents of metal ions, and other pharmaceutical agents.
  • aqueous vehicles include Sodium Chloride Injection, Ringer's Injection, Isotonic Dextrose Injection, Sterile Water Injection, Dextrose, and Lactated Ringer's Injection.
  • Non-aqueous vehicles include fixed oils of vegetable origin, cottonseed oil, corn oil, sesame oil and peanut oil.
  • Antimicrobial agents in bacteriostatic or fungicidal concentrations can be added to parenteral preparations packaged in multi-dose containers, including phenols or cresols, mercury-containing substances, benzyl alcohol, chlorobutanol, methyl and propyl p-hydroxybenzoic acid esters, thimerosols, etc. Includes benzalkonium chloride and benzethonium chloride.
  • Isotonic agents include sodium chloride and dextrose. Buffers include phosphate and citrate.
  • Antioxidants include sodium bisulfate.
  • Local anesthetics include procaine hydrochloride.
  • Suspending and dispersing agents include sodium carboxymethylcellulose, hydroxypropyl methylcellulose and polyvinylpyrrolidone.
  • Emulsifiers include polysorbate 80 ( TWEEN® 80). Sequestering or chelating agents for metal ions include EDTA. Pharmaceutically acceptable carriers also include ethyl alcohol, polyethylene glycol, and propylene glycol for water-miscible vehicles, and may include sodium hydroxide, hydrochloric acid, citric acid, or lactic acid for pH adjustment.
  • compositions can be formulated to suit any route of administration to a subject.
  • routes of administration include intranasal, oral, parenteral, intrathecal, intracerebroventricular, pulmonary, subcutaneous, or intraventricular routes.
  • Parenteral administration characterized by subcutaneous, intramuscular or intravenous injection, is also contemplated.
  • Injectables may be prepared in conventional forms, as liquid solutions or suspensions, solid forms suitable for being brought into solution or suspension in a liquid prior to injection, or emulsions.
  • Injectables, solutions and emulsions also contain one or more excipients. Suitable excipients are, for example, water, saline, dextrose, glycerol or ethanol.
  • the pharmaceutical composition to be administered may also contain small amounts of non-toxic auxiliary substances, such as wetting or emulsifying agents, pH buffering agents, stabilizers, solubility enhancers, and other agents such as sodium acetate, sorbitan monolaurate, triethanolamine. May contain oleate and cyclodextrin.
  • auxiliary substances such as wetting or emulsifying agents, pH buffering agents, stabilizers, solubility enhancers, and other agents such as sodium acetate, sorbitan monolaurate, triethanolamine. May contain oleate and cyclodextrin.
  • Preparations for parenteral administration of anti-B7-H3 antibodies include sterile ready-to-injectable solutions, sterile dry soluble products that can be combined with a solvent immediately prior to use, including tablets for subcutaneous injection, such as lyophilized powders, ready-to-inject. Includes sterile suspensions, sterile dry insoluble products that can be combined with the vehicle immediately prior to use, and sterile emulsions. Solutions may be aqueous or non-aqueous.
  • Anti-B7-H3 antibodies disclosed herein can also be formulated to target specific tissues, receptors, or other body regions of the subject to be treated.
  • a variety of targeting methods are known to those skilled in the art. It is contemplated to use such targeting methods in the present compositions.
  • Non-limiting examples of targeting methods include US Pat. ,No.048,736,No. See 6,039,975, 6,004,534, 5,985,307, 5,972,366, 5,900,252, 5,840,674, 5,759,542 and 5,709,874.
  • compositions used for in vivo administration may be sterile. For example, it can be sterilized by filtration through a sterile filtration membrane.
  • a composition for diagnosing cancer comprising a component selected from the group consisting of transformed cells is provided.
  • the above-described anti-B7-H3 antibody or antigen-binding fragment thereof a nucleic acid encoding the antibody or antigen-binding fragment thereof, a vector comprising the nucleic acid, and a vector comprising or using the vector.
  • a kit for diagnosing cancer containing a component selected from the group consisting of transformed cells.
  • the kit may include instructions for use, which include: the anti-B7-H3 antibody or antigen-binding fragment thereof,
  • a method of using a diagnostic kit may be included, including the step of processing a nucleic acid encoding the antibody or antigen-binding fragment thereof, a vector containing the nucleic acid, and a cell containing the vector or transformed with the vector.
  • the subject in need of diagnosis is a non-human animal, such as a rat or mouse. In some embodiments, the subject to be diagnosed is a human.
  • a sample isolated from a subject in need of diagnosis includes the above-described anti-B7-H3 antibody or antigen-binding fragment thereof, a nucleic acid encoding the antibody or antigen-binding fragment thereof, and the nucleic acid.
  • a method of providing information for the diagnosis of cancer comprising the step of processing a component selected from the group consisting of a vector and cells containing the vector or transformed with the vector.
  • the present invention provides an anti-B7-H3 antibody or antigen-binding fragment thereof that binds to a specific epitope located within the amino acid sequence of the domain of B7-H3.
  • the present invention also provides the anti-B7-H3 antibody or antigen-binding fragment thereof, a nucleic acid encoding the antibody or antigen-binding fragment thereof, a vector comprising the nucleic acid, and a transformation comprising the vector or the vector.
  • a pharmaceutical composition for preventing or treating cancer comprising an ingredient selected from the group consisting of cells and a pharmaceutically acceptable carrier.
  • the anti-B7-H3 antibody specifically binds to various types of cancer cell lines expressing B7-H3, exhibits a T cell-mediated cancer cell killing effect, and binds to both human and mouse epitopes, making it a therapeutic antibody. It is expected that efficient evaluation of anticancer effects will be possible in preclinical trials upon development.
  • Figure 1 is a schematic diagram of biopanning using an antibody library.
  • Figure 2a is a diagram confirming the binding ability of 2D IgG produced with a complete antibody to recombinant human 4Ig B7-H3, recombinant human 2Ig B7-H3, and recombinant mouse B7-H3 by indirect ELISA.
  • Figure 2b is a diagram confirming the binding ability of 2D IgG to Raji and BT-20 cell lines by FACS method.
  • Figure 3a is a diagram confirming the binding ability of G2D IgG, a humanized antibody, to recombinant human 4Ig B7-H3, recombinant human 2Ig B7-H3, and recombinant mouse B7-H3 by indirect ELISA
  • Figure 3b is a diagram confirming the binding affinity of G2D IgG, a humanized antibody, to recombinant human B7-H3. This is a diagram confirming the binding ability to 4Ig B7-H3, recombinant human 2Ig B7-H3, and recombinant mouse B7-H3 using SPR method.
  • Figure 4 is a diagram showing the interaction between B7 family proteins expressed on antigen presenting cells (APC) containing cancer cells and T cells.
  • APC antigen presenting cells
  • Figure 5 is a diagram confirming the specificity of G2D IgG for B7-H3 among B7 family proteins by indirect ELISA.
  • Figure 6 is a diagram confirming the binding capacity of G2D IgG to Raji cell line expressing B7-H3 by FACS method.
  • Figure 6a is a diagram confirming the binding affinity to Raji cell line expressing human 4Ig and 2Ig B7-H3
  • Figure 6b is a diagram confirming binding affinity to Raji cell line expressing mouse B7-H3.
  • Figure 7 is a diagram confirming the binding capacity of G2D IgG to 16 types of human cancer cell lines by FACS method.
  • 7A shows colon cancer, liver cancer, prostate cancer, and ovarian cancer cell lines;
  • Figure 7b shows brain tumor, breast cancer cell lines;
  • Figure 7c shows the results of confirming the binding ability to pancreatic cancer and lung cancer cell lines.
  • Figure 8 is a diagram confirming the binding capacity of G2D IgG to four mouse cancer cell lines in which B7-H3 expression was confirmed by FACS method.
  • Figure 9 is a diagram confirming the immunogenicity of G2D IgG using an in silico method.
  • Figure 10 is a diagram confirming the epitope of G2D IgG.
  • Figure 10a is a diagram confirming the binding of G2D IgG to recombinant 4Ig B7-H3 protein by western blot to confirm the epitope type of G2D IgG
  • Figure 10b is a diagram confirming the human 4Ig B7-H3 peptide to which G2D IgG binds. .
  • Figure 10c is a diagram confirming the binding of G2D IgG to human 4Ig B7-H3 peptide containing EVQVP, which is expected to be an epitope of G2D IgG
  • Figure 10d is a diagram showing the epitope of G2D IgG in all amino acids of human 4Ig B7-H3 am
  • Figure 10e is a diagram showing the epitope of G2D IgG in the human 4Ig B7-H3 protein structure.
  • FIG. 11 is a diagram confirming the anticancer efficacy of G2D IgG in syngeneic mice transplanted with the GL261 cell line.
  • FIG. 11A is a diagram showing the results of measuring tumor volume
  • FIG. 11B is a diagram showing the results of measuring body weight.
  • B7-H3 positive clones were selected using phage display technology.
  • 2.5 ⁇ g of recombinant human 4Ig B7-H3 (Sino Biological, China) was conjugated to magnetic beads (ThermoFisher Scientific, USA).
  • a non-immune chicken phage library (chicken naive phage library) was reacted with a Raji cell pellet, which is known not to express B7-H3, to remove phages binding to Raji cells in advance, and dispersed in a 3% bovine serum albumin (Millipore, USA) solution.
  • 96 clones selected from the plate of the fourth biopanning result were cultured overnight at 37°C with 100 ⁇ g/ml carbenicillin, 70 ⁇ g/ml kanamycin, and VCSM13 helper phage in a 96 deep well plate to produce scFv clones. Proliferation of expressed phage was induced.
  • the culture medium obtained above was centrifuged to obtain a medium supernatant containing phages, and recombinant human 4Ig B7-H3, recombinant human 2Ig B7-H3 (R&D Systems, USA), and recombinant mouse B7-H3 (Sino Biological, China) were obtained, respectively.
  • ER2738 which has a 2D clone showing a positive signal in the selected B7-H3, was cultured overnight using SB medium and centrifuged to obtain bacterial cells. Plasmid DNA was obtained using a DNA mini prep kit (Geneall, Korea), and the base sequence was analyzed using the primers in Table 1. The 2D clones analyzed had the CDR sequences in Table 2. The light chain and heavy chain variable region amino acid sequences of the 2D clone are shown in Table 3.
  • Amino acid sequences of light and heavy chain variable regions of selected clones amino acid sequence number light chain variable region ALTQPSSVSANLGGTVKITCSGGSIGYGWYQQKAPGSAPVTVIYYNDRRPSDIPSRFSGSKSGSANTLTITGVQADDEAIYYCGSADSSSTYTGIFGAGTTLTVL 9 Heavy chain variable region AVTLDESGGGLQTPGGGLSLVCKASGFDFSSYPMVWVRQAPGKGLEYVASINSGGSWTGYGAAVKGRATISRDNGQSTVRLQLNNLRAEDTATYYCARAYGAATIDAWGHGTEVIVSS 10
  • the heavy chain was treated with Eco RI and Not I (New England Biolab, UK) enzymes and ligated into pCMV (ThermoFisher Scientific, USA), an expression vector for animal cells, which was also treated with the same restriction enzymes. Additionally, the light chain was treated using Xba I (New England Biolab, UK) enzyme and ligated into the pCMV vector similarly treated with the same restriction enzyme. The ligated plasmid was transformed by applying heat shock to DH5 ⁇ competent cells (New England Biolab, UK), and the obtained colonies were mass-cultured to obtain the plasmid.
  • the heavy chain and light chain plasmids converted into complete antibodies were transduced into Expi293F cells (Invitrogen, USA) using polyethylenimine (PEI) (Polysciences, USA) and 150 mM NaCl, and cultured in Freestyle 293 expression medium (Invitrogen, USA). ) was cultured in suspension for 7 days in an Erlenmeyer flask at 37°C, 8% CO 2 and 55% humidity. The expression cell culture was centrifuged at 4,000 rpm for 10 minutes, and the supernatant was taken and filtered through a 0.22 ⁇ m filter.
  • PEI polyethylenimine
  • Freestyle 293 expression medium Invitrogen, USA
  • the filtered supernatant was induced to bind to a HiTrap Mabselect PrismA, 1 mL (GE Healthcare, USA) column at 4°C.
  • the bound resin was washed with 10 cv (column volume) of 20 mM sodium phosphate (pH 7.0) and 1 M sodium chloride solution, and then the bound antibody was eluted using 100 mM sodium citrate (pH 3.0) and 150 mM sodium chloride solution. Then, it was neutralized with 1 M Tris-HCL (pH 9.0).
  • the binding ability of the 2D IgG produced in Example 2 to the recombinant B7-H3 protein was confirmed by indirect ELISA.
  • indirect ELISA recombinant human 4Ig B7-H3, recombinant human 2Ig B7-H3, and recombinant mouse B7-H3 were each diluted to 1 ⁇ g/ml in 50 ⁇ l of PBS, placed in a 96-well immunoplate (Corning, USA), and incubated at 4°C. It was stored and adsorbed overnight.
  • the Raji cell line is known to be a B7-H3-negative cell line that does not express B7-H3 (Mol Ther Oncolytics. 2020;17:180-189), and B7-H3 is overexpressed in various breast cancer cells, including the BT-20 cell line. It is known that there is (Mol Cancer Ther. 2011;10(6):960-71).
  • the binding capacity of 2D IgG was analyzed by FACS using the Raji cell line, a B7-H3 negative cell line, and the BT-20 cell line, a B7-H3 positive cell line. 5x10 5 BT-20 and Raji cells were suspended in PBS with or without 1 ⁇ g of 2D IgG, reacted at 4°C for 30 minutes, and then centrifuged to remove the supernatant. After removing the supernatant, each cell was washed twice using PBS.
  • 2D IgG is a chicken/human chimeric antibody
  • humanization was performed as follows to secure a humanized antibody.
  • the amino acid residue numbers of the antibody domain are based on the Kabat EU numbering system commonly used in the art (Kabat et al., "Sequences of Proteins of Immunological Interest", 5th Ed., U.S. Department of Health and Human Services, Numbered according to EU index numbers as in NIH Publication No. 91-3242, 1991.
  • the J gene of the light chain variable region was fixed as FGGGTKLTVL, referring to US2010-0056386, and the J gene of the heavy chain variable region was fixed as WGQGTTVTVSS, referring to US2014-0206849.
  • Humanized 2D was named G2D, and its base sequence is shown in Table 5.
  • G2D light and heavy chain variable region amino acid sequences light chain variable region G2D (VL) SYELTQPPSVSVSPGQTARITC SGGSIGYG WYQQKAPGQAPV T VIY YNDRRPS GIPERFSGS K SGTT N TLTISGVQAEDEADYYC GSADSSSTYTGI FGGGTKLTVL SEQ ID NO: 21
  • Heavy chain variable region G2D (VH) QVQLVESGGGLVQPGGSLRLSCSASGF D FS SYPMV WVRQAPGKGLEYVS SINSGGSWTGYGAAVKG R
  • a TISRDNSKNTLYLQMNSLRAEDTATYYCAR AYGAATIDA WGQGTTVTVSS SEQ ID NO: 22
  • the DNA of the G2D variable region described above was synthesized in scFv form (Cosmogenetech, Korea) and converted into a complete antibody through PCR using the primer combinations shown in Table 6 below. Complete antibody conversion and expression/purification were performed in the same manner as in Example 2 described above.
  • the binding ability of G2D IgG to B7-H3 was confirmed through SPR analysis, which can measure antigen-antibody binding force and kinetics using optical principles. SPR analysis can confirm the association rate (K a ) and dissociation rate (K d ), and through this, the K D value can be obtained, making quantitative binding force analysis possible.
  • B7-family proteins are expressed on the surface of antigen presenting cells (APC), including cancer cells, and regulate T cell activity through interaction with T cell surface proteins (Figure 4).
  • APC antigen presenting cells
  • B7-H3 is one of the B7 family proteins expressed on APC.
  • the T cell receptor has not yet been identified, it is known as an immune checkpoint that inhibits the action of T cells (Front Immunol. 2021; 12: 701006). Since B7 family proteins regulate T cell actions through different mechanisms, the specificity of antibodies targeting B7-H3 for B7-H3 is very important. Therefore, the specificity of G2D IgG for B7-family proteins was analyzed by indirect ELISA.
  • Indirect ELISA was performed on: B7-DC (Sino Biological, China), B7-1 (Sino Biological, China), B7-2 (Sino Biological, China), B7-H2 (Sino Biological, China), B7-H4 (Sino Biological, China) China), B7-H1 (Sino Biological, China), 4Ig B7-H3, and 2Ig B7-H3 were used in the same manner as Example 3-1 using a 96-well immune plate coated at 1 ⁇ g/ml.
  • G2D IgG was 4Ig among B7 family proteins. It bound only to 2Ig B7-H3 ( Figure 5). These results show the excellent specificity of G2D IgG for B7-H3.
  • the recombinant protein and the cell surface protein have the same sequence, there may be structural differences, so it is essential to confirm the binding of the antibody to the cell surface protein.
  • a structure containing 4Ig, 2Ig, and mouse B7-H3 extracellular domain was introduced into Raji cell line, a B7-H3 negative cell line. 2Ig, 4Ig, and mouse B7-H3 expressed on the cell surface were confirmed through insertion of green fluorescent protein (GFP). Binding of G2D IgG to B7-H3 expressed on the cell surface was confirmed in the same manner as Example 3-2.
  • the secondary antibody used was goat anti-Human IgG (H+L) 594 antibody (Invitrogen, USA). Since binding to cell lines is difficult to confirm quantitatively, enoblituzumab, currently in the clinical stage and registered as a Korean patent (registration number: 10-1828570), was used as a control antibody.
  • G2D IgG did not bind to Raji-Vector control, which did not express B7-H3, but bound to Raji-4Ig B7-H3 and Raji-2Ig B7-H3, which expressed 4Ig and 2Ig B7-H3 ( Figure 6a).
  • the binding affinity of G2D IgG to 4Ig and 2Ig B7-H3 expressed on the cell surface was higher than that of enoblituzumab, a control antibody. Similar to human B7-H3, G2D IgG did not bind to Raji-Vector control, but bound to Raji-mouse B7-H3 expressing mouse B7-H3 ( Figure 6b).
  • the control antibody, enoblituzumab did not bind to mouse B7-H3.
  • Therapeutic antibodies are injected into the body and exhibit therapeutic effects by specifically binding to antigens expressed on cells, so the better the binding ability to antigens expressed on cells, the better the therapeutic effect can be expected.
  • Figures 6a and b specific and excellent binding of G2D IgG to cell surface B7-H3 can be confirmed.
  • G2D IgG showed a clear peak shift in all 16 cell lines used compared to the control to which only the secondary antibody was bound, except for the breast cancer cell line MDA-MB-453 ( Figure 7). These results show that G2D IgG binds to 15 out of 16 cell lines used, meaning that G2D IgG can bind to cancer cells expressing B7-H3 regardless of cancer type.
  • Antibodies that cross-link to human and mouse antigens are advantageous for developing treatments because they allow the anticancer effect and level of immune cell activity to be confirmed in a syngeneic mouse model with a preserved immune system. Additionally, it has the advantage of being able to confirm toxicity in small animals, mice, before large animal toxicity tests. Therefore, a total of four mouse cancer cell lines, 3LL (mouse lung cancer cell line), 4T1 (mouse breast cancer cell line), Panc-02 (mouse pancreatic cancer cell line), and GL-261 (mouse brain tumor cell line), in which expression of B7-H3 was confirmed. The binding ability of G2D IgG was confirmed by the method of Example 3-2.
  • G2D IgG bound to the four mouse cancer cell lines used ( Figure 8). These results mean that G2D IgG can be applied to various mouse models, including the syngeneic mouse model, and when developing G2D IgG as a therapeutic antibody, efficient evaluation of anticancer effects is possible in preclinical tests.
  • the property of inducing an immune response when a therapeutic antibody is introduced into the body is called immunogenicity.
  • the immune response in the body caused by the immunogenicity of a therapeutic antibody can cause serious problems not only in drug efficacy but also in patient safety. . Therefore, confirmation of the immunogenicity of therapeutic antibodies is an important part of drug development. Therefore, the immunogenicity of G2D IgG was confirmed using an in silico method.
  • Epitope is an antigenic determining site and refers to a specific sequence of an antigen that an antibody can recognize and bind to.
  • the therapeutic effect of antibodies may differ depending on the epitope, and in the case of cancer immunotherapy drugs, the degree of immune cell activation may also vary, so identifying the epitope of an antibody is an important part of drug development.
  • EVQVP is located in the Ig-like V-type1 and Ig-like V-type2 domains of 4Ig B7-H3 ( Figures 10d and e).
  • these epitopes were confirmed to contain the GYPEAE sequence ( Figure 10b), and GYPEAE is the Ig-like C2-type1 and Ig-like C2- of 4Ig B7-H3. It is located in type2 ( Figures 10d and e).
  • G2D IgG had a different epitope from the control antibody, enoblituzumab.
  • the underlined bold portion in the above sequence represents the B7-H3 epitope to which the G2D antibody binds.
  • G2D IgG showed a T cell-mediated cancer cell killing effect that induced about 30% of activation compared to the negative control group, and the effect was equal or better than that of enoblituzumab, which has wild-type Fc as a control antibody (Table 9). This means that G2D IgG can enhance the cell death effect of T cells through B7-H3 binding on the surface of cancer cells, and that G2D IgG can be applied as an immunotherapy agent.
  • Example 9 Evaluation of anticancer efficacy of G2D IgG in GL261 transplant syngeneic mouse model
  • G2D IgG as an immuno-anticancer agent was confirmed in Example 8, it was verified through an animal model.
  • the syngeneic mouse model induces cancer while the mouse immune system is preserved, so if the antibody being evaluated can recognize mouse cancer cell antigens, it is useful for confirming the anticancer effect through immune cells without separate immune cell transplantation.
  • GL261 FIG. 8
  • a mouse glioma cell line for which G2D IgG binding was confirmed was implanted subcutaneously on the right flank of the mouse at 4x106 cells/mouse into an immunocompetent mouse, a C57BL/ 6 female mouse (Orient Bio, Korea).
  • G2D IgG administration began when the tumor size reached approximately 70 mm 3 .
  • InVivo MAb anti-mouse CD276 (anti-mB7-H3 IgG) (BioXcell, USA), an antibody that binds to mouse B7-H3, was used.
  • Each antibody was injected intravenously at a concentration of 10 mg/kg, and administered twice a week for 2 weeks.
  • Body weight was measured using an electronic scale once a week after the start of administration and on the day of autopsy.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Organic Chemistry (AREA)
  • Immunology (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Microbiology (AREA)
  • Mycology (AREA)
  • Molecular Biology (AREA)
  • Epidemiology (AREA)
  • Genetics & Genomics (AREA)
  • Biophysics (AREA)
  • Biochemistry (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Peptides Or Proteins (AREA)

Abstract

본 발명은 B7-H3의 도메인의 아미노산 서열 내에 위치된 특정 에피토프에 결합하는 항-B7-H3 항체 또는 이의 항원 결합 단편에 관한 것이다. 상기 항체는 (i) B7-H3를 발현하는 다양한 종류의 암세포주에 특이적으로 결합하여 T cell 매개 암세포 사멸 효과를 나타내며, (ii) 인간과 마우스의 에피토프에 모두 결합하여 치료용 항체로 개발 시 전임상시험에서 효율적인 항암효과 평가가 가능할 것으로 예상된다.

Description

B7-H3에 특이적으로 결합하는 항체
본 발명은 B7-H3에 특이적으로 결합하는 항체 또는 이의 항원 결합 단편에 관한 것이다.
전 세계 고형항암제 시장은 '21년 약 1,010억 달러(약 126조 원)에서 '28년 약 2,520억 달러(약 310조 원)으로 연 평균 12.5% 성장할 것으로 전망되었다. '28년 세부질환별 시장 규모는 비소세포암(NSCLC, Non-small cell lung cancer) 약 520억 달러(약 65조 원), 유방암(Breast cancer) 약 460억 달러(약 57조 원), 전립선암(Prostate cancer) 약 210억 달러(약 26조 원), 흑색종(Melanoma) 약 160억 달러(약 20조 원), 신세포암(RCC, Renal cell carcinoma) 약 130억 달러(약 16조 원) 등으로 주요 다섯 개 암 종이 전체의 약 60% 비중을 차지할 것으로 예측된다(Evaluate Pharma Market Explorer, 2022).
국가암등록통계사업을 통해 수집된 우리나라 2019년 국가암 등록 통계를 살펴보면, 2015년 이후 암 환자 수는 매년 증가하였으며, 2019년 신규 발생한 암환자 수는 2018년도 대비 8,844명 (3.6%) 증가한 25만 4,718명이다(보건복지부. 2019년 국가암등록 통계자료).
국가암검진사업을 통한 6대암으로 분류되는 유방암, 위암, 대장암, 간암, 폐암 그리고 자궁경부암에 대해서 장기 추세를 보면, 6대암 중 5개의 암종인 폐암, 대장암, 간암, 위암, 그리고 자궁경부암의 발생률은 최근 10여 년간 감소 추세를 보여주거나, 유의미한 증가를 보이지 않는다. 반면 나머지 유방암의 발생률은 20년간 지속적으로 증가하는 추세를 보이고 있다.
유방암은 3가지 지표인 에스트로겐 수용체, 프로게스테론 수용체 그리고 표피성장인자 (HER2)를 기준으로 분류한다. 3가지 지표 검사시 전부 '음성 (발견되지 않음)'으로 확인되면 삼중음성 유방암으로 진단한다.
유방암은 진단 후 5년 생존율이 90% 이상이지만, 삼중음성 유방암은 70% 정도이다. 3~4기의 삼중음성 유방암 환자들의 5년 생존율은 30%정도에 불과하다. 이는 삼중음성 유방암을 제외한 다른 3~4기 유방암 환자들의 5년 생존율이 약 50% 인것과 비교하면 낮은 수치이다. 또한 조기 발견 환자의 30%정도가 외과적 수술 후 5년 내 사망 위험을 경험할 정도로 삼중음성 유방암의 진행이 빠르고 공격적이다.
삼중음성 유방암의 경우 암세포의 변이가 많으며, 다른 장기로의 전이가 다른 유방암보다 빠르기 때문에 치료에 여러 한계가 존재한다. 뿐만 아니라, 삼중음성 유방암은 초기에 치료해도 약 50% 환자가 재발을 경험할 정도로 예후가 나쁘다. 현재 유방암 치료제는 에스트로겐과 프로게스테론 그리고 표피성장인자 수용체를 표적으로 해서 치료한다. 따라서 이들 수용체가 음성인 삼중음성 유방암 환자들은 해당 약물을 이용하여 치료 효과를 기대하기 어렵다.
성인암 뿐만 아니라 소아암의 비율도 적지 않은 범위로 발생되고 있다. 소아암의 발생빈도는 전세계적으로 비슷하며, 대한민국의 경우 매년 1,000~1,200여명이 소아암으로 진단을 받는다. 이는 소아 10만 명당 매년 약 1명이 소아암으로 진단을 받으며 이는 전체 암환자의 약 1%을 차지하고 있다. 소아암은 1세부터 9세 사이 아동의 질병 사망률 1위로 교통사고로 사망한 아동 수보다 많을 정도로 매우 위험한 질병이다.
대표적인 소아암으로는 백혈병, 림프종 그리고 뇌종양으로 나눌 수 있다. 백혈구 중에서도 림프구계 백혈구가 제대로 성숙하지 못하고 암세포로 변하는 백혈병인 림프모구백혈병의 경우 치료 성적이 매우 좋아 완치율이 80~90% 가량이 되며, 급성골수성 백혈병 역시 70%의 완치율을 보이고 있다. 그러나, 소아 뇌종양의 경우 예후가 좋지 않아 새로운 치료법 개발이 필요한 실정이다. 보건복지부 중앙암등록본부 자료에 의하면 2020년에 대한민국에서는 247,952건의 암이 새로이 발생했는데, 그 중 뇌종양은 전체 암 발생의 0.7%인 1,795건으로 확인되었다. 이중에서 소아청소년 뇌종양은 총 152건으로 10세~19세에서 74건 그리고 9세 이하에서 78건이 발생하였다고 보고하였다. 남녀 성비는 1.8:1로 남자에게 더 많이 발생했다. 국가암정보센터에 따르면 소아청소년기에 호발하는 뇌종양으로는 수모세포종 (Medulloblastoma), 성상세포종 (Astrocytoma), 뇌실막세포종 (Ependymoma), 두개인두종 (Craniopharyngioma), 뇌간신경아교종 (Brainstem glioma) 그리고 배세포종 (Germ cell tumor)이며, 뇌종양은 악성도, 발생위치 그리고 구성하는 세포에 따라서 나눌 수 있다.
이중 수모세포종은 소뇌 중앙부에서 자라며, 뇌척수액로를 통해 전이를 일으키기도 한다. 두통 등의 뇌압상승 징후, 운동장애, 뇌신경 마비 징후 그리고 의식장애 등을 나타내며, 소아기 악성 뇌종양 중 가장 흔한 암이다. 뇌종양중 뇌간신경아교종은 뇌의 부위 중 중뇌, 뇌교, 연수에서 발생하는 교종으로 구음장애 연하장애, 사시, 안면 신경마비등 다발성 뇌신경 장애나 반신부전 마비가 오며, 2년 생존율이 10% 미만으로 예후가 가장 나쁜 소아 뇌종양이다. 현, 뇌종양의 치료법으로는 수술 또는 수술과 방사선 치료를 함께하는 것이 가장 기본적이 치료이며 종양 조직 결과에 따라서 항암화학용법을 시도하기도 한다.
수모세포종에 대한 수술적 치료의 경우 소뇌함구증후군 (Cerebellar mutism syndrome CMS) 이 수술 환자의 25%에게 나타나는데, 소뇌함구증후군은 소뇌를 포함한 뇌의 특정 부위를 종양 제거 수술을 받은 환자에서 발생할 수 있는 상태이며, 수술 후 약 1~2일 후 증상이 나타나며 증상으로는 말수가 줄어들고, 균형 잡기가 어려워 걷기가 힘들거나 근육 긴장 소실 등이 포함된다. 소뇌함구증후군에 따른 증상들은 시간이 흐르면서 서서히 사라지게 된다. 하지만, 수술 후 방사선조사를 바로 실시하는데 이 또한, 어려움이 존재한다. 수술 후 보조 두개척추 방사선 치료법은 뇌척수액(Cerebrospinal fluid, CSF)에서 수포종이 전파되는 것을 방지하기 위해 수포종의 전체 뇌와 척추를 치료하는 데 사용되는데, 두개척추 방사선 치료는 의심할 여지없이 생존을 연장하지만, 아쉽게도 방사선 치료법은 매년 2-4포인트의 지능발달 지수 (Intelligence Quotient, IQ) 감소를 희생해야 한다.
연수막 전이암은 전체 고형암의 약 5-20%에서 나타난다고 알려져 있으며 이 중 폐암, 유방암, 흑색종이 많은 비중을 차지하고 있다. 연수막전이암으로 전이되는 환자의 비율 역시 폐암, 유방암, 흑색종에서 많은 빈도수로 나타나고 있다(Cancers (Basel). 2021;13). 2020년 국가암등록 통계에 따르면 2020년 폐암은 28,949명, 유방암은 24,923명이 진단된 것으로 알려져 있기에 위의 두가지 암에서 발생하는 연수막 전이암 환자수만 국내에서 한 해에 최소 2500명 이상이 될 것으로 예상이 되며 다른 적응증 유래 연수막전이암 환자수 및 진단법과 치료제의 발전을 고려하면 그 수는 더욱 늘 것으로 예상된다. 하지만 늘어나는 환자수에 비해 효과적인 치료제 개발은 쉽지 않은 상황이다. 뇌실 내로 메토트렉세이트 (Methotrexate)같은 항암제를 투여하거나 국소 방사선 치료가 증상 개선에 도움이 될 수 있으나 치료를 받더라도 중앙생존기간이 6개월 이내로 예후가 매우 좋지 않다(대한내과학회지. 2011;제81권:제3호). 그나마 최근 혈관-뇌장벽을 효과적으로 통과하는 타그리소 같은 타깃치료제들이 연수막전이암에도 효과적이라고 알려져있으나 적용가능한 환자수가 제한적이며 타깃치료제들은 내성이 생기는 문제를 안고 있다(Neurotherapeutics. 2022;19:1782-1798).
한편, B7-H3은 소아뇌암, 연수막전이암, 삼중음성 유방암을 비롯한 다양한 암종에서 높게 발현된다고 알려져 있으며, 이러한 B7-H3의 고발현은 부정적인 임상적 치료 결과와 관련되어 있다. 일부 연구에 따르면 B7-H3에 특이적으로 결합하는 단일클론 항체를 인간 삼중음성 유방암세포주에 처리한 결과 삼중음성 유방암세포의 성장이 억제되는 결과를 도출하였다. 따라서 본 발명자는 암에서 높게 발현하고 있는 B7-H3에 대하여 다양한 암에 대한 관계성 및 삼중음성 유방암 등에 있어서 치료제로의 가능성을 확인하고 본 발명을 하기에 이르렀다.
상기한 배경기술로서 설명된 사항들은 본 발명의 배경에 대한 이해 증진을 위한 것일 뿐, 이 기술분야에서 통상의 지식을 가진 자에게 이미 알려진 종래기술에 해당함을 인정하는 것으로 받아들여져서는 안 될 것이다.
이에 본 발명자들은 고형암에서 높게 발현하고 있는 B7-H3를 타겟하는 항체를 개발하고자 하였다. 그 결과 본 발명자들은 B7-H3를 발현하는 다양한 종류의 암세포주에 특이적으로 결합하여 T cell 매개 암세포 사멸 효과를 나타내는 항-B7-H3 항체를 발굴함으로써 본 발명을 완성하게 되었다.
따라서 본 발명의 목적은, B7-H3에 특이적으로 결합하는 항-B7-H3 항체 또는 이의 항원 결합 단편을 제공하는데 있다.
본 발명의 다른 목적은, B7-H3의 도메인의 아미노산 서열 내에 위치된 특정 에피토프에 결합하는 항-B7-H3 항체 또는 이의 항원 결합 단편을 제공하는데 있다.
본 발명의 또 다른 목적은, 상기 항-B7-H3 항체 또는 이의 항원 결합 단편을 코딩하는 핵산을 제공하는데 있다.
본 발명의 또 다른 목적은, 상기 핵산을 포함하는 벡터를 제공하는데 있다.
본 발명의 또 다른 목적은, 상기 벡터를 포함하는 세포를 제공하는데 있다.
본 발명의 또 다른 목적은, 상기 벡터로 형질전환된 세포를 제공하는데 있다.
본 발명의 또 다른 목적은, 상기 항-B7-H3 항체 또는 이의 항원 결합 단편, 상기 항체 또는 이의 항원 결합 단편을 코딩하는 핵산, 상기 핵산을 포함하는 벡터 및 상기 벡터를 포함하거나 상기 벡터로 형질전환된 세포로 구성된 군으로부터 선택되는 성분을 포함하는 조성물을 제공하는데 있다.
본 발명의 또 다른 목적은, 상기 항-B7-H3 항체 또는 이의 항원 결합 단편, 상기 항체 또는 이의 항원 결합 단편을 코딩하는 핵산, 상기 핵산을 포함하는 벡터 및 상기 벡터를 포함하거나 상기 벡터로 형질전환된 세포로 구성된 군으로부터 선택되는 성분 및 약제학적으로 허용되는 담체를 포함하는 암의 예방 또는 치료용 약제학적 조성물을 제공하는데 있다.
본 발명의 또 다른 목적은, 이를 필요로 하는 대상에게, 상기 항-B7-H3 항체 또는 이의 항원 결합 단편, 상기 항체 또는 이의 항원 결합 단편을 코딩하는 핵산, 상기 핵산을 포함하는 벡터 및 상기 벡터를 포함하거나 상기 벡터로 형질전환된 세포로 구성된 군으로부터 선택되는 성분을 투여하는 단계를 포함하는, 암의 치료방법을 제공하는데 있다.
본 발명의 또 다른 목적은, 상기 항-B7-H3 항체 또는 이의 항원 결합 단편, 상기 항체 또는 이의 항원 결합 단편을 코딩하는 핵산, 상기 핵산을 포함하는 벡터 및 상기 벡터를 포함하거나 상기 벡터로 형질전환된 세포로 구성된 군으로부터 선택되는 성분을 포함하는 것을 특징으로 하는, 암의 진단용 조성물을 제공하는데 있다.
본 발명의 다른 목적 및 이점은 하기의 발명의 상세한 설명, 청구범위 및 도면에 의해 보다 명확하게 된다.
본 발명의 일 양태에 따르면, 본 발명은 B7-H3에 특이적으로 결합하는 항-B7-H3 항체 또는 이의 항원 결합 단편을 제공한다.
암세포를 포함하는 항원발현세포 (Antigen presenting cell, APC)의 표면에는 B7-family protein이 발현되어 있고 T cell 표면 단백질과의 상호작용을 통하여 T cell의 작용을 조절한다. B7-H3는 APC에 발현된 B7 family protein 중 하나로 T cell의 작용을 저해하는 immune checkpoint로 알려져 있다(Front Immunol. 2021; 12: 701006). B7 family protein은 T cell의 작용을 서로 다른 기전으로 조절하므로 B7-H3를 타겟하는 항체의 B7-H3에 대한 특이성이 매우 중요하다.
본 명세서에서 용어 "항체"는 당업계의 용어이며 본 명세서에서 상호 교환하여 사용될 수 있고, 항원에 특이적으로 결합하는 항원 결합 부위를 가진 분자를 말한다. 본 명세서에서 사용된 용어는 전체 항체 및 임의의 항원 결합 단편(즉 "항원-결합 부분") 또는 이들의 단쇄를 포함한다. 하나의 구체예에서, "항체"는 이황화물 결합에 의해 상호-연결된 적어도 2개의 중쇄(H)와 2개의 경쇄(L)를 포함하는 당단백질, 또는 이의 항원-결합 부분을 말한다. 다른 구체예에서, "항체"는 단일 가변 도메인, 예를 들어 VHH 도메인을 포함하는 단쇄 항체를 말한다. 각 중쇄는 중쇄 가변 영역(VH로 약기)과 중쇄 불변 영역으로 이루어진다. 특정 자연-발생 항체에서, 중쇄 불변 영역은 3개의 도메인 CH1, CH2 및 CH3으로 이루어진다. 특정 자연-발생 항체에서, 각 경쇄는 경쇄 가변 영역(VL로 약기)과 경쇄 불변 영역으로 이루어진다. 경쇄 불변 영역은 하나의 도메인 CL로 이루어진다.
VH 및 VL 영역은 프레임워크 영역(FR)이라 칭하는, 더 보존되는 영역들이 산재된, 상보성 결정 영역(CDR)이라 칭하는, 초가변성의 영역으로 더 세분될 수 있다. 각각의 VH 및 VL은 3개의 CDR과 4개의 FR로 이루어지며, 이들은 FR1, CDR1, FR2, CDR2, FR3, CDR3, 및 FR4의 순서로 아미노-말단에서 카복시-말단을 향해 배열된다. 중쇄 및 경쇄의 가변 영역은 항원과 상호작용하는 결합 도메인을 함유한다. 항체의 불변 영역은 면역 시스템의 다양한 세포(예를 들어 이펙터 세포) 및 정통 보체 시스템의 제1 성분(C1q)를 포함하는 숙주 조직 또는 인자들과 면역글로불린의 결합을 매개할 수 있다.
항체는 면역글로불린 분자의 임의의 타입(예를 들어 IgG, IgE, IgM, IgD, IgA 또는 IgY), 임의의 유형(예를 들어 IgD, IgG2, IgG3, IgG4, IgA1 또는 IgA2), 또는 임의의 아형(예를 들어 인간에서 IgG1, IgG2, IgG3 및 IgG4; 및 마우스에서IgG1, IgG2a, IgG2b 및 IgG3)를 가질 수 있다. 면역글로불린, 예를 들어 IgG1은 몇몇 알로타입으로 존재하며, 이들은 최대 몇 개의 아미노산이 서로 상이하다. 본 명세서에 개시된 항체는 통상 알려진 이소타입, 유형, 아형, 또는 알로타입 중 어느 것으로부터 유래할 수 있다. 특정 구체예에서, 본 명세서에 개시된 항체는 IgG1, IgG2, IgG3, 또는 IgG4 아형 또는 이들의 임의의 하이브리드이다. 특정 구체예에서, 항체는 인간 IgG1 아형 또는 인간 IgG2 또는 인간 IgG4 아형의 것이다.
"항체"는, 예로서, 자연-발생 및 비-자연-발생 항체; 단클론성 및 다클론성 항체; 키메라 및 인간화된 항체; 인간 및 비-인간 항체, 전체 합성 항체; 단쇄 항체; 단일특이적 항체; 다중특이적 항체(이중특이적 항체를 포함); 2개의 중쇄와 2개의 경쇄 분자를 포함하는 테트라머 항체; 항체 경쇄 모노머; 항체 중쇄 모노머; 항체 경쇄 다이머; 항체 중쇄 다이머; 항체 경쇄-항체 중쇄 쌍; 인트라바디; 헤테로콘쥬게이트 항체; 1가 항체; 낙타화 항체; 아피바디; 항-이디오타입(항-Id) 항체(예를 들어 항-항-Id 항체를 포함), 및 충분히 항원 결합할 수 있는 단일 모노머 가변 항체 도메인(예를 들어 VH 도메인 또는 VL 도메인)으로 구성된 결합 분자를 포함하는 단일-도메인 항체(sdAb)를 포함한다(Harmen M. M. and Haard H. J. Appl Microbiol Biotechnol. 77(1): 13-22 (2007)).
본 명세서에서 사용된 용어 항체의 "항원-결합 부분", 즉, "항원 결합 단편"은 항원(예를 들어, 인간 Ig-like-V-type 1 또는 Ig-like-V-type 2의 도메인)에 특이적으로 결합하는 능력을 보유한 항체의 하나 이상의 단편을 말한다. 이러한 "단편"은, 예를 들어 약 8 내지 약 1500개 아미노산 길이, 적합하게는 약 8 내지 약 745개 아미노산 길이, 더 적합하게는 약 8 내지 약 300개, 예를 들어 약 8 내지 약 200개 아미노산, 또는 약 10개 내지 약 50 또는 100개 아미노산 길이이다. 항체의 항원-결합 기능은 전장 항체의 단편에 의해 수행될 수 있다는 것이 밝혀졌다. 항체, 예를 들어 본 명세서에 개시된 항-B7-H3 항체의 "항원-결합 부분" 또는 "항원 결합 단편이란 용어에 포함되는 결합 단편의 예들은 (i) VL, VH, CL, 및 CH1 도메인으로 구성된 1가 단편인 Fab 단편; (ii) 힌지 영역에서 이황화물 브릿지에 의해 연결된 2개의 Fab 단편을 포함하는 2가 단편인 F(ab')2 단편; (iii) VH 및 CH1 도메인으로 구성된 Fd 단편; (iv) 항체의 단일 팔의 VL 및 VH 도메인으로 구성된 Fv 단편, 및 이황화물-연결된 Fvs(sdFv); (v) VH 도메인으로 구성된 dAb 단편(Ward et al., (1989) Nature 341: 544-546); 및 (vi) 분리된 상보성 결정 영역(CDR) 또는 (vii) 합성 링커에 의해 선택적으로 이어질 수 있는 둘 이상의 분리된 CDR의 조합을 포함하나, 이로 제한되는 것은 아니다. 또한, Fv 단편의 두 도메인인 VL과 VH는 별개의 유전자에 의해 코딩되지만, 이들은 합성 링커에 의해, 재조합 방법을 사용하여 이어질 수 있으며, 이로써 VL과 VH 영역이 쌍을 이루어 1가 분자를 형성한 단일 단백질 사슬이 될 수 있다(단쇄 Fv(scFv)라고 한다)(예를 들어 Bird et al., (1988) Science 242:423-426; 및 Huston et al., (1988) Proc. Natl. Acad. Sci. USA 85:5879-5883 참조). 이러한 단쇄 항체도 또한 항체의 "항원-결합 부분" 또는 "항원 결합 단편이라는 용어 내에 포함된다. 이들 항체 단편은 당업자에게 공지된 종래의 기술을 사용하여 얻어지며, 단편들은 무손상 항체와 동일한 방식으로 유용성에 대해 스크리닝된다. 항원-결합 부분은 재조합 DNA 기술에 의해, 또는 무손상 면역글로불린의 효소 또는 화학 절단에 의해 생성될 수 있다.
본 명세서에서 사용된 용어 "가변영역" 또는 "가변도메인"은 당업계에서 통상적으로 상호 교환하여 사용된다. 가변영역은 전형적으로 항체의 일부분, 일반적으로 경쇄 또는 중쇄의 일부분, 전형적으로 성숙한 중쇄에서 약 110 내지 120개 아미노산 및 성숙한 경쇄에서 약 90 내지 115개 아미노산을 말하며, 이들은 항체와 서열이 광범하게 상이하고 이의 특정 항원에 대한 특정 항체의 결합 및 특이성 때문에 사용된다. 서열 변동성은 상보성 결정 영역(CDR)이라고 불리는 영역에 집중되며, 가변 도메인에서 더 고도로 보존된 영역은 프레임워크 영역(FR)이라고 불린다.
경쇄 및 중쇄의 CDR은 항원과 항체의 상호작용 및 특이성을 주로 담당한다고 여겨진다. 특정 구체예에서, 가변영역은 인간 가변영역이다. 특정 구체예에서, 가변영역은 설치류 또는 뮤린 CDR과 인간 프레임워크 영역(FR)을 포함한다. 특정 구체예에서, 가변영역은 영장류(예를 들어 비-인간 영장류) 가변영역이다. 특정 구체예에서, 가변영역은 설치류 또는 뮤린 CDR과 영장류(예를 들어 비-인간 영장류) 프레임워크 영역(FR)을 포함한다.
본 명세서에서 사용된 용어 "중쇄"는 항체와 관련하여 사용되었을 때, 불변도메인의 아미노산 서열에 기초하여, 임의의 상이한 타입, 예를 들어 알파(α), 델타(δ), 엡실론(ε), 감마(γ) 및 뮤(μ)를 말할 수 있으며, 이들은 각각 IgG의 아형, 예를 들어 IgG1, IgG2, IgG3 및 IgG4를 포함하여, 항체의 IgA, IgD, IgE, IgG 및 IgM 유형을 발생시킨다.
본 명세서에서 사용된 용어 "경쇄"는 항체와 관련하여 사용되었을 때, 불변도메인의 아미노산 서열에 기초하여 임의의 상이한 타입, 예를 들어 카파(κ) 및 람다(λ)를 말할 수 있다. 경쇄 아미노산 서열은 당업계에 잘 공지되어 있다. 특정한 구체예에서, 경쇄는 인간 경쇄이다.
본 명세서에서 용어 "VL" 및 "VL 도메인"은 상호 교환하여 사용되며 항체의 경쇄 가변영역을 말한다.
용어 "VH" 및 "VH 도메인"은 상호 교환하여 사용되며 항체의 중쇄 가변영역을 말한다.
본 명세서에서 사용된 용어 "불변영역" 또는 "불변도메인"은 상호 교환 가능하며 당업계에서의 통상의 의미를 가진다. 불변 도메인은 항체 부분이며, 예를 들어 항체와 항원의 결합에는 직접 연루되지 않지만 Fc 수용체와의 상호작용과 같은 다양한 이펙터 기능을 나타낼 수 있는 경쇄 및/또는 중쇄의 카복시 말단 부분이다. 면역글로불린 분자의 불변 영역은 일반적으로 면역글로불린 가변 도메인에 비해 더 보존된 아미노산 서열을 가진다.
"Fc 영역"(단편 결정화 가능한 영역) 또는 "Fc 도메인" 또는 "Fc"는 면역 시스템의 다양한 세포(예를 들어 이펙터 세포) 상에 위치된 Fc 수용체 또는 정통 보체 시스템의 제1 성분(C1q)과의 결합을 포함하여, 숙주 조직 또는 인자들과 면역글로불린의 결합을 매개하는 항체의 중쇄의 C-말단 영역을 말한다. 따라서, Fc 영역은 제1 불변 영역 면역글로불린 도메인(예를 들어 CH1 또는 CL)을 제외한 항체의 불변 영역을 포함한다. IgG, IgA 및 IgD 항체 이소타입에서, Fc 영역은 항체의 두 중쇄의 제2(CH2) 및 제3(CH3) 불변 도메인으로부터 유래된 2개의 동일한 단백질 단편을 포함한다; IgM 및 IgE Fc 영역은 각 폴리펩타이드 사슬에 3개의 중쇄 불변 도메인(CH 도메인 2~4)을 포함한다. IgG의 경우, Fc 영역은 면역글로불린 도메인 Cγ2 및 Cγ3과 Cγ1과 Cγ2 사이의 힌지를 포함한다. 면역글로불린 중쇄의 Fc 영역의 경계는 다양하지만, 인간 IgG 중쇄 Fc 영역은 일반적으로 위치 C226이나 P230에 있는 아미노산 잔기(또는 이들 두 아미노산 사이의 아미노산)에서 중쇄의 카복시-말단까지 늘어난 것으로서 한정되며, 여기서 넘버링은 Kabat에서와 같은 EU 인덱스를 따른다. 인간 IgG Fc 영역의 CH2 도메인은 약 아미노산 231에서 약 아미노산 340까지 연장되고, CH3 도메인은 Fc 영역에서 Cm 도메인의 C-말단 측에 위치되는데, 즉 그것은 IgG의 약 아미노산 341에서 약 아미노산 447까지 연장된다. Fc 영역은 임의의 알로타입 변이체를 포함하는 자생 서열 Fc, 또는 변이체 Fc(예를 들어 비-자연-발생 Fc)일 수 있다. 또한, Fc는 분리된 상태의 영역을 말하거나 또는 "Fc 융합 단백질"(예를 들어 항체 또는 면역유착(immunoadhesion))이라고도 하는, "Fc 영역을 포함하는 결합 단백질"과 같은 Fc-포함 단백질 폴리펩타이드와 관련된 영역을 말한다.
"힌지", "힌지 도메인" 또는 "힌지 영역" 또는 "항체 힌지 영역"은 CH1 도메인을 CH2 도메인에 연결하고 힌지의 상부, 중앙, 및 하부 부분을 포함하는 중쇄 불변 영역의 도메인을 말한다(Roux et al.J. Immunol. 1998 161:4083). 힌지는 항체의 결합 영역과 이펙터 영역 사이에 가요성의 수준을 변화시키며, 또한 두 중쇄 불변 영역 사이에 분자간 이황화물 결합을 위한 부위를 제공한다. 야생형 IgG1, IgG2, IgG3 및 IgG4 힌지의 서열이 당업계에 공지되어 있다(예를 들어 Kabat EA et al., (1991) Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No. 91-3242; Vidarsson G. et al., Front Immunol. 5:520(2014년 10월 20일 온라인 공개) 참조).
본 명세서에서 사용된 "이소타입"은 중쇄 불변 영역 유전자에 의해 암호화되는 항체 유형(예를 들어 IgG1, IgG2, IgG3, IgG4, IgM, IgA1, IgA2, IgD, 및 IgE 항체)을 말한다.
"알로타입"은 몇 개의 아미노산이 차이가 있는 특정한 이소타입 그룹 내에서 자연-발생한 변이체를 말한다(예를 들어 Jefferis et al. (2009) mAbs 1:1 참조). 본 명세서에 제시된 항체는 임의의 알로타입을 가질 수 있다. IgG1, IgG2, IgG3, 및 IgG4의 알로타입은 당업계에 공지되어 있다(예를 들어, Kabat EA et al., (1991)(상동); Vidarsson G. et al., Front Immunol. 5:520(2014년 10월 20일 온라인 공개); 및 Lefranc MP, mAbs 1:4, 1-7(2009) 참조).
용어 "항원을 인식하는 항체" 및 "항원에 특이적인 항체"는 용어 "항원에 특이적으로 결합하는 항체"와 본 명세서에서 상호 교환하여 사용된다.
본 명세서에서 사용된 "분리된 항체"는 상이한 항원 특이성을 가진 다른 항체가 실질적으로 없는 항체를 말한다(예를 들어 B7-H3에 특이적으로 결합하는 분리된 항체는 B7-H3 이외의 다른 항원에 특이적으로 결합하는 항체가 실질적으로 없다). 그러나, B7-H3의 에피토프에 특이적으로 결합하는 분리된 항체는 상이한 종으로부터의 다른 B7-H3 단백질에 대해 교차-반응성을 가질 수 있다.
"결합 친화성"은 일반적으로 분자(예를 들어 항체)의 단일 결합 부위와 이의 결합 파트너(예를 들어 항원) 간의 비-공유 상호작용의 전체 합계 강도를 말한다. 특별한 언급이 없다면, 본 명세서에서 사용된 "결합 친화성"은 결합 쌍의 멤버(예를 들어 항체와 항원) 간의 1:1 상호작용을 반영하는 고유한 결합 친화성을 말한다. 파트너 Y에 대한 분자 X의 친화성은 일반적으로 해리 상수(KD)에 의해 표시될 수 있다. 친화성은, 제한은 아니지만, 평형 해리 상수(KD), 및 평형 결합 상수(KA)를 포함하는, 당업계에 공지된 다수의 방식으로 측정 및/또는 표시될 수 있다. KD는 koff/kon의 몫으로부터 계산되고 몰 농도(M)로 표시되며, KA는 kon/koff의 몫으로부터 계산된다. kon은, 예를 들어 항원에 대한 항체의 결합 속도 상수를 말하고, koff는, 예를 들어 항원에 대한 항체의 해리 속도 상수를 말한다. kon 및 koff는 면역분석(예를 들어 효소-결합 면역흡착 분석(ELISA)), BIACORE® 또는 역학적 배제 분석(KinExA®)과 같은, 당업자에게 공지된 기술에 의해 결정될 수 있다.
본 명세서에서 사용된 용어 "특이적으로 결합한다", "특이적으로 인식한다", "특이적 결합", "선택적 결합" 및 "선택적으로 결합한다"는 항체와 관련하여 유사한 용어들로서 항원(예를 들어 에피토프 또는 면역 복합체)에 결합하는 분자(예를 들어 항체)와 관련된 용어이며, 이러한 결합은 당업자에 의해 이해되는 대로이다. 예를 들어, 항원에 특이적으로 결합하는 분자는, 예를 들어 면역분석, BIACORE®, KinExA® 3000 기기(Sapidyne Instruments, Boise, ID), 또는 당업계에 공지된 다른 분석들에 의해 결정되었을 때, 일반적으로 더 낮은 친화성으로 다른 펩타이드 또는 폴리펩타이드에 결합할 수 있다.
항체는 전형적으로 10-5 내지 10-11 M 이하의 해리 상수에 의해 반영되는, 높은 친화성으로 동족 항원에 특이적으로 결합한다. 약 10-4 M를 초과하는 KD는 일반적으로 비특이적 결합을 나타낸다고 간주된다. 항원과 "특이적으로 결합하는" 항체는 높은 친화성으로 항원 및 실질적으로 동일한 항원에 결합하는 항체를 말하며, 이것은 예를 들어 정해진 항원을 사용하여 면역분석(예를 들어 ELISA) 또는 BIACORE® 2000 기기에서 표면 플라즈몬 공명(SPR) 기술에 의해 결정되었을 때, 10-7 M 이하, 바람직하게 10-8 M 이하, 더욱더 바람직하게 10-9 M 이하, 보다 바람직하게 10-10 M 이하 또는 10-11 M 이하의 KD를 갖는 것을 의미하고, 이것은 관련 없는 항원에는 높은 친화성으로 결합하지 않는다.
본 명세서에서 사용된 용어 "항원"은 임의의 천연 또는 합성 면역원성 물질, 예컨대 단백질, 펩타이드 또는 합텐을 말한다. 항원은 B7-H3 또는 이의 단편일 수 있다.
본 명세서에서 사용된 "에피토프"는 당업계의 용어로서 항체가 특이적으로 결합할 수 있는 항원의 국소화된 영역을 말한다. 에피토프는, 예를 들어 폴리펩타이드의 연속(contiguous) 아미노산들(선형 또는 연속 에피토프)일 수 있거나, 또는 에피토프는, 예를 들어 폴리펩타이드 또는 폴리펩타이드들의 둘 이상의 비-연속 영역들이 합쳐진 것(입체형태적, 비-선형, 불연속, 또는 비-연속 에피토프)일 수 있다. 연속 아미노산으로부터 형성된 에피토프는 항상 그렇지는 않지만 전형적으로 변성 용매에 노출시 보유되고, 3차 접힘에 의해 형성된 에피토프는 전형적으로 변성 용매로 처리시 상실된다. 에피토프는 전형적으로 독특한 공간적 입체형태에서 적어도 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 또는 20개 아미노산을 포함한다. 에피토프가 주어진 항체에 의해 결합된 것을 결정하는 방법(즉 에피토프 맵핑)이 당업계에 잘 공지되어 있고, 이것은 예를 들어 면역블롯팅 및 면역침전 분석을 포함하며, 중첩 또는 연속 펩타이드가 주어진 항체(예를 들어 항-B7-H3 항체)와의 반응성에 대해 시험된다. 에피토프의 공간적 입체형태를 결정하는 방법은 당업계의 기술 및 본 명세서에 개시된 것들을 포함하며, 예를 들어 엑스선 결정학, 2-차원 핵자기공명 및 HDX-MS를 포함한다(예를 들어 Epitope Mapping Protocols in Methods in Molecular Biology, Vol. 66, G. E. Morris, Ed. (1996) 참조).
둘 이상의 항체와 관련하여 용어 "동일한 에피토프에 결합한다"는 주어진 방법에 의해 결정되었을 때 항체들이 아미노산 잔기의 동일한 세그먼트에 결합한다는 것을 의미한다. 항체들이 본 명세서에 제시된 항체와 "B7-H3 상의 동일한 에피토프"에 결합하는지의 여부를 결정하는 기술은, 예를 들어 에피토프 맵핑 방법, 예컨대 에피토프의 원자 분해능을 제공하는 항원:항체 복합체의 결정의 엑스선 분석 및 수소/중수소 교환 질량분광법(HDX-MS)을 포함한다. 다른 방법은 항체와 항원 단편 또는 항원의 돌연변이된 변이체의 결합을 모니터링하며, 여기서 항원 서열 내에서 아미노산 잔기의 변형으로 인한 결합의 손실이 주로 에피토프 성분의 표시로서 간주된다. 이에 더하여, 에피토프 맵핑을 위한 컴퓨터 조합 방법이 또한 사용될 수 있다. 이들 방법은 조합 파지 디스플레이 펩타이드 라이브러리로부터 특정한 짧은 펩타이드를 친화성 분리할 수 있는 관심 항체의 능력에 의존한다. 동일한 VH 및 VL 또는 동일한 CDR1, 2 및 3 서열을 가진 항체는 동일한 에피토프에 결합할 것으로 예상된다.
"표적과의 결합에 대해 다른 항체와 상호 경쟁(cross-compete)하는" 항체는 나머지 항체와 표적의 결합을 (부분적으로 또는 완전히) 저해하는 항체를 말한다. 두 항체가 표적과의 결합에 대해 서로 경합하는지의 여부, 즉 하나의 항체가 나머지 항체와 표적의 결합을 저해하는지의 여부와 저해하는 정도는 공지된 경합 실험을 사용하여 결정될 수 있다. 특정 구체예에서, 항체는 다른 항체와 표적의 결합에서 경쟁하며 이 결합을 적어도 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% 또는 100%까지 저해한다. 저해 또는 경쟁의 수준은 항체가 "차단 항체"(즉 표적과 먼저 인큐베이션된 저온 항체)인지에 따라 상이할 수 있다. 경쟁 분석은, 예를 들어 E.d. Harlow and David Lane, Cold Spring Harb Protoc; 2006; doi:10.1101/pdb.prot4277 또는 E.d. Harlow and David Lane에 의한 "Using Antibodies"(Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY, USA 1999)의 제11장에 제시된 대로 수행될 수 있다. 경합 항체는 (예를 들어 입체 장해에 의해) 동일한 에피토프, 중첩 에피토프 또는 인접 에피토프에 결합한다.
용어 "기준 항체" 또는 "reference antibody"는 상기 동일한 에피토프, 중첩 에피토프 또는 인접 에피토프에 결합하는 경합 항체의 분석의 기준이 되는 항체를 의미하며, 상기 경합 항체와 에피토프와의 결합에서 상호-경쟁(cross-compete)한다.
다른 경합 결합 분석은 고체상 직접 또는 간접 방사성면역분석(RIA), 고체상 직접 또는 간접 효소면역분석(EIA), 샌드위치 경합 분석(Stahli et al., Methods in Enzymology 9:242 (1983) 참조); 고체상 직접 바이오틴-아비딘 EIA(Kirkland et al., J. Immunol. 137:3614 (1986) 참조); 고체상 직접 표지화 분석, 고체상 직접 표지화 샌드위치 분석(Harlow and Lane, Antibodies: A Laboratory Manual, Cold Spring Harbor Press (1988) 참조); 1-125 표지를 사용한 고체상 직접 표지 RIA(Morel et al., Mol. Immunol. 25(1):7 (1988) 참조); 고체상 직접 바이오틴-아비딘 EIA(Cheung et al., Virology 176:546 (1990) 참조); 및 직접 표지화 RIA(Moldenhauer et al., Scand. J. Immunol. 32:77 (1990) 참조)를 포함한다.
본 명세서에서 사용된 용어 "단클론성 항체"는 특정 에피토프에 대해 단일 결합 특이성 및 친화성을 나타내는 항체 또는 모든 항체가 특정 에피토프에 대해 단일 결합 특이성 및 친화성을 나타내는 항체들의 조성물을 말한다. 따라서, 용어 "인간 단클론성 항체"는 단일 결합 특이성을 나타내고 인간 점라인 면역글로불린 서열로부터 유래된 가변 및 선택적 불변 영역을 가진 항체 또는 항체 조성물을 말한다. 하나의 구체예에서, 인간 단클론성 항체는 트랜스제닉 비-인간 동물, 예를 들어 불멸화 세포에 융합된 인간 중쇄 트랜스젠과 경쇄 트랜스젠을 포함하는 게놈을 가진, 트랜스제닉 마우스로부터 얻어진 B 세포를 포함하는 하이브리도마에 의해 생성된다.
용어 "재조합 인간 항체"는 (a) 인간 면역 글로불린 유전자에 대해 트랜스젠이거나 트랜스염색체성(transchromosomal)인 동물(예를 들어 마우스)로부터 분리된 항체 또는 그로부터 제조된 하이브리도마, (b) 항체를 발현하도록 형질전환된 숙주 세포로부터, 예를 들어 트랜스펙토마(transfectoma)로부터 분리된 항체, (c) 재조합, 조합 인간 항체 라이브러리로부터 분리된 항체, 및 (d) 다른 DNA 서열에 대한 인간 면역글로불린 유전자 서열을 스플라이싱을 수반하는 임의의 다른 수단에 의해 제조, 발현, 생성 또는 분리된 항체와 같은, 재조합 수단에 의해 제조, 발현, 생성 또는 분리된 모든 인간 항체를 포함한다. 이러한 재조합 인간 항체는 점라인 유전자에 의해 암호화되지만, 예를 들어 항체 성숙화 동안 발생하는 후속 재배열 및 돌연변이를 포함하는 특정한 인간 점라인 면역글로불린 서열을 이용하는 가변 및 불변 영역을 포함한다. 당업계에 공지된 대로(예를 들어 Lonberg (2005) Nature Biotech. 23(9): 1117-1125 참조), 가변 영역은 외래 항원에 대해 특이적인 항체를 형성하도록 재배열한 다양한 유전자에 의해 암호화된, 항원 결합 도메인을 함유한다. 재배열에 더하여, 가변 영역은 외래 항원에 대한 항체의 친화성을 증가시키기 위해 다수의 단일 아미노산 변화(체세포 돌연변이 또는 초돌연변이)에 의해 더 변형될 수 있다. 불변 영역은 항원에 대한 추가의 반응(즉 이소타입 스위치)에서 변할 것이다. 따라서, 항원에 반응하여 경쇄 및 중쇄 면역글로불린 폴리펩타이드를 암호화하는 재배열되고 체세포 돌연변이된 핵산 분자는 원래 핵산 분자와 서열 동일성을 가질 수 없지만, 대신 실질적으로 동일하거나 유사할 것이다(즉 적어도 80% 동일성을 가진다).
"인간" 항체(HuMAb)는 프레임워크와 CDR 영역이 둘 다 인간 점라인 면역글로불린 서열로부터 유래된 가변 영역을 가진 항체를 말한다. 또한, 이 항체가 불변 영역을 함유한다면, 불변 영역 역시 인간 점라인 면역글로불린 서열로부터 유래된다. 본 명세서에 제시된 항체는 인간 점라인 면역글로불린 서열에 의해 암호화되지 않는 아미노산 잔기를 포함할 수 있다(예를 들어 시험관내 무작위 또는 부위-특정 돌연변이유발에 의해 또는 생체내 체세포 돌연변이에 의해 도입된 돌연변이). 그러나, 용어 "인간 항체"는 마우스와 같은 다른 포유류 종의 점라인으로부터 유래된 CDR 서열이 인간 프레임워크 서열에 접목된 항체는 포함하지 않는다. 용어 "인간" 항체와 "완전한 인간" 항체는 동의어로서 사용된다.
용어 "인간화된 항체"는 비-인간 항체의 CDR 도메인 밖의 아미노산의 일부, 대부분 또는 전부가 인간 면역글로불린으로부터 유래된 상응하는 아미노산으로 치환된 항체를 말한다. 항체의 인간화된 형태의 하나의 구체예에서, CDR 도메인 밖의 아미노산의 일부, 대부분 또는 전부가 인간 면역글로불린으로부터의 아미노산으로 치환되고, 하나 이상의 CDR 영역 내의 아미노산의 일부, 대부분 또는 전부는 그대로 남는다. 아미노산의 첨가, 결실, 삽입, 치환 또는 변형은 이들이 항체가 특정 항원에 결합하는 능력을 없애지 않는 한 허용된다. "인간화된" 항체는 원래 항체의 것과 유사한 항원 특이성을 보유한다.
"키메라 항체"는 하나의 종으로부터 가변 영역이 유래되고 다른 종으로부터 불변 영역이 유래된 항체, 예컨대 마우스 항체로부터 가변 영역이 유래되고 인간 항체로부터 불변 영역이 유래된 항체를 말한다.
본 명세서에서 사용된 용어 "교차-반응한다"는 상이한 종들로부터의 B7-H3에 결합하는 본 명세서에 제시된 항체의 능력을 말한다. 예를 들어, 인간 B7-H3에 결합하는 본 명세서에 제시된 항체는 또한 다른 종의 B7-H3 (예를 들어 마우스 B7-H3)에도 결합할 수 있다. 이러한 교차-반응성은 결합 분석(예를 들어 SPR, ELISA)에서 정제된 항원과의 특이적 반응성을 검출함으로써 또는 B7-H3를 생리학적으로 발현하는 세포와의 결합, 또는 기능적 상호작용을 검출함으로써 측정될 수 있다. 교차-반응성을 결정하는 방법은 본 명세서에 개시된 표준 결합 분석, 예를 들어 BIACORE® 2000 SPR 기기(Biacore AB, Uppsala, Sweden)를 사용한 BIACORE® 표면 플라즈몬 공명(SPR) 분석, 또는 유세포계수 기술을 포함한다.
용어 "보존적 아미노산 치환"은 아미노산 잔기가 유사한 측쇄를 가진 아미노산 잔기로 치환되는 것을 말한다. 유사한 측쇄를 가진 아미노산 잔기의 패밀리는 당업계에 규정되어 있다. 이들 패밀리는 염기성 측쇄(예를 들어 리신, 아르기닌, 히스티딘), 산성 측쇄(예를 들어 아스파르트산, 글루탐산), 비하전 극성 측쇄(예를 들어 글리신, 아스파라긴, 글루타민, 세린, 트레오닌, 티로신, 시스테인, 트립토판), 비극성 측쇄(예를 들어 알라닌, 발린, 로이신, 이소로이신, 프롤린, 페닐알라닌, 메티오닌), 베타-분지 측쇄(예를 들어 트레오닌, 발린, 이소로이신) 및 방향족 측쇄(예를 들어 티로신, 페닐알라닌, 트립토판, 히스티딘)를 가진 아미노산을 포함한다. 특정 구체예에서, 항-B7-H3 항체에서 예상된 비필수 아미노산 잔기가 동일한 측쇄 패밀리로부터의 다른 아미노산 잔기로 치환된다. 항원 결합을 해치지 않는 뉴클레오타이드 및 아미노산 보존성 치환을 확인하는 방법은 당업계에 잘 공지되어 있다(예를 들어 Brummell et al., Biochem. 32: 1180-1187 (1993); Kobayashi et al.Protein Eng. 12(10):879-884 (1999); 및 Burks et al.Proc. Natl. Acad. Sci. USA 94:412-417 (1997) 참조).
용어 "실질적인 상동성"은 두 폴리펩타이드, 또는 이들의 지정된 서열이 최적 정렬되고 비교되었을 때 동일하다는 것을 나타내며, 이때 아미노산의 적어도 약 80%, 적어도 약 90% 내지 95%, 또는 아미노산의 적어도 약 98% 내지 99.5%에서, 적절한 아미노산 삽입 또는 결실을 가진다.
두 서열 사이의 동일성 퍼센트는 두 서열의 최적 정렬을 위해 도입되어야 하는, 갭의 수, 및 각 갭의 길이를 고려한, 서열에 의해 공유된 동일한 위치의 수의 함수이다(즉 상동성 % = 동일한 위치의 #/위치의 총 # x 100). 서열의 비교 및 두 서열 사이의 동일성 퍼센트는 아래 비제한적 예들에 설명된 것과 같은 수학적 알고리즘을 사용하여 결정될 수 있다.
두 아미노산 서열 사이의 동일성 퍼센트는 GCG 소프트웨어 패키지의 GAP 프로그램에 통합된 Needleman and Wunsch(J. Mol. Biol. (48):444-453 (1970)) 알고리즘을 사용하여 결정될 수 있으며(http:/www.gcg.com에서 이용 가능함), 이것은 Blossum 62 매트릭스 또는 PAM250 매트릭스, 및 갭 가중치 16, 14, 12, 10, 8, 6, 또는 4 및 길이 가중치 1, 2, 3, 4, 5, 또는 6을 사용한다.
본 명세서에 제시된 핵산 및 단백질 서열은, 예를 들어 관련된 서열을 확인하기 위해 공공 데이터베이스에서 검색을 수행하기 위한 "쿼리 서열"로서 사용될 수 있다. 이러한 검색은 문헌(Altschul, et al. (1990) J. Mol. Biol. 215:403-10)의 NBLAST 및 XBLAST 프로그램(버전 2.0)을 사용하여 수행될 수 있다. BLAST 뉴클레오타이드 검색은 NBLAST 프로그램, 스코어 = 100, 단어길이 = 12 하에 수행될 수 있으며, 이로써 본 명세서에 제시된 핵산 분자와 상동성인 뉴클레오타이드 서열이 얻어진다. BLAST 단백질 검색은 XBLAST 프로그램, 스코어 = 50, 단어길이 = 3 하에 수행될 수 있으며, 이로써 본 명세서에 제시된 단백질 분자와 상동성인 아미노산 서열이 얻어진다. 비교 목적으로 갭이 있는 정렬을 얻기 위해, Gapped BLAST가 문헌(Altschul et al., (1997) Nucleic Acids Res. 25(17): 3389-3402)에 설명된 대로 이용될 수 있다. BLAST 및 Gapped BLAST 프로그램을 이용할 때, 각 프로그램(예를 들어 XBLAST 및 NBLAST)의 디폴트 변수가 이용될 수 있다(worldwideweb.ncbi.nlm.nih.gov 참조).
본 발명의 바람직한 구현예에 따르면, 본 발명의 항-B7-H3 항체 또는 이의 항원 결합 단편은 B7-H3의 도메인인 Ig-like-V-type, Ig-like-V-type 1, 및/또는 Ig-like-V-type 2 도메인의 아미노산 서열 내에 위치된 에피토프에 결합한다.
본 발명의 일 실시예에 따르면, 본 발명의 항-B7-H3 항체 또는 이의 항원 결합 단편은 서열번호 36의 Ig-like-V-type 1 서열, 서열번호 38의 Ig-like-V-type 2 서열 및 서열번호 40의 Ig-like-V-type 서열로 구성된 군으로부터 선택되는 B7-H3 도메인의 아미노산 서열 내에 위치된 에피토프에 결합한다.
본 발명의 바람직한 구현예에 따르면, 본 발명의 항-B7-H3 항체 또는 이의 항원 결합 단편은 서열번호 36의 아미노산 잔기 2 내지 6(즉, EVQVP), 서열번호 38의 아미노산 잔기 6 내지 10(즉, EVQVP) 및 서열번호 40의 아미노산 잔기 2 내지 6(즉, EVQVS)에 해당하는 하나 이상의 아미노산에 결합한다.
본 발명의 일 실시예에 따르면, 상기 항-B7-H3 항체 또는 이의 항원 결합 단편은 인간 유래의 Ig-like-V-type 1, 및/또는 Ig-like-V-type 2 도메인의 아미노산 서열 내에 위치된 에피토프(예를 들어 EVQVP) 및 마우스 유래의 Ig-like-V-type 도메인의 아미노산 서열 내에 위치된 에피토프(예를 들어 EVQVS)에 모두 결합하여 T cell 매개 암세포 사멸 효과를 나타내는 바(실시예 8 및 9), 치료용 항체로 개발 시 전임상시험에서 효율적인 항암효과를 나타낼 것으로 예상된다.
본 발명의 바람직한 구현예에 따르면, 본 발명의 항-B7-H3 항체 또는 이의 항원 결합 단편은 경쇄 CDR1, CDR2, 및 CDR3 및 중쇄 CDR1, CDR2, 및 CDR3을 포함하며, 여기서 경쇄 CDR1, CDR2, 및 CDR3은 각각 서열번호 3, 4, 및 5로 구성되고, 중쇄 CDR1, CDR2, 및 CDR3은 각각 서열번호 6, 7, 및 8로 구성된다.
본 발명의 바람직한 구현예에 따르면, 본 발명의 항-B7-H3 항체 또는 이의 항원 결합 단편은 경쇄 가변영역 및 중쇄 가변영역을 포함한다.
상기 경쇄 가변영역은 서열번호 9에 제시된 서열과 적어도 80%, 적어도 85%, 적어도 90%, 적어도 95%, 적어도 96%, 적어도 97%, 적어도 98%, 적어도 99%, 또는 100% 동일한 아미노산 서열을 포함할 수 있다.
상기 경쇄 가변영역은 서열번호 3, 4, 및 5로 구성된 경쇄 CDR1, CDR2, 및 CDR3을 포함하면서, 서열번호 9에 제시된 서열과 적어도 80%, 적어도 85%, 적어도 90%, 적어도 95%, 적어도 96%, 적어도 97%, 적어도 98%, 적어도 99%, 또는 100% 동일한 아미노산 서열을 포함할 수 있다.
상기 중쇄 가변영역은 서열번호 10에 제시된 서열과 적어도 80%, 적어도 85%, 적어도 90%, 적어도 95%, 적어도 96%, 적어도 97%, 적어도 98%, 적어도 99%, 또는 100% 동일한 아미노산 서열을 포함할 수 있다.
상기 중쇄 가변영역은 서열번호 6, 7, 및 8로 구성된 중쇄 CDR1, CDR2, 및 CDR3을 포함하면서, 서열번호 10에 제시된 서열과 적어도 80%, 적어도 85%, 적어도 90%, 적어도 95%, 적어도 96%, 적어도 97%, 적어도 98%, 적어도 99%, 또는 100% 동일한 아미노산 서열을 포함할 수 있다.
본 발명의 바람직한 구현예에 따르면, 본 발명의 항-B7-H3 항체 또는 이의 항원 결합 단편은 서열번호 9로 구성된 경쇄 가변영역을 포함한다.
본 발명의 바람직한 구현예에 따르면, 본 발명의 항-B7-H3 항체 또는 이의 항원 결합 단편은 서열번호 10으로 구성된 중쇄 가변영역을 포함한다.
또한, 상기 경쇄 가변영역은 서열번호 21에 제시된 서열과 적어도 80%, 적어도 85%, 적어도 90%, 적어도 95%, 적어도 96%, 적어도 97%, 적어도 98%, 적어도 99%, 또는 100% 동일한 아미노산 서열을 포함할 수 있다.
상기 경쇄 가변영역은 서열번호 3, 4, 및 5로 구성된 경쇄 CDR1, CDR2, 및 CDR3을 포함하면서, 서열번호 21에 제시된 서열과 적어도 80%, 적어도 85%, 적어도 90%, 적어도 95%, 적어도 96%, 적어도 97%, 적어도 98%, 적어도 99%, 또는 100% 동일한 아미노산 서열을 포함할 수 있다.
상기 중쇄 가변영역은 서열번호 22에 제시된 서열과 적어도 80%, 적어도 85%, 적어도 90%, 적어도 95%, 적어도 96%, 적어도 97%, 적어도 98%, 적어도 99%, 또는 100% 동일한 아미노산 서열을 포함할 수 있다.
상기 중쇄 가변영역은 서열번호 6, 7, 및 8로 구성된 중쇄 CDR1, CDR2, 및 CDR3을 포함하면서, 서열번호 22에 제시된 서열과 적어도 80%, 적어도 85%, 적어도 90%, 적어도 95%, 적어도 96%, 적어도 97%, 적어도 98%, 적어도 99%, 또는 100% 동일한 아미노산 서열을 포함할 수 있다.
본 발명의 바람직한 구현예에 따르면, 본 발명의 항-B7-H3 항체 또는 이의 항원 결합 단편은 서열번호 21로 구성된 경쇄 가변영역을 포함한다.
본 발명의 바람직한 구현예에 따르면, 본 발명의 항-B7-H3 항체 또는 이의 항원 결합 단편은 서열번호 22로 구성된 중쇄 가변영역을 포함한다.
본 발명의 바람직한 구현예에 따르면, 본 발명의 항-B7-H3 항체 또는 이의 항원 결합 단편은 서열번호 9로 구성된 경쇄 가변영역 및 서열번호 10으로 구성된 중쇄 가변영역을 포함하는 기준 항체와, 상기 에피토프와의 결합에서 상호 경쟁한다.
본 발명의 바람직한 구현예에 따르면, 본 발명의 항-B7-H3 항체 또는 이의 항원 결합 단편은 서열번호 21로 구성된 경쇄 가변영역 및 서열번호 22로 구성된 중쇄 가변영역을 포함하는 기준 항체와, 상기 에피토프와의 결합에서 상호 경쟁한다.
본 발명의 다른 양태에 따르면, 본 발명은 상기 항-B7-H3 항체 또는 이의 항원 결합 단편을 코딩하는 핵산을 제공한다.
본 명세서에서 용어 "핵산 분자"는 DNA(gDNA 및 cDNA) 그리고 RNA 분자를 포괄적으로 포함하는 의미를 가지며, 핵산 분자에서 기본 구성단위인 뉴클레오타이드는 자연의 뉴클레오타이드뿐만 아니라, 당 또는 염기 부위가 변형된 유사체(analogue)도 포함한다(Scheit, Nucleotide Analogs, John Wiley, New York(1980); Uhlman 및 Peyman, Chemical Reviews, (1990) 90:543-584). 본 발명의 중쇄 및 경쇄 가변영역을 코딩하는 핵산 분자의 서열은 변형될 수 있다. 상기 변형은 뉴클레오타이드의 추가, 결실, 또는 비보존적 치환 또는 보존적 치환을 포함한다.
본 발명의 핵산 분자는 상기한 뉴클레오타이드 서열에 대하여 실질적인 동일성을 나타내는 뉴클레오타이드 서열도 포함하는 것으로 해석된다. 상기의 실질적인 동일성은, 상기한 본 발명의 뉴클레오타이드 서열과 임의의 다른 서열을 최대한 대응되도록 얼라인하고, 당업계에서 통상적으로 이용되는 알고리즘을 이용하여 얼라인 된 서열을 분석한 경우에, 최소 80%의 상동성, 일 특정예에서는 최소 90%의 상동성, 다른 특정예에서는 최소 95%의 상동성을 나타내는 뉴클레오타이드 서열을 의미한다.
본 발명의 또 다른 양태에 따르면, 본 발명은 전술한 본 발명의 항체 또는 이의 항원 결합 단편을 코딩하는 핵산분자를 포함하는 벡터를 제공한다.
본 명세서에서 용어 "벡터"는 상기 폴리뉴클레오타이드(핵산) 서열을 복제할 수 있는 세포로의 도입을 위해서 폴리뉴클레오타이드 서열을 삽입할 수 있는 전달체를 의미한다. 폴리뉴클레오타이드 서열은 외생(Exogenous) 또는 이종(Heterologous)일 수 있다. 벡터로서는 플라스미드, 코스미드 벡터 및 바이러스 벡터(레트로바이러스, 아데노바이러스 및 아데노-부속 바이러스 벡터 등)를 들 수 있으나, 이에 제한되지 않는다. 당업자는 표준적인 재조합 기술에 의해 벡터를 구축할 수 있다(Maniatis, et al., Molecular Cloning, A Laboratory Manual, Cold Spring Harbor Press, Cold Spring Harbor, N.Y., 1988; 및 Ausubel et al., In: Current Protocols in Molecular Biology, John, Wiley & Sons, Inc, NY, 1994 등).
본 명세서에서 용어 "발현 벡터"는 전사되는 유전자 산물 중 적어도 일부분을 코딩하는 뉴클레오타이드 서열을 포함한 벡터를 의미한다. 일부의 경우에는 그 후 RNA 분자가 단백질, 폴리펩타이드, 또는 펩타이드로 번역된다. 발현 벡터에는 다양한 조절서열을 포함할 수 있다. 전사 및 번역을 조절하는 조절서열과 함께 벡터 및 발현 벡터에는 또 다른 기능도 제공하는 핵산 서열도 포함될 수 있다.
본 발명의 또 다른 양태에 따르면, 본 발명은 전술한 벡터를 포함하는 세포를 제공한다.
본 발명의 또 다른 양태에 따르면, 본 발명은 전술한 벡터로 형질전환된 세포를 제공한다.
본 명세서에서 용어 "세포"는 진핵세포 및 원핵세포를 포함하며, 상기 벡터를 포함할 수 있거나, 벡터를 복제할 수 있거나, 벡터에 의해 코딩되는 유전자를 발현할 수 있는 임의의 형질 전환 가능한 세포를 의미한다. 세포는 상기 벡터에 의해 형질감염(Transfected), 형질도입(Transduced) 또는 형질전환(Transformed) 될 수 있으며, 이는 외생의 폴리뉴클레오타이드(핵산분자)가 숙주세포 내에 전달되거나 도입되는 과정을 의미한다. 본 명세서에서 용어 "형질전환"은 상기 형질감염(Transfected) 및 형질도입(Transduced)을 포함하는 의미로 사용된다.
본 발명의(숙주)세포는 제한되지 않으나, 바람직하게는 곤충세포 또는 포유동물 세포, 보다 바람직하게는 곤충세포의 경우 Sf9, 포유동물 세포의 경우 HEK293 세포, HeLa 세포, ARPE-19 세포, RPE-1 세포, HepG2 세포, Hep3B 세포, Huh-7 세포, C8D1a 세포, Neuro2A 세포, CHO 세포, MES13 세포, BHK-21 세포, COS7 세포, COP5 세포, A549 세포, MCF-7 세포, HC70 세포, HCC1428 세포, BT-549 세포,PC3 세포, LNCaP 세포, Capan-1 세포, Panc-1 세포, MIA PaCa-2 세포, SW480 세포, HCT166 세포, LoVo 세포, A172 세포, MKN-45 세포, MKN-74 세포, Kato-III 세포, NCI-N87 세포, HT-144 세포, SK-MEL-2 세포, SH-SY5Y 세포, C6 세포, HT-22 세포, PC-12 세포, NIH3T3 세포 등을 이용할 수 있다.
또한, 본 발명의 항-B7-H3 항체의 항원 결합 단편은 면역 세포가 키메라 항원 수용체를 발현하도록 유전적으로 변형시키는데 이용될 수 있다.
본 명세서에서 용어 "면역 세포"는 림프구(예를 들어, T 세포, B 세포 및 NK 세포), 호중구, 및 단핵구/대식세포로 분류될 수 있는 면역계의 세포를 지칭한다. 일부 실시양태에서, 면역 세포는 T 세포이다. 일부 실시양태에서, 면역 세포는 NK 세포이다.
면역 세포(예를 들어, T 세포)는 하나 이상의 방식으로 변형될 수 있다. 면역 세포(예를 들어, T 세포)는 하나 이상의 유형의 세포 표면 상에 존재하는 항원에 대한 수용체인 적어도 하나의 비-자연 분자를 발현할 수 있다. 일부 실시양태에서, 면역 세포는 자연에서 발견되지 않는 적어도 하나의 합성 분자를 포함하거나 발현하도록 조작되기 때문에 자연에서 발견되지 않는 면역 세포(예를 들어, T 세포)를 포함한다. 특정 실시양태에서, 면역 세포(예를 들어, T 세포)는 B7-H3와 같은 특정 종양 항원을 표적화하는 CAR을 포함하는 적어도 하나의 키메라 항원 수용체(CAR)를 발현하도록 조작된다. 특정 실시양태에서, 면역 세포는 T 세포, 예를 들어 CD4+ T 세포, CD8+ T 세포, Treg 세포, Th1 T 세포, Th2 T 세포, Th17 T 세포, 비특이적 T 세포, 또는 전술한 것 중 임의의 것의 조합을 포함하는 T 세포의 집단일 수 있다. 키메라 항원 수용체로 조작된 면역 세포(예를 들어, T 세포)는 암 치료에 대한 큰 치료 잠재력을 가지고 있다. CAR을 사용하면, 수용체가 항원을 인식하도록 프로그래밍될 수 있으며, 결합되는 경우 면역 세포를 활성화하여 해당 항원을 발현하는 세포를 사멸시킨다. 따라서, 종양 세포 상에서 발현되는 항원에 대한 CAR(들)을 발현하는 면역 세포는 종양 세포를 표적화하고 사멸시킬 수 있다. 예를 들어, 혈액학적 암에 대한 CD19-표적 CAR-형질도입 T 세포(CD19-CAR T 세포)의 최근 임상 시험은 CAR T 기술의 강력한 효과를 나타내었다. (Kochenderfer, J. N. 등. (2010) Blood 116: 4099-4102; Porter, D. L., 등. (2011) N. Engl. J. Med. 365: 725-733; Grupp, S. A. 등. (2013) N. Engl. J. Med. 368: 1509-1518, Kochenderfer, J. N. 등. (2015) J. Clin. Oncol. 33: 540-549, Brown, C. E. 등. (2016) N. Engl. J. Med. 375: 2561-2569).
본 발명의 세포는 바람직하게는 단리된 세포이다.
본 발명의 세포는 바람직하게는 인-비트로 세포이다.
본 발명의 세포는 바람직하게는 엑스-비보 세포이다.
본 발명의 또 다른 양태에 따르면, 본 발명은 전술한 항-B7-H3 항체 또는 이의 항원 결합 단편, 상기 항체 또는 이의 항원 결합 단편을 코딩하는 핵산, 상기 핵산을 포함하는 벡터 및 상기 벡터를 포함하거나 상기 벡터로 형질전환된 세포로 구성된 군으로부터 선택되는 성분의 의약 용도(for use as a medicament)를 제공한다.
본 발명의 또 다른 양태에 따르면, 본 발명은 전술한 항-B7-H3 항체 또는 이의 항원 결합 단편, 상기 항체 또는 이의 항원 결합 단편을 코딩하는 핵산, 상기 핵산을 포함하는 벡터 및 상기 벡터를 포함하거나 상기 벡터로 형질전환된 세포로 구성된 군으로부터 선택되는 성분을 포함하는 조성물을 제공한다.
본 발명의 바람직한 구현예에 따르면, 본 발명의 조성물은 암의 예방 또는 치료용 약제학적 조성물인 것이다.
본 발명의 또 다른 양태에 따르면, 본 발명은 이를 필요로 하는 대상에게, 상기 항-B7-H3 항체 또는 이의 항원 결합 단편, 상기 항체 또는 이의 항원 결합 단편을 코딩하는 핵산, 상기 핵산을 포함하는 벡터 및 상기 벡터를 포함하거나 상기 벡터로 형질전환된 세포로 구성된 군으로부터 선택되는 성분을 투여하는 단계를 포함하는, 암의 치료방법을 제공한다.
대상의 암 (또는 종양)을 치료하는 방법이 본 명세서에 개시되며, 이 방법은 상기 항-B7-H3 항체 또는 이의 항원 결합 단편, 상기 항체 또는 이의 항원 결합 단편을 코딩하는 핵산, 상기 핵산을 포함하는 벡터 및 상기 벡터를 포함하거나 상기 벡터로 형질전환된 세포로 구성된 군으로부터 선택되는 성분을 대상에 투여하는 것을 포함한다. 특정 구체예에서, 항-B7-H3 항체 또는 이의 항원 결합 단편은 B7-H3에 특이적으로 결합하고 T cell 매개 암세포 사멸 효과를 나타낸다.
일부 구체예에서, 본 명세서에 개시된 방법은 대상의 암(또는 종양)의 성장을 저해 및/또는 감소시킨다. 특정 구체예에서, 종양 성장(예를 들어 종양 부피 또는 중량)은 기준(예를 들어 본 명세서에 개시된 조성물을 투여 받지 않았던 대상에서의 상응하는 종양 부피 또는 중량)과 비교하여 적어도 5%, 적어도 10%, 적어도 20%, 적어도 30%, 적어도 40%, 적어도 50%, 적어도 60%, 적어도 70%, 적어도 80%, 적어도 90%, 또는 100%까지 감소된다. 일부 구체예에서, 본 명세서에 개시된 방법은 기준(예를 들어 본 명세서에 개시된 조성물을 투여 받지 않았던 대상에서의 상응하는 빈도)과 비교하여 적어도 5%, 적어도 10%, 적어도 20%, 적어도 30%, 적어도 40%, 적어도 50%, 적어도 60%, 적어도 70%, 적어도 80%, 적어도 90%, 또는 100%까지 평균 종양 성장 저해(TGI)를 증가시킨다. 일부 구체예에서, 본 명세서에 개시된 조성물(예를 들어 상기 항-B7-H3 항체)의 투여는 기준(예를 들어 본 명세서에 개시된 조성물, 예를 들어 상기 항-B7-H3 항체를 투여 받지 않았던 대상에서의 상응하는 값)과 비교하여 적어도 1일, 2일, 3일, 4일, 5일, 6일 또는 그 이상까지 평균 생존을 증가시킨다.
일부 구체예에서, 본 명세서에 개시된 방법으로 치료될 수 있는 종양은 전형적으로 기존 항암제에 반응성인 암들 및 전형적으로 기존 항암제에 비반응성인 암들로부터 유래된다. 일부 구체예에서, 암은 고상 종양 또는 혈액 악성물(액상 종양)을 가진 암이다.
치료를 요하는 암의 비제한적 예들은 뇌종양, 수모세포종, 연수막전이암, 편평 세포 암종, 소-세포 폐암(SCLC), 비-소 세포 폐암, 편평 비-소 세포 폐암(NSCLC), 비편평 NSCLC, 위장관암, 신암(예를 들어 투명 세포 암종), 난소암, 간암, 담도암, 비인두암, 결직장암, 자궁내막암, 신장암(예를 들어 신장 세포 암종(RCC)), 전립선암(예를 들어 호르몬 난치성 전립선 선암종), 갑상선암, 부갑상선암, 췌장암, 자궁경부암, 위암, 방광암, 간세포암, 유방암, 결장 암종, 두경부암(또는 암종), 후두암, 생식 세포 종양, 소아암, 비강 자연 살해, 흑색종(예를 들어 전이성 악성 흑색종, 예컨대 피부 또는 안내 악성 흑색종), 뼈암, 피부암, 자궁암, 항문 부위의 암, 고환암, 나팔관의 암종, 자궁내막의 암종, 자궁경부의 암종, 질의 암종, 외음부의 암종, 식도암, 소장암, 대장암, 결장암, 비만세포종, 내분비계의 암, 부갑상선의 암, 부신의 암, 연조직의 육종, 요도의 암, 성기의 암, 소아의 고상 종양, 요관의 암, 신우의 암종, 종양 혈관형성, 뇌하수체 선종, 카포시 육종, 상피상 암, 편평 세포 암, T-세포 림프종, 석면에 의해 유발된 것들을 포함하는 환경 유발 암, 바이러스 관련 암 또는 바이러스 기원의 암(예를 들어 인간 유두종 바이러스(HPV-관련 또는 -기원 종양)), 및 두 가지 주요 혈액 세포 계통, 즉 골수성 셀라인(이것은 과립구, 적혈구, 혈소판, 대식세포 및 비만 세포를 생성함) 또는 림프성 셀라인(이것은 B, T, NK 및 혈장 세포를 생성함) 중 어느 하나로부터 유래된 혈액학상의 악성물, 예컨대 모든 종류의 백혈병, 림프종, 및 골수종, 예를 들어 급성, 만성, 림프구성 및/또는 골수성 백혈병, 예컨대 급성 백혈병(ALL), 급성 골수성 백혈병(AML), 만성 림프구성 백혈병(CLL) 및 만성 골수성 백혈병(CML), 비분화 AML(MO), 골수모구성 백혈병(M1), 골수모구성 백혈병(M2; 세포 성숙화 동반), 전골수성 백혈병(M3 또는 M3 변이형[M3V]), 골수단핵구성 백혈병(M4 또는 호산구증가증 동반 M4 변이형[M4E]), 단핵구성 백혈병(M5), 적백혈병(M6), 거핵아구 백혈병(M7), 분리된 과립구성 육종, 및 녹색종; 림프종, 예컨대 호지킨 림프종(HL), 비-호지킨 림프종(NHL), B 세포 혈액학상의 악성물, 예를 들어 B-세포 림프종, T-세포 림프종, 림프모구세포종 림프종, 단구성 B-세포 림프종, 점막-관련 림프성 조직(MALT) 림프종, 역형성(예를 들어 Ki 1+) 거대-세포 림프종, 성인 T-세포 림프종/백혈병, 맨틀 세포 림프종, 혈관-면역아구성 T-세포 림프종, 혈관중심 림프종, 장 T-세포 림프종, 원발성 종격동 B-세포 림프종, 전구체 T-림프모구성 림프종, T-림프모구성; 및 림프종/백혈병(T-Lbly/T-ALL), 말초 T-세포 림프종, 림프모구성 림프종, 이식 후 림프증식 장애, 진성 조직구성 림프종, 원발성 유출 림프종, B세포 림프종, 림프모구성 림프종(LBL), 림프 계통의 조혈성 종양, 급성 림프모구성 백혈병, 미만성 거대 B-세포 림프종, 버킷 림프종, 소포성 림프종, 미만성 조직구성 림프종(DHL), 면역아구성 거대 세포 림프종, 전구체 B-림프모구성 림프종, 피부 T-세포 림프종(CTLC)(균상식육종 또는 시자리 증후군이라고도 한다), 및 왈덴스트룀 마크로글로불린혈증을 동반한 림프모구세포종 림프종(LPL); 골수종, 예컨대 IgG 골수종, 경쇄 골수종, 비분비성 골수종, 무증상 다발성 골수종(smoldering myeloma)(무통성 골수종이라고도 함), 고립 형질세포종(solitary plasmocytoma), 및 다발성 골수종, 만성 림프구성 백혈병(CLL), 모양 세포 림프종; 골수 계통의 조혈성 종양, 섬유육종 및 횡문근육종을 포함하는 간엽 기원의 종양; 섬유육종, 횡문근육종, 및 골육종을 포함하는 간엽 기원의 정상피종, 기형암종, 종양; 및 흑색종, 색소성건피증, 각질가시세포종, 정상피종, 갑상선 소포성 암 및 기형암종을 포함하는 기타 종양들, 림프 계통의 조혈성 종양, 예를 들어 제한은 아니지만 소 세포 및 대뇌양 세포 타입을 포함하여 T-전림프구성 백혈병(T-PLL)과 같은 T-세포 장애를 포함하는 T-세포 및 T-세포 종양; T-세포 타입의 거대 과립 림프구 백혈병(LGL); a/d T-NHL 간비장 림프종; 말초/흉선 뒤(post-thymic) T 세포 림프종(다형성 및 면역아구성 서브타입); 혈관중심(코) T-세포 림프종; 머리 또는 목의 암, 신암, 직장암, 갑상선의 암; 급성 골수성 림프종, 및 이들의 임의의 조합을 포함한다.
본 발명의 일 실시예에 따르면, 상기 암은 뇌종양, 소아암, 수모세포종, 연수막전이암, 유방암, 폐암, 췌장암, 대장암, 간암, 전립선암, 난소암, 위암, 식도암, 림프종, 흑색종, 신장암, 섬유육종, 결장암, 결직장암, 자궁내막암, 갑상선암, 부갑상선암, 자궁경부암, 방광암, 두경부암, 뼈암, 피부암, 자궁암, 고환암, 담도암, 기관지암, 비인두암, 후두암 및 요관암으로 구성된 군으로부터 선택되는 1 이상의 암인 것이다.
일부 구체예에서, 본 명세서에 개시된 방법은 또한 전이성 암, 절제 불가능한, 난치성 암(예를 들어 기존의 암 요법, 예를 들어 면역요법, 예를 들어 차단 PD-(L)1 항체에 의한 요법에 대해 내성인 암), 및/또는 재발성 암의 치료에 사용될 수 있다. 특정 구체예에서, 본 명세서에 개시된 방법은 재발성 암의 치료에 사용될 수 있다.
본 발명의 바람직한 구현예에 따르면, 상기 약제학적 조성물은 면역치료제, 화학치료제, 표적화 치료제, 또는 방사선치료제를 포함하는 추가의 암 제제와 조합하여 사용될 수 있다.
일부 구체예에서, 본 명세서에 개시된 방법은 기존의 암 요법으로서 화학요법을 포함한다.
일부 구체예에서, 본 명세서에 개시된 방법은 하는 대상(예를 들어 종양이 침범된)의 생존 지속기간을 효과적으로 증가시킨다. 예를 들어, 대상의 생존 지속기간은 기준 개체(예를 들어 본 명세서에 개시된 조성물, 예를 들어 상기 항체-약물 접합체로 치료되지 않은 다른 대상)과 비교했을 때 적어도 약 1개월, 적어도 약 2개월, 적어도 약 3개월, 적어도 약 4개월, 적어도 약 5개월, 적어도 약 6개월, 적어도 약 7개월, 적어도 약 8개월, 적어도 약 9개월, 적어도 약 10개월, 적어도 약 11개월, 또는 적어도 약 1년 또는 그 이상까지 증가된다. 또 다른 구체예에서, 본 명세서에 개시된 방법은 대상의 생존 지속기간을, 기준 대상(예를 들어 본 명세서에 개시된 조성물, 예를 들어 상기 항-B7-H3 항체로 치료되지 않은 다른 대상)의 생존 지속기간보다 더 긴 수준으로(약 1개월 더 길게, 약 2개월 더 길게, 약 3개월 더 길게, 약 4개월 더 길게, 약 5개월 더 길게, 약 6개월 더 길게, 약 7개월 더 길게, 약 8개월 더 길게, 약 9개월 더 길게, 약 10개월 더 길게, 약 11개월 더 길게, 또는 약 1년 더 길게) 증가시킨다.
일부 구체예에서, 본 발명의 방법은 대상의 질환 진행 없는 생존 지속기간을 증가시킨다. 예를 들어, 대상의 질환 진행 없는 생존 지속기간은 기준 대상(예를 들어 본 명세서에 개시된 조성물, 예를 들어 상기 항-B7-H3 항체로 치료되지 않은 다른 대상)과 비교했을 때 적어도 약 1개월, 적어도 약 2개월, 적어도 약 3개월, 적어도 약 4개월, 적어도 약 5개월, 적어도 약 6개월, 적어도 약 7개월, 적어도 약 8개월, 적어도 약 9개월, 적어도 약 10개월, 적어도 약 11개월, 또는 적어도 약 1년까지 증가된다.
일부 구체예에서, 본 명세서에 개시된 방법은 일군의 대상에서의 반응 속도를 효과적으로 증가시킨다. 예를 들어, 일군의 대상에서의 반응 속도는 기준 대상(예를 들어 본 명세서에 개시된 조성물, 예를 들어 상기 항-B7-H3 항체로 치료되지 않은 다른 대상)과 비교했을 때 적어도 약 2%, 적어도 약 3%, 적어도 약 4%, 적어도 약 5%, 적어도 약 10%, 적어도 약 15%, 적어도 약 20%, 적어도 약 25%, 적어도 약 30%, 적어도 약 35%, 적어도 약 40%, 적어도 약 45%, 적어도 약 50%, 적어도 약 55%, 적어도 약 60%, 적어도 약 70%, 적어도 약 75%, 적어도 약 80%, 적어도 약 85%, 적어도 약 90%, 적어도 약 95%, 적어도 약 99% 또는 적어도 약 100%까지 증가된다.
일부 구체예에서, 본 방법에서 치료될 대상은 비-인간 동물, 예컨대 래트 또는 마우스이다. 일부 구체예에서, 본 방법에서 치료될 대상은 인간이다.
본 발명은 또한 다른 암 제제와 조합하여 대상의 암을 치료하는 방법을 포함한다. 일부 구체예에서, 본 발명의 방법에서 유용한 상기 항-B7-H3 항체는 조합 요법으로, 즉 적어도 하나의 다른 항암제 및/또는 면역조정제, 예를 들어 T-세포 자극(예를 들어 활성화) 제제와 조합하여 투여될 수 있다. 일부 구체예에서, 본 발명의 방법에서 유용한 항-B7-H3 항체는 암의 치료에 사용되는 다른 화합물, 약물, 및/또는 제제와 조합하여 투여될 수 있다. 이러한 화합물, 약물, 및/또는 제제는, 예를 들어 화학요법 약물, 소 분자 약물, 또는 암에 대한 면역 반응을 자극하는 항체를 포함할 수 있다. 일부 구체예에서, 본 명세서에 개시된 방법은 표준 치료(예를 들어 수술, 방사선 및 화학요법)와 조합하여 사용된다. 다른 구체예에서, 본 명세서에 개시된 방법은 유지 요법, 예를 들어 종양의 발생이나 재발을 방지하고자 하는 요법으로서 사용된다.
일부 구체예에서, 본 명세서에 개시된 항-B7-H3 항체는 면역치료제, 화학치료제, 표적화 치료제, 방사선치료제(방사선 요법), 또는 이들의 임의의 조합을 포함하는 하나 이상의 추가의 암 제제와 조합하여 사용될 수 있다.
약제학적으로 허용되는 담체, 부형제 또는 안정제(Remington's Pharmaceutical Sciences (1990) Mack Publishing Co., Easton, PA) 중에서 원하는 정도의 순도를 가진, 본 명세서에 개시된 항-B7-H3 항체 또는 이의 항원 결합 단편을 포함하는 조성물이 본 명세서에 개시된다. 허용되는 담체, 부형제 또는 안정제는 이용된 투약량 및 농도에서 수혜자에게 비독성이며, 버퍼, 예컨대 포스페이트, 시트레이트 및 다른 유기산; 아스코르브산 및 메티오닌을 포함하는 항산화제; 보존제(예컨대 염화 옥타데실디메틸벤질암모늄; 염화헥사메토늄; 염화벤잘코늄; 페놀, 부틸 또는 벤질 알코올; 알킬 파라벤, 예컨대 메틸 또는 프로필 파라벤; 카테콜; 레졸시놀; 사이클로헥산올; 3-펜타놀; 및 m-크레졸); 저 분자량(약 10개 잔기 미만) 폴리펩타이드; 단백질, 예컨대 혈청 알부민, 젤라틴, 또는 면역글로불린; 친수성 중합체, 예컨대 폴리비닐피롤리돈; 아미노산, 예컨대 글리신, 글루타민, 아스파라긴, 히스티딘, 아르기닌, 또는 리신; 단당류, 이당류, 및 글루코오스, 만노오스, 또는 덱스트린을 포함하는 다른 탄수화물들; 킬레이트화제, 예컨대 EDTA; 당, 예컨대 수크로오스, 만니톨, 트레할로오스 또는 소르비톨; 염-형성 반대-이온, 예컨대 나트륨; 금속 복합체(예를 들어 Zn-단백질 복합체); 및/또는 비-이온 계면활성제, 예컨대 TWEEN®, PLURONICS® 또는 폴리에틸렌 글리콜(PEG)을 포함한다.
일부 구체예에서, 약제학적 조성물은 본 명세서에 개시된 항-B7-H3 항체 또는 이의 항원 결합 단편, 상기 항체 또는 이의 항원 결합 단편을 코딩하는 핵산, 상기 핵산을 포함하는 벡터 및 상기 벡터를 포함하거나 상기 벡터로 형질전환된 세포로 구성된 군으로부터 선택되는 성분을, 약제학적으로 허용되는 담체 중에 포함한다. 특정 구체예에서, 약제학적 조성물은 본 명세서에 개시된 항-B7-H3 항체의 유효량, 및 선택적으로 하나 이상의 추가의 예방 또는 치료제를, 약제학적으로 허용되는 담체 중에 포함한다. 일부 구체예에서, 항-B7-H3 항체 또는 이의 항원 결합 단편, 상기 항체 또는 이의 항원 결합 단편을 코딩하는 핵산, 상기 핵산을 포함하는 벡터 및 상기 벡터를 포함하거나 상기 벡터로 형질전환된 세포로 구성된 군으로부터 선택되는 성분은 약제학적 조성물에 포함된 유일한 활성 성분이다.
비경구 제조물에서 사용된 약제학적으로 허용되는 담체는 수성 비히클, 비수성 비히클, 항균제, 등장제, 버퍼, 항산화제, 국소 마취제, 현탁 및 분산제, 유화제, 금소 이온의 봉쇄 또는 킬레이트화제 및 다른 제약학적으로 허용되는 물질을 포함한다. 수성 비히클의 예들은 염화나트륨 주사액, 링거 주사액, 등장 덱스트로오스 주사액, 멸균수 주사액, 덱스트로오스 및 락테이트 링거 주사액을 포함한다. 비수성 비히클은 식물 기원의 고정유, 면실유, 옥수수유, 참깨유 및 땅콩유를 포함한다. 정균 또는 정진균 농도의 항균제가 다수-용량 용기에 패키지된 비경구 제조물에 첨가될 수 있으며, 이들은 페놀 또는 크레졸, 수은함유물질, 벤질 알코올, 클로로부탄올, 메틸 및 프로필 p-하이드록시벤조산 에스테르, 티메로살, 염화벤잘코늄 및 염화벤제토늄을 포함한다. 등장제는 염화나트륨 및 덱스트로오스를 포함한다. 버퍼는 포스페이트 및 시트레이트를 포함한다. 항산화제는 중황산나트륨을 포함한다. 국소 마취제는 프로카인 염산염을 포함한다. 현탁 및 분산제는 나트륨 카복시메틸셀룰로오스, 하이드록시프로필 메틸셀룰로오스 및 폴리비닐피롤리돈을 포함한다. 유화제는 폴리소르베이트 80(TWEEN® 80)을 포함한다. 금속 이온의 봉쇄 또는 킬레이트화제는 EDTA를 포함한다. 약제학적으로 허용되는 담체는 또한 수 혼화성 비히클용 에틸 알코올, 폴리에틸렌 글리콜 및 프로필렌 글리콜을 포함하고, pH 조정용 수산화나트륨, 염산, 시트르산 또는 락트산을 포함할 수 있다.
약제학적 조성물은 대상에 대한 임의의 투여 경로에 맞게 제제화될 수 있다. 투여 경로의 구체적인 예들은 비내, 경구, 비경구, 척추강내, 뇌실내, 폐, 피하, 또는 심실내 경로를 포함한다. 피하, 근육내 또는 정맥내 주사를 특징으로 하는 비경구 투여가 또한 고려된다. 주사가능물질이 종래의 형태로, 액체 용액 또는 현탁액, 주사 전에 액체 중에서 용액 또는 현탁액으로 되기에 적합한 고체 형태, 또는 에멀젼으로서 제조될 수 있다. 주사가능물질, 용액 및 에멀젼은 또한 하나 이상의 부형제를 함유한다. 적합한 부형제는, 예를 들어 물, 식염수, 덱스트로오스, 글리세롤 또는 에탄올이다. 이에 더하여, 원한다면, 투여될 약제학적 조성물은 또한 소량의 비-독성 보조 물질, 예컨대 습윤 또는 유화제, pH 완충제, 안정제, 용해성 증진제, 및 다른 제제들, 예컨대 나트륨 아세테이트, 소르비탄 모노라우레이트, 트리에탄올아민 올레에이트 및 사이클로덱스트린을 함유할 수 있다.
항-B7-H3 항체의 비경구 투여용 제조물은 바로 주사 가능한 멸균 용액, 피하주사용 정제를 포함하는 사용 직전에 용매와 바로 조합될 수 있는 멸균 건조 가용성 제품, 예컨대 동결건조된 분말, 바로 주사 가능한 멸균 현탁액, 사용 직전에 비히클과 바로 조합될 수 있는 멸균 건조 불용성 제품 및 멸균 에멀젼을 포함한다. 용액은 수성 또는 비수성일 수 있다.
본 명세서에 개시된 항-B7-H3 항체는 또한 치료될 대상의 특정 조직, 수용체, 또는 다른 신체 영역에 표적화되도록 제제화될 수 있다. 다양한 표적화 방법이 당업자에게 공지되어 있다. 이러한 표적화 방법을 본 조성물에 사용하는 것이 고려된다. 표적화 방법의 비제한적 예들은 미국특허 제6,316,652호, 제6,274,552호, 제6,271,359호, 제6,253,872호, 제6,139,865호, 제6,131,570호, 제6,120,751호, 제6,071,495호, 제6,060,082호, 제6,048,736호, 제6,039,975호, 제6,004,534호, 제5,985,307호, 제5,972,366호, 제5,900,252호, 제5,840,674호, 제5,759,542호 및 제5,709,874호를 참고한다.
생체내 투여에 사용되는 조성물은 멸균될 수 있다. 예를 들어, 멸균 여과 막을 통한 여과에 의해 멸균될 수 있다.
본 발명의 또 다른 양태에 따르면, 전술한 항-B7-H3 항체 또는 이의 항원 결합 단편, 상기 항체 또는 이의 항원 결합 단편을 코딩하는 핵산, 상기 핵산을 포함하는 벡터 및 상기 벡터를 포함하거나 상기 벡터로 형질전환된 세포로 구성된 군으로부터 선택되는 성분을 포함하는 암의 진단용 조성물을 제공한다.
본 발명의 또 다른 양태에 따르면, 전술한 항-B7-H3 항체 또는 이의 항원 결합 단편, 상기 항체 또는 이의 항원 결합 단편을 코딩하는 핵산, 상기 핵산을 포함하는 벡터 및 상기 벡터를 포함하거나 상기 벡터로 형질전환된 세포로 구성된 군으로부터 선택되는 성분을 포함하는 암의 진단용 키트를 제공한다.
상기 키트에는 사용 설명서가 포함될 수 있으며, 상기 사용 설명서에는 진단을 필요로 하는 대상으로부터 분리된 샘플(체액, 혈액, 소변, 세포, 조직 등)에 상기 항-B7-H3 항체 또는 이의 항원 결합 단편, 상기 항체 또는 이의 항원 결합 단편을 코딩하는 핵산, 상기 핵산을 포함하는 벡터 및 상기 벡터를 포함하거나 상기 벡터로 형질전환된 세포를 처리하는 단계를 포함하는, 진단 키트의 사용 방법이 포함될 수 있다.
일부 구체예에서, 진단을 필요로 하는 대상은 비-인간 동물, 예컨대 래트 또는 마우스 등이다. 일부 구체예에서, 진단될 대상은 인간이다.
본 발명의 또 다른 양태에 따르면, 진단을 필요로 하는 대상으로부터 분리된 샘플에 전술한 항-B7-H3 항체 또는 이의 항원 결합 단편, 상기 항체 또는 이의 항원 결합 단편을 코딩하는 핵산, 상기 핵산을 포함하는 벡터 및 상기 벡터를 포함하거나 상기 벡터로 형질전환된 세포로 구성된 군으로부터 선택되는 성분을 처리하는 단계를 포함하는, 암의 진단을 위한 정보의 제공방법을 제공한다.
본 발명의 특징 및 이점을 요약하면 다음과 같다:
(i) 본 발명은 B7-H3의 도메인의 아미노산 서열 내에 위치된 특정 에피토프에 결합하는 항-B7-H3 항체 또는 이의 항원 결합 단편을 제공한다.
(ii) 또한, 본 발명은 상기 항-B7-H3 항체 또는 이의 항원 결합 단편, 상기 항체 또는 이의 항원 결합 단편을 코딩하는 핵산, 상기 핵산을 포함하는 벡터 및 상기 벡터를 포함하거나 상기 벡터로 형질전환된 세포로 구성된 군으로부터 선택되는 성분 및 약제학적으로 허용되는 담체를 포함하는 암의 예방 또는 치료용 약제학적 조성물을 제공한다.
(iii) 상기 항-B7-H3 항체는 B7-H3를 발현하는 다양한 종류의 암세포주에 특이적으로 결합하여 T cell 매개 암세포 사멸 효과를 나타내며, 인간과 마우스의 에피토프에 모두 결합하여 치료용 항체로 개발 시 전임상시험에서 효율적인 항암효과 평가가 가능할 것으로 예상된다.
도 1은 항체 라이브러리를 이용한 바이오패닝 (Biopanning)의 개요도다.
도 2a는 완전항체로 제작한 2D IgG의 recombinant human 4Ig B7-H3, recombinant human 2Ig B7-H3 및 recombinant mouse B7-H3에 대한 결합력을 indirect ELISA로 확인한 도면이다.
도 2b는 2D IgG의 Raji 및 BT-20 세포주에 대한 결합력을 FACS 방법으로 확인한 도면이다.
도 3a는 인간화 항체인 G2D IgG의 recombinant human 4Ig B7-H3, recombinant human 2Ig B7-H3 및 recombinant mouse B7-H3에 대한 결합력을 indirect ELISA로 확인한 도면이고, 도 3b는 인간화 항체인 G2D IgG의 recombinant human 4Ig B7-H3, recombinant human 2Ig B7-H3 및 recombinant mouse B7-H3에 대한 결합력을 SPR 방법으로 확인한 도면이다.
도 4는 암세포를 포함하는 antigen presenting cell (APC)에 발현된 B7 family protein과 T cell의 상호작용을 보여주는 도면이다.
도 5는 G2D IgG의 B7 family protein 중 B7-H3에 대한 특이성을 indirect ELISA로 확인한 도면이다.
도 6은 B7-H3 발현 Raji 세포주에 대한 G2D IgG의 결합력을 FACS 방법으로 확인한 도면이다. 도 6a는 human 4Ig, 2Ig B7-H3 발현 Raji 세포주에 대한 결합력을 확인한 도면이고, 도 6b는 mouse B7-H3 발현 Raji 세포주에 대한 결합력을 확인한 도면이다.
도 7은 16종의 인간 암세포주에 대한 G2D IgG의 결합력을 FACS 방법으로 확인한 도면이다. 도 7a는 대장암, 간암, 전립선암, 난소암 세포주; 도 7b는 뇌종양, 유방암 세포주; 도 7c는 췌장암, 폐암 세포주에 대한 결합력을 확인한 결과이다.
도 8은 B7-H3 발현이 확인된 4종의 mouse 암세포주에 대한 G2D IgG의 결합력을 FACS 방법으로 확인한 도면이다.
도 9는 G2D IgG의 immunogenicity를 in silico 방법으로 확인한 도면이다.
도 10은 G2D IgG의 epitope을 확인한 도면이다. 도 10a는 G2D IgG의 epitope 유형을 확인하기 위하여 recombinant 4Ig B7-H3 단백질에 대한 G2D IgG의 결합을 western blot으로 확인한 도면이고, 도 10b는 G2D IgG가 결합하는 human 4Ig B7-H3 peptide를 확인한 도면이다. 도 10c는 G2D IgG의 epitope으로 예상되는 EVQVP가 포함된 human 4Ig B7-H3 peptide에 대한 G2D IgG의 결합을 확인한 도면이며, 도 10d는 human 4Ig B7-H3 전체 아미노산에서 G2D IgG의 epitope을 표시한 도면이다. 도 10e는 human 4Ig B7-H3 단백질 구조에서 G2D IgG의 epitope을 표시한 도면이다.
도 11은 G2D IgG의 항암 효능을 GL261 세포주를 이식한 동계마우스에서 확인한 도면이다. 도 11a는 종양 부피 측정 결과를 표시한 도면이고, 도 11b는 체중 측정 결과를 표시한 도면이다.
이하, 실시 예를 통하여 본 발명을 더욱 상세히 설명하고자 한다. 이들 실시 예는 오로지 본 발명을 보다 구체적으로 설명하기 위한 것으로, 본 발명의 요지에 따라 본 발명의 범위가 이들 실시 예에 의해 제한되지 않는다는 것은 당업계에서 통상의 지식을 가진 자에 있어서 자명할 것이다.
실시예
실시예 1: B7-H3 양성 클론 스크리닝 (B7-H3 positive clone screening)
1-1. B7-H3에 결합하는 클론 선별
도 1과 같이 phage display 기술을 이용하여 B7-H3 양성 클론을 선별하였다. 먼저, 마그네틱 비드 (ThermoFisher Scientific, 미국)에 recombinant human 4Ig B7-H3 (Sino Biological, 중국) 2.5 μg을 접합시켰다. B7-H3가 발현하지 않는다고 알려진 Raji cell pellet과 반응시켜 Raji cell에 결합하는 파아지를 미리 제거하고 3% 우혈청 알부민 (Millipore, 미국) 용액에 분산시킨 비면역 닭 파아지 라이브러리 (chicken naive phage library)와 마그네틱 비드에 접합된 4Ig B7-H3를 상온에서 2시간 동안 반응하게 하여 B7-H3에 친화력을 가진 파아지를 결합시킨 후, 이를 0.5% Tween 20 (Amresco, 미국)이 포함된 완충용액으로 세척하고, 산성 용액을 이용하여 용출하였다. 용출된 파아지는 다음 라운드 바이오패닝을 위해 대장균 ER2738에 감염시켜 밤새 배양하여 증식시켰다. 이러한 과정을 4차례 반복하며 바이오패닝을 진행하였다. 1차에서 1회, 2~3차에서 3회, 4차에서 5회 세척하여 바이오패닝 횟수가 증가할수록 세척 횟수가 증가하여 결합력이 높은 파아지를 축적하였다.
4차 바이오패닝 결과물의 플레이트로부터 선별된 96개의 클론을 96 딥웰 (deep well) 플레이트에서 100 μg/ml 카베니실린, 70 μg/ml 카나마이신 및 VCSM13 헬퍼 파아지를 넣고 37℃에서 밤새 배양하여 scFv 클론이 발현된 파아지의 증식을 유도하였다. 상기에서 수득한 배양액을 원심분리를 통해 파아지를 포함한 배지 상등액을 얻어 recombinant human 4Ig B7-H3, recombinant human 2Ig B7-H3 (R&D Systems, 미국) 및 recombinant mouse B7-H3 (Sino Biological, 중국)가 각각 코팅되어 있는 ELISA 플레이트에 넣고 37℃에서 2시간 동안 반응하였으며, HRP가 접합되어 있는 항-M13 항체 (Sino Biological, 중국)를 이차항체로 이용하여 각각의 B7-H3에 결합하는 클론을 phage ELISA로 확인하고 강한 신호를 나타내는 2D 클론을 선별하였다.
1-2. 선별한 항체의 염기서열 분석
선별한 B7-H3에 양성 signal을 나타내는 2D 클론을 가지고 있는 ER2738을 SB 배지를 이용하여 밤새 배양한 후 원심분리하여 균체를 얻었다. DNA mini prep kit (Geneall, 한국)를 이용하여 plasmid DNA를 확보하고 표 1의 프라이머를 이용하여 염기서열을 분석하였다. 분석한 2D 클론은 표 2의 CDR 서열을 가진다. 2D 클론의 경쇄 및 중쇄 가변영역 아미노산 서열을 표 3에 나타냈다.
선별한 클론의 염기서열 분석에 사용된 프라이머
scFv 시퀀싱 프라이머
1 ACA CTT TAT GCT TCC GGC 정방향 (서열번호 1)
2 CAA AAT CAC CGG AAC CAG AG 역방향 (서열번호 2)
선별한 2D 클론의 CDR 아미노산 서열
경쇄 가변영역 CDR
LCDR1 LCDR2 LCDR3
SGGSIGYG
(서열번호 3)		 YNDRRPS
(서열번호 4)		 GSADSSSTYTGI
(서열번호 5)
중쇄 가변영역 CDR
HCDR1 HCDR2 HCDR3
SYPMV
(서열번호 6)		 SINSGGSWTGYGAAVKG
(서열번호 7)		 AYGAATIDA
(서열번호 8)
선별한 클론의 경쇄 및 중쇄 가변영역의 아미노산 서열
아미노산 서열번호
경쇄 가변영역 ALTQPSSVSANLGGTVKITCSGGSIGYGWYQQKAPGSAPVTVIYYNDRRPSDIPSRFSGSKSGSANTLTITGVQADDEAIYYCGSADSSSTYTGIFGAGTTLTVL 9
중쇄 가변영역 AVTLDESGGGLQTPGGGLSLVCKASGFDFSSYPMVWVRQAPGKGLEYVASINSGGSWTGYGAAVKGRATISRDNGQSTVRLQLNNLRAEDTATYYCARAYGAATIDAWGHGTEVIVSS 10
실시예 2: 선별한 클론의 완전항체 전환 및 발현/정제
2-1. 선별한 클론의 완전항체 전환
상기 실시예 1에 따라 선별한 클론인 2D는 scFv 형태이므로 PCR을 통해 완전 항체 (full-length IgG)로 전환하였다. 먼저 scFv를 포함하는 pComb3x로부터 중쇄 및 경쇄의 가변영역과 불변영역의 절편을 하기 표 4의 VL, CK 및 VH, CH 프라이머 조합을 이용해서 PCR을 통하여 수득하였다. 수득한 항체의 가변영역과 불변영역을 이용하여 하기 표 4의 LC 및 HC 프라이머 조합을 사용하여 PCR을 수행하여 각각의 항체의 중쇄와 경쇄를 확보하였다. 중쇄는 EcoRI과 NotI (New England Biolab, 영국) 효소를 처리하였고 마찬가지로 동일한 제한효소로 처리된 동물세포 발현용 벡터인 pCMV (ThermoFisher Scientific, 미국)에 라이게이션 하였다. 또한 경쇄는 XbaI (New England Biolab, 영국) 효소를 사용하여 처리하였으며 마찬가지로 동일한 제한효소로 처리된 pCMV 벡터에 라이게이션 하였다. 라이게이션이 완료된 플라스미드는 DH5α competent cell (New England Biolab, 영국)에 열충격을 가하여 형질전환하였고, 확보한 콜로니를 대량 배양하여 플라스미드를 확보하였다.
Figure PCTKR2023018360-appb-img-000001
2-2. 발현/정제
완전항체로 전환시킨 중쇄와 경쇄 각각의 플라스미드를 폴리에틸렌이민(polyethylenimine, PEI) (Polysciences, 미국)과 150 mM NaCl을 이용하여 Expi293F 세포 (Invitrogen, 미국)에 형질도입하고 Freestyle 293 발현배지 (Invitrogen, 미국)에서 37℃, 8% CO2 및 55% 습도 조건으로 Erlenmeyer 플라스크에서 7일간 부유배양 하였다. 발현 세포 배양액을 4,000 rpm로 10분 간 원심분리한 후, 상등액을 취해 0.22 μm 필터로 여과하였다. 여과된 상등액은 4℃에서 HiTrap Mabselect PrismA, 1 mL (GE Healthcare, 미국) 컬럼에 결합을 유도하였다. 결합된 레진은 10 cv (column volume)의 20 mM Sodium phosphate (pH 7.0)과 1 M 염화나트륨 용액으로 세척 후, 100 mM Sodium citrate (pH 3.0)과 150 mM 염화나트륨 용액을 사용하여 결합된 항체를 용출한 후, 1 M Tris-HCL (pH 9.0)으로 중화하였다. Slide-A-Lyzer Dialysis 카세트 (ThermoFisher Scientific, 미국)를 이용하여 pH 7.2 ~ 7.4 PBS로 완충액 교환을 진행 후 SDS-PAGE를 통해 정제된 항체의 경쇄와 중쇄의 크기 및 순도를 최종적으로 확인하였으며, 그 결과 이론적 계산치와 일치하는 분자량과 고순도의 항체가 생산되었음을 확인할 수 있었다.
실시예 3: 항원 결합력 분석
3-1. 재조합 항원 단백질에 대한 결합력 분석
상기 실시예 2에서 제작한 2D IgG의 재조합 B7-H3 단백질에 대한 결합력을 indirect ELISA로 확인하였다. Indirect ELISA는 50 μl의 PBS에 1 μg/ml로 recombinant human 4Ig B7-H3, recombinant human 2Ig B7-H3 및 recombinant mouse B7-H3를 각각 희석하여 96웰 면역 플레이트 (Corning, 미국)에 넣고 4℃에서 보관하여 밤새 흡착시켰다. 3% 우혈청 알부민이 포함된 완충용액으로 상온에서 1시간 반응시킨 후, 0.5% Tween 20이 포함된 완충용액으로 3회 세척하고, 순차적 농도(0.0001, 0.0003, 0.001, 0.003, 0.01, 0.03, 0.1, 0.3, 1, 3, 10 nM)로 희석한 각각의 항체를 웰 당 50 μl씩 처리하였다. 항원에 항체가 결합할 수 있도록 상온에서 2시간 반응시킨 후, 0.5% Tween 20이 포함된 완충용액으로 3회 세척하였다. 항-인간 면역글로불린 Fc-HRP 항체 (Jackson Immunoresearch, 미국)를 1:3,000으로 희석하여 웰당 50 μl씩 처리한 후, 상온에서 1시간 반응시켰다. 반응이 끝난 후, 0.5% Tween 20이 포함된 완충용액으로 3회 세척한 후, 3,3',5,5'-테트라메틸벤지딘 (TMB) (ThermoFisher Scientific, 미국) 50 μl씩 넣고 10분간 발색 시켰다. 분광 광도계 (Biotek, 미국)를 이용하여 450 nm에서 흡광도를 측정한 결과, 2D IgG는 B7-H3에 결합하는 결과를 나타냈고 결합력은 4Ig B7-H3, 2Ig B7-H3, mouse B7-H3 순이었다 (도 2a).
3-2. B7-H3 발현 세포주에 대한 결합력 분석
Raji 세포주는 B7-H3가 발현하지 않는 B7-H3-음성 세포주로 알려져 있으며 (Mol Ther Oncolytics. 2020;17:180-189), BT-20 세포주를 포함하는 다양한 유방암 세포에 B7-H3가 과발현 되어 있다고 알려져 있다 (Mol Cancer Ther. 2011;10(6):960-71).
B7-H3 음성 세포주인 Raji 세포주와 B7-H3 양성 세포주인 BT-20세포주를 사용하여 2D IgG의 결합력을 FACS로 분석하였다. 5x105개의 BT-20 및 Raji 세포를 2D IgG 1 μg이 포함되거나 포함되지 않은 PBS로 현탁하고 30분간 4℃에서 반응후에 원심분리를 통해 상층액을 제거하였다. 상층액 제거 후 각각의 세포를 PBS를 이용하여 2회 세척하였다. 세척이 완료된 세포를 원심분리후 FITC-conjugated Alexa Fluor goat anti-Human IgG (H+L) 항체 (Invitrogen, 미국)을 넣고 4℃ 조건에서 3분간 반응 후 원심분리를 통해 상층액을 제거하였다. 상층액 제거 후 각각의 세포를 PBS를 이용하여 2회 세척 후 유세포분석을 진행하고, 그 결과를 도 2b에 나타냈다. 2D IgG는 B7-H3 음성 세포주인 Raji에 결합하지 않았고, B7-H3 양성 세포주인 BT-20에 강하게 결합하였다 (도 2b).
실시예 4: 2D의 인간화 항체 (humanized antibody)인 G2D 제작
4-1. 2D의 인간화
2D IgG는 chicken/human chimeric antibody이므로 humanized antibody를 확보하기 위하여 다음과 같은 방법으로 인간화를 수행하였다.
2D의 인간화를 위해, 2D의 경쇄 가변영역 내 3개의 FR(LFR1, LFR2, LFR3)을 IGLV3-25*02의 FR로 치환하였고 중쇄 가변영역 내 3개의 FR(HFR1, HFR2, HFR3)을 IGHV3-64*04의 FR로 치환하였다. 그 후, 아미노산의 물리화학적 성질의 유사성 또는 비유사성을 고려하여 특정한 아미노산을 모항체 (2D)의 아미노산으로 다시 치환하였다. 모항체 (2D)로 다시 치환된 아미노산은 경쇄 가변영역에서 L46T, S66K, V71N이고, 중쇄 가변영역에서 T28D, F67A이다. 항체 도메인의 아미노산 잔기 번호는 당업계에서 통상적으로 사용되는 카밧 EU 넘버링 시스템(Kabat EU numbering system, Kabat et al., "Sequences of Proteins of Immunological Interest", 5th Ed., U.S. Department of Health and Human Services, NIH Publication No. 91-3242, 1991에서와 같은 EU 지수번호에 따름)에 따라 넘버링하였다. 경쇄 가변영역의 J gene은 US2010-0056386을 참고하여 FGGGTKLTVL로 고정하였고, 중쇄 가변영역의 J gene은 US2014-0206849를 참고하여 WGQGTTVTVSS로 고정하였다. 인간화 2D를 G2D로 명명하였고, 그 염기서열을 표 5에 표시하였다.
G2D의 경쇄 및 중쇄 가변영역 아미노산 서열
경쇄 가변영역
G2D (VL) SYELTQPPSVSVSPGQTARITCSGGSIGYGWYQQKAPGQAPVTVIYYNDRRPSGIPERFSGSKSGTTNTLTISGVQAEDEADYYCGSADSSSTYTGIFGGGTKLTVL 서열번호 21
중쇄 가변영역
G2D (VH) QVQLVESGGGLVQPGGSLRLSCSASGFDFSSYPMVWVRQAPGKGLEYVSSINSGGSWTGYGAAVKGRATISRDNSKNTLYLQMNSLRAEDTATYYCARAYGAATIDAWGQGTTVTVSS 서열번호 22
상기 표에서 밑줄친 부분은 CDR 영역이고, 볼드체는 모항체 (2D)로 다시 치환된 아미노산을 나타낸다.
4-2. G2D의 완전 항체 전환 및 발현/정제
상기에 기술한 G2D 가변영역의 DNA를 scFv 형태로 합성하고 (Cosmogenetech, 한국), 하기 표 6의 프라이머 조합을 사용하여 PCR을 통해 완전 항체로 전환하였다. 완전항체 전환 및 발현/정제는 전술한 실시예 2와 동일한 방법으로 수행하였다.
Figure PCTKR2023018360-appb-img-000002
실시예 5: G2D IgG의 항원 결합력 및 특이성 분석
5-1. Indirect ELISA를 이용한 재조합 항원 단백질에 대한 결합력 분석
상기 실시예 4에서 제작한 G2D IgG의 재조합 B7-H3 단백질에 대한 결합력을 indirect ELISA로 확인하였다. Indirect ELISA는 전술한 실시예 3-1과 동일한 방법으로 수행하였다.
Indirect ELISA 결과 G2D IgG는 2D IgG와 마찬가지로 B7-H3에 결합하였고 결합력은 4Ig B7-H3, 2Ig B7-H3, mouse B7-H3 순이었다 (도 3).
5-2. Surface Plasmon Resonance Measurement System (SPR)을 이용한 재조합 항원 단백질에 대한 결합력 분석
광학적 원리를 이용하여 항원-항체 결합력 및 kinetics 측정이 가능한 SPR 분석을 통하여 G2D IgG의 B7-H3에 대한 결합력을 확인하였다. SPR 분석은 결합 속도 (Ka)와 해리 속도 (Kd)의 확인이 가능하고 이를 통하여 KD 값을 구할 수 있으므로 정량적인 결합력 분석이 가능하다.
SPR 분석은 Biacore T200 (Cytiva, 미국) 장비를 사용하여 수행하였다. CM5 chip (Cytiva, 미국)에 Anti-human Fc antibody (Jackson Immunoresearch, 미국)를 7658~7908 RU로 고정하고 그 위에 G2D IgG를 400~460 RU로 캡쳐하였다. 4Ig B7-H3는 0.3125~10 nM, 2Ig B7-H3는 25~800 nM, mouse B7-H3는 15.625~500 nM로 주입하였다. 각각의 B7-H3에 대한 association/dissociation time을 4분/7분으로 설정하고 분석을 수행하였다. 분석 결과 4Ig B7-H3에 대하여 10-9 M 수준의 결합력을 보였고 2Ig B7-H3에 대하여 10-7 M 수준, mouse B7-H3에 대하여 10-6 M 수준의 결합력을 보였다 (도 3b, 표 7). Indirect ELISA와 유사한 결과를 확인하였고, G2D IgG가 recombinant 4Ig, 2Ig 및 mouse B7-H3에 모두 결합할 수 있음을 확인하였다.
SPR 분석을 통하여 확인한 G2D IgG의 B7-H3에 대한 결합력
Analyte Ligand Ka(1/Ms) Kd(1/s) KD(M)
4Ig B7-H3 G2D IgG 2.357x106 1.465x10-2 6.216x10-9
2Ig B7-H3 2.494x104 2.875x10-3 1.153x10-7
Mouse B7-H3 5.270x105 5.961x10-1 1.131x10-6
5-3. 재조합 B7-family protein에 대한 특이성 분석
암세포를 포함하는 항원발현세포 (Antigen presenting cell, APC)의 표면에는 B7-family protein이 발현되어 있고 T cell 표면 단백질과의 상호작용을 통하여 T cell의 작용을 조절한다 (도 4). B7-H3는 APC에 발현된 B7 family protein 중 하나로 T cell receptor는 아직 규명되지 않았지만 T cell의 작용을 저해하는 immune checkpoint로 알려져 있다 (Front Immunol. 2021; 12: 701006). B7 family protein은 T cell의 작용을 서로 다른 기전으로 조절하므로 B7-H3를 타겟하는 항체의 B7-H3에 대한 특이성이 매우 중요하다. 그러므로 G2D IgG의 B7-family protein에 대한 특이성을 indirect ELISA로 분석하였다.
Indirect ELISA는 B7-DC (Sino Biological, 중국), B7-1 (Sino Biological, 중국), B7-2 (Sino Biological, 중국), B7-H2 (Sino Biological, 중국), B7-H4 (Sino Biological, 중국), B7-H1 (Sino Biological, 중국), 4Ig B7-H3, 2Ig B7-H3를 1 μg/ml로 코팅한 96웰 면역 플레이트를 사용하여 실시예 3-1과 동일한 방법으로 수행하였다.
Indirect ELISA 결과 G2D IgG는 B7 family protein 중 4Ig. 2Ig B7-H3에만 결합하였다 (도 5). 이러한 결과는 G2D IgG의 B7-H3에 대한 우수한 특이성을 보여준다.
5-4. 세포 표면에 발현된 B7-H3에 대한 결합력 분석
재조합 단백질과 세포 표면 단백질은 서열이 동일하지만 구조적인 차이가 있을 수 있으므로 세포 표면 단백질에 대한 항체의 결합 확인은 필수적이다. 세포표면에 발현하는 B7-H3에 대한 결합여부를 확인하기 위하여 B7-H3 음성 세포주인 Raji 세포주에 4Ig, 2Ig 및 mouse B7-H3 세포 외 도메인을 포함하는 구조를 도입하였다. 녹색 형광 단백질 (Green fluorescent protein, GFP) 삽입을 통하여 세포 표면에 발현되는 2Ig, 4Ig 및 mouse B7-H3를 확인하였다. 세포 표면에 발현된 B7-H3에 대한 G2D IgG의 결합을 실시예 3-2와 동일한 방법으로 확인하였다. 이차항체는 goat anti-Human IgG (H+L) 594 항체 (Invitrogen, 미국)을 사용하였다. 세포주에 대한 결합은 정량적인 확인이 어려우므로 대조 항체로 현재 임상단계에 진입하였으며 대한민국 특허로 등록된 (등록번호: 10-1828570) enoblituzumab을 사용하였다.
G2D IgG는 B7-H3가 발현하지 않은 Raji-Vector control에 결합하지 않고 4Ig, 2Ig B7-H3를 발현시킨 Raji-4Ig B7-H3, Raji-2Ig B7-H3에 결합하였다 (도 6a). 세포 표면에 발현된 4Ig 및 2Ig B7-H3에 대한 G2D IgG의 결합력은 대조항체인 enoblituzumab 보다 높았다. Human B7-H3와 유사하게 G2D IgG는 Raji-Vector control에는 결합하지 않고 mouse B7-H3를 발현시킨 Raji-mouse B7-H3에는 결합하였다 (도 6b). 대조항체인 enoblituzumab은 mouse B7-H3에는 결합하지 않았다. 치료용 항체는 체내에 주입되어 세포에 발현된 항원에 특이적으로 결합하여 치료효과를 나타내므로 세포에 발현된 항원에 대한 결합력이 우수할수록 좋은 치료효과를 기대할 수 있다. 도 6a 및 b를 통하여 G2D IgG의 세포 표면 B7-H3에 대한 특이적이고 우수한 결합을 확인할 수 있다.
5-5. 인간 암 세포주에 대한 결합력 분석
B7-H3는 다양한 암종에서 발현하고 있으므로 다양한 인간 암 세포주에 대한 G2D IgG의 결합을 확인하였다. 대장암 세포주인 HCT116 및 HT29; 간암 세포주인 HepG2와 HepG2K; 전립선암 세포주인 PC-3; 난소암 세포주인 A2780; 뇌종양 세포주인 A172, U251 및 U87; 유방암 세포주인 MDA-MB-231, SK-BR-3 및 MDA-MB-453; 췌장암 세포주인 MIA-PaCa2 및 Panc-1; 폐암 세포주인 A549 및 NCI-H1975를 사용하여 G2D IgG의 결합력을 실시예 3-2의 방법으로 확인하였다.
G2D IgG는 사용한 세포주 16종에서 유방암 세포주 MDA-MB-453을 제외하고 이차항체만 결합시킨 control에 비하여 모두 확연한 피크의 이동을 나타냈다 (도 7). 이러한 결과는 G2D IgG가 사용한 세포주 16종 중에서 15종에 결합함을 보여주며 G2D IgG는 암 종에 관계없이 B7-H3를 발현하는 암 세포와 결합 가능함을 의미한다.
5-6. B7-H3 발현 마우스 암 세포주에 대한 결합력 분석
Human과 mouse 항원에 교차 결합하는 항체는 면역시스템이 보존된 동계 마우스 모델 (syngeneic mouse model)에서 항암효과와 면역세포 활성 정도 확인이 가능하므로 치료제 개발에 유리하다. 또한 대동물 독성실험 이전에 소동물인 mouse에서 독성을 확인할 수 있는 장점이 있다. 그러므로 B7-H3의 발현이 확인된 3LL (마우스 폐암 세포주), 4T1 (마우스 유방암 세포주), Panc-02 (마우스 췌장암 세포주) 및 GL-261 (마우스 뇌종양 세포주)의 총 4종의 mouse 암 세포주에 대한 G2D IgG의 결합력을 실시예 3-2의 방법으로 확인하였다.
대조항체인 enoblituzumab과 달리 G2D IgG는 사용한 4종의 mouse 암세포주에 결합하였다 (도 8). 이러한 결과는 syngeneic mouse model을 포함하는 다양한 mouse 모델에 G2D IgG가 적용 가능함을 의미하며 G2D IgG를 치료용 항체로 개발 시 전임상시험에서 효율적인 항암효과 평가가 가능하다.
실시예 6: G2D IgG의 in silico immunogenicity 확인
치료용 항체가 체내에 유입되었을 때 면역반응을 유발하는 성질을 면역원성 (immunogenicity)이라고 하며 치료용 항체의 면역원성에 의하여 유발된 체내 면역반응은 약효 뿐만 아니라 환자의 안전성에도 심각한 문제를 일으킬 수 있다. 따라서 치료용 항체의 immunogenicity 확인은 의약품 개발에 중요한 부분이다. 따라서 G2D IgG의 immunogenicity를 in silico 방법으로 확인하였다.
항체 단백질과 MHC-II가 결합하게 되면 면역원성을 나타낼 확률이 높아지므로 전체 HLA-II allele 중 90%를 차지하는 27종의 HLA-II allele에 대한 결합을 예측하였다 (http:/tools.iedb.org/mhcii/result/).
도 9에서 가로축에 HLA-II allele를 나열하였고 세로축에는 G2D IgG의 아미노산을 15개씩 14개를 겹치게 하여 나열하였다. 그러므로 세로축에 나열된 HLA-II allele에 대한 가로축의 G2D IgG의 15개씩 나열한 아미노산의 결합 가능성을 확인할 수 있다. 결합 가능성에 대한 결과값이 작을수록 결합가능성이 높으므로 결과값이 <1을 빨간색 (결합가능성: high), 1이상 5미만을 주황색 (결합가능성: medium), 5이상 10미만을 노란색 (결합가능성: low)로 표시하였다. G2D IgG는 대조항체인 enoblituzumab 대비 동등 이하의 면역원성 가능성을 확인할 수 있었다 (도 9). 이러한 결과는 G2D IgG가 체내 면역반응을 유발할 가능성이 낮음을 의미한다.
실시예 7: G2D IgG의 epitope 확인
Epitope은 항원 결정 부위로써 항체가 인식하고 결합할 수 있는 항원의 특정한 서열을 의미한다. Epitope에 따라 항체의 치료효과가 상이할 수 있고 면역항암제의 경우 면역세포 활성 정도 역시 상이할 수 있으므로 항체의 epitope 확인은 의약품 개발에서 중요한 부분이다.
Western blot을 통하여 G2D가 4Ig B7-H3를 인식하는 것을 확인하여 (도 10a), G2D IgG가 linear epitope을 가짐을 알 수 있었다. 따라서 linear epitope mapping을 진행하였다. Linear epitope mapping을 앱클론㈜에 의뢰하였고 독일의 Pepperprint GmbH에서 수행하였다. 4Ig B7-H3 아미노산을 15개씩 14개가 겹치도록 합성하여 peptide microarray를 제작하고 항체를 반응시키고 이차항체로 peptide에 결합하는 항체를 확인하였다 (도 10b). 그 결과 G2D IgG는 EVQVP 서열을 가지는 peptide에 결합하였다 (도 10c). EVQVP는 4Ig B7-H3의 Ig-like V-type1 및 Ig-like V-type2 domain에 위치한다 (도 10d 및 e). 같은 방법으로 대조항체인 enoblituzumab의 epitope을 확인하였을 때 이들의 epitope은 GYPEAE 서열이 포함된 부분으로 확인되었고 (도 10b), GYPEAE는 4Ig B7-H3의 Ig-like C2-type1 및 Ig-like C2-type2에 위치한다 (도 10d 및 e). 결과적으로 G2D IgG가 대조항체인 enoblituzumab과 상이한 epitope을 가짐을 확인하였다.
B7-H3의 서열 및 이의 도메인 서열과 G2D 항체가 결합하는 에피토프 서열은 다음과 같다(표 8).
B7-H3 서열
Human 4Ig B7-H3 (서열번호 33)
MLRRRGSPGMGVHVGAALGALWFCLTGAL EVQVP EDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYQGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSILRVVLGANGTYSCLVRNPVLQQDAHSSVTITPQRSPTGAV EVQVP EDPVVALVGTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTFPPEALWVTVGLSVCLIALLVALAFCWRKIKQSCEEENAGAEDQDGEGEGSKTALQPLKHSDSKEDDGQEIA
Human 2Ig B7-H3 (서열번호 34)
MLRRRGSPGMGVHVGAALGALWFCLTGAL EVQVP EDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTFPPEALWVTVGLSVCLIALLVALAFVCWRKIKQSCEEENAGAEDQDGEGEGSKTALQPLKHSDSKEDDGQEIA
Mouse B7-H3 (서열번호 35)
MLRGWGGPSVGVCVRTALGVLCLCLTGAV EVQVS EDPVVALVDTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYSNRTALFPDLLVQGNASLRLQRVRVTDEGSYTCFVSIQDFDSAAVSQVAAPYSKPSMTLEPNKDLRPGNMVTITCSSYQGYPEAEVFWKDGQGVPLTGNVTTSQMANERGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPLTFPPEALWVTVGLSVCLVVLLVALAFVCWRKIKQSCEEENAGAEDQDGDGEGSKTALRPLKPSENKEDDGQEIA
B7-H3 도메인 서열 및 에피토프의 위치
도메인 서열 서열번호
Human 4Ig B7-H3 Ig-like-V-type 1 L EVQVP EDPV VALVGTDATL CCSFSPEPGF SLAQLNLIWQ LTDTKQLVHS FAEGQDQGSA YANRTALFPD LLAQGNASLR LQRVRVADEG SFTCFVSIRD FGSAAVSLQV A 36
Ig-like-C2-type 1 PSMTLEPNKD LRPGDTVTIT CSSYQGYPEA EVFWQDGQGV PLTGNVTTSQ MANEQGLFDV HSILRVVLGA NGTYSCLVRN PVLQQDAHSS VTIT 37
Ig-like-V-type 2 PTGAV EVQVP EDPVVALVGT DATLRCSFSP EPGFSLAQLN LIWQLTDTKQ LVHSFTEGRD QGSAYANRTA LFPDLLAQGN ASLRLQRVRV ADEGSFTCFV SIRDFGSAAV SLQVA 38
Ig-like-C2-type 2 PSMTLEPNKD LRPGDTVTIT CSSYRGYPEA EVFWQDGQGV PLTGNVTTSQ MANEQGLFDV HSVLRVVLGA NGTYSCLVRN PVLQQDAHGS VTIT 39
Human 2Ig B7-H3 Ig-like-V-type 1 L EVQVP EDPV VALVGTDATL CCSFSPEPGF SLAQLNLIWQ LTDTKQLVHS FAEGQDQGSA YANRTALFPD LLAQGNASLR LQRVRVADEG SFTCFVSIRD FGSAAVSLQV A 36
Ig-like-C2-type 1 PSMTLEPNKD LRPGDTVTIT CSSYRGYPEA EVFWQDGQGV PLTGNVTTSQ MANEQGLFDV HSVLRVVLGA NGTYSCLVRN PVLQQDAHGS VTIT 39
Mouse B7-H3 Ig-like V-type V EVQVS EDPV VALVDTDATL RCSFSPEPGF SLAQLNLIWQ LTDTKQLVHS FTEGRDQGSA YSNRTALFPD LLVQGNASLR LQRVRVTDEG SYTCFVSIQD FDSAAVSLQV A 40
Ig-like C2-type PSMTLEPNKD LRPGNMVTIT CSSYQGYPEA EVFWKDGQGV PLTGNVTTSQ MANERGLFDV HSVLRVVLGA NGTYSCLVRN PVLQQDAHGS VTIT 41
상기 서열에서 밑줄 볼드체 부분은 G2D 항체가 결합하는 B7-H3의 에피토프를 나타낸다.
실시예 8: G2D IgG의 T cell 매개 암세포 사멸 효과 확인
G2D IgG의 결합이 확인된 A549 세포 (도 7c)를 사용하여 T cell 매개 암세포 사멸 효과를 확인하였다. B7-H3 결합에 의한 효과를 비교하기 위하여 야생형 Fc를 보유한 enoblituzumab을 사용하였다. GFP가 삽입된 A549 세포 1x104개에 anti-CD3/CD28 antibody (eBioscience, 미국)로 활성을 유도한 PBMC (STEMCELL Technologies, 캐나다) 2x105개를 추가하고 G2D IgG를 200 μg/ml을 처리하여 48시간 공동 배양하였다. 대조군으로는 같은 조건에서 활성을 유도하지 않은 PBMC를 사용하였다. 48시간의 공동 배양 후 GFP에 의한 형광을 SPARK (TECAN, 스위스) 장비로 측정하여 A549의 viability를 확인하였다. 그 결과 G2D IgG는 음성대조군 대비 30% 정도의 활성화를 유도한 T cell 매개 암세포 사멸 효과를 보였고, 그 효과는 대조항체인 야생형 Fc를 보유한 enoblituzumab 대비 동등 이상이었다 (표 9). G2D IgG가 암세포 표면의 B7-H3 결합을 통하여 T cell의 세포 사멸 효과를 증진시킬 수 있음을 의미하며 G2D IgG가 면역항암제로 적용 가능함을 의미한다.
활성화를 유도한 T cell 매개 A549 세포 사멸 효과
A549 ability(%)=
Figure PCTKR2023018360-appb-img-000003
x100
음성대조군 100
Isotype control 99.5
G2D 69.3
enoblituzumab 77.3
실시예 9: GL261 이식 동계 마우스 모델에서 G2D IgG의 항암 효능 평가
실시예 8에서 G2D IgG의 면역항암제 가능성을 확인하였으므로 동물 모델을 통하여 검증하였다. 동계 마우스 모델 (syngeneic mouse model)은 마우스 면역시스템이 보존된 상태에서 암을 유도하므로, 평가 대상 항체가 마우스 암세포 항원을 인식할 수 있다면 따로 면역세포 이식 없이 면역세포를 통한 항암 효과 확인에 유용하다. 면역적격마우스인 C57BL/6 암컷 마우스 (Orient Bio, 한국)에 G2D IgG의 결합이 확인된 mouse glioma 세포주인 GL261 (도 8)를 4x106개/mouse로 마우스의 오른쪽 옆구리 피하에 이식하였다. Tumor의 크기가 약 70 mm3에 도달하였을 때 G2D IgG 투여를 시작하였다. 대조 약물로는 mouse B7-H3에 결합하는 항체인 InVivoMAb anti-mouse CD276 (anti-mB7-H3 IgG) (BioXcell, 미국)을 사용하였다. 각각의 항체는 10 mg/kg 농도로 정맥 주사하였고, 2회/주, 2주간 투여를 진행하였다. 종양의 부피 측정은 약물 투여 개시 시점부터 2회/주, 2주간 진행하였고 종양 부피(mm3)은 [종양부피(mm3) = (장축x단축2)/2] 식을 통하여 산출하였다. 체중은 투여 개시 후 1회/주 및 부검일에 전자저울을 사용하여 측정하였다. Student t-test를 실시하여 통계분석을 수행하였고 p<0.05인 경우 통계적으로 유의하다고 판정하였다 (#). 그 결과 G2D IgG는 체중감소 없이 대조 약물인 anti-mB7-H3 IgG 대비 높은 종양 부피 감소 효과를 나타내었다 (도 11). 이러한 결과는 G2D IgG가 B7-H3를 효과적으로 억제하여 항암 효능을 나타냄을 의미한다.
이상, 본 발명의 실시예들에 대하여 설명하였으나, 해당 기술 분야에서 통상의 지식을 가진 자라면 특허청구범위에 기재된 본 발명의 사상으로부터 벗어나지 않는 범위 내에서, 구성 요소의 부가, 변경, 삭제 또는 추가 등에 의해 본 발명을 다양하게 수정 및 변경시킬 수 있을 것이며, 이 또한 본 발명의 권리범위 내에 포함된다고 할 것이다.

Claims (20)

  1. 서열번호 36의 Ig-like-V-type 1 서열, 서열번호 38의 Ig-like-V-type 2 서열 및 서열번호 40의 Ig-like-V-type 서열로 구성된 군으로부터 선택되는 B7-H3의 도메인의 아미노산 서열 내에 위치된 에피토프에 특이적으로 결합하는 것을 특징으로 하는, 항-B7-H3 항체 또는 이의 항원 결합 단편.
  2. 제 1 항에 있어서,
    상기 항-B7-H3 항체 또는 이의 항원 결합 단편은 서열번호 36의 아미노산 잔기 2 내지 6(즉, EVQVP), 서열번호 38의 아미노산 잔기 6 내지 10(즉, EVQVP) 및 서열번호 40의 아미노산 잔기 2 내지 6(즉, EVQVS)에 해당하는 하나 이상의 아미노산에 특이적으로 결합하는 것을 특징으로 하는, 항-B7-H3 항체 또는 이의 항원 결합 단편.
  3. 제 1 항에 있어서,
    상기 항-B7-H3 항체 또는 이의 항원 결합 단편은 경쇄 CDR1, CDR2, 및 CDR3 및 중쇄 CDR1, CDR2, 및 CDR3을 포함하며, 여기서 경쇄 CDR1, CDR2, 및 CDR3은 각각 서열번호 3, 4, 및 5로 구성되고, 중쇄 CDR1, CDR2, 및 CDR3은 각각 서열번호 6, 7, 및 8로 구성되는 것을 특징으로 하는, 항-B7-H3 항체 또는 이의 항원 결합 단편.
  4. B7-H3에 특이적으로 결합하는 항-B7-H3 항체 또는 이의 항원 결합 단편으로서,
    상기 항-B7-H3 항체 또는 이의 항원 결합 단편은 경쇄 CDR1, CDR2, 및 CDR3과 중쇄 CDR1, CDR2, 및 CDR3을 포함하며, 여기서 경쇄 CDR1, CDR2, 및 CDR3은 각각 서열번호 3, 4, 및 5로 구성되고, 중쇄 CDR1, CDR2, 및 CDR3은 각각 서열번호 6, 7, 및 8로 구성되는 것을 특징으로 하는, 항-B7-H3 항체 또는 이의 항원 결합 단편.
  5. 제 3 항 또는 제 4 항에 있어서, 상기 항-B7-H3 항체 또는 이의 항원 결합 단편은 경쇄 가변영역 및 중쇄 가변영역을 포함하며,
    (i) 상기 경쇄 가변영역은 서열번호 9에 제시된 서열과 적어도 80%, 적어도 85%, 적어도 90%, 적어도 95%, 적어도 96%, 적어도 97%, 적어도 98%, 적어도 99%, 또는 100% 동일한 아미노산 서열을 포함하고; 및
    (ii) 상기 중쇄 가변영역은 서열번호 10에 제시된 서열과 적어도 80%, 적어도 85%, 적어도 90%, 적어도 95%, 적어도 96%, 적어도 97%, 적어도 98%, 적어도 99%, 또는 100% 동일한 아미노산 서열을 포함하는 것을 특징으로 하는, 항-B7-H3 항체 또는 이의 항원 결합 단편.
  6. 제 5 항에 있어서, 상기 항-B7-H3 항체 또는 이의 항원 결합 단편은 경쇄 가변영역 및 중쇄 가변영역을 포함하며,
    상기 경쇄 가변영역은 서열번호 9로 구성되고, 상기 중쇄 가변영역은 서열번호 10으로 구성되는 것을 특징으로 하는, 항-B7-H3 항체 또는 이의 항원 결합 단편.
  7. 제 3 항 또는 제 4 항에 있어서, 상기 항-B7-H3 항체 또는 이의 항원 결합 단편은 경쇄 가변영역 및 중쇄 가변영역을 포함하며,
    (i) 상기 경쇄 가변영역은 서열번호 21에 제시된 서열과 적어도 80%, 적어도 85%, 적어도 90%, 적어도 95%, 적어도 96%, 적어도 97%, 적어도 98%, 적어도 99%, 또는 100% 동일한 아미노산 서열을 포함; 및
    (ii) 상기 중쇄 가변영역은 서열번호 22에 제시된 서열과 적어도 80%, 적어도 85%, 적어도 90%, 적어도 95%, 적어도 96%, 적어도 97%, 적어도 98%, 적어도 99%, 또는 100% 동일한 아미노산 서열을 포함하는 것을 특징으로 하는, 항-B7-H3 항체 또는 이의 항원 결합 단편.
  8. 제 7 항에 있어서, 상기 항-B7-H3 항체 또는 이의 항원 결합 단편은 경쇄 가변영역 및 중쇄 가변영역을 포함하며,
    상기 경쇄 가변영역은 서열번호 21로 구성되고, 상기 중쇄 가변영역은 서열번호 22로 구성되는 것을 특징으로 하는, 항-B7-H3 항체 또는 이의 항원 결합 단편.
  9. 제 1 항 또는 제 4 항의 항-B7-H3 항체 또는 이의 항원 결합 단편을 코딩하는 핵산.
  10. 제 9 항의 핵산을 포함하는 벡터.
  11. 제 10 항의 벡터를 포함하는 세포.
  12. 제 10 항의 벡터로 형질전환된 세포.
  13. 제 1 항 또는 제 4 항의 항-B7-H3 항체 또는 이의 항원 결합 단편, 상기 항체 또는 이의 항원 결합 단편을 코딩하는 핵산, 상기 핵산을 포함하는 벡터 및 상기 벡터를 포함하거나 상기 벡터로 형질전환된 세포로 구성된 군으로부터 선택되는 성분을 포함하는 조성물.
  14. 제 1 항 또는 제 4 항의 항-B7-H3 항체 또는 이의 항원 결합 단편, 상기 항체 또는 이의 항원 결합 단편을 코딩하는 핵산, 상기 핵산을 포함하는 벡터 및 상기 벡터를 포함하거나 상기 벡터로 형질전환된 세포로 구성된 군으로부터 선택되는 성분 및 약제학적으로 허용되는 담체를 포함하는 암의 예방 또는 치료용 약제학적 조성물.
  15. 제 14 항에 있어서, 상기 암은 B7-H3를 발현하는 암종에 의한 것을 특징으로 하는, 암의 예방 또는 치료용 약제학적 조성물.
  16. 제 14 항에 있어서, 상기 암은 뇌종양, 소아암, 수모세포종, 연수막전이암, 유방암, 폐암, 췌장암, 대장암, 간암, 전립선암, 난소암, 위암, 식도암, 림프종, 흑색종, 신장암, 섬유육종, 결장암, 결직장암, 자궁내막암, 갑상선암, 부갑상선암, 자궁경부암, 방광암, 두경부암, 뼈암, 피부암, 자궁암, 고환암, 담도암, 기관지암, 비인두암, 후두암 및 요관암으로 구성된 군으로부터 선택되는 것을 특징으로 하는, 암의 예방 또는 치료용 약제학적 조성물.
  17. 제 14 항에 있어서, 상기 약제학적 조성물은 면역치료제, 화학치료제, 표적화 치료제, 또는 방사선치료제를 포함하는 추가의 암 제제와 조합하여 사용되는 것을 특징으로 하는, 암의 예방 또는 치료용 약제학적 조성물.
  18. 이를 필요로 하는 대상에게, 제 1 항 또는 제 4 항의 항-B7-H3 항체 또는 이의 항원 결합 단편, 상기 항체 또는 이의 항원 결합 단편을 코딩하는 핵산, 상기 핵산을 포함하는 벡터 및 상기 벡터를 포함하거나 상기 벡터로 형질전환된 세포로 구성된 군으로부터 선택되는 성분을 투여하는 단계를 포함하는, 암의 치료방법.
  19. 제 1 항 또는 제 4 항의 항-B7-H3 항체 또는 이의 항원 결합 단편, 상기 항체 또는 이의 항원 결합 단편을 코딩하는 핵산, 상기 핵산을 포함하는 벡터 및 상기 벡터를 포함하거나 상기 벡터로 형질전환된 세포로 구성된 군으로부터 선택되는 성분의 의약 용도(for use as a medicament).
  20. 제 1 항 또는 제 4 항의 항-B7-H3 항체 또는 이의 항원 결합 단편, 상기 항체 또는 이의 항원 결합 단편을 코딩하는 핵산, 상기 핵산을 포함하는 벡터 및 상기 벡터를 포함하거나 상기 벡터로 형질전환된 세포로 구성된 군으로부터 선택되는 성분을 포함하는 것을 특징으로 하는, 암의 진단용 조성물.
PCT/KR2023/018360 2022-11-15 2023-11-15 B7-h3에 특이적으로 결합하는 항체 WO2024106939A1 (ko)

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
KR10-2022-0152913 2022-11-15
KR20220152913 2022-11-15
KR10-2023-0154552 2023-11-09
KR1020230154552A KR20240072932A (ko) 2022-11-15 2023-11-09 B7-h3에 특이적으로 결합하는 항체

Publications (1)

Publication Number Publication Date
WO2024106939A1 true WO2024106939A1 (ko) 2024-05-23

Family

ID=91084778

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/KR2023/018360 WO2024106939A1 (ko) 2022-11-15 2023-11-15 B7-h3에 특이적으로 결합하는 항체

Country Status (1)

Country Link
WO (1) WO2024106939A1 (ko)

Citations (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR20100014527A (ko) * 2007-03-22 2010-02-10 슬로안-케테링인스티튜트퍼캔서리서치 단일클론항체 8ｈ9의 용도
KR20140033018A (ko) * 2011-04-25 2014-03-17 다이이찌 산쿄 가부시키가이샤 항 ｂ７-ｈ３항체
KR20170042786A (ko) * 2014-08-27 2017-04-19 메모리얼 슬로안-케터링 캔서 센터 항체, 조성물 및 용도
KR20190134614A (ko) * 2017-03-31 2019-12-04 지앙수 헨그루이 메디슨 컴퍼니 리미티드 B7-h3 항체, 이의 항원-결합 단편 및 이의 의학적 용도
WO2020102779A1 (en) * 2018-11-16 2020-05-22 Albert Einstein College Of Medicine MONOCLONAL ANTIBODIES AGAINST IgV DOMAIN OF B7-H3 AND USES THEREOF

Patent Citations (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR20100014527A (ko) * 2007-03-22 2010-02-10 슬로안-케테링인스티튜트퍼캔서리서치 단일클론항체 8ｈ9의 용도
KR20140033018A (ko) * 2011-04-25 2014-03-17 다이이찌 산쿄 가부시키가이샤 항 ｂ７-ｈ３항체
KR20170042786A (ko) * 2014-08-27 2017-04-19 메모리얼 슬로안-케터링 캔서 센터 항체, 조성물 및 용도
KR20190134614A (ko) * 2017-03-31 2019-12-04 지앙수 헨그루이 메디슨 컴퍼니 리미티드 B7-h3 항체, 이의 항원-결합 단편 및 이의 의학적 용도
WO2020102779A1 (en) * 2018-11-16 2020-05-22 Albert Einstein College Of Medicine MONOCLONAL ANTIBODIES AGAINST IgV DOMAIN OF B7-H3 AND USES THEREOF

Similar Documents

Publication Publication Date Title
WO2020076105A1 (ko) 신규 항-c-kit 항체
KR102340832B1 (ko) 항 pd-1 항체 및 그의 용도
WO2019225777A1 (ko) 항-ror1 항체 및 그 용도
WO2017052241A1 (en) Novel anti-mesothelin antibody and composition comprising the same
NZ719092A (en) Tumor necrosis factor-like ligand 1a specific antibodies and compositions and uses thereof
WO2015167293A1 (en) Antibody binding to fcrn for treating autoimmune diseases
AU2018271751B2 (en) Anti-human interleukin-2 antibodies and uses thereof
WO2015133817A1 (ko) B 세포 림프종 세포를 특이적으로 인지하는 단일클론항체 및 이의 용도
KR20160037130A (ko) 신규한 항체 접합체 및 이의 용도
WO2017074074A1 (en) Novel anti-glypican 3 antibody and pharmaceutical composition containing the same
BR112021004287A2 (pt) anticorpos anti-avss8 e composições e usos dos mesmos
US20220411498A1 (en) Binding molecule specifically for cd39 and use thereof
WO2017030370A1 (ko) 항-코티닌 항체가 연결된 키메라 항체 수용체 및 이의 용도
WO2018174544A2 (ko) Muc1에 특이적으로 결합하는 항체 및 그의 용도
WO2021107566A1 (ko) C-kit에 대한 항체 및 이의 용도
WO2019132533A1 (ko) 항-pd-l1 항체 및 이의 용도
WO2021091359A1 (ko) 조절 t 세포 표면 항원의 에피토프 및 이에 특이적으로 결합하는 항체
KR20220110495A (ko) 클라우딘 18.2를 표적화하는 항체-약물 콘쥬게이트
WO2019078699A2 (ko) 항-vista 항체 및 이의 용도
WO2020101365A1 (ko) 안정성이 향상된 항 c-met 항체 또는 그의 항원 결합 단편
WO2024106939A1 (ko) B7-h3에 특이적으로 결합하는 항체
WO2020004937A1 (ko) 항-bcma 항체-약물 접합체 및 그 용도
WO2016084993A1 (ko) 신규 EGFRvIII 항체 및 이를 포함하는 조성물
WO2024106941A1 (ko) B7-h3 키메라 항원 수용체 및 이의 용도
WO2023157989A1 (ko) 항체-약물 접합체