WO2024048978A1 - 신규한 tmem165-clock 에피토프 및 이에 대한 항체 - Google Patents
신규한 tmem165-clock 에피토프 및 이에 대한 항체 Download PDFInfo
- Publication number
- WO2024048978A1 WO2024048978A1 PCT/KR2023/009849 KR2023009849W WO2024048978A1 WO 2024048978 A1 WO2024048978 A1 WO 2024048978A1 KR 2023009849 W KR2023009849 W KR 2023009849W WO 2024048978 A1 WO2024048978 A1 WO 2024048978A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- cancer
- antibody
- tmem165
- clock
- antigen
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Images
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/30—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/575—Immunoassay; Biospecific binding assay; Materials therefor for cancer
Definitions
- the present invention provides a TMEM165-CLOCK antibody epitope and an antibody or antigen-binding fragment thereof that specifically binds thereto; and a composition for diagnosing, preventing or treating cancer comprising the antibody or antigen-binding fragment thereof.
- cancer diagnosis methods include invasive methods such as tissue sample collection and endoscopy.
- biopsy is performed by removing part of the area suspected of having a disease and observing it under a microscope. Therefore, in order to use a needle, punch, endoscope, or laparoscope to collect tissue samples, the human body must be incised, which not only causes considerable discomfort to the patient, but also leaves scars and takes a long time to recover.
- a fusion gene is a hybrid gene formed by chromosomal rearrangement (translocation, deletion, inversion), trans-splicing, and read-through event. Fusion genes are known to be involved in the development and activation mechanisms of various tumors. In addition, even within the same cancer type, each patient has tumor heterogeneity, and fusion genes can be helpful in developing molecular target drugs by providing a standard for distinguishing cancer diversity for personalized treatment. Therefore, the specific expression of the fusion gene can be used as useful information for predicting and diagnosing cancer or as an effective prognostic marker in the treatment of cancer.
- the present inventors confirmed the specific expression of the fusion gene TMEM165-CLOCK in various sarcoma cancer tissues such as dermatofibrosarcoma, liposarcoma, undifferentiated pleomorphic sarcoma, and osteochondroma.
- sarcoma cancer we confirmed the specific expression of TMEM165-CLOCK in breast cancer, prostate cancer, and lung cancer cell lines.
- the novel sequence of TMEM165-CLOCK was used to produce an epitope and an antibody that specifically binds to it.
- the TMEM165-CLOCK specific antibody can be used for the diagnosis, prevention, or treatment of cancer. Confirmed.
- the object of the present invention is to provide a TMEM165-CLOCK antibody epitope containing the amino acid sequence shown in SEQ ID NO: 1 and an antibody or antigen-binding fragment thereof that specifically binds to the epitope.
- Another task is to provide a composition for diagnosing cancer and a composition for preventing or treating cancer, including a TMEM165-CLOCK specific antibody or antigen-binding fragment thereof.
- Another task is to provide a method for diagnosing cancer, including reacting a TMEM165-CLOCK specific antibody or antigen-binding fragment thereof with a target sample.
- Another task is to provide a method of treating cancer that includes administering a TMEM165-CLOCK specific antibody or antigen-binding fragment thereof to a subject.
- the present invention provides a TMEM165-CLOCK antibody epitope containing the amino acid sequence represented by SEQ ID NO: 1.
- the epitope may include a polypeptide consisting of the 300-321st amino acid sequence of the TMEM165 protein shown in SEQ ID NO: 3.
- the present invention provides an antibody or antigen-binding fragment thereof that specifically binds to the TMEM165-CLOCK antibody epitope containing the amino acid sequence shown in SEQ ID NO: 1.
- the antibody or antigen-binding fragment is selected from the group consisting of Fab, Fd, Fab', dAb, F(ab'), F(ab')2, scFv, Fv, scFv dimer, diabody, and linear antibody. It may be possible.
- the antibody may include the amino acid sequence represented by SEQ ID NO: 2.
- the antibody may be a single chain antibody (scFv).
- the present invention provides a TMEM165-CLOCK-specific single chain antibody (scFv) or an antigen-binding fragment thereof comprising the amino acid sequence shown in SEQ ID NO: 2.
- scFv single chain antibody
- the present invention also provides a polynucleotide encoding the antibody or antigen-binding fragment thereof.
- the present invention provides a recombinant expression vector containing the above polynucleotide.
- the present invention also provides a transformant transformed with the vector.
- the present invention also provides a composition for diagnosing cancer, comprising the antibody or antigen-binding fragment thereof.
- the cancer may be one or more types selected from the group consisting of stomach cancer, colon cancer, kidney cancer, blood cancer, sarcoma cancer, ovarian cancer, breast cancer, cervical cancer, thyroid cancer, prostate cancer, pancreatic cancer, liver cancer, and lung cancer.
- the present invention also provides a composition for preventing or treating cancer, comprising the antibody or antigen-binding fragment thereof.
- the cancer may be one or more types selected from the group consisting of stomach cancer, colon cancer, kidney cancer, blood cancer, sarcoma cancer, ovarian cancer, breast cancer, cervical cancer, thyroid cancer, prostate cancer, pancreatic cancer, liver cancer, and lung cancer.
- composition may further include PBMC cells or NK cells.
- the present invention also provides a method for diagnosing cancer, comprising reacting the antibody or antigen-binding fragment thereof with a target sample.
- the cancer may be one or more types selected from the group consisting of stomach cancer, colon cancer, kidney cancer, blood cancer, sarcoma cancer, ovarian cancer, breast cancer, cervical cancer, thyroid cancer, prostate cancer, pancreatic cancer, liver cancer, and lung cancer.
- the present invention also provides a method of treating cancer comprising administering the antibody or antigen-binding fragment thereof to a subject.
- the TMEM165-CLOCK antibody epitope according to the present invention is an antigen binding site of a novel sequence identified from the cancer cell-specific expression fusion gene TMEM165-CLOCK, and since the antibody against this was confirmed to have high binding affinity to TMEM165-CLOCK, the expression of TMEM165-CLOCK and It can be useful in the diagnosis, prevention, or treatment of cancer, a related disease.
- Figure 1 is a diagram showing the expression level of TMEM165-CLOCK in normal cells and various sarcoma tissues.
- Top image - Lanes 1 and 2 Normal tissue
- Lane 3 Dermatofibrosarcoma protuberans (DFSP)
- Lane 4 Undifferentiated pleomorphic sarcoma (UPS)
- Bottom image - Lane 1 Dermatofibrosarcoma (DFSP; Dermatofibrosarcoma protuberans)
- Lane 2 Low-grade liposarcoma
- Lane 3 Undifferentiated pleomorphic sarcoma (UPS)
- Lane 4 Giant cell tumor
- Lane 5 Osteochondroma .
- Figure 2 is a diagram showing the expression level of TMEM165-CLOCK in cancer cells other than sarcoma. Lane 1: NCI-H1299, Lane 2: NCI-H1437, Lane 3: NCI-H1793, Lane 4: HCC827, Lane 5: NCI-H23.
- Figure 3 shows the base sequence difference (a), amino acid sequence difference (b), TMEM165-CLOCK protein schematic diagram (c), and 3D structure of the synthetic peptide (d) between TMEM165 (top) and TMEM165-CLOCK fusion (bottom).
- the sequence starting with ATG in the middle of the TMEM165 sequence in the top image is indicated in bold for comparison with the TMEM165*CLOCK sequence in the bottom image.
- the TMEM165*CLOCK sequence in the bottom image can be divided into TEME165 on the left and CLOCK on the right based on the * symbol.
- Figure 4 is a diagram showing immunostaining of a sarcoma cell line overexpressing TMEM165-CLOCK using a TMEM165-CLOCK specific antibody.
- Figure 5 shows apoptosis (a) of a sarcoma cancer cell line overexpressing TMEM165-CLOCK using immune-activated PBMC cells and a TMEM165-CLOCK-specific antibody, and cells of a sarcoma cancer cell line overexpressing TMEM165-CLOCK using immune-activated NK cells and a TMEM165-CLOCK-specific antibody.
- This is a diagram showing death (b).
- Figure 6 shows cell proliferation of a: sarcoma cell line (KHOS/NP), b: TMEM165-CLOCK overexpression stabilization cell line (KHOS/NP_TMEM165-CLOCK), and c: lung cancer cell line (NCI-H1793) by treatment with TMEM165-CLOCK specific antibody.
- KHOS/NP sarcoma cell line
- TMEM165-CLOCK overexpression stabilization cell line
- NCI-H1793 lung cancer cell line
- Figure 7 is a diagram showing tumor growth inhibition in an experimental group (TMEM165-CLOCK Ab.) treated with a TMEM165-CLOCK specific antibody in a tumor-induced mouse model.
- a Mouse tumor comparison image
- b Quantification graph.
- TMEM165-CLOCK a significant fusion gene commonly expressed in various sarcoma tissues, based on approximately 30,000 human genes in a total of 54 tissues, including sarcoma and normal tissues.
- the fusion gene was a combination of the TMEM165 gene in the forward direction (5' ⁇ 3') and the CLOCK gene in the reverse direction. It was inferred that this gene could be used as a sarcoma-specific antigen and the sequence was analyzed.
- TMEM165-CLOCK (Fusion in Figure 3b) is identical to the amino acid sequence of Homo sapiens transmembrane protein 165 (TMEM165 in Figure 3a) with accession number NM_018475.5 reported to NCBI from positions 1 to 299, with differences in amino acid sequences from positions 300 to 321. It was confirmed that there is.
- the TMEM165-CLOCK (Fusion) sequence of FIG. 3b is indicated as SEQ ID NO: 3.
- the sequence GSFSPWLILHACSDGKGHLERN (SEQ ID NO: 1) of the terminal 300-321 aa of TMEM165-CLOCK was determined as an antigen-specific region, and a peptide was produced using it.
- the present invention provides a TMEM165-CLOCK antibody epitope containing the amino acid sequence represented by SEQ ID NO: 1.
- the TMEM165-CLOCK is of human origin, but is not limited thereto.
- the epitope may include a polypeptide consisting of the 300-321st amino acid sequence of the TMEM165-CLOCK protein shown in SEQ ID NO: 3.
- an “epitope” may be referred to as an epitope or an antigenic determinant, and is a specific part of an antigen that allows the immune system, such as antibodies, B cells, and T cells, to identify the antigen.
- an epitope refers to a set of amino acid residues in the antigen binding site recognized by a specific antibody, or in T cells, residues required for recognition by the T cell receptor protein and/or Major Histocompatibility Complex (MHC) receptor.
- MHC Major Histocompatibility Complex
- Epitopes according to the present invention are molecules that form a site recognized by antibodies, T cell receptors, or HLA molecules, and refer to primary, secondary, and tertiary peptide structures, or charges.
- isolated or purified protein or peptide molecules larger than the epitope of the present invention and containing the epitope of the present invention may be included within the scope of the present invention.
- the terms epitope or peptide may often be used interchangeably.
- the present invention can provide a polynucleotide encoding the epitope.
- the polynucleotide encoding the TMEM165-CLOCK epitope protein is interpreted as including a sequence showing substantial identity, considering mutations with biologically equivalent activity.
- the term 'substantial identity' means that when the sequence of the present invention and any other sequence are aligned to the maximum extent possible and the aligned sequence is analyzed using an algorithm commonly used in the art, the minimum It refers to a sequence that exhibits 60% homology, more specifically 70% homology, even more specifically 80% homology, and most specifically 90% homology.
- amino acid sequence having high homology to the sequence represented by SEQ ID NO: 1 for example, having a homology of 70% or more, specifically 80% or more, more specifically 90% or more, and the present invention
- Amino acid sequences that can equally function as TMEM165-CLOCK antibody epitopes should also be construed as falling within the scope of the present invention.
- a recombinant expression vector containing the polynucleotide and a transformant transformed with the vector can be provided.
- the present invention provides an antibody or antigen-binding fragment thereof that specifically binds to the TMEM165-CLOCK antibody epitope containing the amino acid sequence shown in SEQ ID NO: 1.
- the TMEM165-CLOCK antibody epitope is as described above.
- the 'antibody that specifically binds to the TMEM165-CLOCK antibody epitope' refers to an antibody that can specifically bind to and detect the TMEM165-CLOCK protein.
- the above antibodies may be used interchangeably with TMEM165-CLOCK specific antibodies, anti-TMEM165-CLOCK monoclonal antibodies, or TMEM165-CLOCK antibodies.
- the antibody or antigen-binding fragment thereof according to the present invention can preferably bind specifically to the 300-321st amino acid sequence of the TMEM165-CLOCK protein represented by SEQ ID NO: 3, that is, the amino acid sequence represented by SEQ ID NO: 1. Therefore, the antibody or antigen-binding fragment thereof according to the present invention can be used for the purpose of detecting or specifically targeting TMEM165-CLOCK.
- antibodies include not only whole antibodies but also functional fragments of antibody molecules that retain antigen-binding function.
- the functional fragment specifically include (i) a Fab fragment consisting of the variable region of the light chain (VL) and the variable region of the heavy chain (VH), the constant region of the light chain (CL), and the first constant region of the heavy chain (CH1); (ii) Fd fragment consisting of VH and CH1 domains; (iii) an Fv fragment consisting of the VL and VH domains of a single antibody; (iv) dAb fragment consisting of VH domain; (v) isolated CDR regions; (vi) F(ab')2 fragment, a bivalent fragment containing two linked Fab fragments; (vii) a single chain Fv molecule (scFv) linked by a peptide linker that joins the VH domain and the VL domain to form an antigen binding site; (viii) bispecific single-chain Fv dimers and (ix) diabodies, which are multi
- a full antibody has a structure of two full-length light chains and two full-length heavy chains, and each light chain is connected to the heavy chain by a disulfide bond.
- the antibodies include monoclonal antibodies, polyclonal antibodies, multispecific antibodies, human antibodies, humanized antibodies, chimeric antibodies, single chain Fvs (scFV), single chain antibodies, Fab fragments, F(ab') fragments, disulfide-linked Fvs (sdFV) ) and anti-idiotype (anti-Id) antibodies, and epitope-binding fragments of the above antibodies.
- the antibody or antigen-binding fragment is selected from the group consisting of Fab, Fd, Fab', dAb, F(ab'), F(ab')2, scFv, Fv, scFv dimer, diabody, and linear antibody. It may be one, but is not limited thereto.
- the term 'monoclonal antibody' is a term known in the art and refers to a highly specific antibody directed against a single antigenic site.
- Monoclonal antibodies are also called monoclonal antibodies, monoclonal antibodies, or monoclonal antibodies. Unlike polyclonal antibodies, which typically contain different antibodies directed against different epitopes (antigenic determinants), monoclonal antibodies are directed against a single determinant on an antigen.
- Monoclonal antibodies have the advantage of improving the selectivity and specificity of diagnostic and analytical methods using antigen-antibody binding, and also have the additional advantage of not being contaminated by other immunoglobulins because they are synthesized by hybridoma culture.
- the anti-TMEM165-CLOCK monoclonal antibody can be prepared through various methods known in the art. As an example, it may be manufactured by a chemical peptide synthesis method, or the gene encoding the monoclonal antibody may be amplified by PCR (polymerase chain reaction) or synthesized by a known method and then cloned into an expression vector and expressed. , it can also be produced using a hybridoma cell line derived from lymphocytes obtained by injecting the immunogen of the monoclonal antibody into an animal.
- PCR polymerase chain reaction
- TMEM165-CLOCK specific antibody was established using phage display technology.
- TMEM165-CLOCK a fusion gene confirmed to be commonly expressed in various sarcoma tissues, was cloned to purify the TMEM165-CLOCK protein, reacted with a human scFv antibody phage surface display library, and scFv-phage that specifically bound to TMEM165-CLOCK was extracted and E- Biopanning was performed to infect and amplify coli.
- 'Bio-panning' refers to the property of binding to target molecules such as antigens (viral envelope proteins), enzymes, and cell surface receptors from a phage library that displays peptides on the outer wall (coat) of the phage. This refers to the process of selecting only phages that express peptides on their surface. After performing this panning process, monoclonal antibodies were selected from the phage antibody group with high binding ability, and ELISA analysis was performed to select antibodies with excellent binding ability once more.
- target molecules such as antigens (viral envelope proteins), enzymes, and cell surface receptors from a phage library that displays peptides on the outer wall (coat) of the phage. This refers to the process of selecting only phages that express peptides on their surface. After performing this panning process, monoclonal antibodies were selected from the phage antibody group with high binding ability, and ELISA analysis was performed to select antibodies with excellent binding ability once more.
- the antibody according to the present invention is not limited thereto, but may include the amino acid sequence represented by SEQ ID NO: 2, and may preferably be a single chain antibody (scFv). Also, preferably, the antibody of the present invention may be a TMEM165-CLOCK-specific single chain antibody (scFv) containing the amino acid sequence shown in SEQ ID NO: 2 or an antigen-binding fragment thereof.
- scFv single chain antibody
- the 'scFv (single chain fragment variable)' refers to a single-chain antibody made by expressing only the variable region of an antibody through genetic recombination, and refers to a single-chain antibody in which the VH region and VL region of the antibody are connected by a short peptide chain.
- the term “scFv” is intended to include scFv fragments, including antigen-binding fragments, unless otherwise specified or understood from context. This is self-evident to those skilled in the art.
- the epitope, antibody, or antigen-binding fragment thereof according to the present invention may include not only the sequences described herein, but also biological equivalents thereof.
- additional changes can be made to the amino acid sequence of the antibody to further improve the binding affinity and/or other biological properties of the antibody.
- Such modifications include, for example, deletions, insertions and/or substitutions of amino acid sequence residues of the antibody. These amino acid mutations are made based on the relative similarity of amino acid side chain substitutions, such as hydrophobicity, hydrophilicity, charge, size, etc.
- arginine, lysine and histidine are all positively charged residues; Alanine, glycine and serine have similar sizes; It can be seen that phenylalanine, tryptophan and tyrosine have similar shapes. Therefore, based on these considerations, arginine, lysine and histidine; Alanine, glycine and serine; And phenylalanine, tryptophan, and tyrosine can be said to be biologically equivalent in function.
- the present invention relates to a polynucleotide encoding the amino acid of the antibody or antigen-binding fragment thereof, a recombinant expression vector containing the polynucleotide, and a transformant prepared by co-transforming the vector into a host cell. .
- polynucleotide encoding the antibody or antigen-binding fragment thereof is interpreted to also include sequences showing substantial identity as described above.
- the polynucleotide may preferably include a base sequence represented by SEQ ID NO: 4, and has at least 60% homology, more specifically 70% homology, with the base sequence represented by SEQ ID NO: 4, More specifically, it may mean a sequence showing 80% homology, most specifically 90% homology.
- the polynucleotide is the amino acid sequence of the light and heavy chains of the antibody expressed from the coding region due to codon degeneracy or in consideration of preferred codons in organisms intended to express the light and heavy chains of the antibody or fragments thereof.
- Various modifications may be made to the coding region within the scope of not changing the coding region, and various modifications or modifications may be made to parts other than the coding region within the scope of not affecting the expression of the gene, and such modified genes are also included in the present invention. Those skilled in the art will be able to understand what is included in the scope.
- nucleic acid bases may be mutated by substitution, deletion, insertion, or a combination thereof, and these are also included within the scope of the present invention.
- sequence of these polynucleotides may be single or double stranded and may be DNA molecules or RNA (mRNA) molecules.
- expression control sequences such as promoters, terminators, enhancers, etc., sequences for membrane targeting or secretion, etc. are added depending on the type of host cell in which the antibody is to be produced. It can be selected appropriately and combined in various ways depending on the purpose.
- Expression vectors according to the present invention include, but are not limited to, plasmid vectors, cosmid vectors, bacteriophage vectors, viral vectors, etc.
- a suitable expression vector includes expression control elements such as a promoter, operator, start codon, stop codon, polyadenylation signal, and enhancer, as well as a signal sequence or leader sequence for membrane targeting or secretion, and can be prepared in various ways depending on the purpose.
- the promoter of an expression vector can be constitutive or inducible.
- the signal sequence includes the PhoA signal sequence and OmpA signal sequence when the host is Escherichia sp., and the ⁇ -amylase signal sequence and subtilisin signal when the host is Bacillus sp.
- the host is yeast
- the MF ⁇ signal sequence, SUC2 signal sequence, etc. can be used
- the host is an animal cell
- the insulin signal sequence, ⁇ -interferon signal sequence, antibody molecule signal sequence, etc. can be used. It is not limited to this.
- the expression vector may include a selection marker for selecting host cells containing the vector, and, if it is a replicable expression vector, may include an origin of replication.
- the antibody according to the present invention can be mass-produced by transforming the expression vector according to the present invention into an appropriate host cell, such as an E. coli or yeast cell, and then culturing the transformed host cells.
- an appropriate host cell such as an E. coli or yeast cell
- Appropriate culture methods and medium conditions depending on the type of host cell can be easily selected by a person skilled in the art from known techniques known to those skilled in the art.
- the host cell may be a prokaryote such as E. coli or Bacillus subtilis . Additionally, it may be a eukaryotic cell derived from yeast, insect cells, plant cells, or animal cells such as Saccharomyces cerevisiae . More preferably, the animal cells may be autologous or allogeneic animal cells. Transformants produced by introduction into autologous or allogeneic animal cells may be administered to an individual and used in cell therapy to treat cancer. Any method known to those skilled in the art may be used to introduce the expression vector into the host cell.
- the present invention relates to a composition for diagnosing cancer, comprising the TMEM165-CLOCK specific antibody or antigen-binding fragment thereof.
- the composition contains the TMEM165-CLOCK antibody represented by SEQ ID NO: 3, and the occurrence of cancer can be diagnosed by analyzing the signal shown by the reaction between the sample and the antibody. Specifically, cancer can be diagnosed through the process of confirming the formation of a complex of the TMEM165-CLOCK antibody epitope and a monoclonal antibody or antigen-binding fragment thereof according to the present invention that specifically binds to it, that is, an antigen-antibody complex. .
- the signal may include, but is not limited to, an enzyme bound to an antibody, such as alkaline phosphatase, ⁇ -galactosidase, horse radish peroxidase, luciferase, or cytochrome P450.
- an enzyme bound to an antibody such as alkaline phosphatase, ⁇ -galactosidase, horse radish peroxidase, luciferase, or cytochrome P450.
- the formation of the antigen-antibody complex can be measured according to conventional immunoassay methods, such as ELISA (enzyme linked immunosorbent assay) using an antibody against the TMEM165-CLOCK protein, immunoblotting, western blotting, Detection and measurement may be performed through immunohistochemistry or FACS (Fluorescence-activated cell sorting), but is not limited thereto.
- immunoassay methods such as ELISA (enzyme linked immunosorbent assay) using an antibody against the TMEM165-CLOCK protein, immunoblotting, western blotting, Detection and measurement may be performed through immunohistochemistry or FACS (Fluorescence-activated cell sorting), but is not limited thereto.
- the presence or absence of cancer can be diagnosed.
- the TMEM165-CLOCK protein of the present invention is overexpressed in a sample isolated from a suspected individual and the signal is stronger than that of a sample isolated from a normal individual, cancer can be diagnosed.
- the cancer may be one or more types selected from the group consisting of stomach cancer, colon cancer, kidney cancer, blood cancer, sarcoma cancer, ovarian cancer, breast cancer, cervical cancer, thyroid cancer, prostate cancer, pancreatic cancer, liver cancer, and lung cancer.
- TMEM165-CLOCK specific expression of the fusion gene TMEM165-CLOCK was confirmed in various sarcoma cancer tissues such as dermatofibrosarcoma, liposarcoma, undifferentiated pleomorphic sarcoma, and osteochondroma, and in addition to sarcoma cancer, breast cancer, prostate cancer, and lung cancer.
- sarcoma cancer tissues such as dermatofibrosarcoma, liposarcoma, undifferentiated pleomorphic sarcoma, and osteochondroma
- TMEM165-CLOCK As the high expression of TMEM165-CLOCK was confirmed in the cell line, it was confirmed that the fusion gene TMEM165-CLOCK can be presented as a molecular marker for cancer cells.
- the occurrence of cancer can be diagnosed by measuring the level of formation of the antigen-antibody complex in a sample of a patient suspected of having cancer using the TMEM165_CLOCK specific antibody according to the present invention.
- ICC immunochemical staining
- TMEM165_CLOCK-specific antibody was performed to evaluate the TMEM165-CLOCK-specific antibody-antigen affinity for the normal cell line and the sarcoma cancer cell line KHOS/NP
- green color was found only in the KHOS/NP cell line. It was confirmed that fluorescent staining was observed, suggesting that the TMEM165-CLOCK specific antibody according to the present invention can detect the cancer cell molecular marker TMEM165_CLOCK, and that sarcoma cancer can be diagnosed through this.
- the present invention relates to a method for diagnosing cancer, comprising reacting the TMEM165-CLOCK specific antibody or antigen-binding fragment thereof with a target sample.
- the cancer may be one or more types selected from the group consisting of stomach cancer, colon cancer, kidney cancer, blood cancer, sarcoma cancer, ovarian cancer, breast cancer, cervical cancer, thyroid cancer, prostate cancer, pancreatic cancer, liver cancer, and lung cancer, but is not limited thereto. .
- the present invention relates to a composition for preventing or treating cancer, comprising a TMEM165-CLOCK specific antibody or an antigen-binding fragment thereof.
- the cancer may be one or more types selected from the group consisting of stomach cancer, colon cancer, kidney cancer, blood cancer, sarcoma cancer, ovarian cancer, breast cancer, cervical cancer, thyroid cancer, prostate cancer, pancreatic cancer, liver cancer, and lung cancer, but is not limited thereto. .
- composition according to the present invention may further include PBMC cells or NK cells.
- the TMEM165-CLOCK specific antibody or antigen-binding fragment thereof of the present invention can induce more effective cancer cell death by increasing the immunity of immune cells, and can be particularly effectively used in the treatment of cancer in which TMEM165-CLOCK is overexpressed. Therefore, when the TMEM165-CLOCK specific antibody or antigen-binding fragment thereof of the present invention is treated with cancer cells together with an immunotherapeutic agent, such as PBMC cells or NK cells, a more effective cancer prevention or treatment effect can be achieved.
- an immunotherapeutic agent such as PBMC cells or NK cells
- TMEM165-CLOCK is overexpressed in cancer cells or cancer tissues, and inhibition of TMEM165-CLOCK using the TMEM165-CLOCK antibody or fragment thereof according to the present invention can be usefully used to inhibit cancer. .
- fluorescence flow cytometry using a TMEM165_CLOCK-specific antibody with PBMC cells with increased antibody-specific immunity
- luciferase activity analysis using a TMEM165_CLOCK-specific antibody with NK cells with increased antibody-specific immunity (luciferase activity assay) activity
- FACS fluorescence flow cytometry
- TMEM165_CLOCK-specific antibody was treated with a TMEM165_CLOCK-specific antibody in mice intratibially injected with a stabilized cell line overexpressing TMEM165-CLOCK, the increase in tumor size was suppressed.
- the TMEM165_CLOCK-specific antibody of the present invention exhibits a therapeutic effect through a TMEM165_CLOCK-specific expression cell line and animal experiments using the same, and the cell proliferation inhibition and killing effects on sarcoma or lung cancer cell lines were confirmed by confirming the TMEM165_CLOCK-specific antibody of the present invention.
- the carcinoma may be one or more types selected from the group consisting of stomach cancer, colon cancer, kidney cancer, hematological cancer, sarcoma cancer, ovarian cancer, breast cancer, cervical cancer, thyroid cancer, prostate cancer, pancreatic cancer, liver cancer, and lung cancer.
- the composition for preventing or treating cancer may further include pharmaceutically acceptable additives.
- the pharmaceutically acceptable additives include starch, gelatinized starch, microcrystalline cellulose, lactose, povidone, colloidal silicon dioxide, and phosphoric acid.
- Aluminum, calcium stearate, white sugar, dextrose, sorbitol, and talc can be used.
- the pharmaceutically acceptable additive according to the present invention is preferably included in an amount of 0.1 to 90 parts by weight based on the composition, but is not limited thereto.
- composition according to the present invention can be administered in various oral and parenteral formulations during actual clinical administration.
- diluents or excipients such as commonly used fillers, extenders, binders, wetting agents, disintegrants, and surfactants are used. It can be prepared using.
- Solid preparations for oral administration include tablets, pills, powders, granules, capsules, etc. These solid preparations include lignified extract and at least one excipient, such as starch, calcium carbonate, and sucrose. It can be prepared by mixing lactose or gelatin. Additionally, in addition to simple excipients, lubricants such as magnesium styrate talc may also be used.
- Liquid preparations for oral use include suspensions, oral solutions, emulsions, and syrups.
- various excipients such as wetting agents, sweeteners, fragrances, and preservatives may be included.
- Formulations for parenteral administration may include sterile aqueous solutions, non-aqueous solvents, suspensions, emulsions, lyophilized formulations, and suppositories.
- Non-aqueous solvents and suspension solvents include propylene glycol, polyethylene glycol, vegetable oil such as olive oil, and injectable esters such as ethyl oleate.
- a base for suppositories witepsol, macrogol, tween 61, cacao, laurin, glycerogeratin, etc. can be used.
- composition according to the present invention can be administered orally or parenterally according to the desired method.
- parenterally it is administered externally to the skin or intraperitoneally, intrarectally, subcutaneously, intravenously, intramuscularly, or intrathoracically. It is desirable to select the injection method.
- the dosage range varies depending on the patient's weight, age, gender, health condition, diet, administration time, administration method, excretion rate, and severity of the disease.
- the dosage of the composition varies depending on the patient's weight, age, gender, health condition, diet, administration time, administration method, excretion rate, and severity of the disease, and the daily dosage is 0.0001 based on the amount of lignified extract. to 100 mg/kg, preferably 0.001 to 10 mg/kg, and may be administered 1 to 6 times a day.
- the antibody according to the present invention can be used alone or in combination with surgery, hormone therapy, drug therapy, and biological response regulators for the treatment of cancer patients.
- Subjects to which the present invention can be applied are vertebrates, preferably mammals including humans.
- the present invention relates to a method of treating cancer comprising administering a TMEM165-CLOCK specific antibody or antigen-binding fragment thereof to a subject.
- Example 1 TMEM165-CLOCK fusion gene screening and expression confirmation
- TMEM165-CLOCK fusion gene was expressed in 9 (20%) sarcoma tissues and was not expressed at all in 9 normal tissues, and TMEM165-CLOCK was found to be expressed in sarcoma tissues. It was predicted that specific new substances (new proteins) would be expressed.
- TMEM165-CLOCK could be used as a marker for diagnosing sarcoma cancer, and PCR was performed on various types of sarcoma tissues to confirm the expression of the TMEM165-CLOCK fusion gene. Forward and reverse primers were prepared (Bionics, Seoul, Korea) to include the fusion junction section of the TMEM165-CLOCK fusion gene and used in the PCR reaction.
- PCR primer F GCTCTTACATTAACATTCT (SEQ ID NO: 5),
- Figure 1 shows the expression levels of TMEM165-CLOCK in normal cells and various sarcoma tissues. Looking at the top image of Figure 1, when compared to normal tissue (lane 1 and lane 2), the TMEM165-CLOCK fusion gene was significantly expressed in dermatofibrosarcoma protuberans (lane 3) and undifferentiated pleomorphic sarcoma (UPS) tissue in lane 4. You can see that it is happening.
- lane 3 dermatofibrosarcoma protuberans
- UPS undifferentiated pleomorphic sarcoma
- dermatofibrosarcoma protuberans in lane 1 low-grade liposarcoma in lane 2, undifferentiated pleomorphic sarcoma (UPS) in lane 3, and giant cell tumor (Giant) in lane 4.
- UPS undifferentiated pleomorphic sarcoma
- Giant giant cell tumor
- TMEM165-CLOCK fusion gene is expressed in various sarcoma cancers such as dermatofibrosarcoma, liposarcoma, undifferentiated pleomorphic sarcoma, and osteochondroma.
- PCR reaction was performed in the same manner as in Example 1-2 to confirm the expression level of the TMEM165-CLOCK fusion gene in various cancer cell lines, including sarcoma.
- the TMEM165-CLOCK fusion gene is highly expressed in sarcoma cancer, prostate cancer, breast cancer, and lung cancer, and that an agent capable of detecting these genes can diagnose the carcinomas.
- TMEM165-CLOCK a target antigen was prepared.
- the TMEM165 gene was transcribed in the forward direction (5' ⁇ 3'), and the CLOCK gene was transcribed in the reverse direction, and the sequences of the combined TMEM165-CLOCK fusion genes were aligned.
- TMEM165 300-321 aa GSFSPWLILHACSDGKGHLERN (SEQ ID NO: 1)
- the peptide sequence 'GSFSPWLILHACSDGKGHLERN (SEQ ID NO: 1)' was synthesized starting from the C-terminus using a solid phase peptide synthesis method.
- BSA carrier proteins
- KLH carrier proteins
- phage displaying a single-chain variable fragment (scFv) antibody library was constructed, and biopanning was performed on the epitope synthesized in Example 2.
- scFv single-chain variable fragment
- the synthesized peptide sequence 'GSFSPWLILHACSDGKGHLERN (SEQ ID NO: 1)' was used as an antigen, and phages from the antibody library were incubated with immobilized targets, and then phages that did not bind to the antigen were filtered out. Once a clone pool binding to the antigen was formed, phages showing high affinity were extracted and single colonies were identified and inoculated respectively. Since the extracted phages were cultured with E. coli host cells for infection and amplification, colonies of infected bacteria were cultured on plates. ELISA was performed on the monoclonal scFv produced in each colony using the above epitope, and positive clones with an OD value of 1.0 or higher were selected.
- Sequence analysis was performed using the 5'-, 3'-oligonucleotides of the scFv obtained from the Phagemid DNA of the monoclonal antibody prepared from the selected clones.
- the final sequence of the scFv was identified by combining the common regions of the sequences read in both directions (ABI3730XL, Sanger-method sequencing, Phred Score ⁇ 20), and the TMEM165_CLOCK antibody sequence represented by SEQ ID NO. 2 below was established.
- Anti- TMEM165_CLOCK scFv polypeptide (SEQ ID NO: 2): ELELTQPPSVSAAPGQEVTISCSGGNSNLGKNAASWYQQVPGTAPKLLIYDNNKRPSGIPDRFSGSKSGTSATLGITGLQTGDEADYYCGTWDSRLRGWVFGGGTQLTVLGGGSSRSSSSSGGGGSGGGGQVQLQESGGGGLVQPGRSLRLSCTASGFTFG DYAMSWVRQAPGKGLEWVGFIRSKAYGGTTEYAASVKGRFTISRDDSKSIAYLQMNSLKTEDTAVYYCTRSARRSSLNSGYFDYWGQGTLVTVSSASPTSPKVTSG
- Immunochemical staining using the TMEM165_CLOCK antibody prepared in Example 3 was performed to evaluate TMEM165-CLOCK specific antibody-antigen affinity.
- human umbilical vein endothelial cells HUVEC cells 2.5 Add 1 ⁇ g of TMEM165-CLOCK plasmid DNA and 1 ⁇ l of Plus reagent to 75 ⁇ l of opti-MEM medium (Gibco), and add 4 ⁇ l of Lipofectamine LTX (Invitrogen, USA) to 75 ⁇ l of opti-MEM medium (Gibco). After mixing and reacting for 20 minutes, it was treated with KHOS/NP cells and cultured at 37°C incubation, and the medium was replaced after 4 hours. Then, after culturing at 37°C for 48 hours, the cells were fixed for 10 minutes at RT using 4% paraformaldehyde and washed three times with PBS.
- the cells were permeabilized for 10 minutes at RT using 0.5% Tx-100 and washed three times with PBS.
- the antibody was treated at a concentration of 5 ⁇ g/ml, reacted at RT for 3-4 hours, and washed three times with PBS.
- the secondary antibody Alexa fluor 488 goat anti-human IgG, Invitrogen, USA was reacted at a ratio of 1:500 for 1 hour at RT, washed three times with PBS, and mounted by dropping a mounting solution containing DAPI. Next, cells were observed through a confocal microscope.
- the HUVEC cell on the left is a normal cell line without expression of the TMEM165_CLOCK fusion gene
- the KHOS/NP cell line in the middle is a sarcoma cancer cell line expressing the TMEM165_CLOCK fusion gene
- the cell line on the right is a cell line that overexpresses the TMEM165_CLOCK fusion gene in the KHOS/NP cell line.
- Example 5 Inhibition of cancer cells using TMEM165-CLOCK specific antibody
- TMEM165-CLOCK-specific antibody prepared in Example 3 increased the antibody-specific immunity of PBMC cells and specifically destroyed TMEM165_CLOCK-expressing cancer cells. .
- KHOS/NP_control_luc control group
- KHOS/NP_TMEM165-CLOCK_luc experimental group cells
- EMEM medium, hyclone overexpressing the TMEM165_CLOCK fusion gene in the sarcoma cancer cell line
- CFSE dojindo, Japan
- Control group KHOS/NP_control_luc and experimental group KHOS/ NP_TMEM165 -CLOCK_luc cells were inoculated into 3 Dishes treated with a concentration of 0.1 ⁇ g/ml and dishes not treated with TMEM165-CLOCK specific antibody were cultured overnight at 37°C.
- FVD Fluorescence-Activated Cell Sorting
- Example 3 Whether the TMEM165-CLOCK specific antibody prepared in Example 3 could increase the antibody-specific immunity of NK cells was confirmed, and cell viability was confirmed through luciferase activity.
- KHOS/NP_TMEM165-CLOCK_luc cells which overexpressed the TMEM165_CLOCK fusion gene in a sarcoma cell line, were inoculated at 1 x 10 4 cells/96 well plate.
- NK-92 cells MyeloCult H5100 mdeia, Stemcell Technologies, Canada
- TMEM165-CLOCK specific antibody A 96 well plate without antibody treatment was incubated overnight at 37°C. Then, cells were harvested and luciferase activity was measured (promega, USA).
- Sarcoma cell line (KHOS/NP), TMEM165-CLOCK overexpression stabilization cell line (KHOS/NP_TMEM165-CLOCK), and lung cancer cell line (NCI-H1793) were seeded at 3 x 10 3 cells/96 well, and after 24 hours, TMEM165-CLOCK MTS assay was performed by treating specific antibodies at a concentration of 50 ⁇ g/ml.
- sarcoma cell line KHOS/NP
- TMEM165-CLOCK overexpression stabilization cell line KHOS/NP_TMEM165-CLOCK
- lung cancer cell line NCI-H1793
- the TMEM165-CLOCK specific antibody according to the present invention not only inhibits proliferation and induces death of sarcoma and lung cancer cells, but also inhibits the growth of TMEM165-CLOCK overexpressing cells, thereby treating cancer cells with TMEM165-CLOCK overexpression. It was confirmed that it can show practical usefulness.
- Example 6 Tumor inhibition using TMEM165-CLOCK specific antibody
- the antitumor effect of the TMEM165-CLOCK specific antibody prepared in Example 3 was investigated in vivo.
- the TMEM165-CLOCK overexpressing stable cell line was injected into the tibia bone at 1 x 10 5 cells/mouse in 6-week-old balb/c-nude mice.
- the control group (Control) was injected with 1 The sizes of tumors were compared.
- Example 6 demonstrated that the TMEM165-CLOCK specific antibody according to the present invention exhibits a direct antitumor effect on carcinomas with TMEM165-CLOCK overexpression.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Immunology (AREA)
- Organic Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Molecular Biology (AREA)
- Engineering & Computer Science (AREA)
- Biochemistry (AREA)
- Urology & Nephrology (AREA)
- Animal Behavior & Ethology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Microbiology (AREA)
- Genetics & Genomics (AREA)
- Biophysics (AREA)
- Hematology (AREA)
- Cell Biology (AREA)
- Biomedical Technology (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Pharmacology & Pharmacy (AREA)
- General Physics & Mathematics (AREA)
- Epidemiology (AREA)
- Mycology (AREA)
- Pathology (AREA)
- Toxicology (AREA)
- Zoology (AREA)
- Gastroenterology & Hepatology (AREA)
- Analytical Chemistry (AREA)
- Physics & Mathematics (AREA)
- Food Science & Technology (AREA)
- Biotechnology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Peptides Or Proteins (AREA)
Abstract
본 발명은 TMEM165-CLOCK 항체 에피토프 및 이에 특이적으로 결합하는 항체 또는 이의 항원 결합 단편, 상기 항체 또는 이의 항원 결합 단편을 포함하는 암의 진단, 예방 또는 치료용 조성물에 관한 것이다. 본 발명에 따른 TMEM165-CLOCK 항체 에피토프는 암세포 특이 발현 융합유전자 TMEM165-CLOCK로부터 확인한 신규한 서열의 항원 결합 부위이며, 이에 대한 항체는 TMEM165-CLOCK에 결합력이 높음을 확인하였으므로, TMEM165-CLOCK의 발현과 관련된 질환인 암의 진단, 예방 또는 치료에 유용하게 이용할 수 있다.
Description
본 발명은 TMEM165-CLOCK 항체 에피토프 및 이에 특이적으로 결합하는 항체 또는 이의 항원 결합 단편; 및 상기 항체 또는 이의 항원 결합 단편을 포함하는 암의 진단, 예방 또는 치료용 조성물에 관한 것이다.
현재까지 암 진단 방법은 조직 샘플의 채취 및 내시경 검사와 같은 침습적인 방법으로 이루어지고 있다. 특히, 조직검사는 질병이 의심되는 부위의 일부를 적출해 현미경으로 관찰하는 방식으로 이루어지고 있다. 따라서, 조직 샘플을 채취하기 위해 침이나 펀치, 내시경 또는 복강경을 이용하기 위해서는, 인체를 절개하여야 하므로, 환자가 느끼는 불편함이 적지 않을 뿐 아니라 흉터가 남고 회복하는데 오랜 시간이 걸린다.
또한, 현재까지 진행되고 있는 암의 치료는 대부분 수술로써 병소를 절제해 내는 것이며, 특히 완치를 목표로 하는 경우 외과적인 절제방법이 유일하다. 이러한 외과적 절제에 있어, 완치를 목표로 하는 수술에서는 가능한 한 넓은 범위를 포함하여 절제하는 것이 원칙이나 수술 후 광범위한 절제로 인한 후유증을 고려하여 그 절제 범위를 정하기도 한다. 다만 이러한 경우에도 암이 다른 장기에 전이되었을 경우에는 근치수술이 불가능하며, 따라서 이 때에는 항암제투여 등 다른 방법을 택하게 되는데 현재까지 시판되고 있는 항암제는 일시적인 증상의 완화나 절제술 후 재발의 억제와 생존기간을 연장하는 일시적 효과만 있을 뿐, 근본적인 암의 치료에 있어서는 한계가 있고, 항암제 투여에 따른 부작용 및 경제적 부담으로 환자에게 이중적 고통을 주기도 한다.
따라서 암을 치료하기 위해서는, 치료 이전의 단계에서 높은 민감도와 특이도를 가진 암의 진단 방법의 개발이 무엇보다 중요하며, 이러한 진단은 암의 초기에 발견될 수 있는 것이어야 한다. 나아가 구체적 암에 대한 예후를 예측하여 맞춤형 진단 및 치료가 요구되고 있다.
한편, 암 유전자 변이는 염색체 전좌(chromosomal translocation)에 의해 일어나며, 이는 서로 다른 유전자가 융합되어 발현되는 융합 유전자(fusion gene)의 발생을 야기시킨다. 즉, 융합유전자는 염색체 재배열(전좌, 삭제, 역위), trans-splicing, read-through event에 의해 형성되는 하이브리드 유전자이다. 융합유전자는 다양한 종양의 발생 및 활성 기전에 관련이 있다고 알려져 있다. 또한, 같은 암종이라고 하더라도 환자마다 암의 다양성 (tumor heterogeneity)을 가지는데 융합유전자는 개인별 맞춤치료를 위한 암의 다양성을 구분하는 기준을 제시함으로써 분자표적 약물을 개발하는데 도움이 될 수 있다. 따라서, 융합유전자의 특정 발현은 암을 예측하고 진단하거나 암의 치료에 있어 효과적인 예후 예측용 표지자로서 유용한 정보로 사용될 수 있다.
본 발명자들은 피부섬유육종, 지방 육종, 미분화다형성 육종, 골연골종과 같은 다양한 육종암 조직에서 융합유전자 TMEM165-CLOCK의 특이 발현을 확인하였으며, 육종암 외 유방암, 전립선암, 폐암 세포주에서 TMEM165-CLOCK의 높은 발현이 확인됨에 따라 상기 융합유전자 TMEM165-CLOCK를 암세포 분자표지로 제시할 수 있음을 확인하였다. 이에 TMEM165-CLOCK의 신규한 서열을 이용하여 에피토프 및 이에 특이적으로 결합하는 항체를 제작하고 일실시예를 통해 상기 TMEM165-CLOCK 특이 항체를 이용하여 암의 진단, 예방 또는 치료 용도로 활용할 수 있음을 확인하였다.
이에 본 발명의 과제는 서열번호 1로 표시되는 아미노산 서열을 포함하는 TMEM165-CLOCK 항체 에피토프 및 이에 특이적으로 결합하는 항체 또는 이의 항원 결합 단편을 제공하는 것이다.
또 다른 과제는 TMEM165-CLOCK 특이 항체 또는 이의 항원 결합 단편을 포함하는 암의 진단용 조성물 및 암의 예방 또는 치료용 조성물을 제공하는 것이다.
또 다른 과제는 TMEM165-CLOCK 특이 항체 또는 이의 항원 결합 단편을 목적하는 시료와 반응시키는 단계;를 포함하는, 암 진단 방법을 제공하는 것이다.
또 다른 과제는 TMEM165-CLOCK 특이 항체 또는 이의 항원 결합 단편을 개체에 투여하는 단계;를 포함하는 암의 치료 방법을 제공하는 것이다.
본 발명은 서열번호 1로 표시되는 아미노산 서열을 포함하는 TMEM165-CLOCK 항체 에피토프를 제공한다.
상기 에피토프는 서열번호 3으로 표시되는 TMEM165 단백질의 300-321번째 아미노산 서열로 이루어진 폴리펩타이드를 포함할 수 있다.
또한 본 발명은 서열번호 1로 표시되는 아미노산 서열을 포함하는 TMEM165-CLOCK 항체 에피토프에 특이적으로 결합하는, 항체 또는 이의 항원 결합 단편을 제공한다.
상기 항체 또는 항원 결합 단편은 Fab, Fd, Fab', dAb, F(ab'), F(ab')2, scFv, Fv, scFv 이량체, 디아바디(diabody) 및 선형 항체로 이루어진 군으로부터 선택되는 것일 수 있다.
상기 항체는 서열번호 2로 표시되는 아미노산 서열을 포함할 수 있다.
상기 항체는 단일쇄 항체(scFv)일 수 있다.
또한 본 발명은 서열번호 2로 표시되는 아미노산 서열을 포함하는 TMEM165-CLOCK 특이적 단일쇄 항체(scFv) 또는 이의 항원 결합 단편을 제공한다.
또한 본 발명은 상기 항체 또는 이의 항원 결합 단편을 암호화하는 폴리뉴클레오티드를 제공한다.
또한 본 발명은 상기 폴리뉴클레오티드를 포함하는 재조합 발현 벡터를 제공한다.
또한 본 발명은 상기 벡터로 형질전환된 형질전환체를 제공한다.
또한 본 발명은 상기 항체 또는 이의 항원 결합 단편을 포함하는, 암의 진단용 조성물을 제공한다.
상기 암은 위암, 대장암, 신장암, 혈액암, 육종암, 난소암, 유방암, 자궁경부암, 갑상선암, 전립선암, 췌장암, 간암 및 폐암으로 이루어진 군에서 선택되는 1종 이상일 수 있다.
또한 본 발명은 상기 항체 또는 이의 항원 결합 단편을 포함하는, 암의 예방 또는 치료용 조성물을 제공한다.
상기 암은 위암, 대장암, 신장암, 혈액암, 육종암, 난소암, 유방암, 자궁경부암, 갑상선암, 전립선암, 췌장암, 간암 및 폐암으로 이루어진 군에서 선택되는 1종 이상일 수 있다.
상기 조성물은 PBMC 세포 또는 NK 세포를 더 포함할 수 있다.
또한 본 발명은 상기 항체 또는 이의 항원 결합 단편을 목적하는 시료와 반응시키는 단계;를 포함하는, 암 진단 방법을 제공한다.
상기 암은 위암, 대장암, 신장암, 혈액암, 육종암, 난소암, 유방암, 자궁경부암, 갑상선암, 전립선암, 췌장암, 간암 및 폐암으로 이루어진 군에서 선택되는 1종 이상일 수 있다.
또한 본 발명은 상기 항체 또는 이의 항원 결합 단편을 개체에 투여하는 단계;를 포함하는 암의 치료 방법을 제공한다.
본 발명에 따른 TMEM165-CLOCK 항체 에피토프는 암세포 특이 발현 융합유전자 TMEM165-CLOCK로부터 확인한 신규한 서열의 항원 결합 부위이며, 이에 대한 항체는 TMEM165-CLOCK에 결합력이 높음을 확인하였으므로, TMEM165-CLOCK의 발현과 관련된 질환인 암의 진단, 예방 또는 치료에 유용하게 이용할 수 있다.
도 1은 정상 세포와 다양한 육종 조직에서의 TMEM165-CLOCK 발현 수준을 나타낸 도이다. 상단이미지 - 레인 1 및 2: 정상 조직, 레인 3: 피부섬유육종(DFSP; Dermatofibrosarcoma protuberans), 레인 4: 미분화다형성육종(UPS; Undifferentiated pleomorphic sarcoma), 하단이미지 - 레인 1: 피부섬유육종(DFSP; Dermatofibrosarcoma protuberans), 레인 2: 지방육종(Low-grade liposarcoma), 레인 3: 미분화다형성육종(UPS; Undifferentiated pleomorphic sarcoma), 레인 4: 거대세포종양(Giant cell tumor), 레인 5: 골연골종(Osteochondroma).
도 2는 육종암 외 암세포에서의 TMEM165-CLOCK 발현 수준을 나타낸 도이다. 레인 1: NCI-H1299, 레인 2: NCI-H1437, 레인 3: NCI-H1793, 레인 4: HCC827, 레인 5: NCI-H23.
도 3은 TMEM165(상단) 및 TMEM165-CLOCK fusion(하단)의 염기서열 차이(a), 아미노산 서열 차이(b), TMEM165-CLOCK 단백질 개략도(c), 합성 펩타이드의 3D 구조(d)를 나타낸 도이다. 도 3A에서, 하단 이미지의 TMEM165*CLOCK 서열과 비교하기 위해 상단 이미지의 TMEM165 서열 중간 부분의 ATG로 시작되는 서열을 볼드체로 표시하였다. 하단 이미지의 TMEM165*CLOCK 서열은 * 기호를 기준으로 좌측은 TEME165, 우측은 CLOCK 서열로 구분될 수 있다.
도 4는 TMEM165-CLOCK 특이 항체를 이용한 TMEM165-CLOCK 과발현 육종암 세포주의 면역염색발광을 나타낸 도이다.
도 5는 면역활성화 PBMC 세포 및 TMEM165-CLOCK 특이 항체를 이용한 TMEM165-CLOCK 과발현 육종암 세포주의 세포사멸(a) 및 면역활성화 NK 세포 및 TMEM165-CLOCK 특이 항체를 이용한 TMEM165-CLOCK 과발현 육종암 세포주의 세포사멸(b)을 나타낸 도이다.
도 6은 TMEM165-CLOCK 특이 항체 처리에 의한 a: 육종암 세포주(KHOS/NP), b: TMEM165-CLOCK 과발현 안정화 세포주(KHOS/NP_TMEM165-CLOCK) 및 c: 폐암 세포주(NCI-H1793)의 세포 증식(cell proliferation) 억제를 나타낸 도이다.
도 7은 종양이 유도된 마우스 모델에 TMEM165-CLOCK 특이 항체를 처리한 실험군(TMEM165-CLOCK Ab.)의 종양 성장 억제를 나타낸 도이다. a:마우스 종양 비교 이미지, b: 정량화 그래프.
본 발명자들은 육종암, 정상 조직을 포함하여 총 54개의 조직으로 약 3만개의 인간 유전자를 토대로 다양한 육종암 조직에서 공통적으로 발현되는 유의한 융합유전자 TMEM165-CLOCK을 발굴하였다.
상기 융합유전자는 TMEM165 유전자가 정방향(5'→3'), CLOCK 유전자가 역방향으로 결합한 형태였으며 이 유전자를 육종암 특이적 항원으로 이용할 수 있음을 유추하고 서열을 분석하였다.
TMEM165-CLOCK(도 3b의 Fusion)은 NCBI에 보고된 등록번호 NM_018475.5의 Homo sapiens transmembrane protein 165(도 3a의 TMEM165)의 아미노산 서열과 1-299번째까지 동일하였고 300-321번째 아미노산 서열에 차이가 있음을 확인하였다. 본 명세서에서 상기 도 3b의 TMEM165-CLOCK(Fusion) 서열을 서열번호 3으로 표시하였다. 상기 TMEM165-CLOCK의 말단 300-321 aa의 서열 GSFSPWLILHACSDGKGHLERN(서열번호 1)을 항원특정부위로 결정하고 이를 이용하여 펩타이드 제작을 하였다.
본 발명은 서열번호 1로 표시되는 아미노산 서열을 포함하는 TMEM165-CLOCK 항체 에피토프를 제공한다.
상기 TMEM165-CLOCK은 인간 유래인 것이나, 이에 제한되지 않는다. 구체적으로 상기 에피토프는 서열번호 3으로 표시되는 TMEM165-CLOCK 단백질의 300-321번째 아미노산 서열로 이루어진 폴리펩타이드를 포함할 수 있다.
본 발명에서 "에피토프(Epitope)"는 항원결정기 또는 항원 결정 부위(antigenic determinant)로 칭할 수 있으며 항체, B 세포, T 세포 등의 면역계가 항원을 식별하게 해주는 항원의 특정한 부분이다. 구체적으로 에피토프는 특정 항체에 의해 인식되는 항원결합부위의 아미노산 잔기 세트, 또는 T 세포에서는 T 세포 수용체 단백질 및/또는 주요 조직적합성 복합체(Major Histocompatibility Complex, MHC) 수용체에 의한 인식에 필요한 잔기를 의미한다. 본 발명에 따른 에피토프는 항체, T 세포 수용체 또는 HLA 분자에 의해 인식되는 부위를 형성하는 분자로, 일차, 이차 및 삼차 펩타이드 구조, 또는 전하를 의미한다. 또한 본 발명의 에피토프보다 크며 본 발명의 에피토프를 포함하는 단리 또는 정제된 단백질 또는 펩타이드 분자는 본 발명의 범위에 포함될 수 있다. 본 발명에서 용어 에피토프 또는 펩타이드는 종종 혼용되어 사용될 수 있다.
본 발명은 상기 에피토프를 암호화하는 폴리뉴클레오티드를 제공할 수 있다. 구체적으로 상기 TMEM165-CLOCK 에피토프 단백질을 암호화하는 폴리뉴클레오티드는 생물학적으로 균등 활성을 갖는 변이를 고려한다면, 실질적인 동일성(substantial identity)을 나타내는 서열도 포함하는 것으로 해석된다. 상기 용어, '실질적인 동일성'은 본 발명의 서열과 임의의 다른 서열을 최대한 대응되도록 얼라인(align)하고, 당업계에서 통상적으로 이용되는 알고리즘을 이용하여 얼라인된 서열을 분석한 경우에, 최소 60%의 상동성, 더욱 구체적으로 70%의 상동성, 더더욱 구체적으로 80%의 상동성, 가장 구체적으로 90%의 상동성을 나타내는 서열을 의미한다.
따라서, 상기 서열번호 1로 표시되는 서열과 높은 상동성을 갖는 아미노산 서열, 예를 들면 그 상동성이 70% 이상, 구체적으로 80% 이상, 더욱 구체적으로 90% 이상의 높은 상동성을 가지면서 본 발명의 TMEM165-CLOCK 항체 에피토프로서의 기능을 동등하게 나타낼 수 있는 아미노산 서열도 본 발명의 범위에 포함되는 것으로 해석되어야 한다.
또한 상기 폴리뉴클레오티드를 포함하는 재조합 발현 벡터 및 상기 벡터로 형질전환된 형질전환체를 제공할 수 있다.
본 발명은 다른 양태로 서열번호 1로 표시되는 아미노산 서열을 포함하는 TMEM165-CLOCK 항체 에피토프에 특이적으로 결합하는 항체 또는 이의 항원 결합 단편을 제공한다.
상기 TMEM165-CLOCK 항체 에피토프는 전술한 바와 같다.
상기 'TMEM165-CLOCK 항체 에피토프에 특이적으로 결합하는 항체'는 TMEM165-CLOCK 단백질에 특이적으로 결합하여 이를 검출할 수 있는 항체를 의미한다. 상기 항체는 TMEM165-CLOCK 특이 항체, 항 TMEM165-CLOCK 단클론 항체 또는 TMEM165-CLOCK 항체와 혼용되어 사용될 수 있다.
상기 용어 '특이적으로 결합(Specifically binding)'은 당해 기술분야에서 통상적으로 알려진 "특이적으로 인식(specifically recognizing)"의 의미와 동일한 것으로서 항원 및 항체가 특이적으로 상호작용하여 항원-항체 복합체를 형성할 수 있으며 또한 면역학적 반응을 하는 것을 의미할 수 있다.
본 발명에 따른 항체 또는 이의 항원 결합 단편은 바람직하게는 서열번호 3으로 표시되는 TMEM165-CLOCK 단백질의 300-321번째 아미노산 서열, 즉 서열번호 1로 표시되는 아미노산 서열에 특이적으로 결합할 수 있다. 따라서, 본 발명에 따른 항체 또는 이의 항원 결합 단편은 TMEM165-CLOCK를 검출 또는 이를 특이적으로 표적화하기 위한 목적으로 활용될 수 있다.
본 발명에서 항체는 전체(whole) 항체 형태일 뿐 아니라 항원 결합 기능을 보유하고 있는 항체 분자의 기능적인 단편을 포함한다. 상기 기능적인 단편의 예는 구체적으로 (i) 경쇄의 가변역역(VL) 및 중쇄의 가변영역(VH)과 경쇄의 불변역역(CL) 및 중쇄의 첫번째 불변 영역(CH1)으로 이루어진 Fab 단편; (ii) VH 및 CH1 도메인으로 이루어진 Fd 단편; (iii) 단일 항체의 VL 및 VH 도메인으로 이루어진 Fv 단편; (iv) VH 도메인으로 이루어진 dAb 단편; (v) 분리된 CDR 영역; (vi) 2개의 연결된 Fab 단편을 포함하는 2가 단편인 F(ab')2 단편; (vii) VH 도메인 및 VL 도메인이 항원 결합 부위를 형성하도록 결합시키는 펩타이드 링커에 의해 결합된 단일쇄 Fv 분자(scFv); (viii) 이특이적인 단일쇄 Fv 이량체 및 (ix) 유전자 융합에 의해 제작된 다가 또는 다특이적인 단편인 디아바디(diabody) 등을 포함한다.
전체 항체는 2개의 전체 길이의 경쇄 및 2개의 전체 길이의 중쇄를 가지는 구조이며 각각의 경쇄는 중쇄와 다이설파이드 결합으로 연결되어 있다. 상기 항체는 단클론 항체, 다클론 항체, 다특이적 항체, 인간 항체, 인간화 항체, 키메라 항체, 단쇄 Fvs(scFV), 단쇄 항체, Fab 단편, F(ab') 단편, 다이설파이드-결합 Fvs(sdFV) 및 항-이디오타입(항-Id) 항체 그리고 상기 항체들의 에피토프-결합 단편 등을 포함할 수 있다.
상기 항체 또는 항원 결합 단편은 Fab, Fd, Fab', dAb, F(ab'), F(ab')2, scFv, Fv, scFv 이량체, 디아바디(diabody) 및 선형 항체로 이루어진 군으로부터 선택되는 하나일 수 있으나 이에 제한되지 않는다.
본 발명에서 용어 '단클론 항체(monoclonal antibody)'는 당해 기술분야에 공지된 용어로서 단일 항원성 부위에 대해서 지시되는 고도의 특이적인 항체를 의미한다. 단클론 항체는 단세포군 항체, 모노클로날 항체 또는 단일클론 항체라고 불리기도 한다. 통상적으로, 상이한 에피토프(항원 결정기)들에 대해 지시되는 상이한 항체들을 포함하는 다클론 항체와는 다르게, 단클론 항체는 항원상의 단일 결정기에 대해서 지시된다. 단클론 항체는 항원-항체 결합을 이용하는 진단 및 분석학적 분석법의 선택성과 특이성을 개선시키는 장점이 있으며, 또한 하이브리도마 배양에 의해 합성되기 때문에 다른 면역글로불린에 의해 오염되지 않는 또 다른 장점을 갖는다.
본 발명에서 항 TMEM165-CLOCK 단클론 항체는 당해 기술 분야에 공지된 다양한 방법을 통해 제조될 수 있다. 일 예로서, 화학적 펩타이드 합성방법으로 제조될 수 있고, 상기 단클론 항체를 코딩하는 유전자를PCR(polymerase chain reaction)에 의해 증폭하거나 공지된 방법으로 합성한 후 발현 벡터에 클로닝하여 발현시켜서 제조될 수도 있으며, 상기 단클론 항체의 면역원을 동물에 주사하여 얻어진 림프구로부터 유래된 하이브리도마 세포주를 사용하여 제조될 수도 있다.
본 발명의 일실시예에 따르면, 파지 디스플레이(Phage display) 기법을 사용하여 TMEM165-CLOCK 특이 항체를 확립하였다. 다양한 육종암 조직에서 공통된 발현을 확인한 융합유전자 TMEM165-CLOCK을 클로닝하여 TMEM165-CLOCK 단백질을 정제하고 이를 인간 scFv 항체 파지 표면제시 라이브러리에 반응시켜 TMEM165-CLOCK에 특이적으로 결합한 scFv-파지를 추출해 E-coli에 감염 및 증폭시키는 바이오패닝을 수행하였다. 상기 '바이오패닝(Bio-panning)'이란 파지의 외벽(coat)에 펩타이드를 발현(display)하는 파지 라이브러리로부터 항원(바이러스 외피 단백질), 효소, 세포표면 리셉터 등의 표적 분자와 결합하는 성질을 지닌 펩타이드를 표면에 발현하고 있는 파지만을 선택해 내는 과정을 일컫는다. 이와 같은 패닝 과정을 수행한 후 결합능이 큰 파지 항체군에서 단클론 항체를 선별하였으며, 이의 ELISA 분석을 수행하여 결합능이 우수한 항체를 한 번 더 선별하였다. 선별된 단클론 항체의 phagemid DNA를 얻은 후 single chain Fv(scFv)의 5'-, 3'-올리고뉴클레오티드를 이용하여 서열 분석을 진행하고 양방향에서 읽힌 서열의 공통부위를 종합하여 서열번호 2로 표시되는 TMEM165_CLOCK 항체 서열을 확립하였다.
본 발명에 따른 항체는 이에 제한되는 것은 아니나, 서열번호 2로 표시되는 아미노산 서열을 포함할 수 있고, 바람직하게는 단일쇄 항체(scFv)일 수 있다. 또한 바람직하게 본 발명의 항체는 서열번호 2로 표시되는 아미노산 서열을 포함하는 TMEM165-CLOCK 특이적 단일쇄 항체(scFv) 또는 이의 항원결합 단편일 수 있다.
상기 'scFv(single chain fragment variable)'는 유전자 재조합을 통해 항체의 가변 영역만을 발현시켜 만든 단쇄항체를 말하며, 항체의 VH 영역과 VL 영역을 짧은 펩타이드 사슬로 연결한 단일쇄 형태의 항체를 말한다. 상기 용어 "scFv"는 달리 명시되지 않거나, 문맥상 달리 이해되는 것이 아니라면, 항원 결합 단편을 비롯한 scFv 단편을 포함하고자 한다. 이는 통상의 기술자에게 자명한 것이다.
본 발명에 따른 에피토프, 항체 또는 이의 항원 결합 단편은 본 명세서에 기재된 서열뿐만 아니라, 이의 생물학적 균등물들도 포함할 수 있다. 예를 들면, 항체의 결합 친화도 및/또는 기타 생물학적 특성을 보다 더 개선시키기 위하여 항체의 아미노산 서열에 추가적인 변화를 줄 수 있다. 이러한 변형은, 예를 들어 항체의 아미노산 서열 잔기의 결실, 삽입 및/또는 치환을 포함한다. 이러한 아미노산 변이는 아미노산 곁사슬 치환체의 상대적 유사성, 예컨대, 소수성, 친수성, 전하, 크기 등에 기초하여 이루어진다. 아미노산 곁사슬 치환체의 크기, 모양 및 종류에 대한 분석에 의하여, 아르기닌, 라이신과 히스티딘은 모두 양전하를 띤 잔기이고; 알라닌, 글라이신과 세린은 유사한 크기를 갖으며; 페닐알라닌, 트립토판과 타이로신은 유사한 모양을 갖는다는 것을 알 수 있다. 따라서, 이러한 고려 사항에 기초하여, 아르기닌, 라이신과 히스티딘; 알라닌, 글라이신과 세린; 그리고 페닐알라닌, 트립토판과 타이로신은 생물학적으로 기능 균등물이라 할 수 있다.
본 발명은 다른 양태로 상기 항체 또는 이의 항원 결합 단편의 아미노산을 암호화하는 폴리뉴클레오티드, 상기 폴리뉴클레오티드를 포함하는 재조합 발현 벡터 및 상기 벡터를 숙주세포에 공동-형질전환하여 제조한 형질전환체에 관한 것이다.
상기 항체 또는 이의 항원 결합 단편을 암호화하는 폴리뉴클레오티드는 전술한 바와 같이 실질적인 동일성(substantial identity)을 나타내는 서열도 포함하는 것으로 해석된다. 본 발명에서 상기 폴리뉴클레오티드는 바람직하게는 서열번호 4로 표시되는 염기서열을 포함할 수 있고, 상기 서열번호 4로 표시되는 염기서열과 최소 60%의 상동성, 더욱 구체적으로 70%의 상동성, 더더욱 구체적으로 80%의 상동성, 가장 구체적으로 90%의 상동성을 나타내는 서열을 의미할 수 있다.
상기 폴리뉴클레오티드는 코돈의 축퇴성(degeneracy)으로 인하여 또는 상기 항체의 경쇄 및 중쇄 또는 그의 단편을 발현시키고자 하는 생물에서 선호되는 코돈을 고려하여, 코딩영역으로부터 발현되는 항체의 경쇄 및 중쇄의 아미노산 서열을 변화시키지 않는 범위 내에서 코딩영역에 다양한 변형이 이루어질 수 있고, 코딩영역을 제외한 부분에서도 유전자의 발현에 영향을 미치지 않는 범위 내에서 다양한 변형 또는 수식이 이루어질 수 있으며, 그러한 변형 유전자 역시 본 발명의 범위에 포함됨을 당업자는 잘 이해할 수 있을 것이다. 즉, 본 발명의 폴리뉴클레오티드는 이와 동등한 활성을 갖는 단백질을 코딩하는 한, 하나 이상의 핵산 염기가 치환, 결실, 삽입 또는 이들의 조합에 의해 변이될 수 있으며, 이들 또한 본 발명의 범위에 포함된다. 이러한 폴리뉴클레오티드의 서열은 단쇄 또는 이중쇄일 수 있으며, DNA 분자 또는 RNA(mRNA) 분자일 수 있다.
상기 발현 벡터의 제작 시에는, 상기 항체를 생산하고자 하는 숙주세포의 종류에 따라 프로모터(promoter), 종결자(terminator), 인핸서(inhancer) 등과 같은 발현 조절 서열, 막 표적화 또는 분비를 위한 서열 등을 적절히 선택하고 목적에 따라 다양하게 조합할 수 있다.
본 발명에 따른 발현 벡터는 플라스미드 벡터, 코즈미드 벡터, 박테리오 파아지 벡터 및 바이러스 벡터 등을 포함하나 이에 제한되지 않는다. 적합한 발현 벡터는 프로모터, 오퍼레이터, 개시코돈, 종결코돈, 폴리아데닐화 시그널 및 인핸서 같은 발현 조절 엘리먼트 외에도 막 표적화 또는 분비를 위한 시그널 서열 또는 리더 서열을 포함하며 목적에 따라 다양하게 제조될 수 있다. 발현 벡터의 프로모터는 구성적 또는 유도성일 수 있다. 상기 시그널 서열에는 숙주가 에쉐리키아속(Escherichia sp.)균인 경우에는 PhoA 시그널 서열, OmpA 시그널 서열 등이, 숙주가 바실러스속(Bacillus sp.)균인 경우에는 α-아밀라아제 시그널 서열, 서브틸리신 시그널 서열 등이, 숙주가 효모(yeast)인 경우에는 MFα 시그널 서열, SUC2 시그널 서열 등이, 숙주가 동물세포인 경우에는 인슐린 시그널 서열, α-인터페론 시그널 서열, 항체 분자 시그널 서열 등을 이용할 수 있으나, 이에 제한되지 않는다.
또한 발현 벡터는 벡터를 함유하는 숙주 세포를 선택하기 위한 선택 마커를 포함할 수 있고, 복제 가능한 발현 벡터인 경우 복제 기원을 포함할 수 있다.
본 발명에 따른 상기 발현 벡터를 적절한 숙주 세포, 예를 들어, 대장균 또는 효모 세포 등에 형질전환시킨 후, 형질전환된 숙주세포를 배양함으로써 본 발명에 따른 항체를 대량 생산할 수 있다. 숙주세포의 종류에 따른 적절한 배양 방법 및 배지 조건 등은 당해 분야의 통상의 기술자에게 알려진 공지 기술로부터 당업자가 용이하게 선택할 수 있다. 상기 숙주세포는 대장균(E. coli) 또는 바실러스 서브틸러스(Bacillus subtilis)와 같은 원핵생물일 수 있다. 또한, 사카로마이세스 세르비시아(Saccharomyces cerevisiae)와 같은 효모, 곤충 세포, 식물 세포, 동물 세포로부터 유래한 진핵 세포일 수 있다. 더욱 바람직하게는, 상기 동물 세포는 자가 또는 동종 이계 동물 세포일 수 있다. 자가 또는 동종 이계 동물 세포에 도입하여 제조된 형질전환체는 개체에 투여되어 암을 치료하는 세포치료 등에 이용될 수도 있다. 상기 숙주세포로의 발현벡터 도입 방법은 당업자에게 공지된 어느 방법을 사용해도 무방하다.
본 발명은 다른 양태로 상기 TMEM165-CLOCK 특이 항체 또는 이의 항원 결합 단편을 포함하는, 암의 진단용 조성물에 관한 것이다.
본 발명에 따른 TMEM165-CLOCK 특이 항체 또는 이의 항원 결합단편은 암세포에서 특이적으로 발현되는 TMEM165-CLOCK에 특이적으로 결합할 수 있으므로, 이들을 검출, 진단하기 위한 목적으로 사용될 수 있다. 즉, 상기 조성물은 서열번호 3으로 표시되는 TMEM165-CLOCK 항체를 포함하고, 시료와 항체가 반응함으로써 나타내는 시그널을 분석하여 암 발생의 여부를 진단할 수 있다. 구체적으로 상기 TMEM165-CLOCK 항체 에피토프 및 이에 특이적으로 결합하는 본 발명에 따른 단클론 항체 또는 이의 항원 결합 단편의 결합물, 즉 항원-항체 복합체의 형성 여부를 확인하는 과정을 통해 암을 진단할 수 있다. 상기 시그널은 항체에 결합된 효소 예를 들어 알칼린 포스파타아제, β-갈락토시다아제, 호스 래디쉬 퍼옥시다아제, 루시퍼라아제 또는 사이토크롬 P450을 포함할 수 있으나, 이에 제한되지 않는다.
상기 항원-항체 복합체의 형성은 통상적인 면역분석 방법에 따라 측정할 수 있으며, 상기 TMEM165-CLOCK 단백질에 대한 항체를 이용한 ELISA(enzyme linked immunosorbent assay), 면역블롯(immunoblotting), 웨스턴블롯(westernblotting), 면역조직화학염색법(immunocytochemistry) 또는 FACS(Fluorescence-activated cell sorting)를 통해 검출 측정할 수 있으나, 이에 제한되지 않는다.
상기 면역분석 과정에 의한 최종적인 시그널의 세기를 분석함으로써, 암의 발생 유무를 진단할 수 있다. 즉, 의심되는 개체로부터 분리한 시료에서 본 발명의 TMEM165-CLOCK 단백질이 과발현되어 시그널이 정상 개체로부터 분리한 시료보다 강하게 나오는 경우에는 암을 진단할 수 있다.
상기 암은 위암, 대장암, 신장암, 혈액암, 육종암, 난소암, 유방암, 자궁경부암, 갑상선암, 전립선암, 췌장암, 간암 및 폐암으로 이루어진 군에서 선택되는 1종 이상일 수 있다.
본 발명의 일실시예에 따르면, 피부섬유육종, 지방 육종, 미분화다형성 육종, 골연골종과 같은 다양한 육종암 조직에서 융합유전자 TMEM165-CLOCK의 특이 발현을 확인하였으며, 육종암 외 유방암, 전립선암, 폐암 세포주에서 TMEM165-CLOCK의 높은 발현이 확인됨에 따라 상기 융합유전자 TMEM165-CLOCK를 암세포 분자표지로 제시할 수 있음을 확인하였다. 이에 본 발명에 따른 TMEM165_CLOCK 특이 항체를 이용하여 암이 의심되는 환자의 시료에서 상기 항원-항체 복합체의 형성 수준을 측정하면 암의 발병 여부를 진단할 수 있다. 일구현예로 TMEM165_CLOCK 특이 항체를 이용한 세포면역화학염색법(ICC)을 실시하여 정상 세포주 및 육종암 세포주 KHOS/NP에 대한 TMEM165-CLOCK 특이항체-항원친화력를 평가하였을 때 KHOS/NP 세포주에서만 특이적으로 녹색 형광의 염색이 관찰되는 것을 확인할 수 있어 본 발명에 따른 TMEM165-CLOCK 특이 항체가 암세포 분자표지 TMEM165_CLOCK를 검출할 수 있으며, 이를 통해 육종암을 진단할 수 있음을 제시하였다.
이에 본 발명은 다른 양태로 상기 TMEM165-CLOCK 특이 항체 또는 이의 항원 결합 단편을 목적하는 시료와 반응시키는 단계를 포함하는, 암 진단 방법에 관한 것이다.
상기 암은 위암, 대장암, 신장암, 혈액암, 육종암, 난소암, 유방암, 자궁경부암, 갑상선암, 전립선암, 췌장암, 간암 및 폐암으로 이루어진 군에서 선택되는 1종 이상일 수 있으나 이에 제한되지 않는다.
본 발명은 또 다른 양태로 TMEM165-CLOCK 특이 항체 또는 이의 항원 결합 단편을 포함하는, 암의 예방 또는 치료용 조성물에 관한 것이다. 상기 암은 위암, 대장암, 신장암, 혈액암, 육종암, 난소암, 유방암, 자궁경부암, 갑상선암, 전립선암, 췌장암, 간암 및 폐암으로 이루어진 군에서 선택되는 1종 이상일 수 있으나 이에 제한되지 않는다.
본 발명에 따른 상기 조성물은 PBMC 세포 또는 NK 세포를 더 포함할 수 있다.
본 발명의 TMEM165-CLOCK 특이 항체 또는 이의 항원 결합 단편은 면역세포의 면역성을 증가시켜 보다 효과적인 암세포 사멸을 유도할 수 있으며, 특히 TMEM165-CLOCK가 과발현되어 있는 암의 치료에 효과적으로 활용될 수 있다. 따라서 본 발명의 TMEM165-CLOCK 특이 항체 또는 이의 항원 결합 단편은 면역치료제, 예컨대 PBMC 세포 또는 NK 세포와 함께 암세포에 처리하는 경우, 보다 효과적인 암 예방 또는 치료효과를 달성할 수 있다.
상술한 바와 같이, TMEM165-CLOCK은 암세포나 암 조직에서 과발현되어 있음을 확인하였으며, 본 발명에 따른 TMEM165-CLOCK 항체 또는 이의 단편을 이용한 TMEM165-CLOCK의 억제는 암을 억제하기 위하여 유용하게 사용될 수 있다.
일구현예로 항체 특이적 면역성을 증가시킨 PBMC 세포와 함께 TMEM165_CLOCK 특이 항체를 이용한 형광 유세포 분석법(FACS), 그리고 항체 특이적 면역성을 증가시킨 NK 세포와 함께 TMEM165_CLOCK 특이 항체를 이용한 루시퍼라제 활성 분석법(luciferase activity)을 실시하여 TMEM165-CLOCK를 보유하고 있는 육종암 세포주에 TMEM165_CLOCK 특이 항체를 처리할 경우 세포 사멸이 증가함을 확인하였다.
일구현예로 육종암 세포주, TMEM165-CLOCK 과발현 안정화 세포주 및 폐암 세포주를 대상으로 TMEM165_CLOCK 특이 항체를 처리할 경우 세포 증식(cell proliferation)이 억제됨을 확인하였다.
일구현예로 TMEM165-CLOCK 과발현 안정화 세포주를 경골내 주사한 마우스에 TMEM165_CLOCK 특이 항체를 처리할 경우 종양의 크기 증가가 억제됨을 확인하였다.
상술한 구현예에 따르면 TMEM165_CLOCK 특이 발현 세포주 및 이를 이용한 동물 실험을 통해 본 발명의 TMEM165_CLOCK 특이 항체가 치료 효과를 나타내며 육종암 또는 폐암 세포주에 대한 세포 증식 억제 및 사멸 효과를 확인함으로써 본 발명의 TMEM165_CLOCK 특이 항체는 TMEM165_CLOCK 과발현을 갖는 암종이라면 치료 효과를 나타낼 수 있다.
상기 암종은 위암, 대장암, 신장암, 혈액암, 육종암, 난소암, 유방암, 자궁경부암, 갑상선암, 전립선암, 췌장암, 간암 및 폐암으로 이루어진 군에서 선택되는 1종 이상일 수 있다.
상기 암의 예방 또는 치료용 조성물은 약제학적으로 허용 가능한 첨가제를 더 포함할 수 있으며, 이때 약제학적으로 허용 가능한 첨가제로는 전분, 젤라틴화 전분, 미결정셀룰로오스, 유당, 포비돈, 콜로이달실리콘디옥사이드, 인산수소칼슘, 락토스, 만니톨, 엿, 아라비아고무, 전호화전분, 옥수수전분, 분말셀룰로오스, 히드록시프로필셀룰로오스, 오파드라이, 전분글리콜산나트륨, 카르나우바 납, 합성규산알루미늄, 스테아린산, 스테아린산마그네슘, 스테아린산알루미늄, 스테아린산칼슘, 백당, 덱스트로스, 소르비톨 및 탈크 등이 사용될 수 있다. 본 발명에 따른 약제학적으로 허용 가능한 첨가제는 상기 조성물에 대해 0.1 ~ 90 중량부 포함되는 것이 바람직하나, 이에 제한되지 않는다.
본 발명에 따른 상기 조성물은 실제 임상 투여 시에 경구 및 비경구의 여러 가지 제형으로 투여될 수 있는데, 제제화할 경우에는 보통 사용하는 충진제, 증량제, 결합제, 습윤제, 붕해제, 계면활성제 등의 희석제 또는 부형제를 사용하여 조제될 수 있다. 경구투여를 위한 고형 제제에는 정제, 환제, 산제, 과립제, 캡슐제 등이 포함되며, 이러한 고형 제제는 갈화 추출물에 적어도 하나 이상의 부형제 예를 들면, 전분, 칼슘카보네이트(Calciumcarbonate), 수크로스(Sucrose), 락토오스(Lactose) 또는 젤라틴 등을 섞어 조제될 수 있다. 또한, 단순한 부형제 이외에 마그네슘 스티레이트 탈크 같은 윤활제들도 사용될 수 있다. 경구를 위한 액상 제제로는 현탁제, 내용액제, 유제 및 시럽제 등이 해당되는데 흔히 사용되는 단순 희석제인 물, 리퀴드 파라핀 이외에 여러 가지 부형제, 예를 들면 습윤제, 감미제, 방향제, 보존제 등이 포함될 수 있다. 비경구 투여를 위한 제제에는 멸균된 수용액, 비수성 용제, 현탁제, 유제, 동결 건조 제제, 좌제가 포함될 수 있다. 비수성 용제, 현탁 용제로는 프로필렌글리콜(Propylene glycol), 폴리에틸렌 글리콜, 올리브 오일과 같은 식물성 기름, 에틸올레이트와 같은주사 가능한 에스테르 등이 사용될 수 있다. 좌제의 기제로는 위텝솔(witepsol), 마크로골, 트윈(tween) 61, 카카오지, 라우린지, 글리세로제라틴 등이 사용될 수 있다.
본 발명에 따른 상기 조성물은 목적하는 방법에 따라 경구 투여하거나 비경구 투여할 수 있으며, 비경구 투여시 피부 외용 또는 복강내 주사, 직장내 주사, 피하주사, 정맥주사, 근육내 주사 또는 흉부내 주사 주입방식을 선택하는 것이 바람직하다. 투여량은 환자의 체중, 연령, 성별, 건강상태, 식이, 투여시간, 투여방법, 배설률 및 질환의 중증도 등에 따라 그 범위가 다양하다.
상기 조성물의 투여량은 환자의 체중, 연령, 성별, 건강상태, 식이, 투여시간, 투여방법, 배설률 및 질환의 중증도에 따라 그 범위가 다양하며, 일일 투여량은 갈화 추출물의 양을 기준으로 0.0001 내지 100㎎/㎏이고, 바람직하게는 0.001 내지 10 ㎎/㎏이며, 하루 1 ~ 6 회 투여될 수 있다.
본 발명에 따른 항체는 암환자의 치료를 위하여 단독 또는 수술, 호르몬 치료, 약물 치료 및 생물학적 반응 조절제와 병행하여 사용될 수 있다. 본 발명이 적용 가능한 개체는 척추동물이고 바람직하게는 인간을 포함하는 포유 동물이다.
본 발명은 또 다른 양태로, TMEM165-CLOCK 특이 항체 또는 이의 항원 결합 단편을 개체에 투여하는 단계를 포함하는 암의 치료 방법에 관한 것이다.
상기 방법은 상술한 조성물을 이용하므로, 공통된 내용의 반복 기재를 피하기 위해 그 기재를 생략한다.
이하, 본 발명을 실시예에 의하여 상세히 설명한다. 단, 하기 실시예는 본 발명을 구체적으로 예시하는 것일 뿐, 본 발명의 내용이 실시예에 의해 한정되는 것은 아니다.
실시예 1: TMEM165-CLOCK 융합유전자 스크리닝 및 발현 확인
1-1. 육종(Sarcoma) 특이 융합유전자 스크리닝
기관윤리위원회로부터 승인된 인체유래물연구동의서를 획득한 환자로부터 육종암 및 정상 검체를 수집하였다(IRB File No. 2020-02-015-014). 수집한 54개의 육종암, 정상 조직에서 총 RNA를 추출하고NGS 분석을 진행한 다음 Defuse, FusionCatcher, Arriba 프로그램의 알고리즘을 활용하여 육종(Sarcoma) 특이적 융합유전자를 발굴하였다.
표 1에 나타낸 바와 같이 45개의 육종암 조직 중 TMEM165-CLOCK 융합유전자가 9개(20%)의 육종암 조직에서 발현되고 9개의 정상 조직에서는 전혀 발현되지 않은 것을 확인하고 TMEM165-CLOCK는 육종암 조직 특이성 신생물질(새로운 단백질)을 발현할 것으로 예측하였다.
| Fusion transcripts | Sarcoma tumors (n=45) |
Normal tissue (n=9) |
| TMEM165-CLOCK | 9(20%) | 0(0%) |
1-2. TMEM165-CLOCK의 육종 조직 발현 검증
상기 결과를 통해 TMEM165-CLOCK이 육종암을 진단하는 마커로 활용가능할 것으로 예상하고 다양한 종류의 육종 조직에서 PCR을 수행하여 TMEM165-CLOCK 융합유전자의 발현을 확인하였다. TMEM165-CLOCK 융합유전자의 융합 접합(fusion junction) 구간이 포함되도록 정방향, 역방향 프라이머를 제작(바이오닉스, 서울, 한국)하여 PCR 반응에 이용하였다.
PCR primer F:GCTCTTACATTAACATTCT(서열번호 5),
PCR primer R:AGTCATCTCAAAGTTCAA(서열번호 6)
도 1에 정상 세포와 다양한 육종 조직에서의 TMEM165-CLOCK 발현 수준을 나타냈다. 도 1의 상단 이미지를 살펴보면, 정상조직(레인 1 및 레인 2)과 비교하였을 때 레인 3의 피부섬유육종(Dermatofibrosarcoma protuberans) 및 레인 4의 미분화다형성육종(UPS) 조직에서 TMEM165-CLOCK 융합유전자가 현저히 발현되는 것을 확인할 수 있다.
또한 도 1의 하단 이미지를 살펴보면, 레인 1의 피부섬유육종(Dermatofibrosarcoma protuberans), 레인 2의 지방육종(Low-grade liposarcoma), 레인 3의 미분화다형성육종(UPS), 레인 4의 거대세포종양(Giant cell tumor) 및 레인 5의 골연골종(Osteochondroma) 조직에서 TMEM165-CLOCK 융합유전자의 높은 발현 수준이 확인되었다.
상기와 같은 결과를 통해 TMEM165-CLOCK 융합 유전자가 피부섬유육종, 지방 육종, 미분화다형성 육종, 골연골종과 같은 다양한 육종암에서 발현됨을 확인하였다.
1-3. TMEM165-CLOCK의 육종암 외 암 세포주 발현 확인
실시예 1-2와 동일한 방법으로 PCR 반응을 수행하여 육종암을 포함한다양한 암 세포주에서 TMEM165-CLOCK 융합유전자의 발현 정도를 확인하였다.
도 2a에서 보는 바와 같이, 레인 1 내지 4의 육종암 세포주(KHOS/NP, U2OS, MG63 143B), 레인 5의 유방암 세포주(SK-BR3) 및 레인 6의 전립선암 세포주(PC3)에서 TMEM165-CLOCK 융합유전자의 특이 발현이 나타나는 것을 확인하였다.
또한 도 2b를 살펴보면, 폐암세포주(NCI-H1299, NCI-H1437, NCI-H1793, HCC827, NCI-H23)에서 TMEM165-CLOCK 융합유전자의 발현이 확인되었다.
상기와 같은 결과를 통해, TMEM165-CLOCK 융합 유전자가 육종암, 전립선암, 유방암, 폐암에서 높게 발현되어 있으며, 이들을 검출할 수 있는 제제가 상기 암종을 진단할 수 있음을 확인하였다.
실시예 2: 표적 항원 펩타이드의 합성
TMEM165-CLOCK를 검출할 수 있는 제제를 생산하기 위하여, 이를 제조하기 위한 표적 항원을 제조하였다. TMEM165 유전자는 정방향 (5'→3'), CLOCK 유전자는 역방향으로 전사되어 결합된 형태의 TMEM165-CLOCK 융합유전자의 서열을 정렬하였다. 도 3a를 살펴보면, NGS 분석을 진행 후 분석 프로그램의 알고리즘에 의해 예측되어진 TMEM165-CLOCK의 염기서열(서열번호 4) 말단 부분의 파란색 표시(하단 이미지 * 기호의 우측)에 나타낸 바와 같이 NCBI에 보고된 TMEM165(Homo sapiens transmembrane protein 165; NM_018475.5)의 서열(상단 이미지)과 상이한 것을 확인할 수 있다. 아울러 도 3b에 나타낸 바와 같이 TMEM165-CLOCK의 아미노산 서열(서열번호 3)을 비교하여 볼 때 1-299번째 아미노산까지 동일하고 300-321번째 아미노산 서열이 상이한 것을 확인할 수 있다. 상기 차이가 있는 300-321번째 아미노산까지의 서열(하기 서열번호 1)을 항원 특정 부위로 결정하고 펩타이드 제작(세랜텍, 한국)을 진행하였다.
TMEM165 300-321 aa: GSFSPWLILHACSDGKGHLERN (서열번호 1)
서열 분석 결과를 바탕으로 상기 펩타이드 서열 'GSFSPWLILHACSDGKGHLERN(서열번호 1)'을 고체상 펩타이드 합성(Solid Phase Peptide Synthesis) 방법을 이용하여 C-말단부터 합성을 수행하였다. 펩타이드 합성 시 2종류의 캐리어 단백질(BSA, KLH)을 접합(Conj㎍ation)하여 파지 디스플레이(phage display)용으로 제작하여 최종 에피토프(Epitope)를 얻었다. 도 3c에 TMEM165-CLOCK의 개략도 및 도 3d에 합성 펩타이드의 3D 구조를 나타냈다.
실시예 3: TMEM165-CLOCK 특이 항체 개발
3-1. 항 TMEM165-CLOCK 단클론 항체의 scFv 제작 및 선별
단쇄가변단편(Single-chain variable fragment; scFv) 항체 라이브러리를 디스플레이하는 파지를 구축하고 실시예 2에서 합성한 에피토프에 대해 바이오패닝(Biopanning)을 수행하였다. 파지디스플레이 라이브러리의 경우 바이오니아(한국)에서 제공하는 인간 라이브러리를 선택하여 진행하였다.
구체적으로, 합성된 펩타이드 서열 'GSFSPWLILHACSDGKGHLERN(서열번호 1)'을 항원으로 항체 라이브러리의 파지가 고정된 표적과 함께 배양한 다음 항원에 결합하지 않은 파지를 걸러냈다. 항원에 결합하는 클론 풀(Clone pool)이 형성되면 높은 친화성을 나타내는 파지를 추출하고 싱글 콜로니를 구분하여 각각 접종하였다. 추출한 파지는 E.coli 숙주 세포와 함께 배양되어 감염(infection) 및 증폭(amplification)이 된 상태이므로 감염된 박테리아의 콜로니를 플레이트에서 배양하였다. 각 콜로니에서 생성된 단일클론 scFv에 대해 상기 에피토프를 이용하여 ELISA를 진행하고 O.D 값이 1.0 이상 나오는 클론(Positive clone)을 선별하였다.
3-2. 항 TMEM165-CLOCK 단클론 항체의 서열 분석
상기 선별한 클론으로부터 제조된 단클론 항체의 Phagemid DNA를 얻은 scFv의 5'-, 3'-올리고뉴클레오티드를 이용하여 서열 분석을 진행하였다. 양방향에서 읽힌 서열의 공통부위를 종합하여 scFv의 최종 서열을 파악 (ABI3730XL, Sanger-method sequencing, Phred Score ≥20)하고 하기 서열번호 2로 표시되는 TMEM165_CLOCK 항체 서열을 확립하였다.
Anti- TMEM165_CLOCK scFv 폴리펩타이드(서열번호 2): ELELTQPPSVSAAPGQEVTISCSGGNSNLGKNAASWYQQVPGTAPKLLIYDNNKRPSGIPDRFSGSKSGTSATLGITGLQTGDEADYYCGTWDSRLRGWVFGGGTQLTVLGGGSSRSSSSGGGGSGGGGQVQLQESGGGLVQPGRSLRLSCTASGFTFGDYAMSWVRQAPGKGLEWVGFIRSKAYGGTTEYAASVKGRFTISRDDSKSIAYLQMNSLKTEDTAVYYCTRSARRSLNSGYFDYWGQGTLVTVSSASPTSPKVTSG
실시예 4: TMEM165-CLOCK 특이 항체를 이용한 육종암 진단
상기 실시예 3을 통해 제조된 TMEM165_CLOCK 항체를 이용한 세포면역화학염색법(ICC)을 실시하여 TMEM165-CLOCK 특이항체-항원친화력를 평가하였다.
먼저 인간 제대 정맥 내피세포 HUVEC 세포 2.5 x 104 cell/well, 육종암 세포주 KHOS/NP세포 5 x 104 cells/well를 접종 후 37℃ 인큐베이션에서 밤새 배양하였다. 75 ㎕의 opti-MEM 배지(Gibco)에 TMEM165-CLOCK 플라스미드 DNA 1 ㎍과 플러스 시약 1 ㎕를 넣고, 75 ㎕의 opti-MEM 배지(Gibco)에 4 ㎕의 리포펙타민 LTX(Invitrogen, 미국)을 넣은 후 섞어 20분 반응 후 KHOS/NP 세포에 처리하고 37℃ 인큐베이션에서 배양하고 4시간 후 배지를 교체하였다. 그 다음 48시간 37℃ 인큐베이션에서 배양 후 4% 파라포름알데히드를 이용하여 RT에서 10분 동안 고정시킨 후 PBS로 3회 세척하였다. 그리고나서 0.5% Tx-100을 이용하여 RT에서 10분동안 세포투과(Permeabilize)시키고 PBS로 3회 씻어냈다. 그 다음 5% BSA로 RT에서 30분동안 블로킹 후 항체를 5 ㎍/㎖의 농도로 처리하여 RT에서 3-4시간 반응시키고 PBS로 3회 세척하였다. 2차 항체(Alexa fluor 488 goat anti-human IgG, Invitrogen, 미국)를 1:500 비율로 RT에서 1시간 반응시킨 후 PBS로 3회 세척하고 DAPI가 포함된 마운팅 용액을 떨어뜨려 마운팅(Mounting)한 다음 공초점 현미경을 통해 세포를 관찰하였다.
도 4에서 왼쪽의 HUVEC 세포는 TMEM165_CLOCK 융합 유전자의 발현이 없는 정상 세포주이고 가운데 KHOS/NP 세포주는 TMEM165_CLOCK 융합유전자를 발현하는 육종암 세포주, 우측의 세포주는 KHOS/NP 세포주에 TMEM165_CLOCK 융합유전자를 과발현 시킨 세포주이다. 이를 살펴보면 TMEM165_CLOCK 융합유전자가 발현되는 KHOS/NP 및 KHOS/NP_TMEM165_CLOCK 세포주에서만 특이적으로 녹색 형광의 염색이 관찰되는 것을 확인할 수 있어 본 발명에 따른 TMEM165-CLOCK 특이 항체가 TMEM165_CLOCK를 검출할 수 있으며, 이를 통해 육종암을 진단할 수 있음을 확인하였다
실시예 5: TMEM165-CLOCK 특이 항체를 이용한 암세포 억제
5-1. 육종암 세포 사멸
실시예 3을 통해 제조된 TMEM165-CLOCK 특이 항체가 PBMC세포의 항체 특이적 면역성을 증가시켜 TMEM165_CLOCK 발현 암세포를 특이적으로 파괴시키는 것을 형광 유세포 분석법(FACS; Fluorescence-activated cell sorting)을 이용하여 확인하였다.
육종암 세포주 KHOS/NP_control_luc(대조군), 육종암 세포주에 TMEM165_CLOCK 융합유전자를 과발현 시킨 KHOS/NP_TMEM165-CLOCK_luc(실험군) 세포(EMEM 배지, hyclone)를 100 mm dish에서 70~80%일 때 CFSE(dojindo, 일본)로 37℃에서 20분 염색하였다. 대조군 KHOS/NP_control_luc 및 실험군 KHOS/NP_TMEM165-CLOCK_luc 세포를 3 x 105 cells/100 mm dish에 접종하고 PBMC(stemexpress, 미국)을 1:1 비율로 공배양(접종)한 다음 TMEM165-CLOCK 특이 항체를 0.1 ㎍/㎖ 농도로 처리한 dish 및 TMEM165-CLOCK 특이 항체를 처리하지 않은 dish를 37℃ 인큐베이션에서 밤새 배양하였다.
그 다음 세포를 수확하여 FVD(Fixable Viability Dye eFluorTM 780, Invitrogen, 미국)로 4℃에서 20분 염색하고 2% FBS가 포함된 PBS로 2회 세척 후 FACS를 이용하여 세포 사멸을 측정하였다.
도 5a의 가운데 이미지(Ab_0 ㎍/㎖)는 항체를 넣어주지 않은 경우이며 이 때 7.4 %의 세포 사멸이 관찰되나, 항체를 0.1 ㎍/㎖ 처리한 경우의 오른쪽 이미지(Ab_0.1 ㎍/㎖)를 살펴보면 세포 사멸이 45.5 %로 증가되는 것을 확인할 수 있다.
이는 TMEM165-CLOCK 특이 항체가 PBMC세포의 항체 특이적 면역성을 증가시켜 TMEM165_CLOCK 발현 암세포에 대한 암세포 사멸 활성을 증가시킬 수 있음을 보여주는 결과이다.
실시예 3을 통해 제조된 TMEM165-CLOCK 특이 항체가 NK세포의 항체 특이적 면역성을 증가시킬 수 있는지, 세포생존도를 루시퍼라제 활성도(luciferase activity)를 통하여 확인하였다.
육종암 세포주에 TMEM165_CLOCK 융합유전자를 과발현 시킨 KHOS/NP_TMEM165-CLOCK_luc 세포를 1 x 104 cells/96 well 플레이트에 접종하였다. 그 다음 NK-92 세포(MyeloCult H5100 mdeia, Stemcell Technologies, 캐나다)를 1:1 비율로 공배양(접종)하고 TMEM165-CLOCK 특이 항체를 5 ㎍/㎖ 농도로 처리한 96 well 플레이트 및 TMEM165-CLOCK 특이 항체를 처리하지 않은 96 well 플레이트를 37℃ 인큐베이션에서 밤새 배양하였다. 그 다음 세포를 수확하여 루시퍼라제 활성도를 측정(promega, 미국)하였다.
도 5b의 암세포 생존율을 살펴보면, TMEM165-CLOCK를 과발현시킨 KHOS/NP_TMEM165-CLOCK_luc의 경우 TMEM165-CLOCK 특이 항체를 처리하지 않은 Ab._0과 비교하여 TMEM165-CLOCK 특이 항체를 5 ㎍/㎖ 농도로 처리한 Ab._5에서 항체에 의한 세포 생존율의 감소가 20% 나타나는 것을 확인하였다.
5-2. 육종암 및 폐암 세포 증식 억제
육종암 세포주(KHOS/NP), TMEM165-CLOCK 과발현 안정화 세포주(KHOS/NP_TMEM165-CLOCK) 및 폐암 세포주(NCI-H1793)를 3 x 103 cell/96 well로 seeding 하여 24시간이 지난 후 TMEM165-CLOCK 특이 항체를 50 ㎍/㎖ 농도로 처리하여 MTS assay를 실시하였다.
도 6의 a~c를 살펴보면, 육종암 세포주(KHOS/NP), TMEM165-CLOCK 과발현 안정화 세포주(KHOS/NP_TMEM165-CLOCK) 및 폐암 세포주(NCI-H1793) 모두 TMEM165-CLOCK 특이 항체 처리에 의해 세포 증식(cell proliferation)이 유의하게 감소된 것을 확인할 수 있다.
실시예 5를 통해 본 발명에 따른 TMEM165-CLOCK 특이 항체는 육종암, 폐암 세포의 증식 억제 및 사멸 유도를 할 뿐만 아니라 TMEM165-CLOCK 과발현 세포의 성장을 억제함으로써 TMEM165-CLOCK 과발현을 갖는 암세포에 대해 치료적 유용성을 나타낼 수 있음을 확인하였다.
실시예 6: TMEM165-CLOCK 특이 항체를 이용한 종양 억제
실시예 3을 통해 제조된 TMEM165-CLOCK 특이 항체의 항종양 효과를 in vivo에서 규명하였다.
TMEM165-CLOCK 과발현 안정화 세포주를 6주령 balb/c-nude 마우스에 1 x 105 cells/mouse로 정강이뼈(tibia bone)내에 주사하였다. 대조군(Control)은 1 x PBS를 주입하고, 실험군(TMEM165-CLOCK Ab.)은 TMEM165-CLOCK 특이 항체를 0, 3, 6, 9일(총 4회) 0.4 mg농도로 주입한 다음, 13일차까지 종양의 크기를 비교하였다.
도 7의 a 및 b를 살펴보면, 대조군(Control)은 종양 크기의 시간 의존적 증가가 현저히 높은 것과 비교하여 실험군(TMEM165-CLOCK Ab.)은 종양 크기의 증가가 낮게 나타남을 확인하였다.
실시예 6을 통해 본 발명에 따른 TMEM165-CLOCK 특이 항체는 TMEM165-CLOCK 과발현을 갖는 암종에 대해 직접적인 항종양 효과를 나타냄을 입증하였다.
Claims (18)
- 서열번호 1로 표시되는 아미노산 서열을 포함하는, TMEM165-CLOCK 항체 에피토프.
- 제1항에 있어서, 상기 에피토프는 서열번호 3으로 표시되는 TMEM165-CLOCK 융합단백질의 300-321번째 아미노산 서열로 이루어진 폴리펩타이드를 포함하는, TMEM165-CLOCK 항체 에피토프.
- 서열번호 1로 표시되는 아미노산 서열을 포함하는 TMEM165-CLOCK 항체 에피토프에 특이적으로 결합하는, 항체 또는 이의 항원 결합 단편.
- 제3항에 있어서, 상기 항체 또는 항원 결합 단편은 Fab, Fd, Fab', dAb, F(ab'), F(ab')2, scFv, Fv, scFv 이량체, 디아바디(diabody) 및 선형 항체로 이루어진 군으로부터 선택되는 1종 이상인 것인, 항체 또는 이의 항원 결합 단편.
- 제3항에 있어서, 상기 항체는 서열번호 2로 표시되는 아미노산 서열을 포함하는, 항체 또는 이의 항원 결합 단편.
- 제5항에 있어서, 상기 항체는 단일쇄 항체(scFv)인 것인, 항체 또는 이의 항원 결합 단편.
- 서열번호 2로 표시되는 아미노산 서열을 포함하는 TMEM165-CLOCK 특이적 단일쇄 항체(scFv) 또는 이의 항원 결합 단편.
- 제7항의 항체 또는 이의 항원 결합 단편을 암호화하는, 폴리뉴클레오티드.
- 제8항의 폴리뉴클레오티드를 포함하는, 재조합 발현 벡터.
- 제9항의 벡터로 형질전환된, 형질전환체.
- 제3항 또는 제7항의 항체 또는 이의 항원 결합 단편을 포함하는, 암의 진단용 조성물.
- 제11항에 있어서, 상기 암은 위암, 대장암, 신장암, 혈액암, 육종암, 난소암, 유방암, 자궁경부암, 갑상선암, 전립선암, 췌장암, 간암 및 폐암으로 이루어진 군에서 선택되는 1종 이상인 것인, 암의 진단용 조성물.
- 제3항 또는 제7항의 항체 또는 이의 항원 결합 단편을 포함하는, 암의 예방 또는 치료용 조성물.
- 제13항에 있어서, 상기 암은 위암, 대장암, 신장암, 혈액암, 육종암, 난소암, 유방암, 자궁경부암, 갑상선암, 전립선암, 췌장암, 간암 및 폐암으로 이루어진 군에서 선택되는 1종 이상인 것인, 암의 예방 또는 치료용 조성물.
- 제13항에 있어서, 상기 조성물은 PBMC 세포 또는 NK 세포를 더 포함하는 것인, 암의 예방 또는 치료용 조성물.
- 제3항 또는 제7항의 항체 또는 이의 항원 결합 단편을 목적하는 시료와 반응시키는 단계를 포함하는, 암 진단 방법.
- 제16항에 있어서, 상기 암은 위암, 대장암, 신장암, 혈액암, 육종암, 난소암, 유방암, 자궁경부암, 갑상선암, 전립선암, 췌장암, 간암 및 폐암으로 이루어진 군에서 선택되는 1종 이상인 것인, 암 진단 방법.
- 제3항 또는 제7항의 항체 또는 이의 항원 결합 단편을 개체에 투여하는 단계를 포함하는, 암의 치료 방법.
Applications Claiming Priority (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| KR20220111246 | 2022-09-02 | ||
| KR10-2022-0111246 | 2022-09-02 | ||
| KR1020230089400A KR102644178B1 (ko) | 2022-09-02 | 2023-07-10 | 신규한 tmem165-clock 에피토프 및 이에 대한 항체 |
| KR10-2023-0089400 | 2023-07-10 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2024048978A1 true WO2024048978A1 (ko) | 2024-03-07 |
Family
ID=90098048
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/KR2023/009849 Ceased WO2024048978A1 (ko) | 2022-09-02 | 2023-07-11 | 신규한 tmem165-clock 에피토프 및 이에 대한 항체 |
Country Status (1)
| Country | Link |
|---|---|
| WO (1) | WO2024048978A1 (ko) |
-
2023
- 2023-07-11 WO PCT/KR2023/009849 patent/WO2024048978A1/ko not_active Ceased
Non-Patent Citations (5)
| Title |
|---|
| DATABASE Protein ANONYMOUS : "transmembrane protein 165 isoform X1 [Homo sapiens] -", XP093144011, retrieved from NCBI * |
| LEE JEE‑SAN, KIM MI‑YEUN, PARK EUN‑RAN, SHEN YAN, JEON JU‑YEON, CHO EUNG‑HO, PARK SUN‑HOO, HAN CHUL, CHOI DONG, JANG JA, SUH KYUNG: "TMEM165, a Golgi transmembrane protein, is a novel marker for hepatocellular carcinoma and its depletion impairs invasion activity", ONCOLOGY REPORTS, SPANDIDOS PUBL., vol. 40, 1 January 2018 (2018-01-01), pages 1297 - 1306, XP093144028, ISSN: 1021-335X, DOI: 10.3892/or.2018.6565 * |
| MURALI, PAVITRA: " Novel role for the Golgi membrane protein TMEM165 in control of migration and invasion for breast carcinoma", ONCOTARGET, vol. 11, no. 28, 14 July 2020 (2020-07-14), pages 2747 - 2762, XP093144017 * |
| RATHE SUSAN K ET AL: "Identification of candidate neoantigens produced by fusion transcripts in human osteosarcomas.", SCIENTIFIC REPORTS, NATURE PUBLISHING GROUP, US, vol. 9, no. 1, 23 January 2019 (2019-01-23), US , pages 1 - 11, XP002797841, ISSN: 2045-2322, DOI: 10.1038/s41598-018-36840-z * |
| SONG CHUNJIAO, CHEN HUAN: "Overview of research on fusion genes in prostate cancer", TRANSLATIONAL CANCER RESEARCH, vol. 9, no. 3, 1 March 2020 (2020-03-01), pages 1998 - 2011, XP093144013, ISSN: 2218-676X, DOI: 10.21037/tcr.2020.01.34 * |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| EP2552959B1 (en) | Antibodies to muc16 and methods of use thereof | |
| WO2020076105A1 (ko) | 신규 항-c-kit 항체 | |
| JP5982698B2 (ja) | Dll4に特異的に結合する新規モノクローナル抗体及びその用途 | |
| WO2015005632A1 (ko) | Dll4와 vegf에 특이적으로 결합하는 신규 이중표적 단백질 및 이의 용도 | |
| JP7667857B2 (ja) | 新規な腫瘍エンゲージャ治療剤の開発及び使用 | |
| WO2012112013A2 (en) | A marker comprising anti-ck8/18 complex autoantibody and its use for diagnosing cancer | |
| WO2017010744A1 (ko) | 엑소좀 단백질 eif3a 특이반응 오토항체검출용 항원 조성물 및 이를 이용한 간암진단법 | |
| WO2022025585A1 (ko) | 항-lilrb1 항체 및 그의 용도 | |
| WO2024090927A1 (ko) | 신규 항-cdcp1 항체 및 이의 용도 | |
| WO2023287096A1 (ko) | Chi3l1에 특이적인 인간화 단일클론항체를 포함하는 대식세포의 m2 분극화 억제 및 암의 치료용 조성물 | |
| WO2023022271A1 (ko) | 항-igsf1 항체 및 이의 용도 | |
| WO2011003369A1 (zh) | 一种新的肿瘤标志物 | |
| WO2019216675A1 (ko) | 조절 t 세포 표면 항원의 에피토프 및 이에 특이적으로 결합하는 항체 | |
| WO2014021693A2 (ko) | Tm4sf5 단백질에 특이적으로 결합하는 신규한 단일클론항체 및 이의 용도 | |
| WO2024048978A1 (ko) | 신규한 tmem165-clock 에피토프 및 이에 대한 항체 | |
| WO2016084993A1 (ko) | 신규 EGFRvIII 항체 및 이를 포함하는 조성물 | |
| KR102644178B1 (ko) | 신규한 tmem165-clock 에피토프 및 이에 대한 항체 | |
| WO2021029746A2 (ko) | 항-tie2 항체 및 이의 용도 | |
| WO2017074013A1 (ko) | 인간 및 마우스 sema3a에 교차결합하는 항체 및 그의 용도 | |
| WO2024196163A1 (ko) | 신규한 항-인간 알스폰딘3 항체 및 이의 용도 | |
| WO2023075318A1 (ko) | 암 생존자 유래 항체 및 이의 용도 | |
| WO2023153763A1 (ko) | C-met의 에피토프 및 hif1alpha의 에피토프를 포함하는 암 백신 및 이의 용도 | |
| WO2023027534A1 (ko) | 신규 항 muc1항체 및 이의 용도 | |
| WO2022005068A1 (ko) | Lgals3bp에 특이적으로 결합하는 항체 및 이의 용도 | |
| WO2022158844A1 (ko) | Igsf4의 막 관통 도메인을 발현하는 t 세포 및 이의 이용 |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 23860660 Country of ref document: EP Kind code of ref document: A1 |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| 122 | Ep: pct application non-entry in european phase |
Ref document number: 23860660 Country of ref document: EP Kind code of ref document: A1 |