WO2023229328A1 - 바이러스 뉴클레오캡시드를 이용한 목적 단백질 발현 플랫폼 - Google Patents

바이러스 뉴클레오캡시드를 이용한 목적 단백질 발현 플랫폼 Download PDF

Info

Publication number
WO2023229328A1
WO2023229328A1 PCT/KR2023/006958 KR2023006958W WO2023229328A1 WO 2023229328 A1 WO2023229328 A1 WO 2023229328A1 KR 2023006958 W KR2023006958 W KR 2023006958W WO 2023229328 A1 WO2023229328 A1 WO 2023229328A1
Authority
WO
WIPO (PCT)
Prior art keywords
target protein
expression vector
protein
coli
present
Prior art date
Application number
PCT/KR2023/006958
Other languages
English (en)
French (fr)
Inventor
손명현
김도다
박성현
김성재
김승후
Original Assignee
주식회사 백스다임
연세대학교 산학협력단
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by 주식회사 백스다임, 연세대학교 산학협력단 filed Critical 주식회사 백스다임
Priority to CN202380015893.4A priority Critical patent/CN118475592A/zh
Publication of WO2023229328A1 publication Critical patent/WO2023229328A1/ko

Links

Images

Classifications

    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/005—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09—Recombinant DNA-technology
    • C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/70—Vectors or expression systems specially adapted for E. coli
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2319/00—Fusion polypeptide
    • C07K2319/85—Fusion polypeptide containing an RNA binding domain
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2740/00—Reverse transcribing RNA viruses
    • C12N2740/00011—Details
    • C12N2740/10011—Retroviridae
    • C12N2740/16011—Human Immunodeficiency Virus, HIV
    • C12N2740/16022—New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes

Definitions

  • the present invention relates to a platform for expressing a target protein using a viral nucleocapsid. More specifically, the present invention provides an expression vector, a transformed host cell, that can efficiently express a target protein, especially an unexpressed protein that is insoluble in E. coli, in host cells, especially E. coli, using a viral nucleocapsid as a fusion partner. and a method for producing the target protein.
  • the main purpose of the present invention is to provide an expression vector that can efficiently express a target protein, particularly an unexpressed protein that is expressed insoluble in E. coli, in host cells, particularly E. coli.
  • Another object of the present invention is to provide a host cell that can be transformed with the expression vector to realize efficient expression of the target protein.
  • the present invention provides a target protein expression vector containing a polynucleotide encoding a viral nucleocapsid as a fusion partner for the target protein.
  • the present invention also includes the steps of constructing a target protein expression vector containing a polynucleotide encoding a target protein and a viral nucleocapsid as a fusion partner of the target protein; Preparing a transformant by introducing the target protein expression vector into a host cell; and cultivating the transformant. It provides a method for producing a target protein including a step.
  • a target protein especially an unexpressed protein that is expressed insoluble in E. coli, can be efficiently expressed in host cells, especially E. coli.
  • Figure 1 is intended to investigate the possibility of using viral nucleocapsid (NC) as a fusion partner, and shows the results of expressing NC together with a His-tag in E. coli and confirming it by SDS-PAGE.
  • NC viral nucleocapsid
  • Figure 2 is intended to investigate the possibility of using NC as a fusion partner, and shows the results of NC expressed in E. coli (expressed without His-tag) and confirmed by SDS-PAGE.
  • Figure 3 shows the results of introducing the expression vector according to one embodiment of the present invention into E. coli and confirming the expression of GFP, the target protein, by SDS-PAGE.
  • Figure 4 shows the results of confirming the expression of GFP, the target protein, by SDS-PAGE when the expression vector according to one embodiment of the present invention was introduced into E. coli and treated with different IPTG concentrations.
  • Figure 5 shows the results of measuring the fluorescence signal of GFP, the target protein expressed when the expression vector according to one embodiment of the present invention was introduced into E. coli and treated with different IPTG concentrations, using a microplate reader.
  • Figure 6 shows the results of introducing the expression vector according to one embodiment of the present invention into E. coli and confirming the expression of the target protein, IFN ⁇ , by SDS-PAGE.
  • Figure 7 shows the results of expressing IFN ⁇ in E. coli without a fusion partner and confirming it by SDS-PAGE.
  • Figure 8 shows the results of an analysis of the IFN ⁇ response by purifying the target protein, IFN ⁇ , according to the experiment in Figure 6 by Ni-affinity chromatography and then serially diluting it.
  • Figure 9 shows the amino acid sequences of mutant NC used in the experiment along with wild type NC and their interaction with zinc ions.
  • Figure 10 shows the results of confirming the expression of the fusion protein by SDS-PAGE when each NC of Figure 9 was applied.
  • Figure 11 shows that the expression vector according to one embodiment of the present invention is introduced into E. coli, the expression of the target protein, GFP, is induced, and then purified by zinc affinity chromatography, and the fluorescence signal of GFP is measured by SDS-PAGE. Indicates the results of analysis through measurement.
  • a vector that allows efficient expression of a target protein in a heterologous or homogeneous host cell includes a polynucleotide encoding a viral nucleocapsid as a fusion partner of the target protein. Vectors are provided.
  • target protein refers to a protein that a person skilled in the art would like to produce in large quantities, and refers to any protein that can be expressed in a host cell by inserting a polynucleotide encoding the protein into a recombinant vector.
  • the target protein may be one or more selected from the group consisting of antigen, antibody, cell receptor, enzyme, structural protein, serum, and cell protein, but is not limited thereto.
  • expression vector refers to a vector for introducing and expressing a polynucleotide encoding a polypeptide of interest into a heterologous or homogeneous host cell, using a circular or linear polynucleotide, for example, a DNA or RNA molecule. it means.
  • Expression vectors may contain promoter and/or terminator sequences, and may also contain components necessary for use as vectors, such as replication origins, selection markers, polyadenylation signals, etc.
  • the expression vector of the present invention may be a plasmid, viral vector, phage particle, or genome insert, and after being introduced into a host cell, it may be replicated independently of the host cell's genome or integrated into the host cell's genome.
  • the expression vector of the present invention may contain a polynucleotide encoding the target protein, or may be used later by including a polynucleotide encoding the target protein.
  • it may preferably include a restriction enzyme recognition site, commonly called a multiple cloning site (MCS), as a component that can easily include the polynucleotide encoding the target protein.
  • MCS multiple cloning site
  • the present invention when applying a viral nucleocapsid as a fusion partner of a target protein, efficiently converts the target protein into a water-soluble protein that is expressed insoluble, for example, when no fusion partner is used or when other existing fusion partners are used. , it is based on new research results showing that it can be manifested.
  • the fusion partner used in the present invention is very small in size (short-length peptide), it has the advantage of minimizing interference with the target protein.
  • the unique zinc binding domain of the viral nucleocapsid can be used.
  • the zinc-binding domain of the viral nucleocapsid for example, by using a zinc affinity purification method, the fusion protein can be easily purified without a separate component for purification, such as a histidine tag.
  • the viral nucleocapsid may be a previously known viral nucleocapsid, and the activity of the present invention, that is, the activity of acting as a fusion partner of the target protein to cause the target protein to be expressed solublely, especially in E. coli, is maintained. It may be a fragment or variant of the viral nucleocapsid.
  • the viral nucleocapsid may be a retrovirus, for example, a nucleocapsid of a retrovirus such as HIV-1, SIV, MuLV, etc.
  • the viral nucleocapsid is preferably a nucleocapsid of human immunodeficiency virus (HIV).
  • HIV human immunodeficiency virus
  • the viral nucleocapsid preferably has at least 50%, preferably at least 60%, more preferably at least 70%, more preferably at least 80%, and more preferably at least 90% of the amino acid sequence of SEQ ID NO: 1.
  • An amino acid sequence or sequence having a sequence identity of at least %, more preferably at least 95%, more preferably at least 96%, more preferably at least 97%, more preferably at least 98%, more preferably at least 99% Contains the amino acid sequence numbered 1.
  • the polynucleotide encoding the viral nucleocapsid preferably has at least 50%, preferably at least 60%, more preferably at least 70%, and more preferably at least 50% of the base sequence of SEQ ID NO: 2 or SEQ ID NO: 3. 80% or more, more preferably 90% or more, more preferably 95% or more, more preferably 96% or more, more preferably 97% or more, more preferably 98% or more, more preferably 99% or more. It includes a nucleotide sequence having more than sequence identity or a nucleotide sequence of SEQ ID NO: 2 or SEQ ID NO: 3.
  • sequence identity means sequence identity between an amino acid sequence and a reference amino acid sequence or between a nucleotide sequence and a reference nucleotide sequence. Sequence identity can be determined by comparing the positions of each sequence, which can be aligned for comparison purposes. When the positions of the comparative sequences are occupied by the same amino acids or bases, then the molecules are identical at those positions. The degree of identity between amino acid or nucleotide sequences is a function of the number of identical amino acids or nucleotides at positions shared by each amino acid or nucleotide sequence. Identity between two sequences can be calculated using various alignment algorithms and/or programs, including, for example, FASTA or BLAST.
  • the expression vector of the present invention may be used to express the target protein in cells selected from all living organisms, including prokaryotic and eukaryotic organisms, but is preferably used to express the target protein in Escherichia microorganisms, and more preferably in Escherichia coli. ( Escherichia coli ) to express the target protein.
  • the expression vector of the present invention includes other components, such as a cloning site for inserting a polynucleotide encoding a protein of interest, such as a restriction enzyme recognition site, such as a multiple cloning site (MCS); A linker sequence to provide spacing between the protein of interest and the fusion partner; tag sequences, such as histidine tagging sequences; And/or it may further include a protease recognition site coding sequence for cutting out part of the expressed fusion protein.
  • a cloning site for inserting a polynucleotide encoding a protein of interest such as a restriction enzyme recognition site, such as a multiple cloning site (MCS);
  • MCS multiple cloning site
  • tag sequences such as histidine tagging sequences;
  • it may further include a protease recognition site coding sequence for cutting out part of the expressed fusion protein.
  • Each of these may be arranged in various ways according to need, and may also be included in
  • the expression vector of the present invention is configured such that the viral nucleocapsid is linked to the N-terminus of the protein of interest.
  • the expression vector of the present invention includes a promoter, a viral nucleocapsid coding site, a target protein coding site, or a cloning site for inserting a target protein encoding polynucleotide (e.g., a restriction enzyme recognition site (e.g., multiple cloning site (MCS)) and a terminator are operably linked to the construct.
  • a restriction enzyme recognition site e.g., multiple cloning site (MCS)
  • MCS multiple cloning site
  • the expression vector of the present invention is configured such that the viral nucleocapsid is linked to the C-terminus of the target protein.
  • the expression vector of the present invention includes a promoter, a target protein coding site, or a cloning site (e.g., a restriction enzyme recognition site, For example, a multiple cloning site (MCS)), a viral nucleocapsid coding region, and a terminator are operably linked.
  • a promoter e.g., a restriction enzyme recognition site, For example, a multiple cloning site (MCS)
  • MCS multiple cloning site
  • the expression vector of the present invention can be applied by allowing the user to select whether to link the fusion partner to the N-terminus of the target protein or, conversely, to link the fusion partner to the C-terminus of the target protein. It is structured so that as a specific example of this embodiment, the expression vector of the present invention contains a promoter, a first cloning site for inserting a polynucleotide encoding the target protein, a viral nucleocapsid encoding site, and a polynucleotide encoding the target protein in order from 5' to 3' direction. It includes a construct to which a second cloning site for inserting a nucleotide and a terminator are operably linked.
  • the expression vector of the present invention as described above can be produced, for example, using a conventional recombination method based on an existing expression vector.
  • a host cell transformed with an expression vector for the target protein of the present invention is provided.
  • the host cell may be selected from the cells of all living organisms, including prokaryotic and eukaryotic cells, but is preferably a cell of Escherichia microorganism, and more preferably Escherichia coli .
  • transformation refers to introducing a polynucleotide into a host so that the polynucleotide becomes replicable as an extrachromosomal factor or by completing chromosomal integration.
  • the methods of transformation with the expression vector according to the present invention include electroporation, calcium phosphate (CaPO4) method, calcium chloride (CaCl2) method, microinjection, polyethylene glycol (PEG) method, and DEAE-dextran method. , cationic liposome method, or lithium acetate-DMSO method, but is not limited thereto.
  • a method capable of efficiently producing a target protein in a heterologous or homogeneous host cell includes a polynucleotide encoding a target protein and a viral nucleocapsid as a fusion partner of the target protein. Creating a target protein expression vector; Preparing a transformant by introducing the target protein expression vector into a host cell; A method for producing a target protein is provided, including the step of culturing the transformant.
  • a culture method known to be suitable for the host cell can be used.
  • the host cell is E. coli
  • a method of culturing in LB (Luria-Bertani) medium at a temperature of 16 to 37°C can be used.
  • the expression vector contains components of an antibiotic selection marker (e.g., an antibiotic ampicillin resistance gene)
  • E. coli containing the expression vector is cultured by adding the corresponding antibiotic (e.g., ampicillin) to the medium. Proliferation can be induced preferentially.
  • the expression vector contains components that regulate the transcription and/or translation of the DNA encoding the target protein, such as lac operon-related components, expression of the target protein can be induced by adding a related substance, such as IPTG. .
  • a vector was created to express the target protein, GFP (green fluorescent protein), with NC linked to the N-terminus as a fusion partner ( Figure 3).
  • the NC and GFP coding sequence regions are as in SEQ ID NO: 4, and the amino acid sequence of the NC+GFP fusion protein expected to be expressed is as in SEQ ID NO: 5.
  • a vector was created to express the target protein, human-derived interferon-beta (IFN ⁇ ), with NC linked to the N-terminus as a fusion partner (FIG. 6). At this time, six histidines were additionally applied for purification.
  • IFN ⁇ human-derived interferon-beta
  • Example 2 The same method as Example 1 was used, but the sequence of SEQ ID NO: 3, which is an E. coli codon optimization sequence, was used as the sequence encoding NC.
  • the NC and IFN ⁇ coding sequence regions are as shown in SEQ ID NO: 6, and the amino acid sequence of the NC+IFN ⁇ fusion protein expected to be expressed is as in SEQ ID NO: 7.
  • Example 2 Using the same method as in Example 2, a vector was created to express the target protein, human-derived IFN ⁇ , with six histidines connected to the N-terminus instead of NC as a fusion partner (FIG. 7).
  • coli were cultured in LB medium containing 50 ⁇ g/ml of ampicillin and 34 ⁇ g/ml of chloramphenicol. The culture temperature was set at 16 to 37°C.
  • IPTG is added at a level of 0 ⁇ M to 1mM to activate the T7 promoter. After adding IPTG, incubate at 30°C for 3 hours or at 16 to 20°C to ensure sufficient protein production. was cultured for about 16 hours. Sufficiently cultured E. coli were centrifuged, the supernatant was removed, and then stored. Next, 0.3 ml of PBS was added to the E.
  • coli harvest corresponding to 5 ml of LB medium and ultrasonic pulverization was performed to prepare a lysate. Then, the lysate was centrifuged and divided into soluble fraction and pellet fraction, and the total lysate, soluble fraction, and pellet fraction were separated and subjected to SDS-PAGE. was analyzed.
  • a vector was created to express the target protein, E. coli heat-labile enterotoxin B subunit (LTB), with NC linked to the N-terminus as a fusion partner. At this time, six histidines were additionally applied for purification, and the same method as Example 1 was used.
  • LTB E. coli heat-labile enterotoxin B subunit
  • a vector was constructed as in Example 3, but was expressed in a form in which cysteine (C) at positions 14, 17, and 27 in the NC amino acid sequence of SEQ ID NO: 1 were replaced with serine (S) ( Figure ⁇ ZF1 in 9). These residues, together with histidine (H) at position 22, are the residues that interact with zinc ions in the first zinc-binding domain of NC.
  • a vector was constructed as in Example 3, but was expressed in a form in which cysteines 35, 38, and 48 in the NC amino acid sequence of SEQ ID NO: 1 were replaced with serine ( ⁇ ZF2 in FIG. 9). These residues, together with histidine (H) at position 43, are the residues that interact with zinc ions in the second zinc binding domain of NC.
  • the vector was constructed as in Example 3, but was expressed in the NC amino acid sequence of SEQ ID NO: 1 in which cysteines at positions 14, 17, 27, 35, 38, and 48 were replaced with serine ( Figure 9 of ⁇ ZF1+2).
  • the vectors of Examples 3 to 6 were transformed into E. coli Shuffle/T7/pLysS in the same manner as Experimental Example 1, then production of fusion proteins was induced, and each produced fusion protein was analyzed by SDS-PAGE. analyzed.
  • Sequence name Nucleotide sequence encoding fusion protein of NC and GFP
  • Sequence name Amino acid sequence of fusion protein of NC and GFP
  • Sequence name Amino acid sequence of fusion protein of NC and IFN ⁇

Landscapes

  • Health & Medical Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Engineering & Computer Science (AREA)
  • Biophysics (AREA)
  • Biomedical Technology (AREA)
  • General Engineering & Computer Science (AREA)
  • Molecular Biology (AREA)
  • General Health & Medical Sciences (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Biochemistry (AREA)
  • Wood Science & Technology (AREA)
  • Zoology (AREA)
  • Biotechnology (AREA)
  • Microbiology (AREA)
  • Plant Pathology (AREA)
  • Physics & Mathematics (AREA)
  • Virology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Medicinal Chemistry (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Peptides Or Proteins (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)

Abstract

본 발명의 목적 단백질 발현 벡터는 목적 단백질의 융합 파트너로서 바이러스 뉴클레오캡시드를 암호화하는 폴리뉴클레오타이드를 포함한다. 또한, 본 발명의 목적 단백질 생산 방법은 목적 단백질 및 상기 목적 단백질의 융합 파트너로서 바이러스 뉴클레오캡시드를 암호화하는 폴리뉴클레오타이드를 포함하는 목적 단백질 발현 벡터를 제작하는 단계; 상기 목적 단백질 발현 벡터를 숙주 세포에 도입하여 형질전환체를 제조하는 단계; 및 상기 형질전환체를 배양하는 단계;를 포함한다.

Description

바이러스 뉴클레오캡시드를 이용한 목적 단백질 발현 플랫폼
본 발명은 바이러스 뉴클레오캡시드를 이용한 목적 단백질 발현 플랫폼에 관한 것이다. 보다 구체적으로, 본 발명은 바이러스 뉴클레오캡시드를 융합 파트너로 이용하여 목적 단백질, 특히 대장균에서 불용성으로 발현되는 난발현 단백질을 숙주 세포, 특히 대장균에서 효율적으로 발현시킬 수 있는 발현 벡터, 형질전환 숙주 세포 및 목적 단백질의 생산 방법에 관한 것이다.
현대의 생명공학에 있어서 핵심은 재조합 단백질의 생산이며, 그 중에서도 중요한 것은 재조합 단백질의 고유 활성을 유지하면서 다량으로 생산하는 것이다. 이렇게 생산된 재조합 단백질은 외래 단백질의 생산 및 회수, 기능 연구를 위한 결정화, 산업화 등에 매우 중요하다.
현재까지 대장균(Escherichia coli)을 이용한 많은 재조합 단백질 생산 연구가 진행되어 왔는데, 이는 대장균의 조작이 쉽고, 성장 시간이 짧고, 발현이 안정적이고, 비용이 적게 들고, 규모를 쉽게 바꿀 수 있는 장점이 있기 때문이다. 그러나, 대장균에서 생산된 외래 기원의 재조합 단백질은 발현 레벨이 낮거나, 적절한 "전사 후 샤페론(post-translational chaperons)"이나 "전사 후 과정(posttranslational processing)"이 없기 때문에, 생산된 재조합 단백질의 불가용성 단백질 응집체(inclusion body)로 형성되는 단점이 지적되고 있다(Francois Baneyx, Recombinant protein expression in Escherichia coli, Current Opinion in Biotechnology (1999), 10:411-421).
이러한 문제들을 해결하기 위하여 재조합 단백질에 MBP, NusA, SUMO, Thioredoxin 또는 GST 등과 같은 수용성이 높은 단백질을 융합시켜 발현시키는 방법이 개발되어 있으나(Dominic Esposito and Deb K Chatterjee, Enhancement of soluble protein expression through the use of fusion tags, Current Opinion in Biotechnology (2006), 17:353-358), 이들 또한 각각 기술적 한계가 있어 새로운 발현 기술의 개발이 요구되고 있다.
본 발명의 주된 목적은 목적 단백질, 특히 대장균에서 불용성으로 발현되는 난발현 단백질을 숙주 세포, 특히 대장균에서 효율적으로 발현시킬 수 있는 발현 벡터를 제공하는데 있다.
본 발명의 다른 목적은 상기 발현 벡터로 형질전환되어 상기 목적 단백질의 효율적인 발현을 실현할 수 있는 숙주 세포를 제공하는데 있다.
본 발명의 또 다른 목적은 상기 발현 벡터 및/또는 상기 숙주 세포를 이용하여 상기 목적 단백질을 효율적으로 생산할 수 있는 방법을 제공하는데 있다.
본 발명은 목적 단백질의 융합 파트너로서 바이러스 뉴클레오캡시드를 암호화하는 폴리뉴클레오타이드를 포함하는 목적 단백질 발현 벡터를 제공한다.
본 발명은 또한 상기 목적 단백질 발현 벡터로 형질전환된 숙주 세포를 제공한다.
본 발명은 또한 목적 단백질 및 상기 목적 단백질의 융합 파트너로서 바이러스 뉴클레오캡시드를 암호화하는 폴리뉴클레오타이드를 포함하는 목적 단백질 발현 벡터를 제작하는 단계; 상기 목적 단백질 발현 벡터를 숙주 세포에 도입하여 형질전환체를 제조하는 단계; 및 상기 형질전환체를 배양하는 단계;를 포함하는 목적 단백질 생산 방법을 제공한다.
본 발명에 따르면 목적 단백질, 특히 대장균에서 불용성으로 발현되는 난발현 단백질을 숙주 세포, 특히 대장균에서 효율적으로 발현시킬 수 있다.
도 1은 바이러스 뉴클레오캡시드(NC)의 융합 파트너로서의 활용 가능성을 조사하기 위한 것으로서, 대장균에서 NC를 His-tag와 함께 발현시키고 SDS-PAGE로 확인한 결과를 나타낸다.
도 2는 NC의 융합 파트너로서의 활용 가능성을 조사하기 위한 것으로서, 대장균에서 NC를 발현(His-tag 없이 발현)시키고 SDS-PAGE로 확인한 결과를 나타낸다.
도 3은 본 발명의 일 실시형태에 따른 발현 벡터를 대장균에 도입하고 목적 단백질인 GFP의 발현을 SDS-PAGE로 확인한 결과를 나타낸다.
도 4는 본 발명의 일 실시형태에 따른 발현 벡터를 대장균에 도입하고 IPTG 농도를 다르게 처리한 경우의 목적 단백질인 GFP의 발현을 SDS-PAGE로 확인한 결과를 나타낸다.
도 5는 본 발명의 일 실시형태에 따른 발현 벡터를 대장균에 도입하고 IPTG 농도를 다르게 처리한 경우 발현된 목적 단백질인 GFP의 형광 신호를 마이크로플레이트 리더로 측정한 결과를 나타낸다.
도 6은 본 발명의 일 실시형태에 따른 발현 벡터를 대장균에 도입하고 목적 단백질인 IFNβ의 발현을 SDS-PAGE로 확인한 결과를 나타낸다.
도 7은 융합 파트너 없이 대장균에서 IFNβ를 발현시키고 SDS-PAGE로 확인한 결과를 나타낸다.
도 8은 도 6의 실험에 따른 목적 단백질인 IFNβ를 Ni-친화성 크로마토그래피로 정제한 다음 연속 희석하여 IFNβ 반응 분석 실험을 수행한 결과를 나타낸다.
도 9는 야생형 NC(wild type)와 함께 실험에 사용한 돌연변이 NC의 아미노산 서열 및 이들과 아연 이온과의 상호작용을 나타낸다.
도 10은 도 9의 각 NC를 적용한 경우의 융합 단백질의 발현을 SDS-PAGE로 확인한 결과를 나타낸다.
도 11은 본 발명의 일 실시형태에 따른 발현 벡터를 대장균에 도입하고 목적 단백질인 GFP의 발현을 유도한 다음, 아연 친화성 크로마토그래피(Zinc affinity chromatography)로 정제하고 SDS-PAGE 및 GFP의 형광 신호 측정으로 분석한 결과를 나타낸다.
본 발명의 일 실시형태에 따르면, 목적 단백질을 이종 또는 동종의 숙주 세포에서 효율적으로 발현할 수 있도록 하는 벡터로서, 목적 단백질의 융합 파트너로서 바이러스 뉴클레오캡시드를 암호화하는 폴리뉴클레오타이드를 포함하는 목적 단백질 발현 벡터가 제공된다.
본 명세서에서 사용된 용어 "목적 단백질"(target protein)은 당업자가 대량으로 생산하고자 하는 단백질로서, 재조합 벡터에 상기 단백질을 암호화하는 폴리뉴클레오티드를 삽입하여 숙주 세포에서 발현이 가능한 모든 단백질을 의미한다.
본 발명에서 목적 단백질은 항원, 항체, 세포수용체, 효소, 구조 단백질, 혈청 및 세포 단백질로 이루어진 군으로부터 1종 이상 선택되는 것일 수 있으나, 이로 제한되는 것은 아니다.
본 명세서에서 사용된 용어 "발현 벡터"는 관심의 폴리펩티드를 암호화하는 폴리뉴클레오타이드를 이종 또는 동종의 숙주 세포에 도입하여 발현시키기 위한 벡터로서, 원형 또는 선형의 폴리뉴클레오타이드, 예를 들어 DNA 또는 RNA 분자를 의미한다. 발현 벡터는 프로모터 및/또는 터미네이터 서열을 포함할 수 있으며, 복제 개시점, 선택 마커, 폴리아데닐화 신호 등과 같은 벡터로 사용하기 위해 필요한 구성 요소 또한 포함할 수 있다.
본 발명의 발현 벡터는 플라스미드, 바이러스 벡터, 파지 입자 또는 게놈 삽입물일 수 있으며, 숙주 세포 내로 도입된 후, 숙주 세포의 게놈과 무관하게 복제되거나 숙주 세포의 게놈 내로 통합될 수 있다.
본 발명의 발현 벡터는 목적 단백질을 암호화하는 폴리뉴클레오타이드를 포함하는 것이거나, 추후 목적 단백질을 암호화하는 폴리뉴클레오타이드를 포함시켜 사용하기 위한 것일 수 있다. 특히 후자의 경우 바람직하게는 목적 단백질 암호화 폴리뉴클레오타이드를 용이하게 포함시킬 수 있는 구성 요소로서 통상 다중 클로닝 부위(Multi Cloning Site: MCS)라고 부르는 제한효소 인식 부위를 포함할 수 있다.
본 발명은 바이러스 뉴클레오캡시드를 목적 단백질의 융합 파트너로서 적용할 경우 목적 단백질을 효율적으로, 예를 들어 융합 파트너를 사용하지 않거나 다른 기존의 융합 파트너를 사용하는 경우에 불용성으로 발현되는 단백질을 수용성으로, 발현시킬 수 있다는 새로운 연구 결과를 바탕으로 한다.
특히, 본 발명에서 사용하는 융합 파트너는 그 크기가 매우 작기 때문에(짧은 길이의 펩타이드), 목적 단백질에 대한 간섭을 최소화할 수 있다는 장점이 있다.
또한, 본 발명에 따르면 바이러스 뉴클레오캡시드 고유의 아연 결합 도메인(zinc binding domain)을 이용할 수 있다는 장점이 있다. 예를 들어, 바이러스 뉴클레오캡시드의 아연 결합 도메인을 이용하면, 예를 들어 아연 친화성 정제 방법을 사용하면, 히스티딘 태그와 같은 정제를 위한 별도의 구성 요소 없이도 융합 단백질을 쉽게 정제할 수 있다.
본 발명에서 바이러스 뉴클레오캡시드는 기존에 알려진 바이러스 뉴클레오캡시드일 수 있으며, 본 발명의 활성, 즉 목적 단백질의 융합 파트너로서 작용하여 목적 단백질이, 특히 대장균에서, 수용성으로 발현되도록 하는 활성이 유지되는 한 상기 바이러스 뉴클레오캡시드의 단편 또는 변이체일 수도 있다.
본 발명에서 바이러스 뉴클레오캡시드는 레트로바이러스, 예를 들어 HIV-1, SIV, MuLV 등과 같은 레트로바이러스의 뉴클레오캡시드일 수 있다.
본 발명에서 바이러스 뉴클레오캡시드는 바람직하게는 인간면역결핍바이러스(human immunodeficiency virus: HIV)의 뉴클레오캡시드이다.
본 발명에서 바이러스 뉴클레오캡시드는 바람직하게는 서열번호 1의 아미노산 서열과 50% 이상, 바람직하게는 60% 이상, 보다 바람직하게는 70% 이상, 보다 바람직하게는 80% 이상, 보다 바람직하게는 90% 이상, 보다 바람직하게는 95% 이상, 보다 바람직하게는 96% 이상, 보다 바람직하게는 97% 이상, 보다 바람직하게는 98% 이상, 보다 바람직하게는 99% 이상의 서열 동일성을 갖는 아미노산 서열 또는 서열번호 1의 아미노산 서열을 포함한다. 바람직하게는 서열번호 1에서 14번, 17번, 22번 및 27번의 서열을 유지하면서, 보다 바람직하게는 14번, 17번, 22번, 27번, 35번, 38번, 43번 및 48번의 서열을 유지하면서, 보다 바람직하게는 6번, 9번, 10번, 13번, 14번, 17번, 19번, 22번, 25번, 27번, 28번, 31번, 32번, 33번, 35번, 37번, 38번, 40번, 43번, 46번, 48번 및 51번의 서열을 유지하면서, 상기 서열 동일성을 만족하는 아미노산 서열을 포함한다.
본 발명에서 바이러스 뉴클레오캡시드를 암호화하는 폴리뉴클레오타이드는 바람직하게는 서열번호 2 또는 서열번호 3의 염기 서열과 50% 이상, 바람직하게는 60% 이상, 보다 바람직하게는 70% 이상, 보다 바람직하게는 80% 이상, 보다 바람직하게는 90% 이상, 보다 바람직하게는 95% 이상, 보다 바람직하게는 96% 이상, 보다 바람직하게는 97% 이상, 보다 바람직하게는 98% 이상, 보다 바람직하게는 99% 이상의 서열 동일성을 갖는 염기 서열 또는 서열번호 2 또는 서열번호 3의 염기 서열을 포함한다. 바람직하게는 서열번호 1에서 14번, 17번, 22번 및 27번의 서열을 유지하는, 보다 바람직하게는 14번, 17번, 22번, 27번, 35번, 38번, 43번 및 48번의 서열을 유지하는, 보다 바람직하게는 6번, 9번, 10번, 13번, 14번, 17번, 19번, 22번, 25번, 27번, 28번, 31번, 32번, 33번, 35번, 37번, 38번, 40번, 43번, 46번, 48번 및 51번의 서열을 유지하는 아미노산 서열을 암호화하면서, 상기 서열 동일성을 만족하는 염기 서열을 포함한다.
본 명세서에서 서열 동일성은 아미노산 서열과 참조 아미노산 서열 사이 또는 뉴클레오타이드 서열과 참조 뉴클레오타이드 서열 사이의 서열 동일성을 의미한다. 서열 동일성은 비교 목적으로 정렬될 수 있는 각 서열의 위치를 비교하여 결정할 수 있다. 비교 서열의 위치를 같은 아미노산 또는 염기가 차지하는 경우, 이때 분자들은 그 위치에서 동일하다. 아미노산 또는 뉴클레오타이드 서열들 사이의 동일성 정도는 각각 아미노산 또는 뉴클레오타이드 서열에 의해 공유되는 위치에서 동일한 아미노산 또는 뉴클레오타이드의 수의 함수이다. 예를 들어, FASTA 또는 BLAST를 포함하는 다양한 정렬 알고리즘 및/또는 프로그램을 사용하여 두 서열 사이의 동일성을 계산할 수 있다.
본 발명의 발현 벡터는 원핵 및 진핵을 포함한 모든 생물 중에서 선택된 세포에서 목적 단백질을 발현하기 위한 것일 수 있으나, 바람직하게는 대장균속(Escherichia) 미생물에서 목적 단백질을 발현하기 위한 것이며, 보다 바람직하게는 대장균(Escherichia coli)에서 목적 단백질을 발현하기 위한 것이다.
본 발명의 발현 벡터는 다른 구성 요소, 예를 들어 목적 단백질 암호화 폴리뉴클레오타이드를 삽입하기 위한 클로닝 부위, 예를 들어 제한효소 인식 부위, 예를 들어 다중 클로닝 부위(MCS); 목적 단백질과 융합 파트너 사이의 간격을 부여하기 위한 링커 서열; 태그 서열, 예를 들어 히스티딘 태깅 서열; 및/또는 발현된 융합 단백질의 일부를 잘라내기 위한 프로테아제 인식 부위 암호화 서열을 더 포함할 수 있다. 이들 각각은 필요에 따라 다양하게 배치될 수 있으며, 또한 다양한 수로 포함될 수 있다.
구체적인 일 실시형태에서, 본 발명의 발현 벡터는 목적 단백질의 N-말단에 바이러스 뉴클레오캡시드가 연결되도록 구성된다. 이러한 실시형태의 구체적인 예시로서, 본 발명의 발현 벡터는 5'에서 3' 방향으로 순서대로 프로모터, 바이러스 뉴클레오캡시드 암호화 부위, 목적 단백질 암호화 부위 또는 목적 단백질 암호화 폴리뉴클레오타이드를 삽입하기 위한 클로닝 부위(예를 들어 제한효소 인식 부위, 예를 들어 다중 클로닝 부위(MCS)) 및 터미네이터가 작동 가능하게 연결된 컨스트럭트를 포함한다.
다른 구체적인 일 실시형태에서, 본 발명의 발현 벡터는 목적 단백질은 C-말단에 바이러스 뉴클레오캡시드가 연결되도록 구성된다. 이러한 실시형태의 구체적인 예시로서, 본 발명의 발현 벡터는 5'에서 3' 방향으로 순서대로 프로모터, 목적 단백질 암호화 부위 또는 목적 단백질 암호화 폴리뉴클레오타이드를 삽입하기 위한 클로닝 부위(예를 들어 제한효소 인식 부위, 예를 들어 다중 클로닝 부위(MCS)), 바이러스 뉴클레오캡시드 암호화 부위 및 터미네이터가 작동 가능하게 연결된 컨스트럭트를 포함한다.
또 다른 구체적인 일 실시형태에서, 본 발명의 발현 벡터는 사용자가 목적 단백질의 N-말단에 융합 파트너를 연결시킬 것인지, 반대로 목적 단백질의 C-말단에 융합 파트너를 연결시킬 것인지를 선택하여 적용할 수 있도록 구성된다. 이러한 실시형태의 구체적인 예시로서, 본 발명의 발현 벡터는 5'에서 3' 방향으로 순서대로 프로모터, 목적 단백질 암호화 폴리뉴클레오타이드를 삽입하기 위한 제1클로닝 부위, 바이러스 뉴클레오캡시드 암호화 부위, 목적 단백질 암호화 폴리뉴클레오타이드를 삽입하기 위한 제2클로닝 부위 및 터미네이터가 작동 가능하게 연결된 컨스트럭트를 포함한다.
본 발명의 발현 벡터는 목적 단백질 및 융합 파트너 암호화 DNA의 전사(transcription)가 박테리오파지 T7 시스템에 의해 조절되도록 T7 프로모터 및 T7 터미네이터를 포함할 수 있다. 이에 따르면 대장균에서 목적 단백질의 보다 효과적인 생산이 가능하다.
상기와 같은 본 발명의 발현 벡터는 예를 들어 기존의 발현 벡터를 기반으로 통상적인 재조합 방식을 사용하여 제작할 수 있다.
본 발명의 다른 일 실시형태에 따르면, 본 발명의 목적 단백질 발현 벡터로 형질전환된 숙주 세포가 제공된다.
본 발명에서 숙주 세포는 원핵 및 진핵을 포함한 모든 생물의 세포에서 선택된 것일 수 있으나, 바람직하게는 대장균속(Escherichia) 미생물의 세포이며, 보다 바람직하게는 대장균(Escherichia coli)이다.
본 명세서에서 사용된 용어 "형질전환" 또는 "도입"은 폴리뉴클레오타이드를 숙주로 도입하여 폴리뉴클레오타이드가 염색체외 인자로서 또는 염색체 통합 완성에 의해 복제 가능하게 되는 것을 의미한다. 본 발명에 따른 발현 벡터로 형질전환시키는 방법은 전기천공법(electrophoration), 인산칼슘(CaPO4)법, 염화칼슘(CaCl2)법, 미세주입법(microinjection), 폴리에틸렌글리콜(PEG)법, DEAE-덱스트란법, 양이온 리포좀법 또는 초산 리튬-DMSO법을 포함할 수 있으나, 이로 제한되는 것은 아니다.
본 발명의 또 다른 일 실시형태에 따르면, 목적 단백질을 이종 또는 동종의 숙주 세포에서 효율적으로 생산할 수 있는 방법으로서, 목적 단백질 및 상기 목적 단백질의 융합 파트너로서 바이러스 뉴클레오캡시드를 암호화하는 폴리뉴클레오타이드를 포함하는 목적 단백질 발현 벡터를 제작하는 단계; 상기 목적 단백질 발현 벡터를 숙주 세포에 도입하여 형질전환체를 제조하는 단계; 및 상기 형질전환체를 배양하는 단계;를 포함하는 목적 단백질 생산 방법이 제공된다.
이때 목적 단백질 발현 벡터에 관한 사항 및 목적 단백질 발현 벡터의 도입에 관한 사항 등의 구체적인 사항은 앞서 기술된 사항을 참조할 수 있다.
형질전환체의 배양을 위해 숙주 세포에 적합한 것으로 알려진 배양 방법을 사용할 수 있다. 예를 들어, 숙주 세포가 대장균인 경우, LB(Luria-Bertani) 배지에서 16 내지 37℃의 온도로 배양하는 방법을 사용할 수 있다. 발현 벡터에 항생제 선별 마커(예를 들어, 항생제인 암피실린(ampicillin) 저항성 유전자)의 구성 요소가 있다면, 이때 배지에 해당 항생제(예를 들어, 암피실린)를 첨가하여 배양함으로써 발현 벡터가 포함된 대장균의 증식을 우선적으로 유도할 수 있다. 또한 발현 벡터에 목적 단백질 암호화 DNA의 전사 및/또는 번역을 조절하는 구성 요소, 예를 들어 lac 오페론 관련 구성 요소가 있다면, 관련 물질, 예를 들어 IPTG를 첨가하여 목적 단백질의 발현을 유도할 수 있다.
이하의 실시예는 발명의 이해를 돕기 위해 제시한 것으로 하기 내용이 발명의 보호범위를 한정하는 것은 아니다.
[실시예]
제조예 1
바이러스 뉴클레오캡시드(NC)의 융합 파트너로서의 활용 가능성을 조사하기 위해, HIV 바이러스의 NC를 발현시키기 위한 벡터를 제작하였다(도 1). 이때 정제를 위한 6개의 히스티딘도 추가 적용하였다.
목적 단백질의 발현이 T7 프로모터에 의해 조절되도록 설계된 pGEMEX-1(Promega) 벡터를 기반으로 제작하였으며, NC를 암호화하는 서열로서 서열번호 2의 서열을 사용하였다.
제조예 2
상기 제조예 1과 비교하여 6개의 히스티딘이 제외된 형태로 발현시키기 위한 벡터를 제작하였다(도 2).
실시예 1
목적 단백질인 GFP(green fluorescent protein)를 N-말단에 NC가 융합 파트너로 연결된 형태로 발현시키기 위한 벡터를 제작하였다(도 3).
상기 제조예 2와 같은 방식을 사용하되, pGEMEX-1(Promega) 벡터의 MCS에 NC를 암호화하는 서열(서열번호 2)과 목적 단백질 암호화 서열을 삽입하였다.
제작된 벡터에서 NC 및 GFP 암호화 서열 부위는 서열번호 4와 같으며, 발현될 것으로 예상되는 NC+GFP 융합 단백질의 아미노산 서열은 서열번호 5와 같다.
실시예 2
목적 단백질인 인간 유래 IFNβ(interferon-beta)를 N-말단에 NC가 융합 파트너로 연결된 형태로 발현시키기 위한 벡터를 제작하였다(도 6). 이때 정제를 위한 6개의 히스티딘도 추가 적용하였다.
상기 실시예 1과 같은 방식을 사용하되, NC를 암호화하는 서열로서 대장균 코돈 최적화 서열인 서열번호 3의 서열을 사용하였다.
제작된 벡터에서 NC 및 IFNβ 암호화 서열 부위는 서열번호 6과 같으며, 발현될 것으로 예상되는 NC+IFNβ 융합 단백질의 아미노산 서열은 서열번호 7과 같다.
비교예 1
상기 실시예 2와 같은 방식을 사용하되, 목적 단백질인 인간 유래 IFNβ를 NC가 융합 파트너로 연결되지 않고 N-말단에 6개의 히스티딘이 연결된 형태로 발현시키기 위한 벡터를 제작하였다(도 7).
실험예 1
상기 제조예 1, 제조예 2, 실시예 1, 실시예 2 및 비교예 1의 벡터를 대장균 Shuffle/T7/pLysS에 형질전환시켜 배양하였다. Shuffle/T7/pLysS는 BL21 star (DE3) pLysS One Shot™ vitrogen™ competent 대장균에서 pLysS 플라스미드를 Mini-prep을 통해 추출하고 pLysS를 SHuffle®T7(NEB) competent 대장균에 도입한 후 pLysS에 포함되어 있는 항생제 마커인 클로람페니콜(chloramphenicol: CM)로 선별해서 만든 것이다. 모든 형질전환된 대장균은 50㎍/㎖의 암피실린(ampicillin) 및 34㎍/㎖의 클로람페니콜이 포함된 LB 배지에서 배양하였다. 배양 온도는 16 내지 37℃로 설정하였다. 대장균의 OD600값이 0.5 이상이 되면, T7 프로모터를 활성화시키기 위해 IPTG를 0μM 내지 1mM 수준으로 첨가하고, 단백질이 충분히 생산될 수 있도록, IPTG를 넣어준 이후부터 30℃에서는 3시간 또는 16 ~ 20℃에서는 16시간 정도를 배양하였다. 충분히 배양된 대장균은 원심분리하여 상등액을 제거한 후에 보관하였다. 그 다음, LB 배지의 5㎖에 해당되는 대장균 수확물에 PBS 0.3㎖을 넣고 초음파 분쇄를 하여, 용해물(lysate)을 만들었다. 그리고 용해물을 원심분리하여 용해 분획(soluble fraction)과 펠렛 분획(pellet fraction)으로 나누었고, 총 용해물(total lysate), 용해 분획(soluble fraction), 펠렛 분획(pellet fraction)을 구분하여 SDS-PAGE로 분석하였다.
먼저 제조예 1 및 제조예 2의 벡터를 각각 대장균에 도입하여 NC의 발현을 유도한 결과, 도 1 및 도 2와 같이, 16℃ 및 20℃ 모두에서 정상적으로, 즉 예상되는 크기 및 수용성으로, 대량으로 발현되는 것으로 나타났다. 특히, 도 2와 같이, His-tag가 없는 경우에도 거의 100% 수용성으로 발현되는 것으로 나타났다. 이는 NC가 목적 단백질의 발현 효율 증가 목적, 특히 수용성으로 발현되도록 하는 목적의 융합 파트너 용도로서 활용될 가능성이 있음을 보여준다.
실시예 1의 벡터를 대장균에 도입하여 목적 단백질인 GFP의 발현을 유도한 결과, 도 3과 같이, 16℃ 및 20℃ 모두에서 정상적으로 발현되는 것으로 나타났다. GFP는 대장균에서 불용성으로 발현되는 것으로 알려져 있다. 따라서 이러한 결과는 본 발명의 방식에 따르면 대장균에서 불용성으로 발현되는 단백질을 수용성으로 발현시킬 수 있음을 보여준다.
추가로, 실시예 1의 벡터를 대장균에 도입하고 IPTG 농도를 다르게 처리한 경우의 GFP 발현을 조사한 결과, 도 4와 같이, IPTG가 저농도인 경우에도 IPTG의 농도에 비례하여 효율적으로 발현되는 것으로 나타났으며, 발현된 단백질의 GFP 형광 신호를 마이크로플레이트 리더로 측정한 결과, 도 5와 같이, IPTG의 농도에 비례하여 GFP 형광 신호가 증가하는 것으로 나타났다. 이는 본 발명의 방식에 따르면 목적 단백질을 본래의 기능을 유지한 상태로 효율적으로 발현시킬 수 있음을 보여준다.
실시예 2 및 비교예 1의 벡터를 각각 대장균에 도입하여 목적 단백질인 IFNβ의 발현을 유도한 결과, 도 6 및 도 7과 같이, 실시예 2의 경우, 비록 30℃에서 불용성으로 발현되는 비율이 상대적으로 높기는 하였지만, 16℃ 및 30℃ 모두에서 많은 양의 단백질이 정상적으로, 특히 수용성으로 발현되는 것으로 나타난 반면, 비교예 1의 경우, 대부분의 단백질이 불용성으로 발현되는 것으로 나타났다. 이는 본 발명의 방식에 따르면 대장균에서 불용성으로 발현되는 단백질을 수용성으로 발현시킬 수 있음을 보여준다.
추가로, 실시예 2의 벡터를 대장균에 도입하여 목적 단백질인 IFNβ의 발현을 유도하고 Ni-친화성 크로마토그래피로 정제한 다음 초기 200nM을 기준으로 1/2 연속 희석하여 IFNβ 반응 분석(Invivogen) 실험을 진행한 결과, 도 8과 같이, 정제물에서 IFNβ 반응이 확인되며, 이러한 IFNβ 반응이 희석 배수가 증가함에 따라 감소하는 것으로 나타났다. 이때 대조군(Con)으로는 배지를 사용하였다. 이러한 결과는 본 발명의 방식에 따르면 목적 단백질을 본래의 기능을 유지한 상태로 효율적으로 발현시킬 수 있음을 보여준다.
실시예 3
목적 단백질인 대장균 이열성 장독소 B 서브유닛(heat-labile enterotoxin B subunit, LTB)을 N-말단에 NC가 융합 파트너로 연결된 형태로 발현시키기 위한 벡터를 제작하였다. 이때 정제를 위한 6개의 히스티딘을 추가 적용하였고, 상기 실시예 1과 같은 방식을 사용하였다.
실시예 4
상기 실시예 3과 같이 벡터를 제작하되, 서열번호 1의 NC 아미노산 서열에서 14번, 17번 및 27번의 시스테인(cysteine: C)이 세린(serine: S)으로 치환된 형태로 발현되도록 하였다(도 9의 ΔZF1). 이들 잔기는 22번의 히스티딘(histidine: H)과 함께 NC의 첫 번째 아연 결합 도메인에서 아연 이온과 상호작용하는 잔기이다.
실시예 5
상기 실시예 3과 같이 벡터를 제작하되, 서열번호 1의 NC 아미노산 서열에서 35번, 38번 및 48번의 시스테인이 세린으로 치환된 형태로 발현되도록 하였다(도 9의 ΔZF2). 이들 잔기는 43번의 히스티딘(H)과 함께 NC의 두 번째 아연 결합 도메인에서 아연 이온과 상호작용하는 잔기이다.
실시예 6
상기 실시예 3과 같이 벡터를 제작하되, 서열번호 1의 NC 아미노산 서열에서 14번, 17번, 27번, 35번, 38번 및 48번의 시스테인이 세린으로 치환된 형태로 발현되도록 하였다(도 9의 ΔZF1+2).
실험예 2
상기 실시예 3 내지 실시예 6의 벡터를 상기 실험예 1과 같은 방식으로 대장균 Shuffle/T7/pLysS에 형질전환시킨 다음, 융합 단백질의 생산을 유도하고, 각각의 생산된 융합 단백질을 SDS-PAGE로 분석하였다.
이의 결과, 도 10과 같이, 실시예 3 및 실시예 5의 경우 거의 대부분의 융합 단백질이 정상적으로 수용성으로 발현되는 것으로 나타난 반면, 실시예 4 및 실시예 6의 경우 수용성으로 발현되는 융합 단백질의 비율이 약 50% 정도로 감소한 것으로 나타났다. 이는 NC의 첫 번째 아연 결합 도메인에서 아연 이온과 상호작용하는 잔기가 목적 단백질의 수용성 발현에 중요함을 보여준다.
실험예 3
상기 실시예 1의 벡터를 상기 실험예 1과 같은 방식으로 대장균 Shuffle/T7/pLysS에 형질전환시킨 다음, 융합 단백질의 생산을 유도하고, 아연 친화성 크로마토그래피(Zinc affinity chromatography)로 정제한 다음 SDS-PAGE 및 GFP 형광 신호 측정(마이크로플레이트 리더 사용)으로 분석하였다.
이의 결과, 도 11과 같이, 아연 친화성 크로마토그래피를 통해 상당히 높은 회수율로 융합 단백질을 정제할 수 있는 것으로 나타났다. 이는 히스티딘 태그와 같은 별도의 정제용 태그 없이 NC의 아연 결합 도메인을 이용하여 효율적인 정제가 가능함을 보여준다.
이제까지 본 발명에 대하여 그 바람직한 실시예들을 중심으로 살펴보았다. 본 발명이 속하는 기술 분야에서 통상의 지식을 가진 자는 본 발명이 본 발명의 본질적인 특성에서 벗어나지 않는 범위에서 변형된 형태로 구현될 수 있음을 이해할 수 있을 것이다. 그러므로 개시된 실시예들은 한정적인 관점이 아니라 설명적인 관점에서 고려되어야 한다. 본 발명의 범위는 전술한 설명이 아니라 특허청구범위에 나타나 있으며, 그와 동등한 범위 내에 있는 모든 차이점은 본 발명에 포함된 것으로 해석되어야 할 것이다.
<서열목록>
서열번호 1
서열명칭 : Amino acid sequence of HIV nucleocapsid
서열타입 : AA
생물명 : human immunodeficiency virus
서열 :
QRGNFRNQRKTVKCFNCGKEGHIAKNCRAPRKKGCWRCGREGHQMKDCTERQAN
서열번호 2
서열명칭 : Nucleotide sequence encoding HIV nucleocapsid
서열타입 : DNA
생물명 : human immunodeficiency virus
서열 :
CAGCGGGGAAACTTCAGGAACCAGAGAAAAACTGTGAAGTGCTTCAATTGCGGAAAGGAGGGCCACATCGCTAAGAACTGCCGCGCCCCCAGAAAGAAAGGCTGCTGGAGATGCGGCAGAGAGGGCCACCAGATGAAGGACTGCACAGAGAGACAGGCAAAC
서열번호 3
서열명칭 : Nucleotide sequence encoding HIV nucleocapsid
서열타입 : DNA
생물명 : synthetic construct
서열 :
CAGCGTGGTAACTTCCGTAACCAGCGTAAAACCGTTAAATGCTTCAACTGCGGCAAAGAAGGCCACATCGCGAAAAACTGCCGTGCGCCGCGTAAAAAAGGCTGCTGGCGTTGCGGCCGTGAAGGCCACCAGATGAAAGATTGCACCGAACGTCAGGCGAAC
서열번호 4
서열명칭 : Nucleotide sequence encoding fusion protein of NC and GFP
서열타입 : DNA
생물명 : synthetic construct
서열 :
AGTAAAGGAGAAGAACTTTTCACTGGAGTTGTCCCAATTCTTGTTGAATTAGATGGTGATGTTAATGGGCACAAATTTTCTGTCAGTGGAGAGGGTGAAGGTGATGCAACATACGGAAAACTTACCCTTAAATTTATTTGCACTACTGGAAAACTACCTGTTCCATGGCCAACACTTGTCACTACTTTCTCTTATGGTGTTCAATGCTTTTCAAGATACCCAGATCATATGAAACGGCATGACTTTTTCAAGAGTGCCATGCCCGAAGGTTATGTACAGGAAAGAACTATATTTTTCAAAGATGACGGGAACTACAAGACACGTGCTGAAGTCAAGTTTGAAGGTGATACCCTTGTTAATAGAATCGAGTTAAAAGGTATTGATTTTAAAGAAGATGGAAACATTCTTGGACACAAATTGGAATACAACTATAACTCACACAATGTATACATCATGGCAGACAAACAAAAGAATGGAATCAAAGTTAACTTCAAAATTAGACACAACATTGAAGATGGAAGCGTTCAACTAGCAGACCATTATCAACAAAATACTCCAATTGGCGATGGCCCTGTCCTTTTACCAGACAACCATTACCTGTCCACACAATCTGCCCTTTCGAAAGATCCCAACGAAAAGAGAGACCACATGGTCCTTCTTGAGTTTGTAACAGCTGCTGGGATTACACATGGCATGGATGAACTATACAAA
서열번호 5
서열명칭 : Amino acid sequence of fusion protein of NC and GFP
서열타입 : AA
생물명 : synthetic construct
서열 :
SKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKRHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK
서열번호 6
서열명칭 : Nucleotide sequence encoding fusion protein of NC and IFNβ
서열타입 : DNA
생물명 : synthetic construct
서열 :
AAATCTTACAACCTGCTGGGCTTCCTGCAGCGTTCCTCCAACTTCCAGTGCCAGAAGCTGCTGTGGCAGCTGAACGGTCGCCTGGAATACTGCCTGAAAGATCGTATGAACTTCGATATCCCGGAAGAAATCAAACAGTTGCAGCAGTTCCAGAAAGAAGATGCGGCGTTAACCATCTACGAAATGCTGCAAAACATTTTCGCTATCTTCCGTCAGGATTCCAGCTCCACCGGCTGGAACGAAACCATCGTTGAAAACCTTCTGGCGAACGTTTATCACCAGATCAATCATCTGAAAACCGTGCTGGAAGAGAAACTGGAAAAAGAAGACTTCACCCGTGGTAAACTGATGTCCTCGCTGCACCTGAAGCGTTACTACGGTCGTATCCTGCATTATCTGAAAGCGAAAGAGTACAGCCACTGCGCTTGGACCATTGTTCGTGTTGAAATTCTGCGCAATTTCTACTTCATCAACCGTCTGACCGGTTACCTGCGTAAC
서열번호 7
서열명칭 : Amino acid sequence of fusion protein of NC and IFNβ
서열타입 : AA
생물명 : synthetic construct
서열 :
KSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINRLTGYLRN

Claims (11)

  1. 목적 단백질의 융합 파트너로서 바이러스 뉴클레오캡시드를 암호화하는 폴리뉴클레오타이드를 포함하는 목적 단백질 발현 벡터.
  2. 제1항에 있어서,
    상기 목적 단백질은 항원, 항체, 세포수용체, 효소, 구조 단백질, 혈청 및 세포 단백질로 이루어진 군으로부터 1종 이상 선택되는 것인, 목적 단백질 발현 벡터.
  3. 제1항에 있어서,
    상기 바이러스 뉴클레오캡시드는 인간면역결핍바이러스의 뉴클레오캡시드인, 목적 단백질 발현 벡터.
  4. 제1항에 있어서,
    상기 바이러스 뉴클레오캡시드는 서열번호 1의 아미노산 서열을 포함하는, 목적 단백질 발현 벡터.
  5. 제1항에 있어서,
    상기 벡터는 목적 단백질을 대장균에서 발현하기 위한 것인, 목적 단백질 발현 벡터.
  6. 제1항 내지 제5항 중 어느 한 항의 목적 단백질 발현 벡터로 형질전환된 숙주 세포.
  7. 목적 단백질 및 상기 목적 단백질의 융합 파트너로서 바이러스 뉴클레오캡시드를 암호화하는 폴리뉴클레오타이드를 포함하는 목적 단백질 발현 벡터를 제작하는 단계;
    상기 목적 단백질 발현 벡터를 숙주 세포에 도입하여 형질전환체를 제조하는 단계; 및
    상기 형질전환체를 배양하는 단계;를 포함하는 목적 단백질 생산 방법.
  8. 제7항에 있어서,
    상기 목적 단백질은 항원, 항체, 세포수용체, 효소, 구조 단백질, 혈청 및 세포 단백질로 이루어진 군으로부터 1종 이상 선택되는 것인, 목적 단백질 생산 방법.
  9. 제7항에 있어서,
    상기 바이러스 뉴클레오캡시드는 인간면역결핍바이러스의 뉴클레오캡시드인, 목적 단백질 생산 방법.
  10. 제7항에 있어서,
    상기 바이러스 뉴클레오캡시드는 서열번호 1의 아미노산 서열을 포함하는, 목적 단백질 생산 방법.
  11. 제7항에 있어서,
    상기 숙주 세포는 대장균인, 목적 단백질 생산 방법.
PCT/KR2023/006958 2022-05-23 2023-05-23 바이러스 뉴클레오캡시드를 이용한 목적 단백질 발현 플랫폼 WO2023229328A1 (ko)

Priority Applications (1)

Application Number Priority Date Filing Date Title
CN202380015893.4A CN118475592A (zh) 2022-05-23 2023-05-23 使用病毒核衣壳的靶蛋白表达平台

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
KR10-2022-0062789 2022-05-23
KR20220062789 2022-05-23

Publications (1)

Publication Number Publication Date
WO2023229328A1 true WO2023229328A1 (ko) 2023-11-30

Family

ID=88919674

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/KR2023/006958 WO2023229328A1 (ko) 2022-05-23 2023-05-23 바이러스 뉴클레오캡시드를 이용한 목적 단백질 발현 플랫폼

Country Status (3)

Country Link
KR (1) KR102617593B1 (ko)
CN (1) CN118475592A (ko)
WO (1) WO2023229328A1 (ko)

Citations (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1997044064A2 (en) * 1996-05-20 1997-11-27 The Government Of The United States Of America, Represented By The Secretary, Department Of Health And Human Services Oligonucleotides which specifically bind retroviral nucleocapsid proteins
KR100368073B1 (ko) * 1999-03-09 2003-01-24 한국생명공학연구원 융합파트너를 이용한 재조합 단백질의 제조방법
KR20130020206A (ko) * 2011-08-19 2013-02-27 연세대학교 산학협력단 수용성 ｂｍｐ-2를 생산하는 재조합 대장균 및 이를 이용한 수용성 ｂｍｐ-2의 제조방법
KR20160088012A (ko) * 2015-01-15 2016-07-25 고려대학교 산학협력단 CysQ를 융합파트너로 이용한 재조합 단백질의 제조방법

Family Cites Families (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR100844497B1 (ko) 2007-01-22 2008-07-08 연세대학교 산학협력단 세포침투성 융합단백질, 이를 코딩하는 폴리뉴클레오티드및 이를 발현하는 재조합 발현벡터

Patent Citations (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1997044064A2 (en) * 1996-05-20 1997-11-27 The Government Of The United States Of America, Represented By The Secretary, Department Of Health And Human Services Oligonucleotides which specifically bind retroviral nucleocapsid proteins
KR100368073B1 (ko) * 1999-03-09 2003-01-24 한국생명공학연구원 융합파트너를 이용한 재조합 단백질의 제조방법
KR20130020206A (ko) * 2011-08-19 2013-02-27 연세대학교 산학협력단 수용성 ｂｍｐ-2를 생산하는 재조합 대장균 및 이를 이용한 수용성 ｂｍｐ-2의 제조방법
KR20160088012A (ko) * 2015-01-15 2016-07-25 고려대학교 산학협력단 CysQ를 융합파트너로 이용한 재조합 단백질의 제조방법

Non-Patent Citations (3)

* Cited by examiner, † Cited by third party
Title
DOMINIC ESPOSITODEB K CHATTERJEE: "Enhancement of soluble protein expression through the use of fusion tags", CURRENT OPINION IN BIOTECHNOLOGY, vol. 17, 2006, pages 353 - 358
FRANCOIS BANEYX: "Recombinant protein expression in Escherichia coli", CURRENT OPINION IN BIOTECHNOLOGY, vol. 10, 1999, pages 411 - 421
NELSON GARY W., STOHLMAN STEPHEN A., TAHARA STANLEY M.: "High affinity interaction between nucleocapsid protein and leader/intergenic sequence of mouse hepatitis virus RNA", MICROBIOLOGY, SOCIETY FOR GENERAL MICROBIOLOGY, READING, vol. 81, no. 1, 1 January 2000 (2000-01-01), Reading , pages 181 - 188, XP093111794, ISSN: 1350-0872, DOI: 10.1099/0022-1317-81-1-181 *

Also Published As

Publication number Publication date
CN118475592A (zh) 2024-08-09
KR20230163939A (ko) 2023-12-01
KR102617593B9 (ko) 2024-07-24
KR102617593B1 (ko) 2023-12-29

Similar Documents

Publication Publication Date Title
Davis et al. Protein splicing in the maturation of M. tuberculosis recA protein: a mechanism for tolerating a novel class of intervening sequence
Waring et al. Identification and time of synthesis of chorion proteins in Drosophila melanogaster
WO2010076939A1 (en) A novel zinc finger nuclease and uses thereof
Luzzago et al. Isolation of point mutations that affect the folding of the H chain of human ferritin in E. coli.
KR20220100901A (ko) 인공 나노포어 및 이와 관련된 용도 및 방법
WO2019135559A1 (ko) 목적 단백질의 수용성 및 발현량 증가를 위한 융합 태그 및 이의 용도
WO2010137903A2 (ko) 신개념 신약개발을 위한 타겟 단백질-단백질 상호작용을 저해하는 신약후보물질의 스크리닝 방법
WO2012053823A9 (ko) 인자 ix 활성을 갖는 융합 단백질
WO2023229328A1 (ko) 바이러스 뉴클레오캡시드를 이용한 목적 단백질 발현 플랫폼
Lei et al. Initiation of HIV-1 Gag lattice assembly is required for recognition of the viral genome packaging signal
WO2017155160A1 (ko) 다중 진단 키트
WO2023229329A1 (ko) 바이러스 뉴클레오캡시드를 이용한 결정성 단백질 기반 목적 단백질 융합 자가 조립 나노 입자 제조 플랫폼
WO2019103512A2 (ko) 목적 단백질의 발현 효율을 증진시키기 위한 신규한 펩타이드 및 이를 포함하는 융합 단백질
WO2021054774A1 (ko) 목적 단백질의 수용성 및 열안정성을 증가시키기 위한 태그 단백질 및 이를 포함하는 융합 단백질
WO2020138951A1 (ko) N-말단의 메티오닌이 절단된 목적 단백질 발현용 유전자 발현 카세트 및 이를 이용하여 n-말단의 메티오닌이 절단된 목적 단백질을 생산하는 방법
WO2021125917A1 (ko) Whep 도메인 융합에 의한 목적 단백질의 수용성 증진 방법
CN113767170A (zh) 用于促进酶去除的His-MBP标记的DNA内切酶
WO2016068428A1 (ko) 메탄올 자화 효모를 이용한 인터루킨-2 단백질 생산 방법
WO2023229330A1 (ko) 바이러스 뉴클레오캡시드를 이용한 오량체형 독소 단백질 기반 목적 단백질 융합 오량체 제조 플랫폼
WO2020139031A1 (ko) Crispr-cas를 기반으로 하는 유전자 교정용 조성물
WO2017160118A2 (ko) 목적 단백질의 발현 효율을 증진시키기 위한 신규한 펩타이드 및 이를 포함하는 융합 단백질
WO2009145573A9 (ko) 아미노 말단의 메티오닌이 제거된 재조합 사람 변이 인터페론-베타 단백질을 생산하는 재조합 대장균 및 이의 제조방법
WO2023128639A1 (ko) 목적 단백질의 발현 방법
WO2024053899A1 (ko) 다량체 단백질 어셈블리 구조체 제조방법 및 이에 의해 제조된 다량체 단백질 어셈블리 구조체
WO2024071970A1 (ko) 주요 아미노산이 전하성 아미노산으로 구성된 펩타이드 태그를 포함하여 자가 조립체를 형성하는 융합 단백질 및 이를 이용하여 재조합 단백질을 정제하는 방법

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 23812102

Country of ref document: EP

Kind code of ref document: A1