WO2023182657A1 - 항-fetuin-b 항체 및 해당 항체를 유효 성분으로 포함하는 근육질환의 예방, 치료 또는 개선용 조성물 - Google Patents

항-fetuin-b 항체 및 해당 항체를 유효 성분으로 포함하는 근육질환의 예방, 치료 또는 개선용 조성물 Download PDF

Info

Publication number
WO2023182657A1
WO2023182657A1 PCT/KR2023/002082 KR2023002082W WO2023182657A1 WO 2023182657 A1 WO2023182657 A1 WO 2023182657A1 KR 2023002082 W KR2023002082 W KR 2023002082W WO 2023182657 A1 WO2023182657 A1 WO 2023182657A1
Authority
WO
WIPO (PCT)
Prior art keywords
antibody
muscle
fetuin
muscular atrophy
preventing
Prior art date
Application number
PCT/KR2023/002082
Other languages
English (en)
French (fr)
Inventor
정승효
이경진
김수정
Original Assignee
주식회사 케이에스비튜젠
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by 주식회사 케이에스비튜젠 filed Critical 주식회사 케이에스비튜젠
Publication of WO2023182657A1 publication Critical patent/WO2023182657A1/ko

Links

Images

Classifications

    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P21/00—Drugs for disorders of the muscular or neuromuscular system
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/38—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against protease inhibitors of peptide structure
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/565—Complementarity determining region [CDR]

Definitions

  • the present invention relates to an anti-Fetuin-B antibody and a composition for preventing, treating or improving muscle disease comprising the antibody as an active ingredient.
  • This invention was made with support from the Korean government under the Ministry of SMEs and Startups' grant number 1425157125, "Development of a treatment for intractable sarcopenia based on clinical multi-omics.”
  • Muscles are classified into skeletal muscle, smooth muscle, and cardiac muscle in terms of structure and function.
  • skeletal muscle is located directly under the skin of the hands, feet, chest, and stomach, and supports bones and tendons throughout the body.
  • Skeletal muscle accounts for 40 to 50% of body weight and performs functions such as maintaining body temperature and generating energy. Additionally, skeletal muscles move or support bones through contraction, and at this time, muscle contraction occurs and is controlled by nerve signals.
  • Skeletal muscle atrophy is a condition in which the amount of skeletal muscle is reduced or completely lost, resulting in a decrease in the ability to support the human body or exercise. Skeletal muscle atrophy occurs due to denervation due to trauma, and causes conditions such as resting recumbency or joint immobilization. It is classified into skeletal muscle atrophy (pulmonary atrophy) that occurs due to immobility.
  • Skeletal muscle atrophy is generally associated with reduced blood supply to the muscles, lack of exercise (immobilization), persistent weight loss, malnutrition or starvation, cancer, AIDS, congestive heart failure, and chronic obstructive pulmonary disease. It is known to be caused by a variety of causes, including pulmonary disease, renal failure, and severe burns.
  • dexamethasone is used to treat several diseases such as cancer, but it reduces the rate of protein synthesis in skeletal muscle and increases the rate of protein degradation through the ubiquitin-proteasome system, causing muscle atrophy.
  • Two muscle ubiquitin ligases are related to Atrogin-1 and MuRF1.
  • Dexamethasone reduces MyoD (myogenic differentiation antigen) through Atrogin-1, and this mechanism leads to a decrease in muscle mass.
  • the present inventors completed the present invention by conducting research to develop a therapeutic agent that is excellent in preventing, treating, and improving muscle atrophy.
  • One object of the present invention is to provide a pharmaceutical composition for preventing or treating muscle atrophy containing an anti-Fetuin-B antibody as an active ingredient.
  • Another object of the present invention is to provide a method of treating muscular atrophy comprising administering the composition to a subject.
  • One aspect of the present invention provides a pharmaceutical composition for preventing or treating muscle atrophy containing an anti-Fetuin-B antibody as an active ingredient.
  • the muscle atrophy may be caused by any one selected from the group consisting of muscle aging-related diseases, cancerous cachexia, muscle loss, aging, obesity, long-term administration of steroids, and spaceflight.
  • the muscle aging-related diseases include senile sarcopenia, atony, muscular atrophy, muscle degeneration, muscle stiffness, amyotrophic axonal sclerosis, myasthenia gravis, myositis, It may be any one disease selected from the group consisting of muscle calcification, muscle ossification, muscle weakness-related disease, and cachexia.
  • the composition is used in the orbicularis oculi, masticatory muscles, tongue and neck muscles, thoracic girdle and arm muscles, arm and shoulder, intrinsic muscles of the hand, lower extremity and leg muscles, forelimb and foot muscles. It can be delivered to one or more target tissues selected from the group consisting of
  • the steroid agent may be dexamethasone.
  • the antibody may be a monoclonal antibody.
  • the amino acid sequence of the complementarity determining region (CDR) of the antibody may be one or more sequences selected from the group consisting of SEQ ID NO: 1 to SEQ ID NO: 11.
  • the antibody may be a double antibody.
  • the antibody may be a humanized antibody.
  • Another aspect of the invention provides a method of treating muscular atrophy comprising administering the composition to a subject.
  • the anti-Fetuin-B antibody and the composition for preventing, treating or improving muscle diseases containing the antibody as an active ingredient it can effectively inhibit muscle atrophy, so it is used for preventing, treating or improving muscle diseases such as muscular atrophy. It can be usefully utilized.
  • Figure 1 is a photograph and graph showing the effects of starvation and Fetuin-B protein treatment on the anterior tibial photograph (a), muscle mass (b) and body weight (c) of the gastrocnemius muscle (GS).
  • Figure 2 shows a photograph of the tibialis anterior (a), the lean muscle mass of the tibialis anterior (b), the muscle length of the tibialis anterior (T1) (c), and the lean muscle mass of the gastrocnemius (GS) (d) according to dexamethasone treatment. ) are photos and graphs showing the effect on
  • Figure 3 is a photograph confirming the expression of Fetuin-B in the gastrocnemius anterior (GS) and tibialis anterior (TA) muscles in the dexamethasone treatment model.
  • Figure 4 shows body weight (a) and lean muscle mass (b) according to administration of control anti-IgG1 antibody or anti-Myostatin (growth differentiation factor 8, GDF8) antibody (Bimagrumab) and anti-Fetuin-B antibody in the dexamethasone treatment model. This is a graph showing the change.
  • Figure 5 is a graph showing the effect on muscle function (grip strength) according to administration of control anti-IgG1 antibody or anti-GDF8 antibody (Bimagrumab) and anti-Fetuin-B antibody in the dexamethasone treatment model.
  • Figure 6 shows distance (a) and time (b) measured by Treadmill, which is muscle function according to administration of control anti-IgG1 antibody or anti-GDF8 antibody (Bimagrumab) and anti-Fetuin-B antibody in the dexamethasone treatment model. ) This is a graph showing the effect.
  • Figure 7 is a photograph of the tibialis anterior (a) and tibialis anterior (TA) (b) according to administration of control anti-IgG1 antibody or anti-GDF8 antibody (Bimagrumab) and anti-Fetuin-B antibody in the dexamethasone treatment model. This is a photograph and graph showing changes in lean muscle mass of the gastrocnemius muscle (GS) (c).
  • Figure 8 shows the length (T1) of the tibialis anterior muscle (a) and tibialis anterior (TA) according to administration of control anti-IgG1 antibody or anti-GDF8 antibody (Bimagrumab) and anti-Fetuin-B antibody in the dexamethasone treatment model.
  • TA tibialis anterior muscle
  • GS gastrocnemius muscle
  • One aspect of the present invention provides a pharmaceutical composition for preventing or treating muscle atrophy containing an anti-Fetuin-B antibody as an active ingredient.
  • muscle atrophy used in the present invention has the same meaning as “skeletal muscle atrophy” and refers to the loss of size and mass of muscle cells and muscle tissue. This type of muscle atrophy may be caused by a variety of reasons, such as being unable to move for a long time due to aging, serious illness, nerve damage, etc., or malnutrition.
  • the therapeutic agent containing the anti-Fetuin-B antibody of the present invention as an active ingredient is administered systemically or parenterally, for example, by intravenous injection such as drip, intramuscular injection, intraperitoneal injection, subcutaneous injection, inhalation through a nebulizer, etc. Can be administered topically.
  • the administration method can be appropriately selected depending on the patient's age and condition.
  • a therapeutic agent containing the anti-Fetuin-B antibody of the present invention as an active ingredient can be administered to a patient suffering from a disease in an amount sufficient to treat and at least partially prevent the disease and complex symptoms.
  • the effective dosage may be 0.01 mg to 1000 mg per 1 kg of body weight at a time.
  • the effective dosage may be selected from 5 to 2000 mg per patient.
  • the effective dosage of the therapeutic agent consisting of the anti-Fetuin-B antibody of the present invention is not limited to the above dosage.
  • the administration time can be appropriately selected by a person skilled in the art as an effective method for preventing, treating, or improving muscle diseases caused by various causes, especially diseases such as skeletal muscle atrophy and sarcopenia.
  • the administration period can be appropriately selected by a person skilled in the art depending on the patient's age and symptoms.
  • the therapeutic agent containing the anti-Fetuin-B antibody of the present invention as an active ingredient can be formulated according to conventional methods (Remington's Pharmaceutical Science, latest edition, Mark Publishing Company, Easton, U.S.A.), and can be further supplemented with a pharmaceutically acceptable carrier. Or it may contain additives.
  • Such carriers or pharmaceutical additives include water, pharmaceutically acceptable organic solvents, collagen, polyvinyl alcohol, polyvinylpyrrolidone, carboxyvinyl polymer, sodium carboxymethylcellulose, sodium polyacrylate, sodium alginate, water-soluble dextran, carboxymethylcellulose.
  • HSA human serum albumin
  • the actual additive may be selected from the above or their compounds depending on the dosage of the therapeutic agent of the present invention, but is not limited thereto.
  • the purified anti-Fetuin-B antibody When used as an injectable preparation, the purified anti-Fetuin-B antibody is dissolved in a solvent such as physiological saline, buffer solution, glucose solution, etc., and an anti-adsorption agent such as Tween 80, Tween 20, gelatin, human Serum albumin, etc. may be added.
  • a lyophilizer that is reconstituted before use can be used, and sugar alcohols and saccharides such as mannitol and glucose can be used as excipients for lyophilization.
  • the muscle atrophy may be caused by any one selected from the group consisting of muscle aging-related diseases, cancerous cachexia, muscle loss, aging, obesity, long-term administration of steroids, and space flight. .
  • the muscle aging-related diseases include senile sarcopenia, atony, muscular atrophy, muscle degeneration, muscle stiffness, amyotrophic axonal sclerosis, myasthenia gravis, myositis, It may be any one disease selected from the group consisting of muscle calcification, muscle ossification, muscle weakness-related disease, and cachexia.
  • the composition is used for the orbicularis oculi, masticatory muscles, tongue and neck muscles, thoracic girdle and arm muscles, arm and shoulder, intrinsic muscles of the hand, lower extremity and leg muscles, forelimb and foot muscles. It can be delivered to one or more target tissues selected from the group consisting of
  • the steroid agent may be dexamethasone.
  • the antibody may be a monoclonal antibody.
  • the antibody of the present invention can be produced as a monoclonal antibody through methods known in the art. In other words, it can be obtained by immunization using a conventional immunization method using Fetuin-B as an immunizing antigen, and the resulting immune cells are fused with known parent cells in a conventional fusion process to perform conventional screening. It may be produced by selecting monoclonal antibody-producing cells using a screening method.
  • the amino acid sequence of the complementarity determining region (CDR) of the antibody may be one or more sequences selected from the group consisting of SEQ ID NO: 1 to SEQ ID NO: 11.
  • the CDR sequence of the antibody may be the amino acid sequence of SEQ ID NO: 1, which consists of 382 amino acids, and is preferably the 19th to 382nd amino acid sequence of the amino acid sequence of SEQ ID NO: 1 (SEQ ID NO: 2), 293 to 322 amino acid sequence (C-Term, SEQ ID NO: 3), 292 to 322 amino acid sequence (SEQ ID NO: 4), 149 to 255 amino acid sequence (SEQ ID NO: 5), 28 to 141 amino acid sequence (SEQ ID NO: 6) ), 152nd to 261st amino acid sequence (SEQ ID NO: 7), 179th to 295th amino acid sequence (SEQ ID NO: 8), 19th to 362nd amino acid sequence (SEQ ID NO: 9), 220th to 300th amino acid sequence (SEQ ID NO: 10), and/or the 35th to 84th amino acid sequence (N-Term, SEQ ID NO: 11), most preferably the amino acid sequence represented by SEQ ID NO: 2.
  • the antibody may be a humanized antibody.
  • the humanized antibody used in the present invention may be a humanized WS-4 antibody.
  • the CDRs of the mouse-derived WS-4 antibody are linked to the FRs of the human antibody REI for the L chain, FRI-3 of the human antibody VDH26 for the H chain, and FR4 and FR of the human antibody 4B4.
  • Antigen-binding activity can be obtained by substitution of amino acid residues.
  • the antibody may be a double antibody.
  • the double antibody is an antibody that can bind to two different types of antigens (target proteins), and may be manufactured by genetic engineering or any other method.
  • the double antibody according to the present invention may be in the form of multiple antibodies connected by a linker.
  • the linker can connect two different fusion partners (e.g., biological polymers, etc.) using hydrogen bonds, electrostatic interactions, van der Waals forces, disulfide bonds, salt bridges, hydrophobic interactions, covalent bonds, etc. It refers to a linker that has at least one cysteine that can participate in at least one disulfide bond under physiological conditions or other standard peptide conditions (e.g., peptide purification conditions, peptide storage conditions), In addition to simply connecting each fusion partner, it can also serve as a gap of a certain size between the fusion partners or as a hinge that provides flexibility or rigidity to the fusion body.
  • fusion partners e.g., biological polymers, etc.
  • it refers to a linker that has at least one cysteine that can participate in at least one disulfide bond under physiological conditions or other standard peptide conditions (e.g., peptide purification conditions, peptide storage conditions).
  • it can also serve as a gap of a certain size between the
  • the linker may be a non-peptide linker or a peptide linker, and may include any linker directly connected by a peptide bond, a disulfide bond, etc.
  • the peptide linker may include an amino acid sequence in which a plurality of amino acid sequences or motifs are repeated.
  • the non-peptide linker is polyethylene glycol (PEG) homopolymer, polypropylene glycol homopolymer, ethylene glycol-propylene glycol copolymer, polyoxyethylated polyol, polyvinyl alcohol, polysaccharide, dextran, polyvinyl ethyl
  • PEG polyethylene glycol
  • polypropylene glycol homopolymer ethylene glycol-propylene glycol copolymer
  • polyoxyethylated polyol polyvinyl alcohol
  • polysaccharide dextran
  • It may be a biodegradable polymer such as ether, lipid polymer, chitin, hyaluronic acid, or a combination thereof.
  • it may be a polyethylene glycol homopolymer, and derivatives thereof already known in the art and derivatives that can be easily produced at the level of technology in the art may also be included in the scope of the present invention.
  • the region connected directly or indirectly through the linker is not particularly limited, but may be an Fc portion, Fab', F(ab')2, Fab, Fv, etc.
  • One target protein of the double antibody according to one embodiment of the present invention is Fetuin-B
  • the other target protein is, for example, a protein that acts on an inflammation suppression mechanism (e.g., Myostatin, TNF ⁇ , IL-1, IL- 6, IL-10), proteins that act to inhibit muscle protein breakdown (e.g., Atrogin1, MuRF1, TRIM32), proteins that act to inhibit cell damage and death (e.g., WNT, GSK3, TGF ⁇ , ⁇ -Catenin , Axin), or a protein that acts to inhibit muscle protein degradation signaling through receptor inhibition (e.g., ActivinReceptor Type IIB, Toll-like receptor).
  • an inflammation suppression mechanism e.g., Myostatin, TNF ⁇ , IL-1, IL- 6, IL-10
  • proteins that act to inhibit muscle protein breakdown e.g., Atrogin1, MuRF1, TRIM32
  • proteins that act to inhibit cell damage and death e.g., WNT, GSK3, T
  • the double antibody according to one embodiment of the present invention can act simultaneously on Myokine (Muscle cytokine), MuscleE3 ligase, WntSignaling pathway, or various receptors in addition to Fetuin-B, and thus has a superior effect in preventing or treating muscle atrophy. It can be expressed.
  • Myokine Muscle cytokine
  • MuscleE3 ligase MuscleE3 ligase
  • WntSignaling pathway or various receptors in addition to Fetuin-B
  • Another aspect of the invention provides a method of treating muscular atrophy comprising administering the composition to a subject.
  • composition of the present invention can be effectively used to treat muscular atrophy in a subject, for example, by applying it to the subject by oral administration.
  • the fasting model was prepared by complete fasting for 2 days followed by 75% restricted fasting for 12 days, and the Fetuin-B treatment group was administered 50 ng/kg of recombinant Fetuin-B daily for 14 days during which the fasting diet was performed. It was prepared by intraperitoneal injection (IP). Afterwards, the thickness of the anterior tibial leg was photographed using DexaScan, and the gastrocnemius muscle (GS) was separated and weighed through dissection on the 14th day of fasting and administration of recombinant Fetuin-B. Lastly, body weight was measured every day to measure changes. To minimize errors in test results due to stress, DexaScan imaging was limited to once a week.
  • leg thickness was found to be reduced by treatment with recombinant Fetuin-B (Figure 1), and body weight and gastrocnemius muscle (GS) were further reduced in the Fetuin-B treated group compared to the fasting model ( Figure 1). ), the effect of recombinant Fetuin-B on inducing skeletal muscle atrophy due to decreased muscle mass was confirmed.
  • the thickness of the anterior tibial leg was photographed using DexaScan, and to measure muscle strength, strength adaptation training was performed at least 3 times before drug administration, and once every 2 days from the start of the test to the completion of the test. Muscle strength was evaluated for each repetition.
  • the mouse was placed in a muscle strength measuring device so that it could grab the grid with its front paws, and then its tail was slowly pulled with a constant force until it released the grid with its front paws. The maximum strength to grab the grid was measured five times, and the average value was obtained. was derived in Newton (N) units.
  • T1 the length from the upper limb to the medial dissection of the tibia in mice (tibia length: L) and the vertical distance from half the length of the tibia to the outer edge of the hindlimb muscle (muscle The thickness, T) was measured.
  • lean muscle mass lean body mass was measured targeting the tibialis anterior (TA) and gastrocnemius muscle (GS), and photographs were taken to minimize errors in test results due to stress. was limited to once a week.
  • anti-Fetuin-B (Med Chem Express, USA) antibody dissolved in physiological saline solvent was administered to the skeletal muscle atrophy model prepared in Example 2 at a dose of 5 mg/kg/week, and physiological saline was used as the negative control group.
  • the positive control group was prepared by administering Bimagrumab (Med Chem Express, USA), an anti-IgG1 antibody or an anti-Myostatin (growth differentiation factor 8, GDF8) antibody, at a dose of 5 mg/kg/week.
  • the complementarity determining region (CDR) amino acid sequence of the anti-Fetuin-B antibody used is shown in Table 1.
  • Anti-Fetuin-B antibody was administered subcutaneously twice a week for a total of 21 days, from 7 days before dexamethasone treatment to 14 days after dexamethasone treatment. Afterwards, the change in body weight of the control group and the anti-Fetuin-B antibody treatment group, lean muscle mass of the entire body, muscle function measures such as Grip Strength and Treadmill, change in thickness of the anterior tibial bone, and tibialis anterior muscle ( Lean muscle mass of Tibialis anterior (TA) and Gastrocnemius muscle (GS) was measured in the same manner as in Example 2.
  • the anti-Fetuin-B antibody used in the present invention is a symptom in which the amount of skeletal muscle is reduced or completely lost, resulting in a decrease in the ability to support the human body or exercise, such as skeletal muscle atrophy and stable recumbency caused by denervation due to trauma. It is classified into skeletal muscle atrophy (pulmonary atrophy) caused by immobilization such as joint fixation, decreased blood supply to the muscles where skeletal muscle atrophy occurs, lack of exercise (immobilization), continuous weight loss, malnutrition or starvation, and cancer. , AIDS, congestive heart failure, chronic obstructive pulmonary disease, renal failure, severe burns, etc., of any origin, as long as it is effective in treating various causes, including severe burns. It can be of any type (monoclonal or polyclonal), and in any form.
  • the anti-Fetuin-B antibody used in the present invention can be obtained as a polyclonal or monoclonal cell antibody using known methods.
  • the anti-Fetuin-B antibody used in the present invention is preferably a mammalian-derived monoclonal antibody.
  • Monoclonal antibodies of mammalian origin include those produced by hosts transformed with expression vectors containing hybridomas or conventional genetically engineered antibody genes.
  • the anti-Fetuin-B antibody used in the present invention binds to Fetuin-B, thereby interfering with the binding between Fetuin-B and the Fetuin-B receptor expressed in neutrophils, thereby inhibiting the transmission signal of Fetuin-B. Therefore, it can inhibit the biological activity of Fetuin-B.
  • Such antibodies include the WS-4 antibody and the DM/C7 antibody, the Pep-1 antibody and the Pep-3 antibody, or the 6G4.2.5 antibody and the A5.12.14 antibody, with the WS-4 antibody being particularly preferred.
  • the hybridoma cell line producing the WS-4 antibody is mouse hybridoma WS-4, which was provided to the Institute of Biotechnology and Industrial Technology, Ministry of Trade, Industry and Energy, 1-3 Higashi 1-chome, Tsukuba City, Ibaraki-ken, Japan. It may have been deposited internationally under the Budapest Treaty as FERM BP-5507 on April 17, 1996.
  • the anti-Fetuin-B antibody used in the present invention may include one or more amino acid sequences among the amino acid sequences shown in Table 2 as a CDR sequence.
  • Monoclonal antibodies can be produced essentially as described below using known procedures.
  • Fetuin-B can be used as an immunizing antigen and immunization can be performed using a conventional immunization method. Therefore, the obtained immune cells may be produced by fusing known parent cells in a conventional fusion process and selecting monoclonal antibody-producing cells by a conventional screening method.
  • monoclonal antibodies can be obtained by the following method.
  • Human Fetuin-B is produced in various cells and can be manipulated in various ways at the N-terminal ends, and although Fetuin-B with a large number of amino acid residues has been known so far, the number of amino acid residues is different. The number is not limited in any way as long as Fetuin-B can be used as an antigen to obtain the anti-Fetuin-B-antibody used in the present invention.
  • the gene sequence of Fetuin-B is inserted into a known expression vector to transform an appropriate host cell, and the desired anti-Fetuin-B antibody can be purified from the host cells or their culture supernatants using a known method. , Therefore, the purified Fetuin-B protein can be used as an immune antigen.
  • the mammals to be immunized with the immune antigen are selected taking into account their compatibility with the mother cells for use in general cell fusion, and these are generally rodents, logomorphas, and primates, etc. Including but not limited to this.
  • Rodent animals for example, mice, rabbits, hamsters, etc. can be used, and primate animals can be used, for example, monkeys.
  • the monkey may be, for example, a crab-eating monkey (a macaque that eats crabs), a rhesus monkey, a mantled baboon, etc., but is not limited thereto.
  • the method of immunizing an animal with an immune antigen can be performed by a method known in the art, for example, by injecting the immune antigen into the mammal's abdominal cavity or subcutaneously.
  • the immune antigen is diluted and suspended in phosphate buffered saline (PBS) or physiological saline, mixed with an appropriate amount of Freund's complete adjuvant, emulsified, and placed on a mammal. It may be administered several times every 4 to 21 days. Additionally, an appropriate carrier may be used during antigen immunization.
  • PBS phosphate buffered saline
  • physiological saline physiological saline
  • an appropriate carrier may be used during antigen immunization.
  • immune cells such as lymphocytes or spleen cells are taken from mammals and subjected to cell fusion, wherein the preferred immune cells are particularly spleen cells.
  • mammalian myeloma cells are preferably P3 (P3x63Ag8.653) (Kearney, J.F. et al., J. Immunol. (1979) 123, 1548-1550), P3x63Ag8U. 1(Yelton, D.E. et al., Current Topics in Microbiology and Immunology (1978) 81, 1-7), NS-1(Kohler, G. and Milstein, C., Eur. J. Immunol. (1976) 6, 511-519), MPC-11 (Margulies, D.H. et al., Cell (1976) 8, 405-415), SP2/0 (Shulman, M.
  • cell fusion between the immune cells and myeloma cells is basically known as described in Milstrein et al. (Galfre, G. and Milstein, C., Methods Enzymol. (1981) 73, 3-46). It can be performed according to the method.
  • the cell fusion can be carried out, for example, in a normal nourishing culture medium in the presence of a cell fusion promoter.
  • a cell fusion promoter for example, polyethylene glycol (PEG), Sendai virus (HVJ), etc. can be used, and dimethyl sulfoxide, etc. can be added as an adjuvant to preferably increase fusion efficiency.
  • a preferred ratio of immune cells to myeloma cells may be, for example, using 1 to 10 times more immune cells than myeloma cells.
  • Culture media used for cell fusion include RPMI 1640 culture medium and MEM culture medium suitable for proliferation of the myeloma cell line. Common culture media used for culturing these types of cells can be used, and fetal calf serum )(FCS) may be added additionally.
  • a predetermined amount of the immune cells and myeloma cells are uniformly mixed in the culture medium, and a PEG solution warmed to about 37° C., for example, a PEG solution with an average molecular weight of about 1,000 to 6,000, is added, usually at 30 to 60%. It can be added at a concentration of (w/v) and mixed to form desired fused cells (hybridoma). Then, by repeating the operation of continuously adding an appropriate culture medium, centrifuging, and removing the supernatant, cell fusion agents, etc. that are undesirable for the growth of hybridomas can be removed.
  • Hybridomas can be selected by culturing in conventional selection media, such as HAT media (hypoxanthine, aminopterin, and thymine). Cultivation in HAT media can generally be continued for a period of time sufficient to kill cells other than the desired hybridoma (non-fused cells), typically several days or weeks. Afterwards, a conventional limiting dilution method can be performed to select hybridomas that produce desirable antibodies, and asexual reproduction can be performed in a monoclonal manner.
  • conventional selection media such as HAT media (hypoxanthine, aminopterin, and thymine). Cultivation in HAT media can generally be continued for a period of time sufficient to kill cells other than the desired hybridoma (non-fused cells), typically several days or weeks. Afterwards, a conventional limiting dilution method can be performed to select hybridomas that produce desirable antibodies, and asexual reproduction can be performed in a monoclonal manner.
  • human lymphocytes are immunized with Fetuin-B in an in vitro experiment, and the obtained immune lymphocytes are myeloma cells, such as U266 and By fusion, a hybridoma that produces a desired human antibody with binding activity to Fetuin-B can be produced.
  • a transgenic animal with a repertoire of human antibody genes is immunized with the antigen Fetuin-B to obtain cells producing anti-Fetuin-B antibodies, and then the cells are fused with myeloma cells.
  • a hybridoma that can be used to obtain human antibodies against Fetuin-B can be produced.
  • the hybridoma producing the prepared monoclonal antibody can be secondary cultured in a normal culture medium, or can be stored for a long period of time in liquid nitrogen.
  • the hybridoma is cultured by a conventional method and the antibody is obtained as a culture supernatant, or the hybridoma is administered to a mammal compatible with the hybridoma and propagated.
  • a method of obtaining antibodies from ascites can be used. The former method is suitable for obtaining high purity antibodies, while the latter is suitable for large-scale production of antibodies.
  • immune cells such as antibody-producing immune lymphocytes immortalized with oncogenic genes, can be used.
  • Monoclonal antibodies can also be produced as recombinant antibodies produced by recombinant genetic technology.
  • a recombinant antibody can be obtained by an immune cell such as a hybridoma or an antibody-producing immune lymphocyte, then loaded into a suitable vector and introduced into a host to produce an antibody.
  • mRNA encoding the variable region (V region) of the anti-Fetuin-B antibody is isolated.
  • isolation of mRNA may be performed using known methods, such as the guanidine ultracentrifugation method (Chirgwin, J.M. et al., Biochemistry (1979) 18, 5294-5299), AGPC method (Chomczynski, P. and Sacchi (1987) 162, 156-159), and purify the mRNA using an mRNA purification kit (Pharmacia), etc., or use the QuickPrep mRNA purification kit (Pharmacia). It can be performed by directly obtaining mRNA.
  • cDNA of the V region of the antibody is synthesized from the obtained mRNA using reverse transcriptase.
  • the synthesis of cDNA can be performed with the AMV Reverse Transcriptase First-Strand cDNA Synthesis Kit (manufactured by Biochemical Engineering Co., Ltd.).
  • the 5'-RACE method Frohman, M.A. et al., Proc. Natl. Acad
  • the 5'-Ampli FINDER RACE Kit manufactured by Clontech
  • PCR polymerase chain reaction
  • a desired DNA fragment is purified from the obtained PCR product, ligated with vector DNA, the resulting recombinant vector is introduced into E. coli, etc., and then colonies are selected to obtain a desirable recombinant vector.
  • the base sequence of a desirable recombinant DNA can be determined by known methods such as DNA chain termination methods.
  • DNA encoding the V region of the desired anti-Fetuin-B antibody is obtained, it is linked with the DNA encoding the constant region (C region) of the desired antibody and placed into an expression vector.
  • DNA encoding the V region of the antibody is placed into an expression vector that already contains DNA encoding the C region of the antibody.
  • the antibody C region may be derived from the same animal species as that of the V region or a different animal species than that of the V region.
  • the antibody gene can be placed into a vector for expression under the control of an expression control region, such as an enhancer and/or a promoter, wherein the expression
  • an expression control region such as an enhancer and/or a promoter
  • Expression of antibody genes is performed by placing DNA encoding the antibody heavy chain (H chain) or light chain (L chain) into a recombinant expression vector and co-transforming the host cell, or by co-transforming the H chain and L chain. This can be accomplished by transforming the host cell by placing the coding DNA into a single expression cell.
  • the recombinant antibody used in the present invention may be an artificially modified antibody, for example, a chimeric antibody or a humanized antibody, for the purpose of reducing heterologous antigenicity to humans.
  • the modified antibody has the C region of a human antibody, and antibodies such as chimeric antibodies or humanized antibodies can be used.
  • the modified antibody can be produced using a known method. That is, a chimeric antibody can be produced by linking DNA encoding the V region of a non-human antibody to DNA encoding the C region of a human antibody, then loading it into an expression vector and transforming it into a host.
  • the DNA sequence designed to link the CDRs of mouse antibodies and the framework regions (FRs) of human antibodies is synthesized from several segmented oligonucleotides with overlapping portions at the ends, and then the oligonucleotides are It can be synthesized into one complete DNA.
  • the obtained DNA can be linked to DNA encoding the human antibody C region, loaded into an expression vector, and then transformed into a host for antibody production.
  • the humanized antibody used in the present invention is preferably a humanized WS-4 antibody.
  • the CDRs of the mouse-derived WS-4 antibody are linked to the FRs of the human antibody REI for the L chain, FRI-3 of the human antibody VDH26 for the H chain, and FR4 and FR of the human antibody 4B4.
  • Antigen-binding activity can be obtained by substitution of amino acid residues.
  • the CDR sequence of the humanized antibody used in the present invention is preferably the amino acid sequence represented by SEQ ID NO: 2.
  • the antibody gene is loaded into a vector to be expressed under the control of an expression control region, such as an enhancer and/or a promoter, and then the expression vector is transferred to a host cell. It can be transformed to express antibodies.
  • an expression control region such as an enhancer and/or a promoter
  • the anti-Fetuin-B antibody of the present invention is an antibody fragment or an improved antibody thereof that can bind to Fetuin-B and inhibit the activity of Fetuin-B.
  • the antibody is treated with an enzyme, such as papain or pepsin, to produce antibody fragments, or genes encoding these antibody fragments are constructed, which are then introduced into an expression vector and expressed in a suitable host cell.
  • an enzyme such as papain or pepsin
  • anti-Fetuin-B antibodies conjugated with various molecules such as polyethylene glycol (PEG) can be used.
  • PEG polyethylene glycol
  • the improved antibody may be prepared by a method commonly used in the art to chemically improve antibodies.
  • Production Example 1-5 Expression and production of recombinant antibodies, modified antibodies, and antibody fragments
  • the gene encoding the anti-Fetuin-B antibody can be expressed and obtained by a known method. In the case of mammalian cells, expression can be achieved by functionally linking a poly A signal to a commonly useful promoter, 3' downstream of the expressed gene, or DNA. Additionally, the promoter/enhancer may include a human cytomegalovirus immediate early promoter/enhancer.
  • viral promoters/enhancers such as tumor virus, polyomavirus, adenovirus, and simian virus (SV40)
  • human It may be a promoter/enhancer derived from mammalian cells, such as human elongation factor 1 ⁇ (HEF1 ⁇ ).
  • any production system may be used, and the antibody production system may be an in vitro or in vivo expression system.
  • the in vitro system can be an expression system using eukaryotic cells and an expression system using prokaryotic cells.
  • the in vivo expression system may be a system using animals or plants, and the system using animals may be an expression system using mammals or insects.
  • the antibody expressed and produced as described above can be separated from the inside or outside of the cell or from the host cell and then purified to homogeneity. Separation and purification of the antibody used in the present invention can be performed by any common antibody separation and purification method in the art. For example, separation and purification of antibodies can be achieved using affinity chromatography, filtration, ultraconcentration, salting-out, dialysis, etc. as appropriate. Columns used for affinity chromatography may be Protein A columns and Protein G columns. Protein A columns may be, for example, Hyper D, POROS, Sepharose F.F. (manufactured by Pharmacia).
  • Chromatography other than affinity chromatography may be, for example, ion exchange chromatography, hydrophobic chromatography, gel-filtration, reverse-phase chromatography, absorption chromatography, etc., and the chromatography may be liquid-based, such as HPLC, FPLC, etc. It may be phase chromatography.
  • the concentration of the antibody obtained as described above can be determined by measuring absorbance or enzyme-linked immunosorbent assay (ELISA). Therefore, when absorbance measurements are used, the obtained antibodies are appropriately diluted with PBS and the absorbance is measured at 280 nm, then using various species and subclasses, an extinction coefficient of 1.4 OD at 1 mg/ml for humans is used. It can be calculated by:
  • the concentration of antibody can be measured as follows. Specifically, 100 ⁇ l of goat anti-human IgG antibody diluted to 1 ⁇ g/ml in 0.1 M bicarbonate buffer at pH 9.6 was added to a 96-well plate (Nunc), and incubated overnight at 4°C. Incubate and fix the antibody. After sealing the wells, 100 ⁇ l each of an appropriately diluted antibody of the present invention or a sample containing the antibody or 100 ⁇ l of human IgG of a known concentration as a concentration standard is added and incubated at room temperature for 1 hour.
  • ELISA Enzyme immunosorbent assay
  • RIA radioimmunoassay
  • fluorescent antibody method As a method for measuring the antigen-binding activity of the anti-Fetuin-B antibody used in the present invention, ELISA, EIA (enzyme immunosorbent assay), RIA (radioimmunoassay), or fluorescent antibody method can be used.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Immunology (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Genetics & Genomics (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Neurology (AREA)
  • Orthopedic Medicine & Surgery (AREA)
  • Physical Education & Sports Medicine (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Engineering & Computer Science (AREA)
  • Molecular Biology (AREA)
  • Biophysics (AREA)
  • Biochemistry (AREA)
  • Microbiology (AREA)
  • Mycology (AREA)
  • Epidemiology (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)

Abstract

본 발명은 항-Fetuin-B 항체 및 해당 항체를 유효 성분으로 포함하는 근육질환의 예방, 치료 또는 개선용 조성물에 관한 것으로, 근위축을 효과적으로 억제할 수 있으므로, 근위축과 같은 근육질환의 예방, 치료 또는 개선 용도로 유용하게 활용될 수 있다.

Description

항-FETUIN-B 항체 및 해당 항체를 유효 성분으로 포함하는 근육질환의 예방, 치료 또는 개선용 조성물
본 발명은 항-Fetuin-B 항체 및 해당 항체를 유효 성분으로 포함하는 근육질환의 예방, 치료 또는 개선용 조성물에 관한 것이다.
본 발명은 중소벤처기업부의 과제번호 1425157125, "임상 멀티오믹스 기반 난치성 근감소증 치료제 개발"에 따른 한국 정부의 지원을 받아 이루어졌다.
근육은 구조나 기능면에서 골격근(skeletal muscle), 평활근(smooth muscle), 심근(cardiac muscle)으로 분류되고, 이 중 골격근은 손, 발, 가슴, 배 등의 피부 바로 밑에 있으면서 전신의 뼈나 힘줄을 통해 뼈에 붙어있는 600 여개의 수의적인 근육이다. 골격근은 체중의 40 내지 50%를 차지하고 있어 체온유지, 에너지생성 등의 기능을 한다. 또한, 골격근은 수축을 통해 뼈를 움직이거나 지지하는데, 이 때 근육의 수축은 신경신호에 의해 일어나고 조절된다.
골격근 위축(skeletal muscle atrophy)은 골격근의 양이 감소하거나 완전히 소실되어 인체를 지지하거나 운동하는 능력이 감소하는 증세로, 외상에 의한 탈신경(denervation)으로 일어나는 골격근 위축과 안정 와상이나 관절 고정 등의 부동으로 발생하는 골격근 위축(폐용성 위축)으로 구분된다.
골격근 위축은 일반적으로 근육으로의 혈액 공급 감소와 운동 부족(immobilization), 지속적인 체중 감소, 영양 불량 상태(malnutrition or starvation), 암, 에이즈, 울혈 심부전(congestive heart failure), 만성 폐쇄 폐질환(chronic obstructive pulmonary disease), 신부전(renal failure), 심각한 화상(severe burns) 등 다양한 원인에 의해 유발되는 것으로 알려져 있다.
그 중, 덱사메타손은 암과 같은 여러 질병을 치료하는데 사용되지만, 유비퀴틴-프로테아좀 시스템을 통해 골격근에서 단백질 합성 속도를 감소시키고, 단백질 분해 속도를 증가시켜 근위축을 유발한다. 2개의 근육 유비퀴틴 리가아제(ubiquitin ligase)는 Atrogin-1 및 MuRF1과 관련이 있는데, 덱사메타손은 Atrogin-1을 통해 MyoD(myogenic differentiation antigen)를 저하시키고, 이와 같은 기전을 통하여 근육량이 감소하게 된다.
골격근 위축을 치료하기 위한 일반적인 방법으로는 운동을 통한 근육감소의 예방을 들 수 있지만, 현재 시장에 출시된 근본적인 치료제는 보고된 바가 없다.
이에, 본 발명자들은 근위축의 예방, 치료 및 개선 효과가 우수한 치료제를 개발하기 위한 연구를 수행하여 본 발명을 완성하였다.
본 발명의 하나의 목적은 항-Fetuin-B 항체를 유효성분으로 포함하는 근위축(muscle atrophy) 예방 또는 치료용 약학적 조성물을 제공하는 것이다.
본 발명의 다른 목적은 상기 조성물을 대상체에 투여하는 단계를 포함하는 근위축의 치료 방법을 제공하는 것이다.
본 발명의 일 양상은 항-Fetuin-B 항체를 유효성분으로 포함하는 근위축(muscle atrophy) 예방 또는 치료용 약학적 조성물을 제공한다.
본 발명의 일 구체예에 따르면, 상기 근위축은 근육 노화 관련 질환, 암성 악액질, 근감소, 노화, 비만, 스테로이드제 장기투여 및 우주비행으로 이루어진 군으로부터 선택되는 어느 하나에 의하여 발생할 수 있다.
본 발명의 일 구체예에 따르면, 상기 근육 노화 관련 질환은 노인성 근감소증(Sarcopenia), 긴장감퇴증(atony), 근위축증(muscular atrophy), 근육 퇴화, 근경직증, 근위축성 축삭경화증, 근무력증, 근염, 근육 석회화, 근육 골화, 근육약화 관련 질환 및 악액질(cachexia)로 이루어진 군으로부터 선택되는 어느 하나의 질환일 수 있다.
본 발명의 일 구체예에 따르면, 상기 조성물은 안륜근, 저작근육, 혀 및 목 근육, 흉곽 흉대 및 팔의 근육, 팔 및 어깨, 손의 내재성 근육, 하지대 및 다리 근육, 앞다리 및 발근육으로 구성된 군으로부터 선택되는 하나 이상의 표적 조직으로 전달될 수 있다.
본 발명의 일 구체예에 따르면, 상기 스테로이드제는 덱사메타손일 수 있다.
본 발명의 일 구체예에 따르면, 상기 항체는 모노클로날 항체일 수 있다.
본 발명의 일 구체예에 따르면, 상기 항체의 상보성 결정 영역(omplementarity determining region, CDR)의 아미노산 서열은 서열번호 1 내지 서열번호 11로 이루어진 군으로부터 선택되는 하나 이상의 서열일 수 있다.
본 발명의 일 구체예에 따르면, 상기 항체는 이중항체일 수 있다.
본 발명의 일 구체예에 따르면, 상기 항체는 인간화 항체일 수 있다.
본 발명의 다른 양상은 상기 조성물을 대상체에 투여하는 단계를 포함하는 근위축의 치료 방법을 제공한다.
항-Fetuin-B 항체 및 해당 항체를 유효 성분으로 포함하는 근육질환의 예방, 치료 또는 개선용 조성물에 따르면, 근위축을 효과적으로 억제할 수 있으므로, 근위축과 같은 근육질환의 예방, 치료 또는 개선 용도로 유용하게 활용될 수 있다.
도 1은 절식(Starvation)과 Fetuin-B 단밸질 처리에 따른 앞정강이 전경골 사진(a), 장딴지근(GS)의 근육량(b) 및 체중(c)에 미치는 영향을 나타내는 사진 및 그래프이다.
도 2는 덱사메타손 처리에 따른 앞정강이 전경골 사진(a), 앞정강이 전경골의 제지방 근육량(b), 앞정강이 전경골의 근육 길이(T1)(c) 및 장딴지근(GS)의 제지방 근육량(d)에 미치는 효과를 나타내는 사진 및 그래프이다.
도 3은 덱사메타손 처리 모델에서 앞정강이 장딴지근(GS) 및 전경골(TA) 근육에서의 Fetuin-B의 발현을 확인한 사진이다.
도 4는 덱사메타손 처리 모델에서의 대조군 항-IgG1 항체 또는 항-Myostatin(growth differentiation factor 8, GDF8) 항체(Bimagrumab)와 항-Fetuin-B 항체 투여에 따른 체중(a) 및 제지방 근육량(b)의 변화를 나타내는 그래프이다.
도 5는 덱사메타손 처리 모델에서의 대조군 항-IgG1 항체 또는 항-GDF8 항체(Bimagrumab)와 항-Fetuin-B 항체 투여에 따른 근기능인 근력(Grip Strength)에 미치는 효과를 나타내는 그래프이다.
도 6은 덱사메타손 처리 모델에서의 대조군 항-IgG1 항체 또는 항-GDF8 항체(Bimagrumab)와 항-Fetuin-B 항체 투여에 따른 근기능인 트레이드밀(Treadmill) 측정을 통해 나타내는 거리(a) 및 시간(b)에 대한 효과를 나타내는 그래프이다.
도 7은 덱사메타손 처리 모델에서의 대조군 항-IgG1 항체 또는 항-GDF8 항체(Bimagrumab)와 항-Fetuin-B 항체 투여에 따른 앞정강이 전경골 사진(a), 앞정강이근(Tibialis anterior, TA)(b) 및 장딴지근(Gastrocnemius muscle, GS)(c)의 제지방 근육량 변화를 나타내는 사진 및 그래프이다.
도 8은 덱사메타손 처리 모델에서의 대조군 항-IgG1 항체 또는 항-GDF8 항체(Bimagrumab)와 항-Fetuin-B 항체 투여에 따른 앞정강이 전경골근의 길이(T1)(a), 앞정강이근(Tibialis anterior, TA)(b) 및 장딴지근(Gastrocnemius muscle, GS)(c)의 제지방 근육량 변화를 나타내는 그래프이다.
본 발명의 일 양상은 항-Fetuin-B 항체를 유효성분으로 포함하는 근위축(muscle atrophy) 예방 또는 치료용 약학적 조성물을 제공한다.
본 발명에서 사용되는 용어, "근위축"은 "골격근 위축"과 동일한 의미로 사용되며, 근육세포와 근조직의 크기 및 질량적 손실을 말한다. 이러한 근위축은 노화, 중증질병, 신경손상 등으로 인해 오랫동안 움직일 수 없는 상태에 처하거나, 영양공급장애 등 다양한 원인에 의하여 유발되는 것일 수 있다.
본 발명의 항-Fetuin-B 항체를 유효 성분으로서 함유하는 치료제는 비경구적, 예를 들어, 점적 등의 정맥 내 주사, 근육 내 주사, 복강 내 주사, 피하 주사, 분무기를 통한 흡입 등으로 전신 또는 국부적으로 투여될 수 있다. 투여 방법은 환자의 나이와 상태에 의존하여 적절하게 선택될 수 있다. 유효 성분으로서 본 발명의 항-Fetuin-B 항체를 함유하는 치료제는 질병을 앓고 있는 환자에게 질병과 복잡한 증상을 치료하고 적어도 부분적으로 이들을 예방하기에 충분한 양이 투여될 수 있다.
예를 들어, 유효 투여량은 1회에 체중 1㎏ 당 0.01㎎ 내지 1000㎎로 선택하여 투여될 수 있다. 또는, 환자마다 5 내지 2000㎎으로 유효 투여량이 선택될 수 있다. 다만, 본 발명의 항-Fetuin-B 항체로 이루어진 치료제의 유효한 투여량은 상기 투여량에 한정되는 것은 아니다.
투여 시기는 다양한 원인에 의해 발생하는 근육 질환, 특히, 골격근 위축(muscle atrophy), 근육감소증(Sarcopenia) 등의 질환의 예방, 치료 또는 개선에 효과적인 방법으로 당업자에 의해 적절하게 선택될 수 있다.
투여 기간은 환자의 나이와 증상에 따라 당업자에 의해 적절하게 선택될 수 있다.
본 발명의 항-Fetuin-B 항체를 유효 성분으로서 함유하는 치료제는 통상의 방법에 따라서 제제화 될 수 있고(Remington's Pharmaceutical Science, latest edition, Mark Publishing Company, Easton, U.S.A.), 추가로 제약적으로 허용가능한 담체 또는 첨가제를 함유할 수 있다.
상기 담체 또는 제약적 첨가제의 예는 물, 제약적으로 허용 가능한 유기 용매, 콜라겐, 폴리비닐 알콜, 폴리비닐피롤리돈, 카르복시비닐 폴리머, 카르복시메틸셀룰로오스 나트륨, 폴리아크릴산 나트륨, 알긴산 나트륨, 수용성 덱스트란, 카르복시메틸 스타치 나트륨, 펙틴, 메틸 셀룰로오스, 에틸 셀룰로스, 크산 검, 아라비아 검, 카세인, 한천, 폴리에틸렌 글리콜, 디글리세린, 글리세린, 프로필렌 글리콜, 바세린, 파라핀, 스테아릴 알콜, 스테아르산, 인간 혈청 알부민(HSA), 만니톨, 소르비톨, 락토오스, 제약적으로 허용가능한 계면 활성제 등을 포함한다.
실제의 첨가제는 본 발명의 치료제의 투여량에 의존하여 상기된 것 또는 이들의 화합물로부터 선택될 수 있으나, 이에 한정되는 것은 아니다.
주사용 제제로서 사용되는 경우, 정제된 항-Fetuin-B 항체를 용매, 예를 들어 생리 식염수, 완충액, 글루코스용액 등에 용해하여, 여기에 흡착 방지제, 예를 들면 Tween 80, Tween 20, 젤라틴, 인간 혈청 알부민 등이 첨가될 수 있다. 대안으로, 사용 전에 재구성되는 동결 건조제를 사용할 수 있고, 동결 건조를 위한 부형제로서는 만니톨, 글루코스 등의 당 알콜 및 당류를 사용할 수 있다.
본 발명의 일 구체예에 따르면, 상기 근위축은 근육 노화 관련 질환, 암성 악액질, 근감소, 노화, 비만, 스테로이드제 장기투여 및 우주비행으로 이루어진 군으로부터 선택되는 어느 하나에 의하여 발생하는 것일 수 있다.
본 발명의 일 구체예에 따르면, 상기 근육 노화 관련 질환은 노인성 근감소증(Sarcopenia), 긴장감퇴증(atony), 근위축증(muscular atrophy), 근육 퇴화, 근경직증, 근위축성 축삭경화증, 근무력증, 근염, 근육 석회화, 근육 골화, 근육약화 관련 질환 및 악액질(cachexia)로 이루어진 군으로부터 선택되는 어느 하나의 질환일 수 있다.
본 발명의 일 구체예에 따르면서, 상기 조성물은 안륜근, 저작근육, 혀 및 목 근육, 흉곽 흉대 및 팔의 근육, 팔 및 어깨, 손의 내재성 근육, 하지대 및 다리 근육, 앞다리 및 발근육으로 구성된 군으로부터 선택되는 하나 이상의 표적 조직으로 전달될 수 있다.
본 발명의 일 구체예에 따르면, 상기 스테로이드제는 덱사메타손일 수 있다.
본 발명의 일 구체예에 따르면, 상기 항체는 모노클로날 항체일 수 있다.
본 발명의 항체는 당업계에 공지된 방법을 통하여 모노클로날 항체로 제작될 수 있다. 즉, Fetuin-B을 면역 항원(immunizing antigen)으로 사용하여 종래의 면역 방법으로 면역되어 수득될 수 있으며, 따라서 얻어진 면역세포는 통상의 융합 방법(fusion process)에서 공지의 모세포와 융합되어 통상의 선별 방법(screening method)에 의해 모노클로날 항체-생성 세포로 선별되어 제작되는 것일 수 있다.
본 발명의 일 구체예에 따르면, 상기 항체의 상보성 결정 영역(omplementarity determining region, CDR)의 아미노산 서열은 서열번호 1 내지 서열번호 11로 이루어진 군으로부터 선택되는 하나 이상의 서열일 수 있다.
본 발명의 일 구체예에 따른 항체의 CDR 서열은 382개의 아미노산으로 이루어진 서열번호 1의 아미노산 서열일 수 있고, 바람직하게는 서열번호 1의 아미노산 서열 중 19 내지 382번째 아미노산 서열(서열번호 2), 293 내지 322번째 아미노산 서열(C-Term, 서열번호 3), 292 내지 322번째 아미노산 서열(서열번호 4), 149 내지 255번째 아미노산 서열(서열번호 5), 28 내지 141번째 아미노산 서열(서열번호 6), 152 내지 261번째 아미노산 서열(서열번호 7), 179 내지 295번째 아미노산 서열(서열번호 8), 19 내지 362번째 아미노산 서열(서열번호 9), 220 내지 300번째 아미노산 서열(서열번호 10), 및/또는 35 내지 84번째 아미노산 서열(N-Term, 서열번호 11)일 수 있으며, 가장 바람직하게는 서열번호 2로 표시되는 아미노산 서열일 수 있다.
본 발명의 일 구체예에 따르면, 상기 항체는 인간화 항체일 수 있다.
본 발명에서 사용되는 인간화 항체는 인간화 WS-4 항체일 수 있다. 인간화 WS-4 항체에서, 마우스로부터 유도된 WS-4 항체의 CDRs는 L쇄에 대한 인간 항체 REI의 FRs에 연결되고, H쇄에 대한 인간 항체 VDH26의 FRI-3과 인간 항체 4B4의 FR4및 FR의 아미노산 잔기가 치환되어 항원-결합 활성이 얻어질 수 있다.
본 발명의 일 구체예에 따르면, 상기 항체는 이중항체일 수 있다.
상기 이중항체는 서로 다른 두 종류의 항원(표적 단백질)에 결합할 수 있는 항체로, 유전공학 또는 임의의 방법에 의해 제조된 형태일 수 있다. 본 발명에 따른 이중항체는 복수의 항체가 링커로 연결된 형태일 수 있다
상기 링커는 두 개의 서로 다른 융합 파트너(예를 들어, 생물학적 고분자 등)를 수소 결합, 정전기적 상호작용, 반데르 바알스력, 이황화 결합, 염 브릿지, 소수성 상호작용, 공유결합 등을 이용하여 연결할 수 있는 연결체를 의미하는데, 구체적으로는 생리학적 조건 또는 다른 표준 펩타이드 조건(예를 들어, 펩타이드 정제 조건, 펩타이드 저장 조건)하에서 적어도 하나의 이황화 결합에 참여할 수 있는 적어도 하나의 시스테인을 가질 수 있으며, 단순히 각각의 융합 파트너를 연결하는 역할 이외에도, 융합파트너 사이에 일정한 크기의 간격을 부여하는 역할을 수행하거나 또는 융합체에 유연성 또는 강직성을 제공하는 힌지(hinge)의 역할을 수행할 수 있다.
상기 링커는 비펩타이드 링커 또는 펩타이드 링커일 수 있으며, 펩티드 결합, 이황화 결합 등에 의해서 직접 연결되는 것도 모두 포함될 수 있다.
상기 펩타이드 링커는 복수의 아미노산 서열 또는 모티프가 반복된 형태의 아미노산 서열을 포함할 수 있다.
상기 비펩타이드 링커는 폴리에틸렌 글리콜(polyethylene glycol; PEG) 단독 중합체, 폴리프로필렌 글리콜 단독 중합체, 에틸렌 글리콜-프로필렌 글리콜 공중합체, 폴리옥시 에틸화 폴리올, 폴리비닐 알콜, 폴리사카라이드, 덱스트란, 폴리비닐 에틸 에테르과 같은 생분해성 고분자, 지질 중합체, 키틴류, 히아루론산 또는 이들의 조합일 수 있다. 구체적으로는 폴리에틸렌 글리콜 단독 중합체일 수 있으며, 당해 분야에 이미 알려진 이들의 유도체 및 당해 분야의 기술 수준에서 용이하게 제조할 수 있는 유도체들도 본 발명의 범위에 포함될 수 있다.
상기 링커를 통하여 직접 또는 간접적으로 연결되는 부위는 특별히 한정되지 않으나, Fc 부분, Fab', F(ab')2, Fab, Fv 등일 수 있다.
본 발명의 일 구체예에 따른 이중항체의 일 표적 단백질은 Fetuin-B이고, 다른 표적 단백질은 예를 들어, 염증 억제 기전에 작용하는 단백질(예를 들어, Myostatin,TNFα, IL-1, IL-6, IL-10), 근단백질 분해 억제에 작용하는 단백질(예를 들어, Atrogin1, MuRF1,TRIM32), 세포 손상 및 사멸 억제에 작용하는 단백질(예를 들어, WNT, GSK3, TGFβ, β-Catenin, Axin), 또는 수용체 억제를 통한 근단백질 분해 신호전달 억제에 작용하는 단백질(예를 들어, ActivinReceptor Type IIB, Toll-like receptor)일 수 있다. 즉, 본 발명의 일 구체예에 따른 이중항체는 Fetuin-B 외에도, Myokine(Muscle cytokine), MuscleE3 ligase, WntSignaling pathway, 또는 다양한 Receptor에 동시에 작용할 수 있으므로, 근위축의 예방 또는 치료에 더욱 우수한 효과를 나타낼 수 있다.
본 발명의 다른 양상은 상기 조성물을 대상체에 투여하는 단계를 포함하는 근위축의 치료 방법을 제공한다.
본 발명의 조성물은 예를 들어 대상체에 경구투여 방법으로 적용됨으로써, 대상체의 근위축을 치료하는데 효과적으로 사용될 수 있다.
이하 본 발명을 하나 이상의 실시예를 통하여 보다 상세하게 설명한다. 그러나, 이들 실시예는 본 발명을 예시적으로 설명하기 위한 것으로 본 발명의 범위가 이들 실시예에 한정되는 것은 아니다.
실시예 1. Fetuin-B에 의한 골격근 위축 효과 확인
Fetuin-B에 의하여 골격근 위축 또는 근육 감소가 나타나는지 확인하기 위하여, 절식(Starvation) 모델과 비교를 통한 골격근 위축 효과를 비교하였다.
구체적으로, 절식 모델은 2일간 완전 절식을 선행한 후 12일간 75% 제한 절식을 실시하여 준비하였으며, Fetuin-B 처리군은 재조합 Fetuin-B을 절식 식이가 수행되는 14일 동안 매일 50ng/㎏의 용량으로 복강내투여(intraperitoneal injection, IP)하여 준비하였다. 그 후, 덱사스캔을 사용하여 앞정강이 전경골 다리 두께를 촬영하였고, 절식 및 재조합 Fetuin-B 투여 14일째 해부를 통해 장딴지근(Gastrocnemius muscle, GS)을 분리하여 무게를 측정하였다. 마지막으로, 체중의 경우 매일 측정하여 그 변화를 측정하였다. 스트레스에 의한 시험결과의 오류를 최소화하기 위해 덱사스캔 촬영은 일주일에 1번으로 제한하였다.
그 결과, 재조합 Fetuin-B 처리에 의해 다리 두께가 감소된 것으로 나타났고(도 1), 절식 모델 대비 Fetuin-B 처리군에서 체중 및 장딴지근(Gastrocnemius muscle, GS)이 더 감소한 것으로 나타나(도 1) 내지, 재조합 Fetuin-B의 근육량 감소에 따른 골격근 위축 유도 효과가 확인되었다.
실시예 2. 덱사메타손에 의한 골격근 위축 모델에서 근육내 Fetuin-B의 발현 확인
덱사메타손(Dexamethasone)에 의한 골격근 위축 또는 근육 감소 효과를 확인하기 위하여, 10㎎/㎏의 덱사메타손을 14일 동안 복강내투여(intraperitoneal injection, IP)하여 골격근 위축 모델을 제작한 다음, 골격근 위축 모델의 근육량 감소 효과를 확인하기 위하여, 다리 두께, 근력(Grip Strength), 앞정강이 전경골근(Tibialis Anteriors, TA)의 근육 길이 및 제지방 근육량(Lean Body Mass)을 분석하였다.
구체적으로, 덱사스캔을 사용하여 앞정강이 전경골 다리 두께를 촬영하였고, 근력을 측정하기 위하여, 약물 투여 전 3회 이상 근력 적응 훈련을 시행하였으며, 시험이 시작되는 시점부터 완료되는 시점까지 2일에 1회씩 근력 평가하였다. 근력 평가를 위하여, 마우스가 앞발로 그리드를 잡을 수 있도록 근력 측정 장치에 배치한 후, 앞발로 그리드를 놓을 때까지 일정한 힘으로 꼬리를 천천히 당겨주어 그리드를 잡는 최대 강도를 5회 반복 측정하여 그 평균값을 뉴턴(N) 단위로 도출하였다. 또한, 앞정강이 전경골근의 길이(T1)를 분석하기 위하여, 마우스의 경골의 상지에서 내측 해부까지의 길이(경골의 길이:L) 및 경골의 절반 길이에서 뒷다리 근육의 외부 가장자리까지의 수직 거리(근육의 두께, T)를 측정하였다. 마지막으로, 제지방 근육량을 측정하기 위하여, 앞정강이근(Tibialis anterior, TA) 및 장딴지근(Gastrocnemius muscle, GS)을 대상으로 하여 제지방량을 측정하였고, 스트레스에 의한 시험결과의 오류를 최소화하기 위해 촬영은 일주일에 1번으로 제한하였다.
그 결과, 정상 마우스 대비 덱사메타손 처리 모델의 다리 두께가 감소된 것으로 나타났고(도 2), 근력, 앞정강이 전경골근의 길이 및 제지방 근육량이 모두 감소하는 것으로 나타났다는 점에서(도 2), 덱사메타손에 따른 근육량 감소 효과가 확인하여, 골격근 위축 모델이 구축된 것으로 확인되었다. 또한, 앞정강이근(Tibialis anterior, TA) 및 장딴지근(Gastrocnemius muscle, GS)을 대상으로 해부를 통해 분리하여 각 근육내 Fetuin-B의 발현량을 정상군의 비교한 결과, Fetuin-B 발현이 증가되어 있는 것으로 확인되었다(도 3).
실시예 3. 덱사메타손에 의한 골격근 위축 모델에 대한 항-Fetuin-B 항체의 우수한 근육량 개선 효과 확인
덱사메타손에 의한 골격근 위축 모델에 대한 항-Fetuin-B 항체의 우수한 근육량 개선 효과를 확인하였다.
구체적으로, 실시예 2에서 준비한 골격근 위축 모델에 생리식염수 용매에 녹인 항-Fetuin-B(Med Chem Express, 미국) 항체를 5㎎/㎏/week의 용량으로 투여하였고, 음성대조군은 생리식염수를 사용하였으며, 양성대조군은 항-IgG1 항체 또는 항-Myostatin(growth differentiation factor 8, GDF8) 항체인 Bimagrumab(Med Chem Express, 미국)을 각각 5㎎/㎏/week의 용량으로 투여하여 준비하였다. 사용된 항-Fetuin-B 항체의 상보성 결정 영역(omplementarity determining region, CDR) 아미노산 서열은 표 1과 같다.
명칭 아미노산 서열 서열번호
AA 19-382 MSPPQLALNPSALLSRGCNDSDVLAVAGFALRDINKDRKDGYVLRLNRVNDAQEYRRGGLGSLFYLTLDVLETDCHVLRKKAWQDCGMRIFFESVYGQCKAIFYMNNPSRVLYLAAYNCTLRPVSKKKIYMTCPDCPSSIPTDSSNHQVLEAATESLAKYNNENTSKQYSLFKVTRASSQWVVGPSYFVEYLIKESPCTKSQASSCSLQSSDSVPVGLCKGSLTRTHWEKFVSVTCDFFESQAPATGSENSAVNQKPTNLPKVEESQQKNTPPTDSPSKAGPRGSVQYLPDLDDKNSQEKGPQEAFPVHLDLTTNPQGETLDISFLFLEPMEEKLVVLPFPKEKARTAECPGPAQNASPLVLPP 서열번호 2
항-Fetuin-B 항체는 덱사메타손 처리 7일 전부터 덱사메타손 처리 14일 후까지의 총 21일의 기간 동안, 주당 2회 피하투여되었다. 그 후, 대조군 및 항-Fetuin-B 항체 처리군의 체중의 변화, 몸 전체의 제지방 근육량, 근기능측정인 근력(Grip Strength) 및 트레이드밀(Treadmill), 앞정강이 전경골의 두께 변화, 앞정강이근(Tibialis anterior, TA) 및 장딴지근(Gastrocnemius muscle, GS)의 제지방 근육량을 실시예 2과 동일한 방법으로 측정하였다.
그 결과, 항-Fetuin-B 항체 처리군의 체중감소율은 양성대조군과 비슷한 경향을 나타내는 것으로 나타났고(도 4a), 항-Fetuin-B 항체 처리군의 전체 제지방 근육량이 양성대조군 대비 높게 유지되는 것으로 확인되었다(도 4b). 근기능 평가지표인 근력(Grip Strength) 및 트레이드밀(Treadmill) 평가 결과 항-Fetuin-B 항체 처리군의 근력(Grip Strength) 변화율은 양성대조군과 유사한 것으로 나타났으며(도 5), 트레이드밀(Treadmill) 평가에서 항-Fetuin-B 항체 처리군은 양성대조군보다 높은 근기능을 보이는 것으로 확인되었다(도 6). 또한, 항-Fetuin-B 항체 처리군의 다리 두께가 양성대조군 대비 두꺼운 것이 육안으로 확인되었고(도 7a), 항-Fetuin-B 항체 처리군의 앞정강이 전경골의 제지방 근육량(도 7b) 및 장딴지근의 제지방 근육량(도 7c)이 양성대조군 대비 증가된 것으로 것으로 확인되었다. 한편, 앞정강이 전경골의 제지방 근육량(도 8a), 근육 길이(도 8b) 및 장딴지근(도 8c)의 제지방 근육량 변화의 경우, 항 Fetuin-B 항체 처리군에서 양성대조군 대비 덱사메타손에 의한 골격근 감소 효과가 억제되면서도 골격근이 증가된 것으로 확인되었다.
이와 같은 결과를 통하여, 항-Fetuin-B 항체 사용에 따른 우수한 근위축 개선 효과를 확인하였다.
제조예 1. 항-Fetuin-B 항체
본 발명에서 사용되는 항-Fetuin-B 항체는 골격근의 양이 감소하거나 완전히 소실되어 인체를 지지하거나 운동하는 능력이 감소하는 증세로, 외상에 의한 탈신경(denervation)으로 일어나는 골격근 위축과 안정 와상이나 관절 고정 등의 부동으로 발생하는 골격근 위축(폐용성 위축)으로 구분된 골격근 위축이 일어하는 근육으로의 혈액 공급 감소와 운동 부족(immobilization), 지속적인 체중 감소, 영양 불량 상태(malnutrition or starvation), 암, 에이즈, 울혈 심부전(congestive heart failure), 만성 폐쇄 폐질환(chronic obstructive pulmonary disease), 신부전(renal failure), 심각한 화상(severe burns) 등 다양한 원인에 대한 치료 효과를 갖고 지속되는 한 어떠한 유래, 어떠한 종류(모노클로날 또는 폴리클로날), 및 어떠한 형태일 수 있다.
본 발명에 사용되는 항-Fetuin-B 항체는 공지 방법을 사용하여 폴리클로날 또는 모노클로날 세포 항체로써 얻어질 수 있다. 본 발명에 사용되는 항-Fetuin-B 항체는 특히 포유류 유래의 모노클로날 항체인 것이 바람직하다. 포유류 유래의 모노클로날 항체는 하이브리도마 또는 일반적인 유전 공학적인 항체 유전자를 포함하는 발현 벡터로 형질 전환되는 숙주에 의해 생성된 것을 포함한다. 본 발명에 사용되는 항-Fetuin-B 항체는 Fetuin-B과 결합하는 것에 의해 Fetuin-B와 호중구에서 발현되는 Fetuin-B 수용체 사이의 결합을 방해하여, 그로 인하여 Fetuin-B의 전달 신호를 억제하고 따라서 Fetuin-B의 생물학적 활성을 억제할 수 있다.
이러한 항체의 예는 WS-4 항체 및 DM/C7 항체, Pep-1 항체 및 Pep-3 항체, 또는 6G4.2.5 항체 및 A5.12.14 항체를 포함하며, WS-4 항체가 특히 바람직하다.
추가적으로, WS-4 항체를 생성하는 하이브리도마 세포주는 마우스 하이브리도마 WS-4으로서 일본, 이바라키켄, 츠쿠바시, 히가시 1-쵸메, 1-3의 통상산업성 공업기술원 생명공학 공업기술연구소에 1996년 4월 17일에 FERM BP-5507로서 부다페스트 조약에 기하여 국제 기탁된 것일 수 있다.
한편, 본 발명에 사용되는 항-Fetuin-B 항체는 표 2에 제시된 아미노산 서열 중 하나 이상의 아미노산 서열을 CDR 서열로 포함할 수 있다.
명칭 아미노산 서열 서열번호
AA 1-382 MGLLLPLALCILVLCCGAMSPPQLALNPSALLSRGCNDSDVLAVAGFALRDINKDRKDGYVLRLNRVNDAQEYRRGGLGSLFYLTLDVLETDCHVLRKKAWQDCGMRIFFESVYGQCKAIFYMNNPSRVLYLAAYNCTLRPVSKKKIYMTCPDCPSSIPTDSSNHQVLEAATESLAKYNNENTSKQYSLFKVTRASSQWVVGPSYFVEYLIKESPCTKSQASSCSLQSSDSVPVGLCKGSLTRTHWEKFVSVTCDFFESQAPATGSENSAVNQKPTNLPKVEESQQKNTPPTDSPSKAGPRGSVQYLPDLDDKNSQEKGPQEAFPVHLDLTTNPQGETLDISFLFLEPMEEKLVVLPFPKEKARTAECPGPAQNASPLVLPP 서열번호 1
AA 293-322
(C-Term)		 DSPSKAGPRGSVQYLPDLDDKNSQEKGPQE 서열번호 3
AA 292-322 TDSPSKAGPRGSVQYLPDLDDKNSQEKGPQE 서열번호 4
AA 149-255 MTCPDCPSSIPTDSSNHQVLEAATESLAKYNNENTSKQYSLFKVTRASSQWVVGPSYFVEYLIKESPCTKSQASSCSLQSSDSVPVGLCKGSLTRTHWEKFVSVTCD 서열번호 5
AA 28-141 PSALLSRGCNDSDVLAVAGFALRDINKDRKDGYVLRLNRVNDAQEYRRGGLGSLFYLTLDVLETDCHVLRKKAWQDCGMRIFFESVYGQCKAIFYMNNPSRVLYLAAYNCTLRP 서열번호 6
AA 152-261 PDCPSSIPTDSSNHQVLEAATESLAKYNNENTSKQYSLFKVTRASSQWVVGPSYFVEYLIKESPCTKSQASSCSLQSSDSVPVGLCKGSLTRTHWEKFVSVTCDFFESQA 서열번호 7
AA 179-295 NNENTSKQYSLFKVTRASSQWVVGPSYFVEYLIKESPCTKSQASSCSLQSSDSVPVGLCKGSLTRTHWEKFVSVTCDFFESQAPATGSENSAVNQKPTNLPKVEESQQKNTPPTDSP 서열번호 8
AA 19-362 MSPPQLALNPSALLSRGCNDSDVLAVAGFALRDINKDRKDGYVLRLNRVNDAQEYRRGGLGSLFYLTLDVLETDCHVLRKKAWQDCGMRIFFESVYGQCKAIFYMNNPSRVLYLAAYNCTLRPVSKKKIYMTCPDCPSSIPTDSSNHQVLEAATESLAKYNNENTSKQYSLFKVTRASSQWVVGPSYFVEYLIKESPCTKSQASSCSLQSSDSVPVGLCKGSLTRTHWEKFVSVTCDFFESQAPATGSENSAVNQKPTNLPKVEESQQKNTPPTDSPSKAGPRGSVQYLPDLDDKNSQEKGPQEAFPVHLDLTTNPQGETLDISFLFLEPMEEKLVVLPFPKEK 서열번호 9
AA 220-300 QASSCSLQSSDSVPVGLCKGSLTRTHWEKFVSVTCDFFESQAPATGSENSAVNQKPTNLPKVEESQQKNTPPTDSPSKAGP 서열번호 10
AA 35-84
(N-Term)		 GCNDSDVLAVAGFALRDINKDRKDGYVLRLNRVNDAQEYRRGGLGSLFYL 서열번호 11
제조예 1-1. 하이브리도마에 의한 항-Fetuin-B 항체의 제조
모노클로날 항체는 기본적으로는 공지 절차를 사용하여 다음의 기재된 바와 같이 제작될 수 있다. 즉, Fetuin-B을 면역 항원(immunizing antigen)으로 사용하고 종래의 면역 방법으로 면역될 수 있다. 따라서 얻어진 면역세포는 통상의 융합 방법(fusion process)에서 공지의 모세포로 융합시켜 통상의 선별 방법(screening method)에 의해 모노클로날 항체-생성 세포를 선별하여 제작되는 것일 수 있다.
보다 구체적으로, 모노클로날 항체는 다음 방법에 의해 수득될 수 있다.
인간 Fetuin-B는 여러 가지 세포에서 생성되고 N-말단(N-terminal ends)에서 다양하게 조작될 수 있으며, 다수의 아미노산 잔기 수를 갖는 Fetuin-B이 지금까지 알려져 왔음에도 불구하고, 아미노산 잔기의 수는 Fetuin-B이 본 발명에서 사용되는 항-Fetuin-B-항체를 얻기 위한 항원으로서 사용될 수 있는 한 어떤 방식으로도 한정되지 않는다.
Fetuin-B의 유전자 서열은 공지의 발현 벡터로 삽입되어 적절한 숙주 세포를 형질 전환시키게 되며, 숙주 세포 중 또는 이들의 배양 상청액 중으로부터 바람직한 항-Fetuin-B 항체가 공지 방법을 사용하여 정제될 수 있고, 따라서 정제된 Fetuin-B 단백질은 면역 항원으로서 사용될 수 있다.
바람직하게는 면역 항원으로 면역화되는 포유류는 일반적인 세포 융합을 사용하기 위하여 모세포와 이들의 적합성을 고려하여 선택되고 이들은 일반적으로 설치 동물, 로고모르파스(logomorphas), 및 영장류(이에 제한되지 않음) 등을 포함하지만 이에 한정되는 것은 아니다. 설치 동물은, 예를 들어 마우스, 토끼, 햄스터 등이 사용될 수 있고, 영장류 동물은, 예를 들면 원숭이가 사용될 수 있다. 원숭이는 예를 들어, 게잡이 원숭이(게를 먹는 짧은 꼬리 원숭이), 붉은털 원숭이, 망토개코 원숭이 등의 협비류 원숭이(동반구 원숭이)일 수 있으나 이에 한정되는 것은 아니다.
면역 항원을 동물에 면역화하는 방법은 당업계의 공지의 방법에 의하여 수행될 수 있으며, 예를 들어, 면역 항원을 포유류의 복강 내 또는 피하에 주사하여 수행될 수 있다. 구체적으로, 면역 항원은 인산으로 완충된 염수(phosphate buffered saline)(PBS) 또는 생리 식염수 등으로 희석, 현탁된 것을 적절한 양의 프로인트 완전 보제(Freund's complete adjuvant)와 혼합하고 유화 후, 포유류에 매 4일 내지 21일 마다 수회 투여될 수 있다. 추가로 면역 항원 면역시에 적당한 담체가 사용될 수 있다.
통상의 방법에 의해 혈청 중 바람직한 항체 레벨(levels)에서 면역 및 일치성의 증가 후에, 포유류로부터 임파 세포 또는 비장 세포 등의 면역 세포를 취하여 세포 융합되고, 여기서 바람직한 면역 세포는 특히 비장 세포이다.
상기 면역 세포와 세포 융합하는 다른 모세포로서 포유류 골수종 세포는 바람직하게는 P3(P3x63Ag8.653)(Kearney, J.F. et al., J. Immunol. (1979) 123, 1548-1550), P3x63Ag8U. 1(Yelton, D.E. et al., Current Topics in Microbiology and Immunology (1978) 81, 1-7), NS-1(Kohler, G. and Milstein, C., Eur. J. Immunol. (1976) 6, 511-519), MPC-11(Margulies, D.H. et al., Cell (1976) 8, 405-415), SP2/0(Shulman, M. et al., Nature (1978) 276, 269-270), F0(de St. Groth, S.F. and Scheidegger, D., J. Immunol. Methods (1980) 35, 1-21 S194(Trowbridge, I.S., J. Exp. Med. (1978) 148, 313-323), R210(Galfre, G. et al., Nature (1979) 217, 131-133) 등의 여러 가지 공지 세포주일 수 있다.
보다 구체적으로, 상기 면역 세포와 골수종 세포 사이의 세포 융합은 기본적으로는 Milstrein et al.(Galfre, G. and Milstein, C., Methods Enzymol. (1981) 73, 3-46) 등에 기재된 바와 같은 공지의 방법에 따라 수행될 수 있다. 상기 세포 융합은 예를 들어 세포 융합 촉진제의 존재하에서 통상의 자양 배양액 중에서 실시될 수 있다. 세포 융합 촉진제는, 예를 들어, 폴리에틸렌 글리콜(PEG), 센다이 바이러스(HVJ) 등이 사용될 수 있고, 디메틸 설폭시드 등이 보조제로 첨가되어 바람직하게 융합 효율을 증가시킬 수 있다.
면역 세포와 골수종 세포의 바람직한 비는, 예를 들어, 골수종 세포 보다 면역 세포를 1 내지 10배 이상 사용하는 것일 수 있다. 상기 세포 융합에 사용되는 배양액으로는 상기 골수종 세포주의 증식에 적합한 RPMI 1640 배양액 및 MEM 배양액이 포함되고, 이러한 유형의 세포 배양을 위해 사용되는 통상의 배양액이 사용 가능하며, 우태아 혈청(fatal calf serum)(FCS) 등의 혈청이 추가로 첨가되는 것일 수 있다.
세포 융합에서, 상기 면역 세포와 골수종 세포의 소정량을 상기 배양액 중에 서 균일하게 혼합하고, 37℃ 정도로 가온한 PEG 용액, 예를 들어, 평균 분자량 1000 내지 6000 정도의 PEG 용액을 통상 30 내지 60%(w/v)의 농도로 첨가하고 혼합하여 바람직한 융합 세포(하이브리도마)를 형성시킬 수 있다. 이어서 적당한 배양액을 연속적으로 첨가하고 원심 분리하여 상청을 제거하는 조작을 반복하여, 하이브리도마의 성장에 바람직하지 않은 세포 융합제 등이 제거될 수 있다.
하이브리도마는 통상의 선택 배양액, 예를 들어, HAT 배양액(하이폭산틴(hypoxanthine), 아미노프테린, 및 타이민)에서 배양되어 선택될 수 있다. HAT 배양액에서의 배양은 일반적으로 바람직한 하이브리도마 이외의 세포(비융합 세포)를 사멸하기에 충분한 시간, 일반적으로 수 일 또는 수 주 동안 계속될 수 있다. 그 후, 종래의 한계 희석법(limiting dilution method)을 실시하여 바람직한 항체를 생성하는 하이브리도마를 선별하고 모노클로날방식으로 무성생식을 수행할 수 있다.
인간 이외의 동물을 항원으로 면역하여 상기 하이브리도마를 수득하기 위하여, 시험관 내 실험에서 인간의 임파구를 Fetuin-B으로 면역하여, 얻어진 면역 임파구는 골수종 세포, 예를 들어 영구 분열능을 갖는 U266와 융합하여 Fetuin-B에 결합 활성을 갖는 바람직한 인간 항체를 생성하는 하이브리도마를 제조할 수 있다. 또한, 인간의 항체 유전자의 레퍼터리(repertoire)를 갖는 트랜스제닉 동물(transgenic animal)에 항원 Fetuin-B으로 면역화하여 항-Fetuin-B 항체를 생성하는 세포를 수득한 후, 상기 세포를 골수종 세포와 융합하여 Fetuin-B에 대한 인간 항체를 취득하는데 사용할 수 있는 하이브리도마를 제조할 수 있다.
따라서 제작된 모노클로날 항체를 생성하는 하이브리도마는 통상의 배양액 중에서 2차 배양될 수 있고, 또는 액체 질소 중에 장기 보존하는 것이 가능하다.
상기 하이브리도마에서 모노클로날 항체를 얻기 위하여, 상기 하이브리도마를 통상의 방법에서 배양하고 항체를 배양 상청으로서 얻어지는 방법 또는 하이브리도마를 상기 하이브리도마와 적합성이 있는 포유류에 투여하여 증식시켜 항체를 복수(腹水)로 수득하는 방법을 사용할 수 있다. 전자의 방법은 고순도의 항체를 얻기 위해 적합하고, 반면에 후자는 항체의 대규모 생산에 적합하다.
항체 생성을 위하여 하이브리도마를 사용하기 위하여, 종양 형성 유전자로 불멸화된 항체-생성 면역 임파구 등의 면역 세포가 사용될 수 있다.
제조예 1-2. 재조합 항체
모노클로날 항체는 또한 재조합 유전자 기술에 의해 생성된 재조합 항체로써 제조될 수 있다. 예를 들어, 재조합 항체를 하이브리도마 또는 항체-생성 면역 임파구 등의 면역 세포에 의해 수득한 후, 적합한 벡터에 탑재하고, 이를 숙주로 도입하여 항체를 생성할 수 있다.
항-Fetuin-B 항체를 생성하는 하이브리도마로부터, 항-Fetuin-B 항체의 가변 영역(V 영역)을 코드화(encode)하는 mRNA를 단리한다. 구체적으로, mRNA의 단리는 공지의 방법, 예를 들어, 구아니딘 초속심법(guanidineultracentrifugation method) (Chirgwin, J.M. et al., Biochemistry (1979) 18, 5294-5299), AGPC 방법(Chomczynski, P. and Sacchi, N., Anal. Biochem. (1987) 162, 156-159) 등에 의해 전 RNA를 제조하고, mRNA 정제 키트(Pharmacia) 등을 사용하여 mRNA를 정제하거나, QuickPrep mRNA 정제 키트(Pharmacia)를 사용하여 mRNA를 직접적으로 수득하는 방법으로 수행될 수 있다.
수득된 mRNA로부터 역전사효소(reverse transcriptase)를 사용하여 항체의 V 영역의 cDNA가 합성된다. 구체적으로, cDNA의 합성은 AMV Reverse Transcriptase First-Strand cDNA Synthesis Kit(생화학공업사제)로 수행될 수 있다. 또는, cDNA의 합성과 증폭을 위하여, 5'-Ampli FINDER RACE Kit(Clontech제) 및 폴리메라아제 연쇄 반응(PCR)을 이용하는 5'-RACE법(Frohman, M.A. et al., Proc. Natl. Acad. Sci. U.S.A.(1988) 85, 8998-9002; Belyavsky, A. et al., Nucleic Acids Res. (1989) 17, 2919-2932)이 사용될 수 있다.
얻어진 PCR 생성물로부터 바람직한 DNA 단편이 정제되고 벡터 DNA와 연결되고, 생성된 재조합 벡터를 대장균 등에 도입한 다음, 콜로니(colony)를 선택하여 바람직한 재조합 벡터가 수득될 수 있다. 바람직한 재조합 DNA의 염기서열은 DNA 사슬 종료 방법 등의 공지의 방법에 의해 확정될 수 있다.
바람직한 항-Fetuin-B 항체의 V 영역을 암호화하는 DNA가 얻어지면, 이것을 바람직한 항체의 정상 영역(C영역)을 암호화하는 DNA와 연결하여 발현 벡터에 위치시킨다. 또는, 항체의 V 영역을 코드화하는 DNA를 이미 항체의 C 영역을 코드화 하는 DNA를 포함하는 발현 벡터로 위치시킨다. 항체 C 영역은 V 영역의 것과 동일한 동물 종 또는 V 영역의 것과 다른 동물 종으로부터 유도될 수 있다
본 발명에서 사용되는 항-Fetuin-B 항체를 생성하기 위하여, 항체 유전자는 발현 제어 영역, 예를 들어, 인핸서(enhancer) 및/또는 프로모터의 제어 하에서 발현되기 위해 벡터로 위치될 수 있으며, 상기 발현 벡터에 의해 숙주 세포에 형질 전환되어 항체가 발현될 수 있다.
항체 유전자의 발현은 항체 중쇄(heavy chain)(H쇄) 또는 경쇄(ligbt chain)(L쇄)를 암호화하는 DNA를 재조합 발현 벡터에 위치시켜 숙주 세포의 동시 형질전환하거나, H쇄와 L쇄를 암호화하는 DNA를 단일 발현 세포로 위치시켜 숙주 세포를 형질전환하여 이루어질 수 있다.
제조예 1-3. 개변 항체(altered antibody)
본 발명에 사용되는 재조합 항체는 인간에 대한 이종 항원성을 저하하기 위한 목적으로 인위적인 개변 항체, 예를 들면 키메라 항체, 인간화 항체일 수 있다. 개변 항체는 인간 항체의 C 영역을 갖는 것으로, 키메라 항체 또는 인간형화 항체 등의 항체가 사용될 수 있다. 상기 개변 항체는 공지의 방법을 사용하여 생성될 수 있다. 즉, 키메라 항체는 인간 이외의 항체 V 영역을 암호화하는 DNA를 인간 항체 C 영역을 암호화하는 DNA에 연결한 다음, 이를 발현 벡터에 탑재하여 숙주로 형질전환하여 생성될 수 있다.
구체적으로, 마우스 항체의 CDRs와 인간 항체의 프레임워크 영역(framework regions)(FRs)과 연결하도록 설계된 DNA 서열은 말단부에 서로 겹쳐지는 부분을 갖는 수 개의 분할된 올리고뉴클레오티드로부터 합성된 다음, 올리고뉴클레오티드가 하나의 완전한 DNA로 합성될 수 있다. 수득된 DNA는 인간 항체 C 영역을 암호화하는 DNA와 연결되고, 발현 벡터에 탑재된 후 항체 생성을 위한 숙주로 형질전환될 수 있다.
본 발명에서 사용되는 인간화 항체는 인간화 WS-4 항체인 것이 바람직하다. 인간화 WS-4 항체에서, 마우스로부터 유도된 WS-4 항체의 CDRs는 L쇄에 대한 인간 항체 REI의 FRs에 연결되고, H쇄에 대한 인간 항체 VDH26의 FRI-3과 인간 항체 4B4의 FR4및 FR의 아미노산 잔기가 치환되어 항원-결합 활성이 얻어질 수 있다.
또한, 본 발명에서 사용되는 인간화 항체의 CDR 서열은 서열번호 2로 표시되는 아미노산 서열인 것이 바람직하다.
본 발명에 사용되는 항-Fetuin-B 항체를 생성하기 위하여, 항체 유전자는 발현 제어 영역, 예를 들어 인핸서 및/또는 프로모터의 제어 하에서 발현되기 위해 벡터에 탑재된 후, 상기 발현 벡터가 숙주 세포로 형질전환되어 항체가 발현될 수 있다.
제조예 1-4. 항체 단편 및 개선된 항체
본 발명의 항-Fetuin-B 항체는 Fetuin-B에 결합하여 Fetuin-B의 활성을 억제할 수 있는 항체의 단편 또는 이들의 개선된 항체이다. 구체적으로는 항체를 효소, 예를 들어, 파파인 또는 펩신으로 처리하여, 항체 단편을 생성하고, 또는 이들 항체 단편을 코드화하는 유전자를 구성한 다음, 이를 발현 벡터로 도입한 후, 적당한 숙주 세포에서 발현된 것일 수 있다(예를 들면, Co, M.S.et al., J. Immunol. (1994) 152, 2968-2976; Better, M. and Horwitz, A.H., Methods Enzymol. (1989)178, 476-496; Pluckthun, A. and Skerra, A., Methods Enzymol. (1989) 178, 497-515; Lamoyi, E.,Methods Enzymol. (1986) 121, 652-663; Rousseaux, J. et al., Methods Enzymol. (1986) 121, 633-669; Bird, R.E. and Walker, B.W., Trends Biotechnol. (1991) 9, 132-137을 참조).
개선된 항체로서, 폴리에틸렌 글리콜(PEG) 등의 다양한 분자와 결합된 항-Fetuin-B 항체가 사용될 수 있다. 상기 개선된 항체는 당업계에서 일반적으로 항체를 화학적으로 개선하는 방법에 의해 제조된 것일 수 있다.
제조예 1-5. 재조합 항체, 개변 항체, 및 항체 단편의 발현 및 생성
항-Fetuin-B 항체를 암호화하는 유전자는 공지의 방법으로 발현되어 수득될 수 있다. 포유 세포의 경우, 발현은 일반적으로 유용하게 사용되는 프로모터, 발현시킨 유전자 또는 DNA의 3' 하류에 폴리 A 신호를 기능적으로 결합시켜 발현시킬 수 있다. 또한, 프로모터/인핸서로는 인간 세포 확대 바이러스 전기 프로모터/강화제(human cytomegalovirus immediate early promoter/enhancer)를 포함할 수 있다.
또한, 본 발명에서 사용되는 항체 발현에 사용될 수 있는 프로모터/인핸서는 예를 들어, 종양 바이러스, 폴리오마바이러스, 아데노바이러스 및 유인원 바이러스 40(simian virus)(SV40)등의 바이러스성 프로모터/인핸서 및 인간 연장 인자 1α(human elongation factor 1α)(HEF1α) 등의 포유 세포로부터 유래되는 프로모터/인핸서일 수 있다.
본 발명에 사용되는 항체의 제조를 위하여, 임의의 발현 시스템(production system)이 사용될 수 있고, 항체 제조 시스템은 시험관 내 또는 생체 내 발현 시스템일 수 있다. 시험관 내 시스템은, 진핵 세포를 이용하는 발현 시스템 및 원핵 세포를 이용하는 발현 시스템일 수 있다.
생체 내 발현 시스템은, 동물 또는 식물을 사용하는 시스템일 수 있으며, 동물을 사용하는 시스템은 포유류 또는 곤충을 이용하는 발현 시스템일 수 있다.
제조예 1-6. 항체의 분리 및 정제
상기와 같이 발현되고 생성된 항체를 세포의 내외 또는 숙주 세포로부터 분리한 다음 균질하게 정제할 수 있다. 본 발명에서 사용되는 항체의 분리, 정제는 어떤 당업계의 일반적인 항체의 분리 및 정제 방법에 의해 수행될 수 있다. 예를 들어, 항체의 분리 및 정제는 친화 크로마토그래피, 여과기, 한외 농축(ultraconcentration), 염석(salting-out), 투석 등을 적절하게 사용하여 달성될 수 있다. 친화 크로마토그래피에 사용되는 컬럼은 프로틴 A 컬럼 및 프로틴 G 컬럼일 수 있다. 프로틴 A 컬럼은 예를 들어 하이퍼 D(Hyper D), 포로스(POROS), 세파로스 F.F(Sepharose F.F.) (Pharmacia제) 일 수 있다. 친화 크로마토그래피 이외의 다른 크로마토그래피는 예를 들어, 이온 교환 크로마토그래피, 소수성 크로마토그래피, 겔-여과, 역-상 크로마토그래피, 흡수 크로마토그래피 등일 수 있으며, 상기 크로마토그래피는 HPLC, FPLC 등의 액체-상 크로마토그래피일 수 있다.
제조예 1-7. 항체의 농도 측정
상기와 같이 획득된 항체의 농도는 흡광도의 측정 또는 효소 결합 면역 측정법(ELISA) 등에 의해 결정될 수 있다. 따라서, 흡광도 측정이 사용되는 경우, 취득된 항체를 PBS로 적절하게 희석한 후 280nm에서 흡광도를 측정한 다음, 다양한 종과 아강을 이용하여 인간의 경우 1㎎/㎖에서 1.4OD의 흡광 계수를 이용하여 계산할 수 있다.
ELISA법이 사용되는 경우, 다음과 같은 방법으로 항체의 농도가 측정될 수 있다. 구체적으로, pH9.6의 0.1M 중탄산 완충액에서 1㎍/㎖로 희석된 염소 항-인간 IgG 항체 100㎕를 96-웰 플레이트(96-well plate)(Nunc)에 첨가하고, 4℃에서 철야로 배양하여 항체를 고정한다. 웰을 봉쇄한 후에, 본 발명의 적절하게 희석된 항체 또는 항체를 함유하는 시료 각 100㎕ 또는 농도 표준으로서 공지 농도의 인간 IgG 100㎕를 첨가하고, 실온에서 1시간 동안 배양한다. 웰을 세척한 후에, 5000배로 희석된 알카리성의 포스파타아제-표식 항-인간 IgG 항체를 첨가하고, 실온에서 1시간 동안 배양한다. 세척 후, 기질 용액을 첨가하고 배양한 다음, MICROPLATE READER Model 3550(Bio-Rad제)을 사용하여 405nm에서 흡광도를 측정하여 농도 표준 IgG의 흡광도에 기초하여 바람직한 항체의 농도를 계산한다. 항체 농도를 결정하기 위하여, BIAcore(Pharmacia제)가 사용될 수 있다.
제조예 1-8. 항체 활성의 확인
공지 방법이 본 발명에 사용되는 항체의 항원-결합 활성의 측정(Antibodies : A Laboratory Manual. Ed Harlow and David Lane, Cold Spring Harbor Laboratory, 1988)과 리간드 수용체 결합 억제 활성 측정(Harada, A. et al., Int. Immunol. (1993) 5, 681-690)을 위해 사용될 수 있다.
본 발명에서 사용되는 항-Fetuin-B 항체의 항원-결합 활성을 측정하는 방법으로써, ELISA, EIA(효소면역측정법), RIA(방사면역측정법), 또는 형광항체법이 사용될 수 있다.
이제까지 본 발명에 대하여 그 실시예들을 중심으로 살펴보았다. 본 발명이 속하는 기술 분야에서 통상의 지식을 가진 자는 본 발명이 본 발명의 본질적인 특성에서 벗어나지 않는 범위에서 변형된 형태로 구현될 수 있음을 이해할 수 있을 것이다. 그러므로 개시된 실시예들은 한정적인 관점이 아니라 설명적인 관점에서 고려되어야 한다. 본 발명의 범위는 전술한 설명이 아니라 청구범위에 나타나 있으며, 그와 동등한 범위 내에 있는 모든 차이점은 본 발명에 포함된 것으로 해석되어야 할 것이다.

Claims (10)

  1. 항-Fetuin-B 항체를 유효성분으로 포함하는 근위축(muscle atrophy) 예방 또는 치료용 약학적 조성물.
  2. 제 1 항에 있어서, 상기 근위축은 근육 노화 관련 질환, 암성 악액질, 근감소, 노화, 비만, 스테로이드제 장기투여 및 우주비행으로 이루어진 군으로부터 선택되는 어느 하나에 의하여 발생하는 것인 근위축 예방 또는 치료용 약학적 조성물.
  3. 제 2 항에 있어서, 상기 근육 노화 관련 질환은 노인성 근감소증(Sarcopenia), 긴장감퇴증(atony), 근위축증(muscular atrophy), 근육 퇴화, 근경직증, 근위축성 축삭경화증, 근무력증, 근염, 근육 석회화, 근육 골화, 근육약화 관련 질환 및 악액질(cachexia)로 이루어진 군으로부터 선택되는 어느 하나의 질환인 것인 근위축 예방 또는 치료용 약학적 조성물.
  4. 제 1 항에 있어서, 상기 조성물은 안륜근, 저작근육, 혀 및 목 근육, 흉곽 흉대 및 팔의 근육, 팔 및 어깨, 손의 내재성 근육, 하지대 및 다리 근육, 앞다리 및 발근육으로 구성된 군으로부터 선택되는 하나 이상의 표적 조직으로 전달되는 것인 근위축 예방 또는 치료용 약학적 조성물.
  5. 제 2 항에 있어서, 상기 스테로이드제는 덱사메타손인 것인 근위축 예방 또는 치료용 약학적 조성물.
  6. 제 1 항에 있어서, 상기 항체는 모노클로날 항체인 것인 근위축 예방 또는 치료용 약학적 조성물.
  7. 제 1 항에 있어서, 상기 항체의 상보성 결정 영역(omplementarity determining region, CDR)의 아미노산 서열은 서열번호 1 내지 서열번호 11로 이루어진 군으로부터 선택되는 하나 이상의 서열인 것인 근위축 예방 또는 치료용 약학적 조성물.
  8. 제 1 항에 있어서, 상기 항체는 이중항체인 것인 근위축 예방 또는 치료용 약학적 조성물.
  9. 제 1 항에 있어서, 상기 항체는 인간화 항체인 것인 근위축 예방 또는 치료용 약학적 조성물.
  10. 제 1 항의 조성물을 대상체에 투여하는 단계를 포함하는 근위축의 치료 방법.
PCT/KR2023/002082 2022-03-24 2023-02-13 항-fetuin-b 항체 및 해당 항체를 유효 성분으로 포함하는 근육질환의 예방, 치료 또는 개선용 조성물 WO2023182657A1 (ko)

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
KR10-2022-0036372 2022-03-24
KR20220036372 2022-03-24

Publications (1)

Publication Number Publication Date
WO2023182657A1 true WO2023182657A1 (ko) 2023-09-28

Family

ID=88101379

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/KR2023/002082 WO2023182657A1 (ko) 2022-03-24 2023-02-13 항-fetuin-b 항체 및 해당 항체를 유효 성분으로 포함하는 근육질환의 예방, 치료 또는 개선용 조성물

Country Status (2)

Country Link
KR (1) KR20230140362A (ko)
WO (1) WO2023182657A1 (ko)

Cited By (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN118109419A (zh) * 2023-11-20 2024-05-31 梅州市人民医院(梅州市医学科学院) 分泌fetuin-B单克隆抗体的杂交瘤细胞株、单克隆抗体组合及其应用

Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2009046495A1 (en) * 2007-10-09 2009-04-16 St Vincent's Hospital Sydney Limited A method of treating cachexia with the removal or inactivation of macrophage inhibitory cytokine-1
KR20130121340A (ko) * 2012-04-27 2013-11-06 건국대학교 산학협력단 급성동맥경화 진단을 위한 바이오마커로서의 혈청단백질 Ｆｅｔｕｉｎ-Ｂ의 이용
CN104558145A (zh) * 2014-12-30 2015-04-29 华权高 一种胎球蛋白a重组蛋白及多克隆抗体的制备方法

Family Cites Families (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
AU2014209012B2 (en) 2013-01-28 2018-11-08 Regents Of The University Of Minnesota Anti-Flt-1 antibodies in treating Duchenne muscular dystrophy

Patent Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2009046495A1 (en) * 2007-10-09 2009-04-16 St Vincent's Hospital Sydney Limited A method of treating cachexia with the removal or inactivation of macrophage inhibitory cytokine-1
KR20130121340A (ko) * 2012-04-27 2013-11-06 건국대학교 산학협력단 급성동맥경화 진단을 위한 바이오마커로서의 혈청단백질 Ｆｅｔｕｉｎ-Ｂ의 이용
CN104558145A (zh) * 2014-12-30 2015-04-29 华权高 一种胎球蛋白a重组蛋白及多克隆抗体的制备方法

Non-Patent Citations (2)

* Cited by examiner, † Cited by third party
Title
DATABASE PROTEIN ANONYMOUS : "Fetuin B [Homo sapiens]", XP093095495, retrieved from NCBI *
JUNG, S. H. ET AL.: "The serum protein fetuin-B is involved in the development of acute myocardial infarction", CLINICAL SCIENCE., BIOCHEMICAL SOCIETY AND THE MEDICAL RESEARCH SOCIETY, LONDON,, GB, vol. 129, no. 1, 30 November 2014 (2014-11-30), GB , pages 27 - 38, XP009549071, ISSN: 0143-5221, DOI: 10.1042/CS20140462 *

Cited By (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN118109419A (zh) * 2023-11-20 2024-05-31 梅州市人民医院(梅州市医学科学院) 分泌fetuin-B单克隆抗体的杂交瘤细胞株、单克隆抗体组合及其应用

Also Published As

Publication number Publication date
KR20230140362A (ko) 2023-10-06

Similar Documents

Publication Publication Date Title
TWI351967B (en) A preventive agent for vasculitis
KR101317264B1 (ko) 톨 유사 수용체 3 길항제, 방법 및 용도
KR101300546B1 (ko) 항 글리피칸 3 항체를 이용한 어쥬번트 요법
RU2565391C2 (ru) Способы лечения воспаления в нейронной ткани с применением моноклонального антитела или его связывающего фрагмента
KR101601986B1 (ko) 인터류킨 6 수용체 저해제를 유효 성분으로 하는 이식편대숙주병 치료제
JP5285513B2 (ja) 血管形成抑制剤
ES2225889T3 (es) Receptores solubles de la linfotoxina-beta, anticuerpos contra el receptor de la linfotoxina y anticuerpos ligandos, como agentes terapeuticos para el tratamiento de enfermedades inmunologicas.
KR100407811B1 (ko) 인터루킨-6 안타고니스트를 유효성분으로서 함유하는 염증성 장질환의 예방 또는 치료제
KR101239051B1 (ko) 심장질환 치료제
WO2009014263A1 (ja) インターロイキン６受容体阻害剤を有効成分とする眼炎症疾患治療剤
WO2007061029A1 (ja) 前立腺癌治療剤
UA80091C2 (en) Remedies for infant chronic arthritis-relating diseases and still's disease which contain an interleukin-6 (il-6) antagonist
TW200803893A (en) Agents for suppressing the induction of cytotoxic T cells
WO2023182657A1 (ko) 항-fetuin-b 항체 및 해당 항체를 유효 성분으로 포함하는 근육질환의 예방, 치료 또는 개선용 조성물
KR100371000B1 (ko) 류머티즘치료제
KR100584704B1 (ko) 면역 질환을 치료하기 위한 치료제로서의 가용성 림포톡신-베타 수용체, 항림포톡신 수용체 항체 및 항림포톡신 리간드 항체
JP2010095445A (ja) Ｉｌ−６アンタゴニストを有効成分とする炎症性筋疾患治療剤
IE70519B1 (en) Novel cytokines
JPH11501283A (ja) Ｉ型インターフェロンに対する中和活性を有する、インターフェロンレセプターに対するモノクローナル抗体を含んでなる医薬組成物
US6905684B1 (en) Preventives and remedies for diffuse lung diseases
WO2022005068A1 (ko) Lgals3bp에 특이적으로 결합하는 항체 및 이의 용도
WO2024090916A1 (ko) 항-ｉｇｓｆ1 항체를 포함하는 암 치료용 약학 조성물
WO2023191470A1 (ko) Api5 단백질에 특이적으로 결합하는 항체
WO2022216027A1 (ko) 산화된 면역글로불린을 유효성분으로 포함하는 면역조절 기능 이상 관련 질환 예방 또는 치료용 약학적 조성물
WO2023027507A1 (ko) 자가면역질환의 예방 또는 치료를 위한 항체의약품

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 23775160

Country of ref document: EP

Kind code of ref document: A1