WO2023058705A1 - 抗hla-dq2.5抗体の製剤 - Google Patents
抗hla-dq2.5抗体の製剤 Download PDFInfo
- Publication number
- WO2023058705A1 WO2023058705A1 PCT/JP2022/037375 JP2022037375W WO2023058705A1 WO 2023058705 A1 WO2023058705 A1 WO 2023058705A1 JP 2022037375 W JP2022037375 W JP 2022037375W WO 2023058705 A1 WO2023058705 A1 WO 2023058705A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- amino acid
- seq
- antibody
- cdr
- antigen
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Images
Classifications
-
- G—PHYSICS
- G16—INFORMATION AND COMMUNICATION TECHNOLOGY [ICT] SPECIALLY ADAPTED FOR SPECIFIC APPLICATION FIELDS
- G16B—BIOINFORMATICS, i.e. INFORMATION AND COMMUNICATION TECHNOLOGY [ICT] SPECIALLY ADAPTED FOR GENETIC OR PROTEIN-RELATED DATA PROCESSING IN COMPUTATIONAL MOLECULAR BIOLOGY
- G16B15/00—ICT specially adapted for analysing two-dimensional [2D] or three-dimensional [3D] molecular structures, e.g. structural or functional relations or structure alignment
- G16B15/30—Drug targeting using structural data; Docking or binding prediction
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
- A61K39/39591—Stabilisation, fragmentation
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/06—Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite
- A61K47/08—Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite containing oxygen, e.g. ethers, acetals, ketones, quinones, aldehydes, peroxides
- A61K47/10—Alcohols; Phenols; Salts thereof, e.g. glycerol; Polyethylene glycols [PEG]; Poloxamers; PEG/POE alkyl ethers
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/06—Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite
- A61K47/16—Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite containing nitrogen, e.g. nitro-, nitroso-, azo-compounds, nitriles, cyanates
- A61K47/18—Amines; Amides; Ureas; Quaternary ammonium compounds; Amino acids; Oligopeptides having up to five amino acids
- A61K47/183—Amino acids, e.g. glycine, EDTA or aspartame
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/06—Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite
- A61K47/20—Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite containing sulfur, e.g. dimethyl sulfoxide [DMSO], docusate, sodium lauryl sulfate or aminosulfonic acids
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/06—Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite
- A61K47/26—Carbohydrates, e.g. sugar alcohols, amino sugars, nucleic acids, mono-, di- or oligo-saccharides; Derivatives thereof, e.g. polysorbates, sorbitan fatty acid esters or glycyrrhizin
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/30—Macromolecular organic or inorganic compounds, e.g. inorganic polyphosphates
- A61K47/32—Macromolecular compounds obtained by reactions only involving carbon-to-carbon unsaturated bonds, e.g. carbomers, poly(meth)acrylates, or polyvinyl pyrrolidone
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/30—Macromolecular organic or inorganic compounds, e.g. inorganic polyphosphates
- A61K47/34—Macromolecular compounds obtained otherwise than by reactions only involving carbon-to-carbon unsaturated bonds, e.g. polyesters, polyamino acids, polysiloxanes, polyphosphazines, copolymers of polyalkylene glycol or poloxamers
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K9/00—Medicinal preparations characterised by special physical form
- A61K9/0012—Galenical forms characterised by the site of application
- A61K9/0019—Injectable compositions; Intramuscular, intravenous, arterial, subcutaneous administration; Compositions to be administered through the skin in an invasive manner
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K9/00—Medicinal preparations characterised by special physical form
- A61K9/08—Solutions
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61M—DEVICES FOR INTRODUCING MEDIA INTO, OR ONTO, THE BODY; DEVICES FOR TRANSDUCING BODY MEDIA OR FOR TAKING MEDIA FROM THE BODY; DEVICES FOR PRODUCING OR ENDING SLEEP OR STUPOR
- A61M5/00—Devices for bringing media into the body in a subcutaneous, intra-vascular or intramuscular way; Accessories therefor, e.g. filling or cleaning devices, arm-rests
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61M—DEVICES FOR INTRODUCING MEDIA INTO, OR ONTO, THE BODY; DEVICES FOR TRANSDUCING BODY MEDIA OR FOR TAKING MEDIA FROM THE BODY; DEVICES FOR PRODUCING OR ENDING SLEEP OR STUPOR
- A61M5/00—Devices for bringing media into the body in a subcutaneous, intra-vascular or intramuscular way; Accessories therefor, e.g. filling or cleaning devices, arm-rests
- A61M5/36—Devices for bringing media into the body in a subcutaneous, intra-vascular or intramuscular way; Accessories therefor, e.g. filling or cleaning devices, arm-rests with means for eliminating or preventing injection or infusion of air into body
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
- A61P1/04—Drugs for disorders of the alimentary tract or the digestive system for ulcers, gastritis or reflux esophagitis, e.g. antacids, inhibitors of acid secretion, mucosal protectants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
- A61P1/14—Prodigestives, e.g. acids, enzymes, appetite stimulants, antidyspeptics, tonics, antiflatulents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
- A61P37/06—Immunosuppressants, e.g. drugs for graft rejection
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/22—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against growth factors ; against growth regulators
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
- C07K16/2827—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against B7 molecules, e.g. CD80, CD86
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2866—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against receptors for cytokines, lymphokines, interferons
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/36—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against blood coagulation factors
-
- G—PHYSICS
- G16—INFORMATION AND COMMUNICATION TECHNOLOGY [ICT] SPECIALLY ADAPTED FOR SPECIFIC APPLICATION FIELDS
- G16B—BIOINFORMATICS, i.e. INFORMATION AND COMMUNICATION TECHNOLOGY [ICT] SPECIALLY ADAPTED FOR GENETIC OR PROTEIN-RELATED DATA PROCESSING IN COMPUTATIONAL MOLECULAR BIOLOGY
- G16B15/00—ICT specially adapted for analysing two-dimensional [2D] or three-dimensional [3D] molecular structures, e.g. structural or functional relations or structure alignment
- G16B15/20—Protein or domain folding
-
- G—PHYSICS
- G16—INFORMATION AND COMMUNICATION TECHNOLOGY [ICT] SPECIALLY ADAPTED FOR SPECIFIC APPLICATION FIELDS
- G16B—BIOINFORMATICS, i.e. INFORMATION AND COMMUNICATION TECHNOLOGY [ICT] SPECIALLY ADAPTED FOR GENETIC OR PROTEIN-RELATED DATA PROCESSING IN COMPUTATIONAL MOLECULAR BIOLOGY
- G16B40/00—ICT specially adapted for biostatistics; ICT specially adapted for bioinformatics-related machine learning or data mining, e.g. knowledge discovery or pattern finding
-
- G—PHYSICS
- G16—INFORMATION AND COMMUNICATION TECHNOLOGY [ICT] SPECIALLY ADAPTED FOR SPECIFIC APPLICATION FIELDS
- G16H—HEALTHCARE INFORMATICS, i.e. INFORMATION AND COMMUNICATION TECHNOLOGY [ICT] SPECIALLY ADAPTED FOR THE HANDLING OR PROCESSING OF MEDICAL OR HEALTHCARE DATA
- G16H70/00—ICT specially adapted for the handling or processing of medical references
- G16H70/40—ICT specially adapted for the handling or processing of medical references relating to drugs, e.g. their side effects or intended usage
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61M—DEVICES FOR INTRODUCING MEDIA INTO, OR ONTO, THE BODY; DEVICES FOR TRANSDUCING BODY MEDIA OR FOR TAKING MEDIA FROM THE BODY; DEVICES FOR PRODUCING OR ENDING SLEEP OR STUPOR
- A61M2209/00—Ancillary equipment
- A61M2209/04—Tools for specific apparatus
- A61M2209/045—Tools for specific apparatus for filling, e.g. for filling reservoirs
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61M—DEVICES FOR INTRODUCING MEDIA INTO, OR ONTO, THE BODY; DEVICES FOR TRANSDUCING BODY MEDIA OR FOR TAKING MEDIA FROM THE BODY; DEVICES FOR PRODUCING OR ENDING SLEEP OR STUPOR
- A61M5/00—Devices for bringing media into the body in a subcutaneous, intra-vascular or intramuscular way; Accessories therefor, e.g. filling or cleaning devices, arm-rests
- A61M5/178—Syringes
- A61M5/28—Syringe ampoules or carpules, i.e. ampoules or carpules provided with a needle
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/31—Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/94—Stability, e.g. half-life, pH, temperature or enzyme-resistance
Definitions
- the present invention relates to anti-HLA-DQ2.5 antibodies and formulations containing them.
- HLA Human leukocyte antigens
- MHC major histocompatibility complex
- HLA-DQ2.5 HLA-DQ2.5 isoform
- HLA-DQ2.5 presents processed antigens derived from exogenous sources to the T cell receptor (TCR) on T cells.
- Immunogenic gluten peptides such as gliadin peptides, are formed in celiac disease patients as a result of digestion of high gluten foods such as bread (Non-Patent Document 2).
- the peptide is transported across the intestinal epithelium to the lamina propria and deamidated by tissue transglutaminase such as transglutaminase 2 (TG2).
- Non-Patent Document 7 The currently available treatment for celiac disease is lifelong adherence to a gluten-free diet (GFD). However, in reality, it is difficult to completely eliminate gluten exposure even with GFD.
- Non-Patent Document 11 The acceptable gluten dose for these patients is only about 10-50 mg/day (Non-Patent Document 11). Cross-contamination can occur extensively in GFD manufacturing, and trace amounts of gluten can cause symptoms of celiac disease even in patients who are fully adherent to the GFD. In the presence of such risks of unintended gluten exposure, adjunctive therapy for GFD is needed.
- subcutaneous injection When designing an antibody-containing preparation for subcutaneous injection, while the antibody dose per injection is large (approximately 80 to 200 mg), subcutaneous injection generally limits the volume of injection. It is essential to increase the concentration of the antibody in the liquid.
- a cylindrical syringe body filled with a drug inside an injection needle attached to the tip of the syringe body, and a detachably attached syringe cap covering the injection needle and a plunger that is inserted into the syringe body and is slidable in the axial direction of the syringe body.
- the inner wall of the prefilled syringe and the plunger are coated with a lubricant such as silicone oil.
- the particles to be formed are aggregates larger than multimers such as dimers and trimers, but fine particles with a particle size of 1.5 ⁇ m to less than 50 ⁇ m, which are generally difficult to see with the naked eye.
- Sub-visible particles (SVP) and visible particles (visible particles: VP, larger than 100 ⁇ m) that can be detected visually with standard illumination (about 2,000-3,000 lx) are known.
- the visual detection rate of visible particles in pharmaceutical preparations varies greatly among practitioners, but particles with a particle size of 100 ⁇ m can be detected under the standard illuminance (approximately 2,000-3,000 lx) specified in the pharmacopoeia.
- Non-Patent Document 12 Non-Patent Document 12
- the detection sensitivity is about 40%, the detection sensitivity for particles with a particle size of 150 ⁇ m is about 70%, and the detection sensitivity for particles with a particle size of 200 ⁇ m is almost 100% (Non-Patent Document 12).
- Non-Patent Document 12 by increasing the illumination intensity for observing the pharmaceutical formulation or prolonging the observation time, it is actually possible to visually detect even smaller particles with a minimum particle size of about 40 ⁇ m.
- such particles of 40 ⁇ m or more to 100 ⁇ m are particularly referred to as particles visually detectable only under high illumination.
- Particles having a particle size of 40 ⁇ m or more are particles that can be visually detected under high illumination, and are referred to as visually detectable particles.
- antibodies have the property of adsorbing and aggregating at interfaces such as air-liquid and solid-liquid interfaces. The presence of these interfaces may contribute to the formation of the visually detectable particles. It has been reported that applying mechanical stress to a syringe filled with an antibody solution significantly increases the number of fine particles due to the presence of an interface (Non-Patent Document 13).
- the antibody solution filled in the syringe forms an air-liquid interface due to the presence of air bubbles, and forms a solid-liquid interface when it comes into contact with the plunger and syringe barrel.
- Non-Patent Document 14 Protein adsorbed to the solid-liquid interface and aggregated fall off in the liquid due to movement of air in the prefilled syringe and appear as visible particles.
- One way to reduce the stress received at various interfaces is to reduce the amount of air bubbles in the prefilled syringe. By reducing the amount of air bubbles, it is possible to reduce the amount of air moving in the prefilled syringe, and as a result, it is thought that adsorption to the gas-liquid interface and solid-liquid interface and desorption of aggregates can be suppressed. .
- the present invention provides anti-HLA-DQ2.5 antigen-binding molecules and formulations (especially injectable formulations) containing the same.
- the antigen-binding molecules of the present invention have been modified and are capable of binding to two or more complexes formed by HLA-DQ2.5 and gluten peptides.
- the present invention provides: [1] (i) a first antigen-binding portion having binding activity to HLA-DQ2.5 in the form of a complex with a gluten peptide; and (ii) HLA in the form of a complex with a gluten peptide - a multispecific antigen-binding molecule comprising a second antigen-binding portion having binding activity for DQ2.5, the antigen-binding molecule binds to two or more complexes of HLA-DQ2.5 and gluten peptide; at least one of the gluten peptides in the complex bound by the first antigen-binding portion is different from at least one of the gluten peptides in the complex bound by the second antigen-binding portion; - has substantially no binding activity to either or both DQ2.5-positive PBMC B cells and HLA-DQ2.5-expressing Ba/F3 cells,
- the antigen-binding molecule is humanized, and one or more in the heavy chain and/or light chain of the first antigen-binding portion and/or
- the multispecific antigen-binding molecule of [1-1] containing one amino acid substitution.
- the multispecific antigen-binding molecule according to any one of [1] to [1-2], wherein the gluten peptide is an immunodominant peptide associated with celiac disease.
- the gluten peptide is 33mer gliadin peptide, ⁇ 1 gliadin peptide, ⁇ 2 gliadin peptide, ⁇ 1 gliadin peptide, ⁇ 2 gliadin peptide, ⁇ 1 gliadin peptide, ⁇ 2 gliadin peptide, BC hordein peptide, ⁇ 3 gliadin peptide, ⁇ 1b gliadin peptide, ⁇ 4a gliadin peptide , ⁇ 4b gliadin peptide, avenin 1 peptide, avenin 2 peptide, avenin 3 peptide, hordein 1 peptide, hordein 2 peptide, secalin 1 peptide, secalin 2 peptide,
- the gluten peptide is 33mer gliadin peptide, ⁇ 1 gliadin peptide, ⁇ 2 gliadin peptide, ⁇ 1 gliadin peptide, ⁇ 2 gliadin peptide, ⁇ 1 gliadin peptide, ⁇ 2 gliadin peptide, BC hordein peptide, ⁇ 3 gliadin peptide, ⁇ 1b gliadin peptide, ⁇ 4a 1, 2, 3, 4 of gliadin peptides, ⁇ 4b gliadin peptides, avenin 1 peptides, avenin 2 peptides, avenin 3 peptides, hordein 1 peptides, hordein 2 peptides, secalin 1 peptides, secalin 2 peptides and 26mer gliadin peptides, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19 or all of any one of [1]
- the gluten peptide is 33mer gliadin peptide, ⁇ 1 gliadin peptide, ⁇ 2 gliadin peptide, ⁇ 1 gliadin peptide, ⁇ 1 gliadin peptide, ⁇ 2 gliadin peptide, BC hordein peptide, ⁇ 3 gliadin peptide, ⁇ 1b gliadin peptide, ⁇ 4a gliadin peptide, ⁇ 4b selected from the group consisting of gliadin peptides, avenin-1 peptides, avenin-2 peptides, avenin-3 peptides, hordein-1 peptides, hordein-2 peptides, secalin-1 peptides, secalin-2 peptides, and 26mer gliadin peptides [1]-[2] Any one multispecific antigen binding molecule of [3-3] The gluten peptide is 33mer gliadin peptide,
- the irrelevant peptide is CLIP peptide, hepatitis B virus 1 peptide, salmonella peptide; , Mycobacterium bovis peptide, and tyroperoxidase peptide, which is at least one peptide selected from the group consisting of any one of [1] to [3-3] multispecific antigen-binding molecule .
- [4-1] having substantially no binding activity to HLA-DQ2.5 in the form of a complex with an unrelated peptide, wherein the unrelated peptide is a CLIP peptide, a hepatitis B virus 1 peptide,
- [6] (i) interactions between HLA-DQ2.5/gluten peptide complexes and HLA-DQ2.5/gluten peptide-restricted CD4+ T cells and/or (ii) HLA-DQ2.2/ The multispecific antigen binding molecule of any one of [1]-[5] that blocks interaction between gluten peptide complexes and HLA-DQ2.2/gluten peptide-restricted CD4+ T cells.
- the gluten peptide is ⁇ 1 gliadin peptide, ⁇ 1b gliadin peptide, ⁇ 2 gliadin peptide, ⁇ 1 gliadin peptide, ⁇ 2 gliadin peptide, ⁇ 1 gliadin peptide, ⁇ 2 gliadin peptide, ⁇ 3 gliadin peptide, ⁇ 4a gliadin peptide, ⁇ 4d gliadin peptide, and
- the multispecific antigen-binding molecule of [6] which is selected from the group consisting of BC hordein peptides.
- the antigen-binding molecule has enhanced binding activity to a complex formed by HLA-DQ2.5 and a gluten peptide compared to before the humanization and modification, [1] The multispecific antigen-binding molecule of any one of ⁇ [6-2]. [8] The multispecificity of any one of [1] to [7], wherein the antigen-binding molecule has enhanced cross-reactivity to gluten peptides compared to before the humanization and modification. antigen binding molecule.
- [9] 1, 2, 3, or all amino acid residues selected from the group consisting of the amino acid residue sets shown in (a) to (d) below in the heavy and light chains of the antigen-binding molecule The multispecific antigen-binding molecule of any one of [1] to [8-1], wherein the base set is amino acid residues that electrostatically repel each other: (a) the amino acid residue in the heavy chain constant region (CH1), which is position 175 according to EU numbering, and the amino acid residue in the light chain constant region (CL), which is position 131 according to Kabat numbering; (b) the amino acid residue in CH1, which is position 175 according to EU numbering, and the amino acid residue in CL, which is position 160 according to Kabat numbering; (c) the amino acid residue in CH1, position 175 according to EU numbering, and the amino acid residue in CL, positions 131 and 160 according to Kabat numbering; (d) Amino acid residues in CH1 at positions 147 and 175 according to EU numbering and amino acid residues in CL at
- the polyspecificity of [9], wherein the two or more amino acid residues forming the interface between the heavy chain variable region and the light chain variable region are amino acid residues that electrostatically repel each other. sexual antigen-binding molecule.
- the amino acid residues that electrostatically repel each other are one or two amino acid residue sets selected from the group consisting of the following amino acid residue sets (a) and (b),
- the first and/or Fc region subunit comprises Leu at position 428, Ala at position 434, Arg at position 438, and Glu at position 440, with amino acid positions numbered according to EU numbering. , [16].
- a multispecific antigen-binding molecule according to any one of [1] to [8], comprising one or more of the following amino acid residues (i) to (xii): (i) glutamic acid or lysine at position 175 (EU numbering) in the heavy chain constant region; (ii) glutamic acid at position 147 (EU numbering) in the heavy chain constant region; (iii) a glutamic acid or lysine at position 131 (Kabat numbering) in the light chain constant region; (iv) glutamic acid or lysine at position 160 (Kabat numbering) in the light chain constant region; (v) an arginine at position 235 (EU numbering) in the heavy chain constant region; (vi) an arginine
- the first heavy chain further comprises glutamic acid at position 419 (EU numbering) and proline at position 445 (EU numbering), and amino acid deletions at positions 446 and 447 (EU numbering); and the second heavy chain further comprises a lysine at position 196 (EU numbering), a proline at position 445 (EU numbering), and amino acid deletions at positions 446 and 447 (EU numbering);
- the first heavy chain is glycine at position 16 (Kabat numbering), alanine at position 32 (Kabat numbering), lysine at position 61 (Kabat numbering), valine at position 35a (Kabat numbering), position 50 alanine at (Kabat numbering), glutamic acid at position 64 (Kabat numbering), threonine at position 73 (Kabat numbering), glutamic acid at position 95 (Kabat numbering), and valine at position 102 (Kabat numbering);
- the first light chain comprises glutamic acid at position 28 (Kabat numbering), tyrosine at position 55 (Kabat numbering), glutamic acid or tyrosine at position 56 (Kabat numbering), glutamic acid at position 92 (Kabat numbering), and position 94 (Kabat numbering).
- the second heavy chain contains glutamic acid at position 28 (Kabat numbering), alanine or glutamic acid at position 30 (Kabat numbering), glutamic acid at position 31 (Kabat numbering), tryptophan at position 32 (Kabat numbering), and position 34 (Kabat numbering).
- a multispecific antigen-binding molecule comprising a first antigen-binding portion and a second antigen-binding portion, wherein A multispecific antigen-binding molecule, wherein the first antigen-binding portion comprises any one of (a1) to (a3) below: (a1) a first antibody variable region comprising complementarity determining region (CDR) 1 of SEQ ID NO: 129, CDR 2 of SEQ ID NO: 130, CDR 3 of SEQ ID NO: 131, and CDR 1 of SEQ ID NO: 132, a second antibody variable region comprising CDR 2 of SEQ ID NO: 133, CDR 3 of SEQ ID NO: 134; (a2) a first antibody variable region comprising complementarity determining region (CDR) 1 of SEQ ID NO: 164, CDR 2 of SEQ ID NO: 165, CDR
- CDR complementarity determining region
- a multispecific antigen-binding molecule comprising a first antigen-binding portion and a second antigen-binding portion, A multispecific antigen-binding molecule, wherein the second antigen-binding portion comprises any one of (b1) to (b8) below: (b1) a first antibody variable region comprising complementarity determining region (CDR) 1 of SEQ ID NO: 135, CDR 2 of SEQ ID NO: 136, CDR 3 of SEQ ID NO: 137, and CDR 1 of SEQ ID NO: 138; a second antibody variable region comprising CDR 2 of SEQ ID NO: 139, CDR 3 of SEQ ID NO: 140; (b2) a first antibody variable region comprising complementarity determining region (CDR) 1 of SEQ ID NO: 135, CDR 2 of SEQ ID NO: 136, CDR 3 of SEQ ID NO: 137, and CDR 1 of SEQ ID NO: 141; a second antibody variable region comprising CDR 2 of SEQ ID NO: 142,
- a multispecific antigen-binding molecule comprising a first antigen-binding portion and a second antigen-binding portion, wherein The first antigen-binding portion comprises (c1)-(c3): (c1) a first antibody variable region comprising complementarity determining region (CDR) 1 of SEQ ID NO: 129, CDR 2 of SEQ ID NO: 130, CDR 3 of SEQ ID NO: 131, and CDR 1 of SEQ ID NO: 132, a second antibody variable region comprising CDR 2 of SEQ ID NO: 133, CDR 3 of SEQ ID NO: 134; (c2) a first antibody variable region comprising complementarity determining region (CDR) 1 of SEQ ID NO: 164, CDR 2 of SEQ ID NO: 165, CDR 3 of SEQ ID NO: 166, and CDR 1 of SEQ ID NO: 167, a second antibody variable region comprising CDR 2 of SEQ ID NO: 168, CDR 3 of SEQ ID NO: 169; and (c1)
- a multispecific antigen-binding molecule comprising a first antigen-binding portion comprising first and second antibody variable regions and a second antigen-binding portion comprising third and fourth antibody variable regions and a multispecific antigen-binding molecule comprising any one of the following (1) to (15): (1) a first antibody variable region comprising complementarity determining region (CDR) 1 of SEQ ID NO: 129, CDR 2 of SEQ ID NO: 130, CDR 3 of SEQ ID NO: 131; CDR 1 of SEQ ID NO: 132, sequence second antibody variable region comprising CDR 2 of SEQ ID NO: 133, CDR 3 of SEQ ID NO: 134; complementarity determining region (CDR) 1 of SEQ ID NO: 135, CDR 2 of SEQ ID NO: 136, a third antibody variable region comprising CDR 3; and a fourth antibody variable region comprising CDR 1 of SEQ ID NO: 138, CDR 2 of SEQ ID NO: 139, CDR 3 of SEQ ID NO:
- a multispecific antigen-binding molecule comprising a first antigen-binding portion and a second antigen-binding portion, wherein A multispecific antigen-binding molecule, wherein the first antigen-binding portion comprises any one of (e1) to (e3) below: (e1) a first antibody variable region comprising the amino acid sequence of SEQ ID NO:88 and a second antibody variable region comprising the amino acid sequence of SEQ ID NO:90; (e2) a first antibody variable region comprising the amino acid sequence of SEQ ID NO:89, and a second antibody variable region comprising the amino acid sequence of SEQ ID NO:91; a first amino acid sequence having at least 70%, 75%, 80%, 85%, 90%, or 95% sequence identity to the first antibody variable region that is (e1) or (e2) A second amino acid sequence having at least 70%, 75%, 80%, 85%, 90%, or 95% sequence identity to the described second antibody variable region.
- a multispecific antigen-binding molecule comprising a first antigen-binding portion and a second antigen-binding portion, wherein The first antigen-binding portion is (e1)-(e3) as follows: (e1) a first antibody variable region comprising the amino acid sequence of SEQ ID NO:88 and a second antibody variable region comprising the amino acid sequence of SEQ ID NO:90; (e2) a first antibody variable region comprising the amino acid sequence of SEQ ID NO:89, and a second antibody variable region comprising the amino acid sequence of SEQ ID NO:91; a first amino acid sequence having at least 70%, 75%, 80%, 85%, 90%, or 95% sequence identity to the first antibody variable region that is (e1) or (e2) A second amino acid sequence having at least 70%, 75%, 80%, 85%, 90%, or 95% sequence identity to the described second antibody variable region.
- the second antigen-binding portion comprises any one of the following (f1)-(f8): (f1) a third antibody variable region comprising the amino acid sequence of SEQ ID NO:92 and a fourth antibody variable region comprising the amino acid sequence of SEQ ID NO:98; (f2) a third antibody variable region comprising the amino acid sequence of SEQ ID NO:92 and a fourth antibody variable region comprising the amino acid sequence of SEQ ID NO:99; (f3) a third antibody variable region comprising the amino acid sequence of SEQ ID NO:93 and a fourth antibody variable region comprising the amino acid sequence of SEQ ID NO:99; (f4) a third antibody variable region comprising the amino acid sequence of SEQ ID NO:94 and a fourth antibody variable region comprising the amino acid sequence of SEQ ID NO:100; (f5) a third antibody variable region comprising the amino acid sequence of SEQ ID NO:95 and a fourth antibody variable region comprising the amino acid sequence of SEQ ID NO:100; (f6) a third antibody variable region comprising the amino acid sequence of S
- a multispecific antigen-binding molecule comprising a first antigen-binding portion comprising first and second antibody variable regions and a second antigen-binding portion comprising third and fourth antibody variable regions and a multispecific antigen-binding molecule comprising any one of the following (1) to (15): (1) a first antibody variable region comprising the amino acid sequence of SEQ ID NO:88; a second antibody variable region comprising the amino acid sequence of SEQ ID NO:90; a third antibody variable region comprising the amino acid sequence of SEQ ID NO:92 and a fourth antibody variable region comprising the amino acid sequence of SEQ ID NO:98; (2) a first antibody variable region comprising the amino acid sequence of SEQ ID NO:88; and a second antibody variable region comprising the amino acid sequence of SEQ ID NO:90; and a third antibody variable region comprising the amino acid sequence of SEQ ID NO:92.
- a multispecific antigen-binding molecule comprising a combination of two polypeptide chains selected from the group consisting of (A1) to (A3) below: (A1) a first heavy chain comprising the amino acid sequence of SEQ ID NO:42 and a first light chain comprising the amino acid sequence of SEQ ID NO:43; (A2) a first heavy chain comprising the amino acid sequence of SEQ ID NO:45, and a first light chain comprising the amino acid sequence of SEQ ID NO:46; a first amino acid sequence having at least 70%, 75%, 80%, 85%, 90%, or 95% sequence identity to the heavy chain sequence of 1 and described in (A1) or (A2); a second amino acid sequence having at least 70%, 75%, 80%, 85%, 90%, or 95% sequence identity to the first light chain sequence.
- a multispecific antigen-binding molecule comprising a combination of two polypeptide chains selected from the group consisting of the following (A1) to (A3): (A1) a first heavy chain comprising the amino acid sequence of SEQ ID NO:41 and a first light chain comprising the amino acid sequence of SEQ ID NO:43; (A2) a first heavy chain comprising the amino acid sequence of SEQ ID NO:44, and a first light chain comprising the amino acid sequence of SEQ ID NO:46; a first amino acid sequence having at least 70%, 75%, 80%, 85%, 90%, or 95% sequence identity to the heavy chain sequence of 1 and described in (A1) or (A2); a second amino acid sequence having at least 70%, 75%, 80%, 85%, 90%, or 95% sequence identity to the first light chain sequence.
- [28-2] The multispecific antigen-binding molecule of [27] or [27-2], further comprising a combination of two polypeptide chains selected from the group consisting of (B1) to (B8) below: (B1) a second heavy chain comprising the amino acid sequence of SEQ ID NO:53 and a second light chain comprising the amino acid sequence of SEQ ID NO:55; (B2) a second heavy chain comprising the amino acid sequence of SEQ ID NO:53 and a second light chain comprising the amino acid sequence of SEQ ID NO:56; (B3) a second heavy chain comprising the amino acid sequence of SEQ ID NO:57 and a second light chain comprising the amino acid sequence of SEQ ID NO:56; (B4) a second heavy chain comprising the amino acid sequence of SEQ ID NO:59 and a second light chain comprising the amino acid sequence of SEQ ID NO:61; (B5) a second heavy chain comprising the amino acid sequence of SEQ ID NO:62 and a second light chain comprising the amino acid sequence of SEQ ID NO:
- a multispecific antigen-binding molecule comprising a combination of four polypeptide chains selected from the group consisting of the following (1) to (15): (1) a first heavy chain comprising the amino acid sequence of SEQ ID NO:42 and a first light chain comprising the amino acid sequence of SEQ ID NO:43 and a second heavy chain comprising the amino acid sequence of SEQ ID NO:54 and sequences number: a second light chain comprising a sequence of 55 amino acids; (2) a first heavy chain comprising the amino acid sequence of SEQ ID NO:42 and a first light chain comprising the amino acid sequence of SEQ ID NO:43 and a second heavy chain comprising the amino acid sequence of SEQ ID NO:54 and sequences number: a second light chain comprising a sequence of 56 amino acids; (3) a first heavy chain comprising the amino acid sequence of SEQ ID NO:42 and a first light chain comprising the amino acid sequence of SEQ ID NO:43 and a second heavy chain comprising the amino acid sequence of SEQ ID NO:58 and sequences number:
- a multispecific antigen-binding molecule comprising a combination of four polypeptide chains selected from the group consisting of the following (1) to (15): (1) a first heavy chain comprising the amino acid sequence of SEQ ID NO:41 and a first light chain comprising the amino acid sequence of SEQ ID NO:43, and a second heavy chain comprising the amino acid sequence of SEQ ID NO:53 and sequences number: a second light chain comprising a sequence of 55 amino acids; (2) a first heavy chain comprising the amino acid sequence of SEQ ID NO:41 and a first light chain comprising the amino acid sequence of SEQ ID NO:43 and a second heavy chain comprising the amino acid sequence of SEQ ID NO:53 and sequences number: a second light chain comprising a sequence of 56 amino acids; (3) a first heavy chain comprising the amino acid sequence of SEQ ID NO:41 and a first light chain comprising the amino acid sequence of SEQ ID NO:43 and a second heavy chain comprising the amino acid sequence of SEQ ID NO:57 and sequences number
- [29a] A combination of any one of the following (i) to (iii): (i) a multispecific antigen-binding molecule comprising a sequence described in any one of (a1) to (a3) of [20], and any one of (b1) to (b8) of [21] a multispecific antigen binding molecule comprising a sequence described in; (ii) a multispecific antigen-binding molecule comprising a sequence described in any one of (e1) to (e3) of [24], and any one of (f1) to (f8) of [25] and (iii) a multispecific antigen-binding molecule comprising a sequence described in any one of (A1) to (A3) of [27] or [27-2].
- An antigen-binding molecule and a multispecific antigen-binding molecule comprising a sequence described in any one of (B1) to (B8) of [28] or [28-2].
- a vector comprising the nucleic acid of [30].
- a cell comprising the nucleic acid of [30] or the vector of [31].
- a method for producing a multispecific antigen-binding molecule comprising the step of culturing the cell of [32] so that the multispecific antigen-binding molecule is produced.
- a pharmaceutical composition comprising the multispecific antigen binding molecule of any one of [1]-[29] or the combination of [29a], and a pharmaceutically acceptable carrier.
- the composition of [35] which is a pharmaceutical composition for use in treating and/or preventing celiac disease.
- the use of [37], wherein the medicament is for the treatment and/or prevention of celiac disease.
- a method of treating an individual with celiac disease comprising administering to the individual an effective amount of the multispecific antigen-binding molecule of any one of [1] to [29] or the combination of [29a].
- a method, including [40] A kit for use in treating and/or preventing celiac disease, comprising at least any one multispecific antigen binding molecule of [1] to [29] or a combination of [29a], and instructions for use .
- an injectable preparation in which a container is filled with a solution containing an anti-HLA-DQ2.5 antibody as an active ingredient, A formulation for injection, wherein the antibody comprises any of the following (1) to (3): (1) a first antibody variable region comprising complementarity determining region (CDR) 1 of SEQ ID NO: 129, CDR 2 of SEQ ID NO: 130, CDR 3 of SEQ ID NO: 131; CDR 1 of SEQ ID NO: 132, sequence second antibody variable region comprising CDR 2 of SEQ ID NO: 133, CDR 3 of SEQ ID NO: 134; complementarity determining region (CDR) 1 of SEQ ID NO: 153, CDR 2 of SEQ ID NO: 154, a third antibody variable region comprising CDR 3; and a fourth antibody variable region comprising CDR 1 of SEQ ID NO: 150, CDR 2 of SEQ ID NO: 151, CDR 3 of SEQ ID NO: 152; (2) a first antibody variable region
- the solution contained within a 1 mL syringe ranges from 0.1 to 1.2 mL, or the solution contained within a 2.25 mL syringe ranges from 0.1 to 2.5 mL, [101]- The injectable formulation of any of [106a].
- the injectable preparation of any one of [101] to [107], wherein the injectable preparation in which the solution is filled in a container comprises a syringe or cartridge containing a pharmaceutical preparation therein and a stopper.
- [112] The injectable formulation of [111], wherein the surfactant is polysorbate, poloxamer 188, sodium lauryl sulfate, polyol, poly(ethylene glycol), glycerol, propylene glycol or poly(vinyl alcohol).
- Figure 1-1 shows the results of binding of anti-HLA-DQ antibodies (variants DQN0344H0976/L0591//DQN0385H1270/L0722-F6) to Ba/F3 cell lines expressing HLA class II (all antibodies were 0.05 micrograms ( ⁇ g)/mL, control DQN0139bb (DQN0139bb-SG181) (WO2018/155692) and IC17dK were tested at 1 ⁇ g/mL).
- a", “g” and “w” stand for " ⁇ ", " ⁇ ” and " ⁇ ” respectively.
- Figure 1-2 shows the results of binding of anti-HLA-DQ antibodies (variants DQN0344H0976/L0591//DQN0385H1270/L0681-F6) to Ba/F3 cell lines expressing HLA class II (all antibodies were 0.05 ⁇ g/ mL and controls DQN0139bb and IC17dK were tested at 1 ⁇ g/mL).
- Figure 1-3 shows the results of binding of anti-HLA-DQ antibodies (variants DQN0344H0976/L0591//DQN0385H1352/L0681-F6) to Ba/F3 cell lines expressing HLA class II (all antibodies were 0.05 ⁇ g/ mL and controls DQN0139bb and IC17dK were tested at 1 ⁇ g/mL).
- Figure 1-4 shows the results of binding of anti-HLA-DQ antibodies (variants DQN0344H0976/L0591//DQN0385H1527/L0605-F6) to Ba/F3 cell lines expressing HLA class II (all antibodies were 0.05 ⁇ g/ mL and controls DQN0139bb and IC17dK were tested at 1 ⁇ g/mL).
- Figure 1-5 shows the results of binding of anti-HLA-DQ antibodies (variants DQN0344H0976/L0591//DQN0385H1255/L0605-F6) to Ba/F3 cell lines expressing HLA class II (all antibodies were 0.05 ⁇ g/ mL and controls DQN0139bb and IC17dK were tested at 1 ⁇ g/mL).
- Figure 1-6 shows the results of binding of anti-HLA-DQ antibodies (variants DQN0344H1013/L0620//DQN0385H1270/L0722-F6) to Ba/F3 cell lines expressing HLA class II (all antibodies were 0.05 ⁇ g/ mL and controls DQN0139bb and IC17dK were tested at 1 ⁇ g/mL).
- Figure 1-7 shows the results of binding of anti-HLA-DQ antibodies (variants DQN0344H1013/L0620//DQN0385H1521/L0605-F6) to Ba/F3 cell lines expressing HLA class II (all antibodies were 0.05 ⁇ g/ mL and controls DQN0139bb and IC17dK were tested at 1 ⁇ g/mL).
- Figure 1-8 shows the results of binding of anti-HLA-DQ antibodies (variants DQN0344H1013/L0620//DQN0385H1270/L0681-F6) to Ba/F3 cell lines expressing HLA class II (all antibodies were 0.05 ⁇ g/ mL and controls DQN0139bb and IC17dK were tested at 1 ⁇ g/mL).
- Figure 1-9 shows the results of binding of anti-HLA-DQ antibodies (variants DQN0344H1013/L0620//DQN0385H1352/L0681-F6) to Ba/F3 cell lines expressing HLA class II (all antibodies were 0.05 ⁇ g/ mL and controls DQN0139bb and IC17dK were tested at 1 ⁇ g/mL).
- Figure 1-10 shows the results of binding of anti-HLA-DQ antibodies (variants DQN0344H1013/L0620//DQN0385H1353/L0681-F6) to Ba/F3 cell lines expressing HLA class II (all antibodies were 0.05 ⁇ g/ mL and controls DQN0139bb and IC17dK were tested at 1 ⁇ g/mL).
- Figure 1-11 shows the results of binding of anti-HLA-DQ antibody (variant DQN0344H0976/L0591//DQN0385H1251/L0605-F6) to Ba/F3 cell line expressing HLA class II (antibody is 0.05 ⁇ g/mL (#)
- anti-HLA-DQ2.5 and HLA-DQ2.5/hCLIP antibodies were tested at 0.313 ⁇ g/mL and control DQN0139bb and IC17dK were tested at 20 ⁇ g/mL).
- Figure 1-12 shows the results of binding of anti-HLA-DQ antibody (variant DQN0344H0976/L0591//DQN0385H1353/L0681-F6) to Ba/F3 cell line expressing HLA class II (antibody is 0.05 ⁇ g/mL (#)
- anti-HLA-DQ2.5 and HLA-DQ2.5/hCLIP antibodies were tested at 0.313 ⁇ g/mL and control DQN0139bb and IC17dK were tested at 20 ⁇ g/mL).
- Figure 1-13 shows the results of binding of anti-HLA-DQ antibody (variant DQN0344H1013/L0620//DQN0385H1255/L0605-F6) to Ba/F3 cell line expressing HLA class II (antibody is 0.05 ⁇ g/mL (#)
- anti-HLA-DQ2.5 and HLA-DQ2.5/hCLIP antibodies were tested at 0.313 ⁇ g/mL and control DQN0139bb and IC17dK were tested at 20 ⁇ g/mL).
- Figures 1-14 show the results of binding of anti-HLA-DQ antibodies (variants) to HLA-DP, DR, DQ5.1, and DQ6.3 (all antibodies tested at 0.05 ⁇ g/mL, control DQN0139bb and IC17dK were tested at 1 ⁇ g/mL).
- Figures 1-15 show the results of DQN0139bb binding to HLA class II-expressing Ba/F3 cell lines (control DQN0139bb was tested at 1 ⁇ g/mL).
- Figures 1-16 show IC17dK results against Ba/F3 cell lines expressing HLA class II (control IC17dK was tested at 1 ⁇ g/mL).
- FIG. 2 shows the results of antibody binding to PBMC-derived CD19+ B cells (antibodies tested at 0.05 ⁇ g/mL, control DQN0139bb and IC17dK tested at 1 ⁇ g/mL; (#) HLA-DQ2. 5 and HLA-DQ2.5-CLIP, antibodies were tested at 0.313 ⁇ g/mL; controls DQN0139bb and IC17dK were tested at 20 ug/mL).
- FIG. 3-1 shows the inhibitory effect of anti-HLA-DQ antibodies on HLA-DQ2.5/ ⁇ 1 gliadin-dependent Jurkat T cell activation.
- Figure 3-2 shows the inhibitory effect of anti-HLA-DQ antibodies on HLA-DQ2.5/ ⁇ 2 gliadin-dependent Jurkat T cell activation.
- Figure 3-3 shows the inhibitory effect of anti-HLA-DQ antibodies on HLA-DQ2.5/ ⁇ 1b gliadin-dependent Jurkat T cell activation.
- Figure 3-4 shows the inhibitory effect of anti-HLA-DQ antibodies on HLA-DQ2.5/ ⁇ 1 gliadin-dependent Jurkat T cell activation.
- Figures 3-5 show the inhibitory effect of anti-HLA-DQ antibodies on HLA-DQ2.5/ ⁇ 2 gliadin-dependent Jurkat T cell activation.
- Figures 3-6 show the inhibitory effect of anti-HLA-DQ antibodies on HLA-DQ2.5/BC hordein-dependent Jurkat T cell activation.
- Figure 3-7 shows the inhibitory effect of anti-HLA-DQ antibodies on HLA-DQ2.5/ ⁇ 1 gliadin-dependent Jurkat T cell activation.
- Figure 3-8 shows the inhibitory effect of anti-HLA-DQ antibodies on HLA-DQ2.5/ ⁇ 2 gliadin-dependent Jurkat T cell activation.
- Figure 3-9 shows the inhibitory effect of anti-HLA-DQ antibodies on HLA-DQ2.5/ ⁇ 3 gliadin-dependent Jurkat T cell activation.
- FIG. 4-1 shows the inhibitory effect of anti-HLA-DQ antibodies on HLA-DQ2.5/ ⁇ 1 gliadin-dependent Jurkat T cell activation.
- Figure 4-2 shows the inhibitory effect of anti-HLA-DQ antibodies on HLA-DQ2.5/ ⁇ 2 gliadin-dependent Jurkat T cell activation.
- Figure 4-3 shows the inhibitory effect of anti-HLA-DQ antibodies on HLA-DQ2.5/ ⁇ 1b gliadin-dependent Jurkat T cell activation.
- Figure 4-4 shows the inhibitory effect of anti-HLA-DQ antibodies on HLA-DQ2.5/ ⁇ 1 gliadin-dependent Jurkat T cell activation.
- Figure 4-5 shows the inhibitory effect of anti-HLA-DQ antibodies on HLA-DQ2.5/ ⁇ 2 gliadin-dependent Jurkat T cell activation.
- Figure 4-6 shows the inhibitory effect of anti-HLA-DQ antibodies on HLA-DQ2.5/BC hordein-dependent Jurkat T cell activation.
- Figure 4-7 shows the inhibitory effect of anti-HLA-DQ antibodies on HLA-DQ2.5/ ⁇ 1 gliadin-dependent Jurkat T cell activation.
- Figure 4-8 shows the inhibitory effect of anti-HLA-DQ antibodies on HLA-DQ2.5/ ⁇ 2 gliadin-dependent Jurkat T cell activation.
- Figure 4-9 shows the inhibitory effect of anti-HLA-DQ antibodies on HLA-DQ2.5/ ⁇ 3 gliadin-dependent Jurkat T cell activation.
- Figures 4-10 show the inhibitory effect of anti-HLA-DQ antibodies on HLA-DQ2.5/ ⁇ 4a gliadin-dependent Jurkat T cell activation.
- Figure 5-1 shows HLA-DQ2.2/ ⁇ 1a gliadin-dependent Jurkat T cell activation mediated by 33mer gliadin.
- FIG. 5-2 shows HLA-DQ2.2/ ⁇ 2 gliadin-dependent Jurkat T cell activation mediated by 33mer gliadin.
- Figure 5-3 shows the inhibitory effect of anti-HLA-DQ antibodies on HLA-DQ2.2/ ⁇ 1a gliadin-dependent Jurkat T cell activation.
- Figure 5-4 shows the inhibitory effect of anti-HLA-DQ antibodies on HLA-DQ2.2/ ⁇ 2 gliadin-dependent Jurkat T cell activation.
- FIG. 6 shows photographs when the amount of bubbles in the syringe is (a) 120 ⁇ L, (b) 40 ⁇ L, and (c) 10 ⁇ L.
- FIG. 7 is an example of a configuration diagram of a syringe.
- an "acceptor human framework” for the purposes of this specification is a light chain variable domain (VL) framework or heavy chain variable domain (VH ) a framework containing the amino acid sequence of the framework.
- Acceptor human frameworks "derived from” human immunoglobulin frameworks or human consensus frameworks may contain those same amino acid sequences or may contain alterations in the amino acid sequences. In some embodiments, the number of amino acid changes is 10 or less, 9 or less, 8 or less, 7 or less, 6 or less, 5 or less, 4 or less, 3 or less, or 2 or less.
- the VL acceptor human framework is identical in sequence to a VL human immunoglobulin framework sequence or a human consensus framework sequence.
- Bind refers to the total strength of non-covalent interactions between one binding site of a molecule (eg, antibody) and its binding partner (eg, antigen).
- binding affinity refers to the intrinsic binding affinity that reflects a 1:1 interaction between members of a binding pair (eg, antibody and antigen).
- the affinity of molecule X for its partner Y can generally be expressed by the dissociation constant (Kd). Affinity can be measured by routine methods known in the art, including those described herein. Specific illustrative and exemplary embodiments for measuring binding affinity are described below.
- An “affinity matured” antibody has one or more modifications in one or more hypervariable regions (HVRs) that confer improved affinity for the antibody's antigen as compared to a parent antibody that does not possess the modifications.
- HVRs hypervariable regions
- antigen-binding portion or “antigen-binding domain” refers to a portion of an antibody that contains a region that specifically binds to and is complementary to part or all of an antigen.
- Antigen-binding portions/domains can be provided, for example, by one or more antibody variable domains (also called antibody variable regions).
- the antigen-binding portion/domain contains both an antibody light chain variable region (VL) and an antibody heavy chain variable region (VH).
- anti-HLA-DQ2.5 antigen binding molecule binds with sufficient affinity to HLA-DQ2.5 or one or more complexes formed by HLA-DQ2.5 and gluten peptides antigen-binding molecules (antibodies) capable of binding to HLA-DQ2.5, such that the antibodies are useful as diagnostic and/or therapeutic agents when targeted to HLA-DQ2.5.
- the extent of binding of an anti-HLA-DQ2.5 antigen-binding molecule (antibody) to an irrelevant antigen is determined, e.g. or less than about 10% binding to HLA-DQ2.5/gluten peptide complexes.
- antibodies having "binding activity" for HLA-DQ2.5 or HLA-DQ2.5/gluten peptide complexes are ⁇ 1 micromolar ( ⁇ M), ⁇ 100 nM, ⁇ 10 nM, ⁇ 1 nM, have a dissociation constant (Kd) of ⁇ 0.1 nM, ⁇ 0.01 nM, or ⁇ 0.001 nM (eg, 10 ⁇ 8 M or less, such as 10 ⁇ 8 M to 10 ⁇ 13 M, such as 10 ⁇ 9 M to 10 ⁇ 13 M) .
- Kd dissociation constant
- the term "antigen-binding molecule” refers to any molecule containing an antigen-binding site or any molecule having antigen-binding activity, and furthermore, a peptide having a length of about 5 amino acids or more. Or it may refer to molecules such as proteins. Peptides and proteins are not limited to those of biological origin, for example, they can be polypeptides produced from artificially designed sequences. They may be naturally occurring polypeptides, synthetic polypeptides, recombinant polypeptides, and the like.
- a scaffold molecule containing a known stable conformation such as an ⁇ / ⁇ barrel as a scaffold is also an aspect of the antigen-binding molecule described herein.
- the "antigen-binding molecule” is an antibody.
- the terms "antigen-binding molecule” and “antibody” are used in the broadest sense herein and include monoclonal antibodies, polyclonal antibodies, multispecific antibodies (e.g., bispecific antibodies), and antibodies that exhibit the desired antigen-binding activity. It encompasses a variety of antibody structures, including but not limited to antibody fragments where indicated.
- the antibody is a multispecific antibody.
- a multispecific antibody is a bispecific antibody.
- antibody fragment refers to a molecule other than an intact antibody that contains a portion of the intact antibody that binds to the antigen to which the intact antibody binds.
- antibody fragments include, but are not limited to, Fv, Fab, Fab', Fab'-SH, F(ab') 2 ; diabodies; linear antibodies; single chain antibody molecules (e.g., scFv ); and multispecific antibodies formed from antibody fragments.
- an "antibody that binds to the same epitope” as a reference antibody refers to an antibody that blocks the binding of the reference antibody to its own antigen by 50% or more in a competition assay, and conversely, the reference antibody block the binding of the aforementioned antibody to its own antigen by more than 50%.
- An exemplary competition assay is provided herein.
- autoimmune disease refers to a non-malignant disease or disorder arising from and directed against the individual's own tissues.
- autoimmune disease specifically excludes malignant or cancerous diseases or conditions, in particular B-cell lymphoma, acute lymphoblastic leukemia (ALL), chronic lymphocytic Exclude chronic lymphocytic leukemia (CLL), hairy cell leukemia, and chronic myeloblastic leukemia.
- ALL acute lymphoblastic leukemia
- CLL chronic lymphocytic leukemia
- hairy cell leukemia and chronic myeloblastic leukemia.
- autoimmune diseases or disorders include, but are not limited to: inflammatory skin diseases such as celiac disease, psoriasis and inflammatory skin diseases including dermatitis (e.g., atopic dermatitis); systemic sclerosis and sclerosis; inflammatory bowel disease-related reactions (e.g., Crohn's disease and ulcerative colitis); respiratory distress syndrome (including adult respiratory distress syndrome: ARDS); dermatitis; meningitis; encephalitis; uveitis; colitis; rheumatoid arthritis; systemic lupus erythematosus (SLE) (including but not limited to lupus nephritis, cutaneous lupus); diabetes (e.g., type I diabetes or insulin-dependent diabetes); multiple sclerosis; Raynaud's allergic encephalomyelitis; Sjögren's syndrome; juvenile-onset diabetes; and cytokines and T typically seen in tuberculosis, sarcoidosis
- IgA nephropathy IgM polyneuropathy
- ITP immune thrombocytopenic purpura
- celiac disease refers to an inherited autoimmune disease caused by damage to the small intestine when gluten contained in food is ingested.
- Symptoms of celiac disease include gastrointestinal disorders such as abdominal pain, diarrhea, gastroesophageal reflux, central nervous system (CNS) symptoms such as vitamin and mineral deficiencies, fatigue and anxiety depression, osteomalacia and osteoporosis.
- CNS central nervous system
- skin manifestations such as dermatitis, blood manifestations such as anemia and lymphopenia, and other conditions such as infertility, hypogonadism, and failure to thrive and short stature in children.
- CNS central nervous system
- chimeric antibody means that a portion of the heavy and/or light chains are derived from a particular source or species, while the remainder of the heavy and/or light chains are derived from a different source or species. Refers to antibodies.
- the "class" of an antibody refers to the type of constant domain or constant region provided by the heavy chains of the antibody.
- the heavy-chain constant domains that correspond to the different classes of immunoglobulins are called ⁇ , ⁇ , ⁇ , ⁇ , and ⁇ , respectively.
- an “effective amount” of an agent refers to an amount, at the necessary dose and over the necessary period of time, effective to achieve the desired therapeutic or prophylactic result.
- Fc region is used herein to define the C-terminal region of an immunoglobulin heavy chain that includes at least a portion of the constant region.
- the term includes native sequence Fc regions and variant Fc regions.
- the human IgG heavy chain Fc region extends from Cys226 or from Pro230 to the carboxyl terminus of the heavy chain.
- the C-terminal lysine (Lys447) or glycine-lysine (residues Gly446-Lys447) of the Fc region may or may not be present.
- the numbering of amino acid residues in the Fc region or constant region is according to Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, According to the EU numbering system (also known as the EU index), as described in MD 1991.
- FR Framework or "FR” refers to variable domain residues other than hypervariable region (HVR) residues.
- the FRs of variable domains usually consist of four FR domains: FR1, FR2, FR3 and FR4. Accordingly, HVR and FR sequences usually appear in VH (or VL) in the following order: FR1-H1(L1)-FR2-H2(L2)-FR3-H3(L3)-FR4.
- full length antibody “whole antibody” and “whole antibody” are used interchangeably herein and have a structure substantially similar to that of a naturally occurring antibody or as defined herein. It refers to an antibody having a heavy chain containing an Fc region that
- gluten refers collectively to a complex of storage proteins called prolamins found in wheat and other related grains. In the intestinal lumen, gluten is broken down into so-called gluten peptides. Gluten peptides include, but are not limited to, gliadin from wheat, hordeins from barley, and secalins from rye, and avenins from oats.
- gluten peptides are antigenic peptides recognized by T cells and cause the disease.
- immune dominance is a phenomenon in which the immune response is primarily caused by a relatively small number of antigenic peptides.
- antigenic peptides are called "immunodominant peptides.”
- immunodominant peptides include, for example, ⁇ 1 gliadin (which may also be referred to as “ ⁇ 1a gliadin”) and ⁇ 2 gliadin (both included in the 33mer gliadin sequence), and ⁇ 1 gliadin, ⁇ 2 gliadin, and BC hordeins (5 peptides in total) (Science Translational Medicine 21 Jul 2010: Vol.
- immunodominant peptides include, but are not limited to, ⁇ 1 gliadin, ⁇ 2 gliadin, ⁇ 1 gliadin, ⁇ 2 gliadin, BC hordeins, ⁇ 1 gliadin, and ⁇ 2 gliadin (7 peptides total).
- immunodominant peptides are sometimes referred to herein as "immunodominant peptides associated with celiac disease.”
- the type and total number of the peptides are not particularly limited as long as they are dominantly associated with celiac disease.
- the phrase "substantially no binding activity” refers to the ability of an antibody to bind an antigen of interest at a level of binding that includes nonspecific or background binding, but not specific binding. Say. In other words, such an antibody "has no specific/significant binding activity" to an unintended antigen. Specificity can be measured by any method described herein or known in the art. The level of non-specific or background binding described above can be zero, non-zero but close to zero, or so low that it can be technically ignored by one skilled in the art. .
- HLA-DR/DP means "HLA-DR and HLA-DP” or "HLA-DR or HLA-DP”. These HLA's are MHC class II molecules encoded by corresponding haplotype alleles on the MHC class II locus in humans.
- HLA-DQ refers to HLA-DQ isoforms, including HLA-DQ2.5, HLA-DQ7.5, HLA-DQ5.1, HLA-DQ6.3, HLA-DQ7.3, and HLA-DQ8 collectively refers to
- HLA-DQ molecules include, but are not limited to HLA-DQ2.2, HLA-DQ2.3, HLA-DQ4.3, HLA-DQ4 .4, HLA-DQ5.1, HLA-DQ5.2, HLA-DQ5.3, HLA-DQ5.4, HLA-DQ6.1, HLA-DQ6.2, HLA-DQ6.3, HLA-DQ6.4 , HLA-DQ6.9, HLA-DQ7.2, HLA-DQ7.3, HLA-DQ7.4, HLA-DQ7.5, HLA-DQ7.6, HLA-DQ8, HLA-DQ9.2, and HLA- Including known subtypes (iso
- host cell refers to a "cell” into which exogenous nucleic acid has been introduced (including progeny of such cells).
- a host cell includes “transformants” and “transformed cells,” including the primary transformed cell and progeny derived therefrom at any passage number. Progeny may not be completely identical in nucleic acid content to the parent cell, but may contain mutations. Mutant progeny that have the same function or biological activity as with which the originally transformed cell was screened or selected are also included herein.
- human antibody is an antibody with an amino acid sequence that corresponds to that of an antibody produced by a human or human cells or derived from a human antibody repertoire or other non-human source using human antibody coding sequences. This definition of human antibody specifically excludes humanized antibodies that contain non-human antigen-binding residues.
- a "human consensus framework” is a framework that represents the most commonly occurring amino acid residues in a selected group of human immunoglobulin VL or VH framework sequences.
- the term "human antibody framework” may be used to refer to such frameworks.
- the selection of human immunoglobulin VL or VH sequences is from a subgroup of variable domain sequences.
- the subgroup of sequences is the subgroup in Kabat et al., Sequences of Proteins of Immunological Interest, Fifth Edition, NIH Publication 91-3242, Bethesda MD (1991), vols. 1-3.
- the subgroup is subgroup ⁇ I according to Kabat et al., supra.
- the subgroup III according to Kabat et al., supra.
- a “humanized” antibody refers to a chimeric antibody that contains amino acid residues from non-human HVRs and amino acid residues from human FRs.
- a humanized antibody comprises substantially all of at least one, typically two, variable domains in which all or substantially all HVRs (e.g., CDRs) are non- Corresponds to that of a human antibody, and all or substantially all FRs correspond to those of a human antibody.
- a humanized antibody optionally may comprise at least a portion of an antibody constant region derived from a human antibody.
- a "humanized form" of an antibody (eg, a non-human antibody) refers to an antibody that has undergone humanization.
- hypervariable region is hypervariable in sequence (“complementarity determining region” or “CDR”) and/or is structurally defined. Refers to the regions of the variable domain of an antibody that form loops (“hypervariable loops”) and/or contain antigen-contacting residues (“antigen-contacting”). Antibodies typically contain six HVRs: three in VH (H1, H2, H3) and three in VL (L1, L2, L3).
- Exemplary HVRs herein include: (a) at amino acid residues 26-32 (L1), 50-52 (L2), 91-96 (L3), 26-32 (H1), 53-55 (H2), and 96-101 (H3); resulting hypervariable loops (Chothia and Lesk, J. Mol. Biol. 196:901-917 (1987)); (b) at amino acid residues 24-34 (L1), 50-56 (L2), 89-97 (L3), 31-35b (H1), 50-65 (H2), and 95-102 (H3); the resulting CDRs (Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed.
- HVR residues include those set forth herein. Unless otherwise indicated, HVR residues and other residues in the variable domain (eg, FR residues) are numbered herein according to Kabat et al., supra.
- an “immunoconjugate” is an antibody conjugated to one or more heterologous molecules.
- “Individual” or “subject” is a mammal. Mammals include, but are not limited to, domestic animals (eg, cows, sheep, cats, dogs, horses), primates (eg, humans and non-human primates such as monkeys), rabbits, and , including rodents (eg, mice and rats). In certain embodiments, the individual or subject is human.
- suitable CLIP peptides may be used together with other HLA-DQ molecules.
- an “isolated” antibody is one that has been separated from a component of its original environment.
- antibodies are analyzed electrophoretically (e.g., SDS-PAGE, isoelectric focusing (IEF), capillary electrophoresis) or chromatographically (e.g., ion-exchange or reverse-phase HPLC). Purified to greater than 95% or 99% purity as measured.
- electrophoretically e.g., SDS-PAGE, isoelectric focusing (IEF), capillary electrophoresis
- chromatographically e.g., ion-exchange or reverse-phase HPLC.
- isolated nucleic acid refers to a nucleic acid molecule that has been separated from components of its original environment.
- An isolated nucleic acid includes a nucleic acid molecule contained within cells that normally contain the nucleic acid molecule, but the nucleic acid molecule is present extrachromosomally or on a chromosome other than its native chromosomal location. exists in position.
- an “isolated nucleic acid encoding an anti-HLA-DQ2.5 antigen-binding molecule (antibody)" is an antibody one or more nucleic acid molecules encoding the heavy and light chains (or fragments thereof) of the It includes nucleic acid molecules that are present at the position of
- the term "monoclonal antibody” as used herein refers to an antibody obtained from a substantially homogeneous population of antibodies. That is, the individual antibodies that make up the population are mutated antibodies that may arise (e.g., mutated antibodies containing naturally occurring mutations, or mutated antibodies that arise during the manufacture of monoclonal antibody preparations. are identical and/or bind to the same epitope, except that they are present in the same amount. In contrast to polyclonal antibody preparations which typically include different antibodies directed against different determinants (epitopes), each monoclonal antibody of a monoclonal antibody preparation is directed against a single determinant on the antigen.
- monoclonal indicates the character of the antibody as being obtained from a population of substantially homogeneous antibodies and should not be construed as requiring production of the antibody by any particular method.
- monoclonal antibodies used in accordance with the present invention include, but are not limited to, hybridoma technology, recombinant DNA technology, phage display technology, transgenic animals containing all or part of the human immunoglobulin locus. Such and other exemplary methods for making monoclonal antibodies are described herein.
- naked antibody refers to an antibody that is not conjugated to a heterologous moiety or radiolabel.
- a naked antibody may be present in a pharmaceutical formulation.
- Native antibodies refer to immunoglobulin molecules with various structures occurring in nature.
- native IgG antibodies are heterotetrameric glycoproteins of approximately 150,000 daltons composed of two identical light chains and two identical heavy chains that are disulfide-bonded. From N-terminus to C-terminus, each heavy chain has a variable region (VH), also called a variable heavy domain or heavy chain variable domain, followed by three constant domains (CH1, CH2 and CH3). Similarly, from N-terminus to C-terminus, each light chain has a variable region (VL), also called a variable light domain or light chain variable domain, followed by a constant light (CL) domain.
- VH variable region
- VL variable region
- CL constant light
- nucleic acid molecule or “polynucleotide” includes any compound and/or substance comprising a polymer of nucleotides.
- Each nucleotide consists of a base, specifically a purine or pyrimidine base (i.e. cytosine (C), guanine (G), adenine (A), thymine (T) or uracil (U)), a sugar (i.e. deoxyribose or ribose), and a phosphate group.
- Nucleic acid molecules are often described by a sequence of bases, where these bases represent the primary structure (linear structure) of the nucleic acid molecule. Sequences of bases are usually written 5' to 3'.
- nucleic acid molecule includes, for example, deoxyribonucleic acid (DNA) including complementary DNA (cDNA) and genomic DNA, ribonucleic acid (RNA), especially messenger RNA (mRNA), synthetic forms of DNA or RNA, and Mixed polymers containing two or more of these molecules are included.
- Nucleic acid molecules can be linear or circular.
- nucleic acid molecule includes both sense and antisense strands, as well as single- and double-stranded forms.
- nucleic acid molecules described herein can contain naturally occurring or non-naturally occurring nucleotides.
- Nucleic acid molecules also include DNA and RNA molecules suitable as vectors for direct expression of an antibody of the invention in vitro and/or in vivo, eg, in a host or patient.
- DNA eg, cDNA
- RNA eg, mRNA
- Such DNA (eg, cDNA) or RNA (eg, mRNA) vectors may be unmodified or modified.
- the mRNA can be chemically modified to enhance the stability of the RNA vector and/or the expression of the encoded molecule, such that the mRNA can be injected into a subject to produce antibodies in vivo. (See, for example, Stadler et al, Nature Medicine 2017, published online 12 June 2017, doi:10.1038/nm.4356 or EP 2 101 823 B1).
- a "percent (%) amino acid sequence identity" to a reference polypeptide sequence is obtained after aligning the sequences to obtain the maximum percent sequence identity and introducing gaps if necessary, and without any conservative substitutions. Defined as the percentage of amino acid residues in a candidate sequence that are identical to amino acid residues in the reference polypeptide sequence, not considered part of the identity. Alignments for purposes of determining percent amino acid sequence identity may be performed by a variety of methods within the skill in the art, such as BLAST, BLAST-2, ALIGN, Megalign (DNASTAR) software, or GENETYX® (stock This can be accomplished by using publicly available computer software, such as the company Genetics. Those skilled in the art can determine appropriate parameters for aligning sequences, including any algorithms needed to achieve maximal alignment over the entire length of the sequences being compared.
- the ALIGN-2 sequence comparison computer program is the work of Genentech, Inc. and its source code has been filed with the US Copyright Office, Washington DC, 20559 with user documentation, under US Copyright Registration No. TXU510087. Registered.
- the ALIGN-2 program is publicly available from Genentech, Inc., South San Francisco, Calif., or may be compiled from source code.
- ALIGN-2 programs are compiled for use on UNIX operating systems, including Digital UNIX V4.0D. All sequence comparison parameters were set by the ALIGN-2 program and do not vary.
- the % amino acid sequence identity of a given amino acid sequence A to, with, or to a given amino acid sequence B is calculated as follows: 100 times the fraction X/Y. where X is the number of amino acid residues scored as identical matches in the alignment of A and B by the sequence alignment program ALIGN-2, and Y is the total number of amino acid residues in B. . It is understood that the % amino acid sequence identity of A to B does not equal the % amino acid sequence identity of B to A if the length of amino acid sequence A does not equal the length of amino acid sequence B. deaf. Unless otherwise specified, all % amino acid sequence identity values used herein are obtained using the ALIGN-2 computer program as described in the immediately preceding paragraph.
- pharmaceutical formulation or “pharmaceutical composition” means a preparation in a form such that the biological activity of the active ingredients contained therein can be effected, and the formulation/composition A preparation that does not contain additional elements that are unacceptably toxic to the subject to whom it is administered.
- “Pharmaceutically acceptable carrier” refers to an ingredient other than the active ingredient in a pharmaceutical formulation/composition that is non-toxic to a subject.
- Pharmaceutically acceptable carriers include, but are not limited to, buffers, excipients, stabilizers, or preservatives.
- HLA-DQ2.5 refers to any vertebrate source, including mammals such as primates (e.g., humans) and rodents (e.g., mice and rats). Refers to any native HLA-DQ2.5 from a source.
- the term encompasses "full length" unprocessed HLA-DQ2.5 as well as any form of HLA-DQ2.5 that results from processing in the cell.
- the term also includes naturally occurring variants of HLA-DQ2.5, such as splice variants and allelic variants.
- An exemplary HLA-DQ2.5 amino acid sequence is publicly available at the Research Collaborative for Structural Bioinformatics (RCSB) Protein Data Bank (PDB) accession code 4OZG and the IPD-IMGT/database
- TCR means "T cell receptor", which is a membrane protein located on the surface of T cells (e.g., HLA-DQ2.5-restricted CD4+ T cells) and - Recognizing antigenic fragments (eg gluten peptides) presented on MHC molecules containing DQ2.5.
- treatment refers to clinical treatments intended to alter the natural course of the individual being treated.
- intervention which can be performed both for prophylaxis and during the course of a clinical condition.
- Desirable effects of treatment include, but are not limited to, prevention of disease onset or recurrence, relief of symptoms, attenuation of any direct or indirect pathological effects of disease, prevention of metastasis, prevention of disease Includes reduced rate of progression, amelioration or amelioration of disease state, and remission or improved prognosis.
- the antibodies of the invention are used to delay the onset of disease or slow the progression of disease.
- variable region refers to the domains of the heavy or light chains of an antibody that are involved in binding the antibody to the antigen.
- the heavy and light chain variable domains (VH and VL, respectively) of native antibodies are usually similar, with each domain containing four conserved framework regions (FR) and three hypervariable regions (HVR). have a structure. (See, eg, Kindt et al. Kuby Immunology, 6th ed., W.H. Freeman and Co., page 91 (2007).) A single VH or VL domain may be sufficient to confer antigen-binding specificity.
- antibodies that bind a particular antigen may be isolated using the VH or VL domains from the antibody that binds the antigen to screen a complementary library of VL or VH domains, respectively. See, e.g., Portolano et al., J. Immunol. 150:880-887 (1993); Clarkson et al., Nature 352:624-628 (1991).
- vector refers to a nucleic acid molecule capable of propagating another nucleic acid to which it has been linked.
- the term includes vectors as self-replicating nucleic acid structures and vectors that integrate into the genome of a host cell into which they are introduced. Certain vectors are capable of directing the expression of nucleic acids to which they are operably linked. Such vectors are also referred to herein as "expression vectors”.
- Antigen-binding molecules (or antibodies) of the present invention may contain one or more modifications. Such alterations include, for example, deletions from and/or insertions into and/or substitutions of residues within the amino acid sequence of the antibody. Any combination of deletion, insertion, and substitution may be made to arrive at the final construct, provided that the final construct possesses the desired characteristics, eg, antigen binding.
- the antigen-binding molecules (or antibodies) of the present invention may contain amino acid substitutions. Conservative substitutions are shown under the heading "preferred substitutions" in Table 1-1. More substantial changes are provided in Table 1-1 under the heading "Exemplary Substitutions” and as further described below with respect to amino acid side chain classes. Amino acid substitutions may be introduced into the antibody of interest and the products screened for the desired activity, eg, antigen binding.
- amino acid modification is appropriately used with the one-letter code or three-letter code of the amino acid before and after modification before and after the number indicating a specific position, respectively. good too.
- the modification N100bL or Asn100bLeu used when substituting amino acids contained in an antibody variable region, indicates substitution of Asn at position 100b with Leu (according to Kabat numbering). That is, the number indicates the amino acid position according to Kabat numbering, the one-letter or three-letter amino acid code written before the number indicates the amino acid before substitution, and the one-letter or three-letter amino acid code written after the number. Codes indicate amino acids after substitution.
- modified P238D or Pro238Asp used when replacing an amino acid in the Fc region contained in an antibody constant region, denotes substitution of Pro at position 238 (according to EU numbering) with Asp. That is, the number indicates the amino acid position according to EU numbering, the one-letter or three-letter amino acid code written before the number indicates the amino acid before substitution, and the one-letter or three-letter amino acid code written after the number. Codes indicate amino acids after substitution.
- multispecific antigen binding molecules refers to antigen binding molecules (antibodies) that specifically bind to more than one antigen (e.g., peptide) or epitope. say.
- an antigen-binding molecule comprises at least a first antigen-binding portion/domain capable of binding to one or more antigens (e.g., a peptide), and one or more antigens ( It has a second antigen-binding portion/domain capable of binding, eg, a peptide).
- Some or all of the antigen bound by the first antigen binding portion/domain may be different than some or all of the antigen bound by the second antigen binding portion/domain.
- some of the antigens bound by the first antigen binding portion/domain may be identical to some of the antigens bound by the second antigen binding portion/domain.
- multispecific antigen-binding molecules can specifically bind to different types of antigens or epitopes. More specifically, multispecific antigen-binding molecules (antibodies) are those that have specificity for at least two different types of antigens or epitopes, and in addition to molecules/antibodies that recognize different antigens, the same Also included are molecules/antibodies that recognize different epitopes on the antigen. For example, typically such a molecule binds two antigens or epitopes (“bispecific antigen binding molecule (antibody)”; synonymous with “dualspecific antigen binding molecule (antibody)”). used in this description) may also have specificity for even more antigens or epitopes (eg, three or more types of antigens).
- multispecificity and bispecificity mean that the specificity of one antigen-binding domain/region is different from that of another antigen-binding domain/region. That is, these terms mean that one antigen-binding molecule has two or more specificities.
- a "bispecific" antigen binding molecule antibody
- the first antigen binding portion/domain may bind to the first group of complexes formed by HLA-DQ2.5 and the gluten peptide.
- a second antigen binding portion/domain may bind to a second group of complexes formed by HLA-DQ2.5 and gluten peptides.
- Members of two groups ie, conjugates
- Terms such as “multispecific” and "bispecific” can encompass this situation. The same applies to the first and second groups of complexes to which the first/second antigen binding portion/domain does not bind.
- bispecific means that an antigen-binding molecule can specifically bind to at least two distinct antigenic determinants.
- Preferred embodiments of the "multispecific antigen-binding molecules" of the present invention include multispecific antibodies.
- an Fc region with reduced Fc ⁇ receptor binding activity is used as a multispecific antibody Fc region, an Fc region derived from a multispecific antibody may be used appropriately.
- Bispecific antibodies are particularly preferred as multispecific antibodies of the invention. In this case, bispecific antibodies are antibodies with two different specificities. IgG-type bispecific antibodies can be secreted from hybrid hybridomas (quadroma) produced by fusing two types of hybridomas producing IgG antibodies (Milstein et al., Nature (1983) 305, 537-540).
- Multispecific antigen binding molecules may comprise at least two antigen binding portions/domains.
- a bispecific antigen binding molecule can comprise a first antigen binding portion/domain and a second antigen binding portion/domain.
- a bispecific antigen binding molecule (or bispecific antibody) can comprise a first antigen binding portion/domain and a second antigen binding portion/domain.
- the first antigen-binding portion/domain can comprise a first antibody variable region and a second antibody variable region.
- a first antibody variable region is associated with a second antibody variable region. The association between the first antibody variable region and the second antibody variable region allows binding of the first antigen binding portion/domain to the first antigen/epitope.
- the second antigen binding portion/domain may comprise a third antibody variable region and a fourth antibody variable region.
- a third antibody variable region is associated with a fourth antibody variable region. The association between the third antibody variable region and the fourth antibody variable region allows binding of the second antigen binding portion/domain to the second antigen/epitope.
- the first antibody variable region is a heavy chain (H chain) variable region (VH) (may be referred to as a "first heavy (H chain) variable region (VH)"
- the second antibody variable region is a light chain (L chain) variable region (VL) (which may be referred to as a "first light chain (L chain) variable region (VL)").
- the third antibody variable region is a heavy chain (H chain) variable region (VH) (which may be referred to as a "second heavy (H chain) variable region (VH)")
- the fourth antibody variable region is a light chain (L chain) variable region (VL) (which may be referred to as a "second light chain (L chain) variable region (VL)").
- a first heavy (H) chain variable region (VH) associates with a first light (L) chain variable region (VL) for binding to a first antigen/epitope.
- a second heavy (H) chain variable region (VH) associates with a second light (L) chain variable region (VL) for binding to a second antigen/epitope.
- variable regions i.e., between VH and VL
- association is, as is known in the art, a structure on the VH/VL interface (e.g., amino acid residues).
- bispecific antigen-binding molecules are preferably capable of binding to two or more gluten peptides (or complexes formed by HLA-DQ2.5 and gluten peptides).
- the bispecific antigen binding molecule comprises a first antigen binding portion/domain that binds one or more complexes formed by HLA-DQ2.5 and a gluten peptide ( comprising a first antibody variable region and a second antibody variable region (described above), and a second antigen-binding portion that binds one or more complexes formed by HLA-DQ2.5 and a gluten peptide /domain (comprising a third antibody variable region and a fourth antibody variable region (above)).
- the at least one gluten peptide in the complex bound by the first antigen-binding portion/domain is combined with the at least one gluten peptide in the complex bound by the second antigen-binding portion/domain.
- the member of the gluten peptide in the complex bound by the first antigen-binding portion/domain and the member of the gluten peptide in the complex bound by the second antigen-binding portion/domain may overlap. Good, but they don't have to be exactly the same.
- the gluten peptide in the complex bound by the first/second antigen binding portion/domain may be selected from any gluten peptide described herein.
- the first/second antigen binding portion/domain is capable of binding one type of gluten peptide, or more than one type of gluten peptide.
- antibody may be used rather than “antigen-binding molecule” for simplicity. However, those skilled in the art will appreciate that the term “antibody” can be replaced with “antigen-binding molecule” where applicable.
- the present invention is based in part on the binding of anti-HLA-DQ2.5 antigen-binding molecules (antibodies) to HLA-DQ2.5 presenting gluten peptides to T cells.
- antibodies are provided that bind to HLA-DQ2.5.
- the present invention provides antigen-binding molecules or antibodies that have binding activity to HLA-DQ2.5, or one or more complexes formed by HLA-DQ2.5 and gluten peptides. do.
- the anti-HLA-DQ2.5 antigen binding molecule has the functions/characteristics described below.
- the anti-HLA-DQ2.5 antigen-binding molecule has binding activity to HLA-DQ2.5 in the form of a complex with gluten peptide (i.e., HLA-DQ2.5/gluten peptide complex) . More preferably, the anti-HLA-DQ2.5 antigen-binding molecule (antibody) is directed against HLA-DQ2.5 in the form of a complex with gluten peptide (i.e., HLA-DQ2.5/gluten peptide complex). It has specific binding activity.
- Anti-HLA-DQ2.5 antigen-binding molecules have substantial binding activity against non-target antigens such as HLA-DQ5.1/DQ6.3/DQ7.3/DQ7.5/DQ8/DR/DP.
- non-targeted ie, the anti-HLA-DQ2.5 antigen-binding molecule (antibody) does not substantially bind to non-target antigens.
- an anti-HLA-DQ2.5 antigen-binding molecule (antibody) does not have specific binding activity to HLA-DR/DP or does not have significant binding activity to HLA-DR/DP . That is, the antibody does not specifically bind to HLA-DR/DP or does not significantly bind to HLA-DR/DP.
- anti-HLA-DQ2.5 antigen binding molecules are HLA-DQ, such as HLA-DQ7.5, HLA-DQ8, HLA-DQ5.1, HLA-DQ6.3, and HLA-DQ7.3.
- the anti-HLA-DQ2.5 antigen-binding molecule has substantially no binding activity to the molecule, namely, HLA-DQ7.5, HLA-DQ8, HLA-DQ5.1, HLA-DQ6. 3, and does not substantially bind to HLA-DQ molecules such as HLA-DQ7.3.
- anti-HLA-DQ2.5 antigen binding molecules are HLA-DQ such as HLA-DQ7.5, HLA-DQ8, HLA-DQ5.1, HLA-DQ6.3, and HLA-DQ7.3 Does not have specific/significant binding activity for the molecule.
- anti-HLA-DQ2.5 antigen-binding molecules are HLA-DQ molecules such as HLA-DQ7.5, HLA-DQ8, HLA-DQ5.1, HLA-DQ6.3, and HLA-DQ7.3 does not specifically/significantly bind to To prevent any substantial inhibitory effects on these non-targeted MHC class II molecules, and to improve antibody PK in celiac patients with HLA-DQ2.5, these characteristics ("binding substantially none") is preferred.
- a property of "substantially no binding activity" can be defined, for example, using the FACS results described herein.
- An anti-HLA-DQ2.5 antigen-binding molecule that "has substantially no binding activity" for a specific antigen, under the measurement conditions described herein, has a negative control MFI (mean fluorescence intensity) It may have an MFI value that is 250% or less, preferably 200% or less, more preferably 150% or less of the value.
- anti-HLA-DQ2.5 antigen-binding molecules that "have substantially no binding activity" for a specific antigen are described herein
- MFI value of IC17dK is 0% and the MFI value of DQN0139bb is 100% under the measurement conditions described, it has an MFI value of 2% or less, more preferably 1% or less.
- DQN0139bb is disclosed, for example, in WO2018/155692.
- the anti-HLA-DQ2.5 antigen-binding molecule has binding activity to HLA-DQ2.5 in a complex with the gluten peptide described herein.
- the complex formed between the HLA-DQ2.5 molecule and the gluten peptide is referred to as "the complex formed by HLA-DQ2.5 and the gluten peptide", “HLA-DQ2.5/ called “gluten peptide complex”, or "HLA-DQ2.5/gluten peptide”.
- HLA-DQ2.5 loaded with gluten peptide It also includes, for example, "HLA-DQ2.5 loaded with gluten peptide”, “HLA-DQ2.5 loaded with gluten peptide”, “HLA-DQ2.5 bound with gluten peptide”, “complex with gluten peptide” HLA-DQ2.5 in the form of”, and “complex of HLA-DQ2.5 and gluten peptide”.
- gliadin peptides such as: 33mer gliadin peptides, ⁇ 1 gliadin peptides ( may also be referred to as “ ⁇ 1a gliadin peptide"), ⁇ 2 gliadin peptide, ⁇ 1 gliadin peptide, ⁇ 2 gliadin peptide, ⁇ 1 gliadin peptide, ⁇ 2 gliadin peptide, BC hordein peptide, ⁇ 3 gliadin peptide, ⁇ 1b gliadin peptide, ⁇ 4a gliadin peptide, ⁇ 4b gliadin peptide , avenin 1 peptide, avenin 2 peptide, avenin 3 peptide, hordein 1 peptide, hordein 2 peptide, secalin 1 peptide, secalin 2 peptide,
- anti-HLA-DQ2.5 antigen-binding molecules have substantially no binding activity for "unrelated” peptides.
- "Irrelevant" peptides reported herein may be presented on HLA-DQ2.5, but are unrelated to celiac disease or unrelated to the present invention; That is, those which are not gluten peptides for the purposes described above are included.
- irrelevant peptides include CLIP (hCLIP) peptide, Hepatitis B virus 1 (HBV1) peptide, Salmonella peptide, Mycobacterium bovis (M. bovis) peptide, Tyroperoxidase (TPO) peptide, etc. , but not limited to.
- an anti-HLA-DQ2.5 antigen-binding molecule that has "binding activity" for a specific antigen is 300% of the MFI (mean fluorescence intensity) value of the negative control under the measurement conditions described herein. or higher, preferably 500% or higher, more preferably 1000% or higher.
- anti-HLA-DQ2.5 antigen-binding molecules that have "binding activity" for a specific antigen are measured under the measurement conditions described herein below, when the MFI value of IC17dK is 0% and the MFI value of DQN0139bb is 100%, the MFI value that is 3% or more, preferably 6% or more, preferably 10% or more, and more preferably 20% or more have.
- binding activity can be restated as “specific binding activity.”
- the anti-HLA-DQ2.5 antigen-binding molecules (antibodies) of the present invention have a 5 ⁇ 10 ⁇ 7 M or less, preferably 4 ⁇ 10 ⁇ 7 M or less, preferably 3 ⁇ 10 ⁇ 7 M or less, preferably 2 ⁇ 10 ⁇ 7 M or less, preferably 1 ⁇ 10 ⁇ 7 M or less, preferably 9 ⁇ 10 ⁇ 8 M or less, preferably 8 ⁇ 10 ⁇ 8 M or less, preferably 7 ⁇ 10 ⁇ 8 M or less, preferably 6 ⁇ 10 ⁇ 8 M or less, preferably 5 ⁇ 10 ⁇ 8 M or less, preferably 4 ⁇ 10 ⁇ 8 M or less, preferably 3 ⁇ 10 ⁇ 8 M or less, preferably 2 ⁇ 10 ⁇ 8 M or less, preferably 1 ⁇ 10 ⁇ 8 M or less, preferably 9 ⁇ 10 ⁇ 9 M or less, preferably 8 ⁇ 10 ⁇ 9 M or less, preferably 7 ⁇ 10 ⁇ 9 M or less,
- Suitable multispecific antigen binding molecules of the invention include: (1) a portion/domain comprising an antibody variable region having binding activity to HLA-DQ2.5 in the form of a complex with a gluten peptide; (2) a portion/domain comprising an antibody variable region having binding activity to HLA-DQ2.5 in the form of a complex with a gluten peptide; and (3) a reduced Fc ⁇ receptor as described above, not limited to its structure.
- each of the domains described above can be directly linked by peptide bonds.
- a polypeptide formed by linking the antibody variable region-containing domains of (1) and (2) and the Fc region-containing domain of (3) via peptide bonds forms an antibody structure. deaf.
- Such antibodies can be obtained by purification from the hybridoma culture medium described above and also by purification of the antibody from the culture medium of a desired host cell stably harboring a polynucleotide encoding a polypeptide that constitutes the antibody. can be produced.
- Examples of preferred antibody H chain variable regions of the present invention contained in antibody variable regions having binding activity to HLA-DQ2.5 in the form of complexes with gluten peptides include the antibodies described herein
- An antibody H chain having an H chain variable region or a CDR sequence whose CDR1, CDR2 and CDR3 amino acid sequences are the same as the CDR1, CDR2 and CDR3 amino acid sequences contained in the H chain variable regions described herein Included are either variable regions, or antibody heavy chain variable regions that are functionally equivalent to the variable regions described above.
- Examples of preferred antibody variable regions having T-cell receptor complex-binding activity of the present invention include antibody variable regions having HLA-DQ2.5-binding activity in the form of a complex with gluten peptide.
- Examples of antibody H chain variable regions contained in such antibody variable regions include the antibody H chain variable regions described herein, the CDR1, CDR2, and CDR3 amino acid sequences of the antibodies described herein.
- Antibody heavy chain variable regions having CDR sequences that are the same as the CDR1, CDR2, and CDR3 amino acid sequences contained in the heavy chain variable regions, as well as antibody heavy chain variable regions that are functionally equivalent to the variable regions described above are included. .
- the phrase "functionally equivalent” means equivalent binding affinity for antigen when used as a multispecific antigen binding molecule, or alternatively, HLA-DQ2.5/ Equivalent neutralizing activity against cells expressing gluten peptides (or tissue containing these cells) is meant. Binding affinity and neutralizing activity can be determined based on the description herein.
- the cells used for measuring activity can be any desired cell line expressing HLA-DQ2.5/gluten peptide (or any desired tissue containing these cells), or any suitable cell line. can be used. With respect to antibody constant regions, the phrase can mean an equivalent reduction in Fc ⁇ receptor binding activity.
- an antibody H chain variable region that is functionally equivalent to an antibody H chain variable region (i.e., the original H chain variable region) described herein is the present invention in which this region pairs with the original H chain. having the same binding affinity when combined with the antibody light chain variable regions described herein, or alternatively, HLA-DQ2.5 when the regions are used in multispecific antigen binding molecules /Gluten peptide-expressing cells (or tissues containing these cells) have the same neutralizing activity.
- an antibody light chain variable region that is functionally equivalent to an antibody light chain variable region described herein i.e., the original light chain variable region
- this region pairs with the original light chain is the present invention in which this region pairs with the original light chain.
- HLA-DQ2.5 when the regions are used in multispecific antigen binding molecules /Gluten peptide-expressing cells (or tissues containing these cells) have the same neutralizing activity.
- the term "equivalent” does not necessarily imply the same degree of activity, but may have enhanced activity.
- the value (KD value/parent KD value) obtained by comparison with the binding affinity (parent KD value) of the antibody variable region serving as a control is 1.5 or less is included.
- the KD value/parent KD value is preferably 1.3 or less, more preferably 1.2 or less, 1.1 or less, 1.0 or less, 0.9 or less, 0.8 or less, 0.7 or less, 0.6 or less, or 0.5 or less.
- the value of KD value/parent KD value is preferably 10 ⁇ 6 to 1.5 ⁇ 10 ⁇ 0 , more preferably 10 ⁇ 6 to 10 ⁇ 1 , even more preferably 10 ⁇ 6 ⁇ 10 ⁇ 2 , even more preferably 10 ⁇ 6 to 10 ⁇ 3 .
- the KD value for HLA-DQ2.5/gluten peptide is, for example, 2 ⁇ 10 ⁇ 8 M or less, 1 ⁇ 10 -8 M or less, 9 x 10 -9 M or less, 8 x 10 -9 M or less, 7 x 10 -9 M or less, 6 x 10 -9 M or less, 5 x 10 -9 M or less, 4 x 10 - It can be 9 M or less, 3 ⁇ 10 ⁇ 9 M or less, 2 ⁇ 10 ⁇ 9 M or less, or 1 ⁇ 10 ⁇ 9 M or less.
- antibody variable regions are not particularly limited as long as they are antibody H chain and/or antibody L chain variable regions that satisfy the above conditions.
- antibody variable regions include one or more amino acids (eg, 1, 2, 3, 4, 5, or 10 amino acids) in the variable region amino acid sequences of Tables 1-3 above. Regions produced by introducing substitutions, deletions, additions and/or insertions of are included. Methods well known to those skilled in the art for introducing one or more amino acid substitutions, deletions, additions and/or insertions into an amino acid sequence are methods of introducing mutations into proteins.
- variable regions that are functionally equivalent to antibody variable regions having the functions described above by appropriately introducing mutations into the amino acid sequence using methods such as site-directed mutagenesis.
- site-directed mutagenesis an oligodeoxyribonucleotide-directed dual amber method for site-directed mutagenesis. Gene 152, 271-275; Zoller 100, 468-500; Kramer, W., Drutsa, V., Jansen, H.W., Kramer, B. Kramer, W., and Fritz, H.J. (1987) Oligonucleotide-directed mutation construction.
- amino acid side chain properties are: hydrophobic amino acids (A, I, L, M, F, P, W, Y, and V), hydrophilic amino acids (R, D, N, C, E , Q, G, H, K, S, and T), amino acids containing aliphatic side chains (G, A, V, L, I, and P), amino acids containing hydroxyl-containing side chains (S, T , and Y), amino acids containing sulfur atom-containing side chains (C and M), amino acids containing carboxylic acid- and amide-containing side chains (D, N, E, and Q), containing basic side chains Amino acids (R, K, and H), and amino acids containing aromatic side chains (H, F, Y, and W) (amino acids are represented in brackets by the one-letter code).
- Amino acid substitutions within each of these groups are called conservative substitutions.
- Polypeptides containing modified amino acid sequences in which one or more amino acid residues in a given amino acid sequence have been deleted, added, and/or substituted with other amino acids It is known that the original biological activity can be retained (Mark, D. F. et al., Proc. Natl. Acad. Sci. USA; (1984) 81: 5662-6; Zoller, M. J. and Smith, M., Nucleic Acids Res. (1982) 10: 6487-500; Wang, A. et al., Science (1984) 224: 1431-3; Dalbadie-McFarland, G. et al., Proc. Natl. Acad. Sci.
- variable regions of the present invention containing such amino acid alterations are at least 70%, more preferably at least 75%, even more preferably at least 75%, the amino acid sequences of the CDR sequences, FR sequences, or entire variable regions of the variable regions before alteration. have at least 80%, even more preferably at least 85%, even more preferably at least 90%, and most preferably at least 95% amino acid sequence identity.
- sequence identity is the original amino acids of the heavy or light chain variable region, determined after aligning the sequences and introducing gaps as appropriate to maximize sequence identity. Defined as the percentage of residues that are identical to those in the sequence. Amino acid sequence identity can be determined by the methods described below.
- a "functionally equivalent antibody variable region” is obtained, for example, from a nucleic acid that hybridizes under stringent conditions with a nucleic acid comprising a nucleotide sequence encoding the amino acid sequence of the variable region in Tables 1-3, supra. be able to.
- Stringent hybridization conditions for isolating nucleic acids that hybridize under stringent conditions to nucleic acids comprising a nucleotide sequence encoding a variable region amino acid sequence include, for example, 6 M urea, 0.4% SDS, Hybridization conditions with 0.5 ⁇ SSC and 37° C. or equivalent stringency are included.
- washing conditions after hybridization are, for example, washing with 0.5 ⁇ SSC (1 ⁇ SSC is 0.15 M NaCl and 0.015 M sodium citrate at pH 7.0) and 0.1% SDS at 60°C, more preferably at 60°C. Washing with 0.2 ⁇ SSC and 0.1% SDS at 62° C., even more preferably washing with 0.2 ⁇ SSC and 0.1% SDS at 62° C., even more preferably washing with 0.2 ⁇ SSC and 0.1% SDS at 65° C.
- the sequence of the isolated nucleic acid can be determined by known methods described below.
- the overall nucleotide sequence homology of the isolated nucleic acids is at least 50% or more, preferably 70% or more, more preferably 90% or more (e.g., 95%, 96%, 97%, 98%, 99%, or greater) sequence identity.
- a nucleic acid that hybridizes under stringent conditions to a nucleic acid comprising a nucleotide sequence encoding a variable region amino acid sequence can also be obtained by using a nucleotide sequence encoding a variable region amino acid sequence instead of the above methods using hybridization techniques. Isolation can also be achieved through the use of gene amplification methods such as the polymerase chain reaction (PCR) using primers synthesized based on sequence information.
- PCR polymerase chain reaction
- NCBI National Center for Biotechnology Information
- BLAST Basic Local Alignment Search Tool
- the Fc region contained in the multispecific antigen-binding molecule of the present invention is not particularly limited as long as it has reduced Fc ⁇ receptor-binding activity. Combinations of the Fc region portions described herein are included.
- Examples of preferred multispecific antigen-binding molecules of the present invention include a first antibody variable region having binding activity to HLA-DQ2.5 in the form of a gluten peptide complex, and a gluten peptide complex
- Bispecific antibodies comprising a second antibody variable region having binding activity for HLA-DQ2.5 in body form are included.
- Examples of such bispecific antibodies include bispecific antibodies comprising H and L chains described herein, as well as those that bind epitopes that overlap with the epitopes bound by the above antibodies and that reduce Also included are bispecific antibodies that contain an Fc region with enhanced Fc ⁇ receptor binding activity.
- Whether an antibody recognizes an epitope that overlaps with the epitope recognized by another antibody can be confirmed by competition between the two antibodies for the epitope. Competition between antibodies can be assessed by competitive binding assays using means such as enzyme-linked immunosorbent assay (ELISA), fluorescence energy transfer (FRET), and fluorescence microvolume assay technology (FMAT®). can.
- ELISA enzyme-linked immunosorbent assay
- FRET fluorescence energy transfer
- FMAT® fluorescence microvolume assay technology
- an appropriately labeled antibody and the antibody to be evaluated are added simultaneously to the antigen, and the resulting bound antibody is detected using the label.
- the amount of antibody bound to the antigen can be readily determined by labeling the antibody in advance.
- This label is not particularly limited, and the labeling method is selected according to the assay technique used. Specifically, labeling methods include fluorescent labeling, radioactive labeling, enzymatic labeling, and the like.
- a fluorescently-labeled antibody and an unlabeled antibody or a test antibody are added simultaneously to HLA-DQ2.5/gluten peptide-immobilized beads, and the labeled antibody is detected by a fluorescence microassay technique.
- an "antibody that binds an overlapping epitope” is typically 100-fold the amount of labeled antibody bound above the concentration at which unlabeled antibody reduces 50% of the amount of labeled antibody bound ( IC50 ). It refers to a test antibody that can be reduced by at least 50% at a concentration that is higher, preferably 80-fold higher, more preferably 50-fold higher, even more preferably 30-fold higher, even more preferably 10-fold higher.
- a multispecific antigen-binding molecule having an antigen-binding site of an antibody that binds to an epitope that overlaps with the epitope bound by the aforementioned antibody can produce excellent binding activity or neutralizing activity.
- the multispecific antigen-binding molecules of the present invention are produced by the same methods for producing recombinant antibodies described herein.
- any one or more amino acids of the anti-HLA-DQ2.5 antigen binding molecules (antibodies) provided above are either heavy and/or light chain constant and/or variable regions or domains. is replaced in
- substitutions provided herein are conservative substitutions.
- the antibodies provided herein are human antibodies.
- Human antibodies can be produced by various techniques known in the art. Human antibodies are reviewed in van Dijk and van de Winkel, Curr. Opin. Pharmacol. 5: 368-74 (2001) and Lonberg, Curr. Opin. Immunol. 20:450-459 (2008).
- Human antibodies may be prepared by administering an immunogen to transgenic animals that have been engineered to produce fully human antibodies or fully antibodies with human variable regions in response to an antigenic challenge.
- Such animals typically contain all or part of a human immunoglobulin locus, wherein all or part of the human immunoglobulin locus replaces the endogenous immunoglobulin locus, or is extrachromosomally or It exists in a state of being randomly incorporated into the chromosome of the animal.
- the endogenous immunoglobulin loci are usually inactivated.
- Human antibodies can also be made by hybridoma-based methods. Human myeloma and mouse-human heteromyeloma cell lines have been previously described for the production of human monoclonal antibodies. (e.g. Kozbor J. Immunol., 133: 3001 (1984); Brodeur et al., Monoclonal Antibody Production Techniques and Applications, pp.51-63 (Marcel Dekker, Inc., New York, 1987); and Boerner et al. ., J. Immunol., 147: 86 (1991).) Human antibodies generated via human B-cell hybridoma technology are also produced by Li et al., Proc. Natl. Acad. Sci. USA, 103:3557- 3562 (2006).
- Additional methods include, for example, US Pat. No. 7,189,826 (describing production of monoclonal human IgM antibodies from hybridoma cell lines) and Ni, Xiandai Mianyixue, 26(4):265-268 (2006) (human - describing human hybridomas).
- Human hybridoma technology (trioma technology) is also described in Vollmers and Brandlein, Histology and Histopathology, 20(3):927-937 (2005) and Vollmers and Brandlein, Methods and Findings in Experimental and Clinical Pharmacology, 27(3):185-91 (2005).
- Human antibodies can also be generated by isolating selected Fv clone variable domain sequences from human-derived phage display libraries. Such variable domain sequences can then be combined with the desired human constant domain. Techniques for selecting human antibodies from antibody libraries are described below.
- the antibodies provided herein are chimeric antibodies.
- Certain chimeric antibodies are described, for example, in US Pat. No. 4,816,567; and Morrison et al., Proc. Natl. Acad. Sci. USA, 81:6851-6855 (1984).
- a chimeric antibody comprises a non-human variable region (eg, a variable region derived from a non-human primate such as mouse, rat, hamster, rabbit, or monkey) and a human constant region.
- a chimeric antibody is a "class-switched" antibody that has an altered class or subclass from that of the parent antibody. Chimeric antibodies also include antigen-binding fragments thereof.
- the chimeric antibody is a humanized antibody.
- non-human antibodies are humanized to reduce immunogenicity in humans while retaining the specificity and affinity of the parent non-human antibody.
- a humanized antibody comprises one or more variable domains in which HVRs (e.g. CDRs (or portions thereof)) are derived from non-human antibodies and FRs (or portions thereof) are derived from human antibody sequences.
- HVRs e.g. CDRs (or portions thereof)
- FRs or portions thereof
- a humanized antibody optionally will also comprise at least a portion of a human constant region.
- a non-human antibody e.g., the antibody from which the HVR residues were derived
- Human framework regions that can be used for humanization were selected using, but not limited to: the "best fit” method (see Sims et al. J. Immunol. 151:2296 (1993)) Framework regions; framework regions derived from the consensus sequences of human antibodies of a particular subgroup of light or heavy chain variable regions (Carter et al. Proc. Natl. Acad. Sci. USA, 89:4285 (1992) and Presta et al. J. Immunol., 151:2623 (1993)); human mature (somatic mutation) framework regions or human germline framework regions (e.g. Almagro and Fransson, Front. Biosci.
- the anti-HLA-DQ2.5 antigen-binding molecule is humanized.
- the anti-HLA-DQ2.5 antigen binding molecule comprises the HVR of any of the above embodiments and further acceptor human frameworks, such as human immunoglobulin frameworks or human consensus frameworks including.
- the anti-HLA-DQ2.5 antigen binding molecule comprises the HVR of any of the above embodiments and further comprises the FR1, FR2, FR3, or FR4 sequences provided herein .
- "human frameworks” may also be referred to as "humanized frameworks", focusing on the fact that antibodies are humanized.
- the multispecific antigen-binding molecules of the invention are (i) a first antigen-binding portion having binding activity for HLA-DQ2.5 in a complex with a gluten peptide; and (ii) HLA-DQ2 in a complex with a gluten peptide.
- the antigen-binding molecule binds to two or more complexes of HLA-DQ2.5 and gluten peptide, at least one of the gluten peptides in the complex bound by the first antigen-binding portion is different from at least one of the gluten peptides in the complex bound by the second antigen-binding portion; substantially no binding activity to either or both of HLA-DQ2.5-positive PBMC B cells and Ba/F3 cells expressing HLA-DQ2.5 or HLA-DQ2.2;
- the antigen-binding molecule is humanized, and heavy and/or light chain constant and/or variable regions in the first antigen-binding portion and/or the second antigen-binding portion in the multispecific antigen-binding molecule One or more amino acids therein have been modified.
- the multispecific antigen binding molecule in the multispecific antigen-binding molecule, one or more in the heavy and/or light chain of the first antigen-binding portion and/or the second antigen-binding portion in the multispecific antigen-binding molecule amino acids have been substituted.
- the multispecific antigen binding molecule has at least one amino acid substitution in the heavy chain variable region; at least one amino acid substitution in the heavy chain constant region; at least one amino acid substitution in the light chain variable region; amino acid substitution; and at least one amino acid substitution in the constant region of the light chain.
- the gluten peptide is an immunodominant peptide associated with celiac disease.
- the gluten peptide is a 33mer gliadin peptide, an ⁇ 1 gliadin peptide, an ⁇ 2 gliadin peptide, a ⁇ 1 gliadin peptide, a ⁇ 2 gliadin peptide, an ⁇ 1 gliadin peptide, an ⁇ 2 gliadin peptide, a BC hordein peptide, an ⁇ 3 gliadin peptide, an ⁇ 1b gliadin peptide, ⁇ 4a gliadin peptide, ⁇ 4b gliadin peptide, avenin 1 peptide, avenin 2 peptide, avenin 3 peptide, hordein 1 peptide, hordein 2 peptide, secalin 1 peptide, secalin 2 peptide, and 26mer gliadin peptide.
- the gluten peptide is a 33mer gliadin peptide, an ⁇ 1 gliadin peptide, an ⁇ 2 gliadin peptide, a ⁇ 1 gliadin peptide, a ⁇ 2 gliadin peptide, an ⁇ 1 gliadin peptide, an ⁇ 2 gliadin peptide, a BC hordein peptide, an ⁇ 3 gliadin peptide, an ⁇ 1b gliadin peptide, 1, 2, 3, 4 of ⁇ 4a gliadin peptide, ⁇ 4b gliadin peptide, avenin 1 peptide, avenin 2 peptide, avenin 3 peptide, hordein 1 peptide, hordein 2 peptide, secalin 1 peptide, secalin 2 peptide, and 26mer gliadin peptide , 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or all
- the gluten peptide is a 33mer gliadin peptide, an ⁇ 1 gliadin peptide, an ⁇ 2 gliadin peptide, a ⁇ 1 gliadin peptide, an ⁇ 1 gliadin peptide, an ⁇ 2 gliadin peptide, a BC hordein peptide, an ⁇ 3 gliadin peptide, an ⁇ 1b gliadin peptide, a ⁇ 4a gliadin peptide, ⁇ 4b gliadin peptide, avenin 1 peptide, avenin 2 peptide, avenin 3 peptide, hordein 1 peptide, hordein 2 peptide, secalin 1 peptide, secalin 2 peptide, and 26mer gliadin peptide.
- the gluten peptide is a 33mer gliadin peptide, an ⁇ 1 gliadin peptide, an ⁇ 2 gliadin peptide, a ⁇ 1 gliadin peptide, an ⁇ 1 gliadin peptide, an ⁇ 2 gliadin peptide, a BC hordein peptide, an ⁇ 3 gliadin peptide, an ⁇ 1b gliadin peptide, a ⁇ 4a gliadin peptide, 1, 2, 3, 4, 5, 6 of ⁇ 4b gliadin peptide, avenin 1 peptide, avenin 2 peptide, avenin 3 peptide, hordein 1 peptide, hordein 2 peptide, secalin 1 peptide, secalin 2 peptide, and 26mer gliadin peptide , 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, or all.
- the multispecific antigen binding molecules have substantially no binding activity to gluten peptides per se or gluten peptides per se.
- the terms “as such” and “as such” refer to the state in which the gluten peptides are not complexed with HLA-DQ2.5.
- the multispecific antigen-binding molecule has substantially no binding activity for HLA-DQ2.5 in the form of a complex with an unrelated peptide, and the unrelated peptide is CLIP (hCLIP) peptide, hepatitis B virus 1 peptide, Salmonella peptide, Mycobacterium bovis peptide, and tyroperoxidase peptide.
- the multispecific antigen-binding molecule has substantially no binding activity for HLA-DQ2.5 in the form of a complex with an unrelated peptide, and the unrelated peptide is CLIP (hCLIP) peptide, hepatitis B virus 1 peptide, Salmonella peptide, Mycobacterium bovis peptide, and tyroperoxidase peptide.
- the antigen-binding molecule has enhanced avidity for complexes formed by HLA-DQ2.5 and gluten peptides compared to before said humanization and modification.
- "enhanced avidity" means that the antigen-binding molecule is stronger than the pre-antibody prior to modification, i.e.
- the complex formed by HLA-DQ2.5 and the gluten peptide means to bind to
- the antigen binding molecule has enhanced cross-reactivity to gluten peptides compared to before said humanization and modification.
- the gluten peptides are ⁇ 2 gliadin peptides, BC hordein peptides, ⁇ 1 gliadin peptides, ⁇ 2 gliadin peptides, ⁇ 4a gliadin peptides, and ⁇ 4d gliadin peptides.
- enhanced cross-reactivity to gluten peptides means that the antigen-binding molecule binds to more gluten peptides than the pre-antibody prior to modification, i.e. humanization and modification, or It means exhibiting neutralizing activity.
- the anti-HLA-DQ2.5 antigen binding molecule has at least 90%, 91%, 92%, Include heavy chain variable domain (VH) sequences with 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity.
- VH sequences having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity are referred to (i.e., original (e.g., conservative substitutions), insertions, or deletions to the sequence of ), but anti-HLA-DQ2.5 antigen-binding molecules (antibodies) that contain such sequences bind to HLA-DQ2.5 retain ability.
- the anti-HLA-DQ2.5 antigen binding molecule comprises a VH sequence disclosed herein, or a sequence comprising post-translational modifications thereof.
- VH is (a) HVR-H1 disclosed herein, (b) HVR-H2 disclosed herein, and (c) HVR- Contains 1, 2, or 3 HVRs selected from H3.
- Post-translational modifications include, but are not limited to, modification of heavy or light chain N-terminal glutamine or glutamic acid to pyroglutamic acid by pyroglutamylation.
- Amino acids contained in the amino acid sequences of the present invention may be post-translationally modified (for example, modification of N-terminal glutamine to pyroglutamic acid by pyroglutamylation is well known to those skilled in the art). Naturally, such post-translationally modified amino acids are included in the amino acid sequences of the present invention.
- anti-HLA-DQ2.5 antigen binding molecules are provided, wherein the molecules/antibodies are at least 90% relative to the light chain variable domain (VL) amino acid sequence disclosed herein. , 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity.
- VL light chain variable domain
- a VL sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity is a reference (i.e., original ) sequence (e.g., conservative substitution), insertion, or deletion, but anti-HLA-DQ2.5 antigen-binding molecules (antibodies) comprising such sequences bind to HLA-DQ2.5 retain the ability to
- a total of 1 to 10 amino acids have been substituted, inserted and/or deleted relative to the reference (ie original) sequence.
- substitutions, insertions, or deletions occur in regions outside the HVR (ie, within the FRs).
- the anti-HLA-DQ2.5 antigen binding molecule comprises a VL sequence disclosed herein, or a sequence comprising a post-translational modification thereof.
- VL is (a) HVR-L1 as disclosed herein; (b) HVR-L2 as disclosed herein; and (c) HVR- Contains 1, 2, or 3 HVRs selected from L3.
- Post-translational modifications include, but are not limited to, modification of heavy or light chain N-terminal glutamine or glutamic acid to pyroglutamic acid by pyroglutamylation.
- an anti-HLA-DQ2.5 antigen binding molecule is provided, wherein the molecule/antibody is a VH in any of the above provided embodiments and any of the above provided embodiments. Including VL in stuff.
- the molecule/antibody comprises a VH sequence disclosed herein or a sequence comprising post-translational modifications thereof and a VL sequence disclosed herein or a sequence comprising post-translational modifications thereof.
- Post-translational modifications include, but are not limited to, modification of heavy or light chain N-terminal glutamine or glutamic acid to pyroglutamic acid by pyroglutamylation.
- the present invention provides an antigen-binding molecule (antibody) that binds to the same epitope as the anti-HLA-DQ2.5 antigen-binding molecule (antibody) provided herein.
- antibody antigen-binding molecule
- molecules/antibodies are provided that bind to the same epitope as any of the molecules/antibodies described herein.
- a molecule/antibody that binds to an epitope within a fragment of HLA-DQ2.5 of about 8 to 17 amino acids or within a complex formed by HLA-DQ2.5 and a gluten peptide. is provided.
- the gluten peptide can be any of the gluten peptides described herein.
- the present invention provides an antigen-binding molecule (antibody) that competes with another antigen-binding molecule (antibody) for binding to HLA-DQ2.5 or a complex formed by HLA-DQ2.5 and a gluten peptide.
- an antigen-binding molecule antibody
- another antigen-binding molecule antibody
- I will provide a.
- a molecule/antibody that competes with any of the molecules/antibodies described herein for binding to HLA-DQ2.5 or a complex formed by HLA-DQ2.5 and a gluten peptide is provided.
- the gluten peptide can be any of the gluten peptides described herein.
- the anti-HLA-DQ2.5 antigen binding molecules (antibodies) are monoclonal antigen binding molecules (antibodies), including chimeric, humanized or human antigen binding molecules (antibodies). antibody).
- the anti-HLA-DQ2.5 antigen-binding molecules (antibodies) of the present invention are humanized antigen-binding molecules (antibodies).
- the anti-HLA-DQ2.5 antigen binding molecule (antibody) is an antibody fragment, eg, Fv, Fab, Fab', scFv, diabodies, or F(ab') 2 fragments.
- the antibody is a full-length antibody, eg, a complete IgG1 antibody, or other antibody class or isotype as defined herein.
- an anti-HLA-DQ2.5 antigen binding molecule according to any of the above embodiments, either alone or in combination, may incorporate any of the following properties.
- the antibodies provided herein have ⁇ 1 micromolar ( ⁇ M), ⁇ 100 nM, ⁇ 10 nM, ⁇ 1 nM, ⁇ 0.1 nM, ⁇ 0.01 nM or ⁇ 0.001 nM (e.g., 10 ⁇ 8 M or less, eg 10 ⁇ 8 M to 10 ⁇ 13 M, eg 10 ⁇ 9 M to 10 ⁇ 13 M).
- the Kd is measured by a radiolabeled antigen binding assay (RIA).
- the RIA is performed using the Fab version of the antibody of interest and its antigen.
- the in-solution binding affinity of a Fab for an antigen can be determined by equilibrating the Fab with a minimal concentration of ( 125 I)-labeled antigen in the presence of an increasing dose series of unlabeled antigen and then coating the bound antigen with an anti-Fab antibody. measured by capturing with a plate. (See, eg, Chen et al., J. Mol. Biol. 293:865-881 (1999)).
- MICROTITER® multiwell plates were treated with 5 micrograms ( ⁇ g)/ml of capture anti-Fab antibody (Cappel Labs) in 50 mM sodium carbonate (pH 9.6). Coat overnight and then block with 2% (w/v) bovine serum albumin in PBS for 2-5 hours at room temperature (approximately 23°C).
- non-adsorbing plates 100 pM or 26 pM of [ 125 I]-antigen (e.g., anti-VEGF antibody, Fab- 12)) with serial dilutions of the Fab of interest.
- the Fab of interest is then incubated overnight, although this incubation can be continued for a longer time (eg, about 65 hours) to ensure equilibrium is reached.
- the mixture is then transferred to a capture plate for incubation (eg, 1 hour) at room temperature.
- the solution is then removed and the plate washed 8 times with 0.1% polysorbate 20 (TWEEN-20®) in PBS. Once the plates are dry, 150 microliters ( ⁇ L)/well of scintillant (MICROSCINT-20TM, Packard) is added and the plates are counted for 10 minutes in a TOPCOUNTTM gamma counter (Packard). Concentrations of each Fab that give 20% or less of maximal binding are selected for use in competitive binding assays.
- the Kd is measured using a BIACORE® surface plasmon resonance assay.
- assays using the BIACORE®-2000 or BIACORE®-3000 showed that approximately 10 response units (RU) of antigen were immobilized.
- a CM5 chip Performed at 25° C. using a CM5 chip.
- CM5 chip a carboxymethylated dextran biosensor chip (CM5, BIACORE, Inc.) was prepared with N-ethyl-N'-(3-dimethylaminopropyl)-carbodiimide hydrochloride (EDC) and N -activated with hydroxysuccinimide (NHS).
- EDC N-ethyl-N'-(3-dimethylaminopropyl)-carbodiimide hydrochloride
- NHS hydroxysuccinimide
- Antigen was diluted to 5 ⁇ g/ml (approximately 0.2 ⁇ M) with 10 mM sodium acetate, pH 4.8, before injection at a flow rate of 5 ⁇ L/min to achieve approximately 10 response units (RU) of protein binding. diluted. After injection of antigen, 1M ethanolamine is injected to block unreacted groups. For kinetic measurements, two-fold serial dilutions of Fabs (0.78 nM ⁇ 500 nM) is injected. The association (k on ) and dissociation (k off ) kinetics were determined by simultaneously fitting the association and dissociation sensorgrams using a simple one-to-one Langmuir binding model (BIACORE® evaluation software version 3.2). Calculated.
- a spectrometer e.g., a stopped-flow spectrophotometer (Aviv Instruments) or an 8000 series SLM-1 using a stirred cuvette.
- the antibodies provided herein are antibody fragments.
- Antibody fragments include, but are not limited to, Fab, Fab', Fab'-SH, F(ab') 2 , Fv, and scFv fragments, as well as other fragments described below.
- Fab fragment antigen
- Fab' fragment antigen-specific antibody fragment
- Fab'-SH fragment antigen-specific antibody fragment
- Fv fragment antigen-specific antibody fragment
- scFv fragments see, for example, Pluckthun, in The Pharmacology of Monoclonal Antibodies, vol. 113, Rosenburg and Moore eds., (Springer-Verlag, New York), pp.269-315 (1994); 16185; and U.S. Pat. Nos.
- a diabody is an antibody fragment with two antigen-binding sites that may be bivalent or bispecific.
- WO1993/01161 Hudson et al., Nat. Med. 9:129-134 (2003); Hollinger et al., Proc. Natl. Acad. Sci. USA 90: 6444-6448 (1993 ) reference.
- Triabodies and tetrabodies are also described in Hudson et al., Nat. Med. 9:129-134 (2003).
- a single domain antibody is an antibody fragment that contains all or part of the heavy chain variable domain or all or part of the light chain variable domain of an antibody.
- the single domain antibody is a human single domain antibody (Domantis, Inc., Waltham, MA; see, eg, US Pat. No. 6,248,516 B1).
- Antibody fragments include, but are not limited to, proteolytic digestion of intact antibodies, production by recombinant host cells (e.g., E. coli or phage), as described herein; It can be made by various techniques.
- Fc Region Variants In certain embodiments, one or more amino acid modifications may be introduced into the Fc region of the antibodies provided herein, thereby generating Fc region variants.
- An Fc region variant may include a human Fc region sequence (eg, a human IgG1, IgG2, IgG3, or IgG4 Fc region) containing amino acid modifications (eg, substitutions) at one or more amino acid positions.
- FcRn responsible for transferring maternal IgGs to the fetus (Guyer et al., J. Immunol. 117:587 (1976) and Kim et al., J. Immunol. 24:249 (1994)))
- FcRn responsible for transferring maternal IgGs to the fetus
- These antibodies comprise an Fc region with one or more substitutions therein that increase the binding of the Fc region to FcRn.
- Such Fc variants have the following Fc region residues: , 413, 424, or 434 (eg, substitution of Fc region residue 434 (US Pat. No. 7,371,826)). See also Duncan & Winter, Nature 322:738-40 (1988); US Patent No. 5,648,260; US Patent No. 5,624,821; and WO94/29351 for other examples of Fc region variants.
- Fc region or “Fc domain” are used to define a C-terminal region of an immunoglobulin heavy chain, including at least part of the constant region.
- the term includes native sequence Fc regions and variant Fc regions.
- the Fc region of a human IgG heavy chain extends from Cys226 or from Pro230 to the carboxyl terminus of the heavy chain.
- the C-terminal lysine (Lys447) or glycine-lysine (residues 446-447) of the Fc region may or may not be present.
- amino acid residue numbering in the Fc region or constant region is according to Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md. , 1991, according to the EU numbering system, also called the EU index.
- Fc receptor refers to a receptor that binds to the Fc region of an antibody.
- the FcR is a native human FcR.
- the FcR is one that binds IgG antibodies (gamma receptors) and includes receptors of the Fc ⁇ RI, Fc ⁇ RII, and Fc ⁇ RIII subclasses, including allelic variants of these receptors and selective Splice forms are also included.
- Fc ⁇ RII receptors include Fc ⁇ RIIA (an “activating receptor”) and Fc ⁇ RIIB (an “inhibiting receptor”), which have similar amino acid sequences that differ primarily in their cytoplasmic domains.
- Activating receptor Fc ⁇ RIIA contains an immunoreceptor tyrosine-based activation motif (ITAM) in its cytoplasmic domain.
- ITAM immunoreceptor tyrosine-based activation motif
- ITIM immunoreceptor tyrosine-based inhibition motif
- Fc receptor or “FcR” also includes the neonatal receptor FcRn, which is responsible for the transfer of maternal IgG to the fetus (Guyer et al., J. Immunol. 117:587 (1976) and Kim et al. 24:249 (1994)) and is involved in the regulation of immunoglobulin homeostasis. Methods for measuring binding to FcRn are known (e.g., Ghetie and Ward., Immunol. Today 18(12):592-598 (1997); Ghetie et al., Nature Biotechnology, 15(7):637 -640 (1997); Hinton et al., J. Biol. Chem. 279(8):6213-6216 (2004); see WO 2004/92219 (Hinton et al.)).
- Binding to human FcRn in vivo and plasma half-life of human FcRn high affinity binding polypeptides e.g., in transgenic mice or transfected human cell lines expressing human FcRn or containing variant Fc regions
- Assays can be performed in primates to which the polypeptide has been administered.
- WO 2000/42072 (Presta) describes antibody variants with increased or decreased binding to FcRs. See also, e.g., Shields et al. J. Biol. Chem. 9(2):6591-6604 (2001).
- Fc ⁇ receptor Fc ⁇ receptor refers to a receptor that can bind to the Fc domain of a monoclonal IgG1, IgG2, IgG3, or IgG4 antibody and belongs to the family of proteins substantially encoded by the Fc ⁇ receptor genes Including all members.
- this family includes Fc ⁇ RI (CD64), including isoforms Fc ⁇ RIa, Fc ⁇ RIb, and Fc ⁇ RIc; Fc ⁇ RII (CD32), including isoforms Fc ⁇ RIIa (including allotypes H131 and R131), Fc ⁇ RIIb (Fc ⁇ RIIb-1 and 2), and Fc ⁇ RIIc; and Fc ⁇ RIII (CD16), such as isoforms Fc ⁇ RIIIa (including allotypes V158 and F158), and Fc ⁇ RIIIb (including allotypes Fc ⁇ RIIIb-NA1 and Fc ⁇ RIIIb-NA2); and all unidentified human Including Fc ⁇ receptors, Fc ⁇ receptor isoforms, and allotypes thereof.
- Fc ⁇ receptors are not limited to these examples.
- Fc ⁇ receptors include, without limitation, those from humans, mice, rats, rabbits, and monkeys.
- Fc ⁇ receptors may be derived from any organism.
- Mouse Fc ⁇ receptors include Fc ⁇ RI (CD64), Fc ⁇ RII (CD32), Fc ⁇ RIII (CD16), and Fc ⁇ RIII-2 (CD16-2), and all unidentified mouse Fc ⁇ receptors, Fc ⁇ receptor isoforms, and allotypes thereof.
- Such preferred Fc ⁇ receptors include, for example, human Fc ⁇ RI (CD64), Fc ⁇ RIIA (CD32), Fc ⁇ RIIB (CD32), Fc ⁇ RIIIA (CD16), and/or Fc ⁇ RIIIB (CD16).
- Fc ⁇ receptors have binding activity to the Fc domain of monoclonal IgG1, IgG2, IgG3, or IgG4 antibodies can be determined by ALPHA screen (Amplified Luminescent Proximity Homogeneous Assay) in addition to the FACS and ELISA formats described above. Proximity Homogeneous Assay), BIACORE method based on surface plasmon resonance (SPR), etc. (Proc. Natl. Acad. Sci. USA (2006) 103(11), 4005-4010).
- Fc ligand or “effector ligand” refers to a molecule, preferably a polypeptide, that binds to an antibody Fc domain to form an Fc/Fc ligand complex.
- the molecule may be derived from any organism. Binding of an Fc ligand to Fc preferably induces one or more effector functions.
- Fc ligands include Fc receptors, Fc ⁇ receptors, Fc ⁇ receptors, Fc ⁇ receptors, Fc ⁇ receptors, FcRn, C1q and C3, mannan binding lectins, mannose receptors, Staphylococcus protein A, staphylococcal proteins G, as well as viral Fc ⁇ receptors.
- Fc ligands also include Fc receptor homologues (FcRH) (Davis et al., (2002) Immunological Reviews 190, 123-136), a family of Fc receptors homologous to Fc ⁇ receptors. Fc ligands also include unidentified molecules that bind to Fc.
- FcRH Fc receptor homologues
- Fc ligands also include unidentified molecules that bind to Fc.
- Fc ⁇ Receptor Binding Activity Decreased binding activity of the Fc domain to any of the Fc ⁇ receptors Fc ⁇ RI, Fc ⁇ RIIA, Fc ⁇ RIIB, Fc ⁇ RIIIA, and/or Fc ⁇ RIIIB was measured using the FACS and ELISA formats described above, as well as the ALPHA screen (amplified luminescence proximity). homogenous assay) and surface plasmon resonance (SPR)-based BIACORE method (Proc. Natl. Acad. Sci. USA (2006) 103(11), 4005-4010).
- ALPHA screen is performed by ALPHA technology based on the principle described below, using two types of beads, donor beads and acceptor beads.
- a luminescent signal is detected only when the molecule linked to the donor bead biologically interacts with the molecule linked to the acceptor bead and the two beads are placed in close proximity.
- a photosensitizer within the donor bead converts the oxygen surrounding the bead to excited singlet oxygen.
- a chemiluminescent reaction is induced in the acceptor bead when singlet oxygen diffuses around the donor bead and reaches the closely positioned acceptor bead. This reaction ultimately results in luminescence. If the molecule linked to the donor bead does not interact with the molecule linked to the acceptor bead, the singlet oxygen generated by the donor bead will not reach the acceptor bead and no chemiluminescent reaction will occur.
- biotin-labeled antigen-binding molecules or antibodies are immobilized on donor beads, and glutathione S-transferase (GST)-tagged Fc ⁇ receptors are immobilized on acceptor beads.
- GST glutathione S-transferase
- Fc ⁇ receptors interact with antigen-binding molecules or antibodies comprising wild-type Fc domains, resulting in the induction of a signal at 520-620 nm.
- Antigen-binding molecules or antibodies with untagged variant Fc domains compete with antigen-binding molecules or antibodies comprising wild-type Fc domains for interaction with Fc ⁇ receptors. Relative binding affinity can be measured by quantifying the decrease in fluorescence as a result of competition.
- Suitable methods for biotinylating antigen-binding molecules or antibodies, such as antibodies, using sulfo-NHS-biotin and the like are known.
- Suitable methods for adding a GST tag to an Fc ⁇ receptor include fusing GST in-frame with a polypeptide encoding the Fc ⁇ receptor, using cells transfected with a vector carrying the fused gene. Included are methods comprising expressing the gene and then purifying using a glutathione column.
- the induced signal can preferably be analyzed by fitting to a one-site competition model based on non-linear regression analysis, for example using software such as GRAPHPAD PRISM (GraphPad; San Diego).
- One of the substances for observing their interaction is immobilized on the thin gold layer of the sensor chip as a ligand.
- SPR signal Specific sites
- Another substance for observing their interaction is injected onto the surface of the sensor chip as an analyte.
- the mass of the immobilized ligand molecule increases when the analyte binds to the ligand. This changes the refractive index of the solvent on the surface of the sensor chip.
- a change in refractive index causes a positional shift of the SPR signal (conversely, dissociation returns the signal to its original position).
- the Biacore system plots the above-described shift amount (ie, change in mass on the sensor chip surface) on the vertical axis, and thus changes in mass over time are displayed as measured data (sensorgram).
- the kinetic parameters (association rate constant (ka) and dissociation rate constant (kd)) are determined from the curve of the sensorgram and the affinity (KD) is determined from the ratio between these two constants.
- Inhibition assays are preferably used in the BIACORE method. Examples of such inhibition assays are described in Proc. Natl. Acad. Sci. USA (2006) 103(11), 4005-4010.
- the term “reduced Fc ⁇ receptor binding activity” refers to, for example, the competitive activity of a test antigen-binding molecule or antibody based on the analysis method described above, compared to the control 50% or less, preferably 45% or less, 40% or less, 35% or less, 30% or less, 20% or less, or 15% or less, particularly preferably 10% or less, relative to the competitive activity of the antigen-binding molecule or antibody, It means 9% or less, 8% or less, 7% or less, 6% or less, 5% or less, 4% or less, 3% or less, 2% or less, or 1% or less.
- An antigen-binding molecule or antibody comprising the Fc domain of a monoclonal IgG1, IgG2, IgG3, or IgG4 antibody can be suitably used as a control antigen-binding molecule or antibody.
- Fc domain structures are shown in RefSeq Accession No. AAC82527.1, RefSeq Accession No. AAB59393.1, RefSeq Accession No. CAA27268.1, and RefSeq Accession No. AAB59394.1.
- an antigen-binding molecule or antibody containing an Fc domain variant of a specific isotype antibody is used as a test substance
- the effect of the variant mutation on Fc ⁇ receptor binding activity can be evaluated by comparing the Fc domain variant of the same isotype as a control. is evaluated using an antigen-binding molecule or antibody comprising
- antigen-binding molecules or antibodies comprising Fc domain mutants determined to have reduced Fc ⁇ receptor binding activity are preferably prepared.
- Such known mutants include, for example, a mutant with a deletion of amino acids 231A-238S (EU numbering) (WO2009/011941), as well as mutants C226S, C229S, P238S, (C220S) (J. Rheumatol ( 2007) 34, 11); C226S and C229S (Hum. Antibod. Hybridomas (1990) 1(1), 47-54); C226S, C229S, E233P, L234V, and L235A (Blood (2007) 109, 1185-1192) is included.
- EU numbering EU numbering
- C226S, C229S, P238S, (C220S) J. Rheumatol ( 2007) 34, 11
- C226S and C229S Hum. Antibod. Hybridomas (1990) 1(1), 47-54
- C226S, C229S, E233P, L234V, and L235A
- preferred antigen-binding molecules or antibodies include amino acid positions 220, 226, 229, 231, 232, 233, 234, 235, 236, 237 in the amino acids forming the Fc domain of an antibody of a particular isotype: Choose from 238, 239, 240, 264, 265, 266, 267, 269, 270, 295, 296, 297, 298, 299, 300, 325, 327, 328, 329, 330, 331 or 332 (EU numbering) Included are those comprising an Fc domain with at least one amino acid mutation (such as a substitution) that is modified.
- the antibody isotype from which the Fc domain is derived is not particularly limited, and suitable Fc domains derived from monoclonal IgG1, IgG2, IgG3, or IgG4 antibodies can be used. It is preferred to use Fc domains derived from IgG1 antibodies.
- SG181 may be used as an Fc ⁇ receptor silencing Fc that weakens Fc binding to Fc ⁇ receptors.
- SG181.S3n SEQ ID NO: 101
- SG181.S3p SEQ ID NO: 102
- heavy chain constant region sequences may be included in the antigen binding molecules or antibodies of the invention for reduced Fc ⁇ receptor binding.
- antigen-binding molecules or antibodies include, for example, any amino acid at position 233, 234, 235, 236, 237, 327, 330, or 331 (EU numbering) in the amino acids forming the Fc domain of an IgG1 antibody, Included are those containing an Fc domain substituted with the amino acid at the corresponding position in the EU numbering in the corresponding IgG2 or IgG4.
- the multispecific antigen-binding molecules of the present invention further comprise an Fc domain that exhibits reduced binding affinity for human Fc ⁇ receptors compared to native human IgG1 Fc domains.
- the Fc domain comprises Arg at position 235 and Arg at position 236, with amino acid positions numbered according to EU numbering.
- Another aspect of the invention is antigen binding molecules in which heavy and light chain association is modulated, heavy and light chain association is modulated
- the present invention relates to a method for producing an antigen-binding molecule that has an antigen-binding molecule, and a method for modulating the association of heavy and light chains in an antigen-binding molecule.
- Antigen-binding molecules of the present invention are those in which the association between heavy and light chains is regulated, the heavy and light chains constituting the antigen-binding molecule are the desired combination of heavy and light chains, and the heavy chain and the constant region (CL) of the light chain are amino acid residues (having the same charge) that are electrically repulsive to each other.
- amino acid residues at given positions in CH1 and CL of an undesirable combination of heavy and light chains be amino acid residues that are electrically repulsive to each other (i.e., have the same charge) , the formation of undesired combinations of heavy and light chains can be prevented by utilizing this charge repulsion, resulting in the formation of desirable combinations of heavy and light chains.
- regulating association and "regulated association” refer to the regulation to achieve desired association conditions, more specifically Refers to regulation such that undesirable associations are not formed between them.
- the term "interface” usually refers to an association surface resulting from association (interaction), and the amino acid residues forming the interface are usually included in the polypeptide region involved in the association.
- One or more amino acid residues more preferably amino acid residues that are in close proximity to each other during association and participate in interactions. More specifically, this interaction includes, for example, when amino acid residues come closer together in association to form hydrogen bonds, electrostatic interactions, or salt bridges.
- an interfacial polypeptide region refers to a polypeptide region responsible for selective binding between molecules, eg, in an antigen-binding molecule (eg, antibody), ligand, receptor, or substrate. More specifically, in antigen-binding molecules, such examples include heavy chain constant regions, heavy chain variable regions, light chain constant regions, and light chain variable regions.
- the antigen-binding molecule is electrically repelled (same charge has) amino acid residues.
- amino acid residues to be modified are preferably amino acid residues that are close to each other during association in the polypeptide region that forms the interface.
- Amino acid residues that are in close proximity during association can be determined, for example, by analyzing the three-dimensional structure of the polypeptide and examining the amino acid sequences of the regions of the polypeptide that form the interface during polypeptide association. . Interfacial amino acid residues that are in close proximity to each other are preferred targets for "modification" in the antigen-binding molecules of the invention.
- lysine (K), arginine (R), and histidine (H) are known to be positively charged amino acids (positively charged amino acids).
- Aspartic acid (D), glutamic acid (E), etc. are known to be negatively charged amino acids (negatively charged amino acids).
- alanine (A), asparagine (N), cysteine (C), glutamine (Q), glycine (G), isoleucine (I), leucine (L), methionine (M), phenylalanine (F), proline ( P), serine (S), threonine (T), tryptophan (W), tyrosine (Y), valine (V), etc. are known to be uncharged or non-polar amino acids.
- amino acids that are electrically repulsive to each other (having the same charge) in the present invention refer to: (1) an amino acid wherein one of the amino acids is a positively charged amino acid and the other amino acid is also a positively charged amino acid; and (2) an amino acid wherein one of the amino acids is a negatively charged amino acid and the other amino acid is also a negatively charged amino acid.
- amino acid modifications include modification of uncharged or nonpolar amino acids to positively charged amino acids, modification of uncharged or nonpolar amino acids to negatively charged amino acids, modification of positively charged amino acids to negatively charged amino acids, and modification of positively charged amino acids to negatively charged amino acids. Modifications of charged amino acids to positively charged amino acids are included. Furthermore, modification of uncharged or non-polar amino acids to different uncharged or non-polar amino acids, modification of positively charged amino acids to different positively charged amino acids, and modification of negatively charged amino acids to different negatively charged amino acids are also contemplated by the present invention. included in the amino acid modifications of
- Altering amino acids in the present invention includes making one alteration in each of the heavy and light chains, or multiple alterations in each of the heavy and light chains. Additionally, the number of modifications made to the heavy and light chains can be the same or different.
- Altering amino acids in the present invention refers to making multiple modifications to positively charged amino acids on either the heavy or light chain and making multiple modifications to negatively charged amino acids on the other chain. include. Furthermore, multiple modifications to positively charged amino acids and multiple modifications to negatively charged amino acids may be made on the same heavy or light chain. In these modifications, modifications to uncharged amino acids or non-polar amino acids and modifications of uncharged amino acids or non-polar amino acids may also be suitably combined.
- an amino acid on one of the chains can be used unmodified, in which case both the heavy and light chains need not be modified. only one of the strands may be modified.
- the light chain constant region of the antigen-binding molecule of the present invention is preferably a human light chain constant region.
- antibody light chain constant regions include IgK ( ⁇ ), IgL1, IgL2, IgL3, IgL6, and IgL7 ( ⁇ ) type constant regions.
- the light chain constant region of the antigen-binding molecule of the present invention is not particularly limited; when multiple types of light chains are used, the light chains may be different types of light chains, eg, ⁇ and ⁇ .
- Several allotypic sequences obtained by genetic polymorphism are described in Sequences of Proteins of Immunological Interest, NIH Publication No. 91-3242 as human IgK ( ⁇ ) constant region and human IgL7 ( ⁇ ) constant region, and these may be used in the present invention.
- Antibody constant regions may be modified as necessary to improve the function or stability of the antigen-binding molecule.
- modifications to improve the function of the antigen-binding molecule include modifications that strengthen or weaken the binding between the antigen-binding molecule and Fc ⁇ receptors (“Fc ⁇ R”), modifications between the antigen-binding molecule and FcRn modifications that strengthen or weaken the binding of antigen-binding molecules, modifications that strengthen or weaken the cytotoxic activity (eg, ADCC activity and CDC activity) of the antigen-binding molecule, and the like.
- modifications that improve the heterogeneity of the antigen binding molecule and modifications that improve non-immunogenicity and/or pharmacokinetics can also be included.
- the heterogeneity of the heavy chain C-terminal sequence of IgG antibodies includes the amide of the C-terminal carboxyl group due to deletion of the C-terminal amino acid lysine residue or due to deletion of the two C-terminal amino acids glycine and lysine. have been reported (Anal. Biochem. 2007 Jan 1:360(1):75-83). Therefore, in the present invention, it is preferable to use IgG lacking C-terminal lysine or C-terminal lysine and glycine in order to reduce the heterogeneity of the heavy chain C-terminus. Chimeric and humanized antibodies that use human-derived sequences are expected to be useful when administered to humans, such as for therapeutic purposes, due to their reduced antigenicity in the human body.
- a preferred example of the antigen-binding molecule of the present invention is a heteromeric multimer having two or more types of CH1 and two or more types of CL.
- This heteromeric multimer preferably binds to more than one type of epitope, an example of which is a multispecific antibody.
- a preferred example of the multispecific antibody of the present invention is a bispecific antibody. Accordingly, examples of preferred embodiments of antigen-binding molecules of the present invention include two types of heavy chains (first heavy chain and second heavy chain) and two types of light chains (first light chain and second light chain). It is a bispecific antibody that is composed of three chains.
- first heavy chain is "Second H chain” refers to the other H chain different from the first H chain. That is, of the two H chains, one of them can be arbitrarily defined as the first H chain and the other can be defined as the second H chain.
- first light chain refers to one of the two light chains (L chains) that form the bispecific antibody
- second L chain refers to the first It refers to the other L chain that is different from the L chain.
- L chains two light chains
- the first light chain and first heavy chain are derived from the same antibody that binds to a specific antigen (or epitope), and the second light chain and second heavy chain are also derived from the specific antigen (or epitope). or epitope).
- the L chain-H chain pair formed by the first H chain and the L chain is referred to as the first pair
- the L chain-H chain pair formed by the second H chain and the L chain is referred to as the first pair
- the heavy chain pair is called the second pair.
- the antigen (or epitope) used to generate the antibodies from which the second pair is derived is preferably different from the antigen used to generate the antibodies from which the first pair is derived.
- the antigens recognized by the first pair and the second pair may be the same, but preferably the pairs bind different antigens (or epitopes).
- the first pair and the second pair of H and L chains preferably have amino acid sequences that differ from each other. If the first and second pairs bind to different epitopes, the first and second pairs may recognize completely different antigens or may recognize different sites on the same antigen (different epitopes). ) may be recognized.
- one of them may recognize antigens such as proteins, peptides, genes or sugars and the other may recognize cytotoxic substances such as radioactive substances, chemotherapeutic agents or cell-derived toxins. good.
- those specific H and L chains are the first pair and the second pair. may be arbitrarily determined.
- IgG type bispecific antibody having two types of heavy chain constant regions CH1 (CH1-A and CH1-B) and two types of light chain constant regions (CL-A and CL-B) is provided below; however, the invention may be applied to other antibodies as well.
- a bispecific antibody that will recognize one epitope through a first CH1-A and a first CL-A and bind another epitope through a second CH1-B and a second CL-B In theory, expressing each of the 4 types of chains to produce that antibody could produce 10 types of antibody molecules, if desired.
- the desired antibody molecule is preferentially can be obtained at
- Examples include modifying the amino acid residues that form the interface between CH1-A and CL-B to be positively charged amino acid residues, and the interface between CH1-B and CL-A. is to modify the amino acid residue forming the to be a negatively charged amino acid residue.
- unintended association between CH1-A and CL-B is inhibited because the amino acid residues forming the interface are both positively charged
- CH1-B and Association with CL-A is also inhibited because the amino acid residues forming the interface are both negatively charged.
- unintended associations between CH1-A and CL-B and associations between CH1-B and CL-A are inhibited because the amino acid residues forming the interface have the same charge as each other. be done.
- Another example is the It is to modify the amino acid residues forming the interface to positively charged amino acid residues. As a result of this modification, unintended association between CH1-A and CL-B is inhibited because the amino acid residues forming the interface are both positively charged.
- the amino acid residues forming the interface are amino acids that are not electrically repulsive to each other, the intended association between CH1-A and CL-A and the The intended association is believed to occur more readily than if the amino acids were electrically repulsive. As a result, antibodies with the intended association between CH1-A and CL-A and the intended association between CH1-B and CL-B can be efficiently obtained.
- amino acid residues forming the interface between CL-A and CH1-B are not mutually uncharged or non-polar amino acids, then they are mutually uncharged or non-polar. It may be modified to be a polar amino acid.
- amino acid residues forming the interface between CL-B and CH1-B are uncharged or non-polar amino acids in CH1-B
- CH1-A and CL one of the amino acid residues forming the interface between -A is modified to be a positively charged amino acid residue, while the other is modified to be a negatively charged amino acid residue
- CL-B in CL-B and The amino acid residues that form the interface between CH1-B are modified to have the same charge as the modifications made to CH1-A.
- amino acid residues forming the interface between CL-B and CH1-B are not uncharged amino acids or non-polar amino acids in CH1-B, they are uncharged amino acids Or it may be modified to be a non-polar amino acid.
- association modulation of the present invention makes it possible to suppress association between CH1 (CH1-A and CH1-B) or between CL (CL-A and CL-B). .
- a person skilled in the art will be able to suitably determine the types of amino acid residues approaching into association at the interface between CH1 and CL in a desired polypeptide for which modulation of association according to the present invention is desired.
- CH1 or CL amino acid sequence information can be obtained by means described in the Examples below.
- amino acid residues that approach (face or contact) at the CH1 and CL interface upon association include the combinations shown below.
- EU numbering The numbers described by EU numbering in the present invention are shown according to EU numbering (Sequences of proteins of immunological interest, NIH Publication No. 91-3242).
- the phrases “amino acid residue at position X according to EU numbering” and “amino acid at position X according to EU numbering” also refer to "the amino acid residue corresponding to position X according to EU numbering ” and “the amino acid corresponding to position X according to EU numbering”.
- desired antigen-binding molecules can be preferentially obtained by altering these amino acid residues and practicing the methods of the invention.
- the present invention provides an antigen-binding molecule in which the association between a heavy chain and a light chain is regulated, wherein the heavy chain and light chain of the antigen-binding molecule have One or two or more sets of amino acid residues selected from the group consisting of the set of amino acid residues described herein are amino acid residues that electrically repel each other, providing an antigen-binding molecule: (a) the amino acid residue contained in CH1 at position 175 according to EU numbering and the amino acid residue contained in CL at position 160 according to Kabat numbering; (b) the amino acid residue contained in CH1 at position 175 according to EU numbering and the amino acid residue contained in CL at position 131 according to Kabat numbering; (c) amino acid residues contained in CH1 at positions 147 and 175 according to EU numbering and amino acid residues contained in CL at positions 131 and 160 according to Kabat numbering; and (d) 175 according to EU numbering. Amino acid residues contained in CH1 at positions 1 and amino acid residues contained
- amino acid residues that are electrically repulsive to each other or “amino acid residues that have the same charge” are preferably, for example, one of the following (X) or (Y) sets: selected from the amino acid residues contained in: (X) glutamic acid (E) or aspartic acid (D); or (Y) lysine (K), arginine (R), or histidine (H).
- amino acid residue sets that electrically repel each other in the antigen-binding molecules described above include the following amino acid residue sets: (a) the amino acid residue contained in CH1, at position 175 according to EU numbering, and the amino acid residue contained in CL, at position 160 according to EU numbering; (b) the amino acid residue contained in CH1 at position 175 according to EU numbering and the amino acid residue contained in CL at position 131 according to Kabat numbering; (c) amino acid residues contained in CH1 at positions 147 and 175 according to EU numbering and amino acid residues contained in CL at positions 131 and 160 according to Kabat numbering; (d) The amino acid residue contained in CH1 at position 175 according to EU numbering and the amino acid residue contained in CL at positions 131 and 160 according to Kabat numbering.
- two, three, or all sets of amino acid residues are amino acid residues that electrostatically repel each other: (a) the amino acid residue in the heavy chain constant region (CH1), which is position 175 according to EU numbering, and the amino acid residue in the light chain constant region (CL), which is position 131 according to Kabat numbering; (b) the amino acid residue in CH1, which is position 175 according to EU numbering, and the amino acid residue in CL, which is position 160 according to Kabat numbering; (c) the amino acid residue in CH1, position 175 according to EU numbering, and the amino acid residue in CL, positions 131 and 160 according to Kabat numbering; (d) Amino acid residues in CH1 at positions 147 and 175 according to EU numbering and amino acid residues in CL at positions 131 and 160 according to Kabat numbering; (d) Amino acid residues in CH1 at positions 147 and 175 according to EU numbering and amino acid residues in CL at positions 131 and 160 according to Kabat numbering;
- the present invention provides one or two or more amino acid residue sets selected from the group consisting of the following amino acid residue sets (a1) to (c2) in heavy and light chains of antigen-binding molecules: are amino acid residues that are electrically repulsive to each other, providing an antigen-binding molecule: (a1) an amino acid residue contained in CH1 at position 175 according to EU numbering which is glutamic acid (E) or aspartic acid (D) and 160 according to EU numbering which is glutamic acid (E) or aspartic acid (D); amino acid residues contained in CL at positions; (a2) an amino acid residue contained in CH1 at position 175 according to EU numbering, which is lysine (K), histidine (H), or arginine (R), and lysine (K), histidine (H), or arginine; the amino acid residue contained in CL at position 160 according to EU numbering, which is (R); (b1) an amino acid residue contained in CH1 at position 175 according to EU numbering which is glutamic
- amino acid residues contained in CL at positions 131 and 160 according to EU numbering amino acid residues contained in CL at positions 131 and 160 according to EU numbering; (c2) amino acid residues contained in CH1 at positions 147 and 175 according to EU numbering, which are lysine (K), histidine (H), or arginine (R), respectively, and lysine (K), histidine (R), respectively; H), or amino acid residues contained in CL at positions 131 and 160 according to EU numbering, which are arginine (R).
- amino acid residues that electrically repel each other in the aforementioned antigen-binding molecules include the following amino acid residues: (a1) an amino acid residue contained in CH1 at position 175 according to EU numbering which is glutamic acid (E) or aspartic acid (D) and 160 according to EU numbering which is glutamic acid (E) or aspartic acid (D); amino acid residues contained in CL at positions; (a2) an amino acid residue contained in CH1 at position 175 according to EU numbering, which is lysine (K), histidine (H), or arginine (R), and lysine (K), histidine (H), or arginine; the amino acid residue contained in CL at position 160 according to EU numbering, which is (R); (b1) an amino acid residue contained in CH1 at position 175 according to EU numbering which is glutamic acid (E) or aspartic acid (D) and 131 according to EU numbering which is glutamic acid (E) or aspartic acid (D); amino acid residues contained
- amino acid residues contained in CL at positions 131 and 160 according to EU numbering amino acid residues contained in CL at positions 131 and 160 according to EU numbering; (c2) amino acid residues contained in CH1 at positions 147 and 175 according to EU numbering, which are lysine (K), histidine (H), or arginine (R), respectively, and lysine (K), histidine (R), respectively; H), or amino acid residues contained in CL at positions 131 and 160 according to EU numbering, which are arginine (R); (d1) an amino acid residue contained in CH1, at position 175 according to EU numbering, which is glutamic acid (E) or aspartic acid (D), and glutamic acid (E) or aspartic acid (D), respectively, according to EU numbering.
- CL-containing amino acid residues at positions 131 and 160 an amino acid residue contained in CH1, at position 175 according to EU numbering, which is lysine (K), histidine (H), or arginine (R), and respectively lysine (K), histidine (H), or Amino acid residues contained in CL at positions 131 and 160 according to EU numbering, which are arginine (R).
- a technique for inhibiting undesired associated CH1/CL by introducing charge repulsion on the interface between CH1 and CL can be used as an antigen binding agent of the present invention. It can be further applied to molecules.
- the present invention provides antigen-binding molecules having CH1 and CL, wherein one or two selected from the group consisting of the amino acid residue sets shown in (a) to (d) below or sets of amino acid residues that electrically repel each other to provide an antigen binding molecule: (a) the amino acid residue contained in the heavy chain constant region (CH1) at position 147 according to EU numbering and the amino acid residue contained in the light chain constant region (CL) at position 160 according to EU numbering; (b) the amino acid residue contained in CH1 at position 147 according to EU numbering and the amino acid residue contained in CL at position 131 according to EU numbering; (c) the amino acid residue contained in CH1 at position 175 according to EU numbering and the amino acid residue contained in CL at position 160 according to EU numbering; (d) The amino acid residue contained in CH1 at position 213 according to EU numbering and the amino acid residue contained in CL at position 123 according to EU numbering.
- CH1 heavy chain constant region
- CL light chain constant region
- Examples of amino acid residues that contact at the interface of other constant regions of the heavy chain in the approach of inhibiting unintended association between heavy chains by introducing electrical repulsion at the CH2 or CH3 interface include CH3 Positions 356 (EU numbering) and 439 (EU numbering), 357 (EU numbering) and 370 (EU numbering), and 399 (EU numbering) and 409 (EU numbering) in the region are included.
- EU numbering see Kabat et al. (Kabat, E.A., et al., 1991, Sequences of Proteins of Immunological Interest, NIH); for heavy chain constant region numbering , EU numbering is indicated.
- one in the first heavy chain CH3 region selected from the following amino acid residue sets (1) to (3) A set of three to three amino acid residues may be made to electrically repel each other: (1) amino acid residues contained in the heavy chain CH3 region at positions 356 and 439 according to EU numbering; (2) amino acid residues contained in the heavy chain CH3 region at positions 357 and 370 according to EU numbering; and (3) amino acid residues contained in the heavy chain CH3 region at positions 399 and 409 according to EU numbering. .
- the antibody can be an antibody having a set of amino acid residues in the second heavy chain CH3 region that is distinct from the first heavy chain CH3 region described above, wherein the set of amino acid residues is the set of amino acid residues described above ( Amino acid residue sets shown in (1) to (3) above, which are selected from the amino acid residue sets shown in 1) to (3) and electrically repel each other in the first heavy chain CH3 region The set of 1 to 3 amino acid residues corresponding to are not electrically repelled from the corresponding amino acid residues in the first heavy chain CH3 region.
- amino acid residues described in (1) to (3) above approach each other when associated.
- One skilled in the art can correspond to the amino acid residues described in (1)-(3) above for the desired heavy chain CH3 region or heavy chain constant region, such as by homology modeling using commercially available software. One would be able to find sites and modify the amino acid residues at those sites appropriately.
- electrically repulsive means, for example, any two or more amino acid residues herein It means having amino acid residues contained in any one group of (X) and (Y) mentioned.
- the first heavy chain CH3 region and the second heavy chain CH3 region may be crosslinked by a disulfide bond.
- the amino acid residues to be "altered” are not limited to the amino acid residues of the antigen-binding molecule variable region or antibody constant region described above.
- One skilled in the art will find amino acid residues that form an interface in a polypeptide variant or heteromeric multimer, such as by homology modeling using commercially available software, and determine amino acid residues at those sites to regulate association. could be modified.
- Homology modeling is a technique for predicting the three-dimensional structure of proteins using commercially available software. When constructing the structure of a protein with an unknown three-dimensional structure, one first searches for proteins that have been determined to have a three-dimensional structure with high homology to the protein. Next, using this three-dimensional structure as a template, the structure of a protein having an unknown structure is constructed, and the structure is further optimized by a molecular dynamics method or the like to predict the three-dimensional structure of the unknown protein.
- Heavy chain variable regions and Examples of amino acid residues that make contact at the interface with the light chain variable region (VL) include glutamine (Q) at position 39 according to Kabat numbering in VH (FR2 region), and facing (contacting) VL (FR2 region). Glutamine (Q) at position 38 is included according to Kabat numbering in the region). Further preferred examples are leucine (L) at position 45 according to Kabat numbering in VH (FR2) and proline (P) at position 44 according to Kabat numbering in the facing VL (FR2).
- a publication by Kabat et al. Kabat et al. (Kabat, E.A., et al., 1991, Sequences of Proteins of Immunological Interest, NIH) was referenced for the numbering of these sites.
- the multispecific antigen-binding molecule further comprises two or more amino acid residues forming an interface between the heavy and light chain variable regions that are electrostatically repelling each other. is a residue.
- a specific example is an antigen-binding molecule in which two or more amino acid residues forming the interface between VH and VL are amino acid residues that are electrically repulsive to each other. More specifically, examples include antigen binding having one amino acid residue set or two amino acid residue sets selected from the group consisting of the amino acid residue sets shown in (a) or (b) below Molecules included: (a) the amino acid residue contained in VH at position 39 according to Kabat numbering and the amino acid residue contained in VL at position 38 according to Kabat numbering; or (b) the amino acid residue contained in VH at position 45 according to Kabat numbering. and the amino acid residue contained in VL at position 44 according to Kabat numbering.
- the amino acid residues that electrostatically repel each other in the multispecific antigen-binding molecule are one or two selected from the group consisting of the following amino acid residue sets (a) and (b): is a set of amino acid residues: (a) the amino acid residue in the heavy chain variable region which is position 39 according to Kabat numbering and the amino acid residue in the light chain variable region which is position 38 according to Kabat numbering; (b) The amino acid residue in the heavy chain variable region which is position 45 according to Kabat numbering and the amino acid residue in the light chain variable region which is position 44 according to Kabat numbering.
- amino acid residues described in (a) or (b) above approaches each other when associated.
- Those skilled in the art can find sites corresponding to the amino acid residues described in (a) or (b) above in the desired VH or VL by homology modeling or the like using commercially available software, and Amino acid residues of will be able to be suitably modified.
- amino acid residues that electrostatically repel each other in the multispecific antigen-binding molecule are selected from amino acid residues included in either set (X) or (Y) below: (X) glutamic acid (E), aspartic acid (D), (Y) Lysine (K), Arginine (R), Histidine (H).
- amino acid residues capable of forming a hydrophobic core at the interface between VH and VL include leucine (L) at position 45 according to Kabat numbering in VH (FR2), and the facing VL ( A proline (P) at position 44 is included according to Kabat numbering in FR2).
- L leucine
- P proline
- Kabat et al. Kabat et al. (Kabat, E.A., et al., 1991, Sequences of Proteins of Immunological Interest, NIH) was used as a reference for the numbering of these sites.
- hydrophobic core refers to the portion formed by the assembly of hydrophobic amino acid side chains inside the associated polypeptide.
- hydrophobic amino acids include alanine, isoleucine, leucine, methionine, phenylalanine, proline, tryptophan, and valine.
- amino acid residues other than hydrophobic amino acids eg, tyrosine
- This hydrophobic core, together with the hydrophilic surface on which the hydrophilic amino acid side chains are externally exposed, is the driving force for promoting association of water-soluble polypeptides.
- hydrophobic amino acids If two different domains of hydrophobic amino acids are present on the surface of the molecule and exposed to water molecules, the entropy will increase and the free energy will increase. Thus, the two domains associate with each other to reduce their free energy and become stable, and the interfacial hydrophobic amino acids become buried in the interior of the molecule to form a hydrophobic core.
- the antigen-binding molecule of the present invention is an antigen-binding molecule characterized in that an amino acid residue capable of forming a hydrophobic core at the interface is modified to become a charged amino acid residue.
- examples include antigen-binding molecules in which the amino acid residue shown in either (1) or (2) below is a charged amino acid residue.
- the side chains of the amino acid residues shown in (1) and (2) below can be adjacent to each other and form a hydrophobic core: (1) VH-containing amino acid residue at position 45 according to Kabat numbering; and (2) VL-containing amino acid residue at position 44 according to Kabat numbering.
- Preferred examples of charged amino acid residues in the antigen-binding molecules described above include glutamic acid (E), aspartic acid (D), lysine (K), arginine (R), and histidine (H). More preferred examples include glutamic acid (E) and lysine (K).
- amino acid residues described in (1) and (2) above in humans and mice are respectively: (1) leucine (L), and (2) proline (P). Therefore, in preferred embodiments of the invention, these amino acid residues are subject to modification (eg, substitution with charged amino acids). Furthermore, the types of the aforementioned amino acid residues of (1) and (2) are not necessarily limited to the aforementioned amino acid residues, but may be other amino acid equivalents of these amino acid residues.
- variable Amino acid side chains present in the region can be replaced with larger side chains (knobs), and amino acid side chains present in the opposite variable region of the other heavy chain can be replaced with smaller side chains (holes). (hole)), which may place the knob in the hole, promoting association of VH1 with VL1 and/or VH2 with VL2; and consequently VH1 with VL2 and /or association between VH2 and VL1 can be further inhibited.
- modifications of Y349C and T366W are made to make the amino acid side chains in the CH3 region of one H chain larger side chains (knobs), and in the CH3 region of the other H chain Modifications of D356C, T336S, L368A, and Y407V are made to make the amino acid side chains of the smaller ones.
- the Fc domain in the multispecific antigen binding molecule, is composed of a first Fc region subunit and a second Fc region subunit that are capable of stable association.
- the Fc domain comprises (e1) or (e2): (e1) a first Fc region subunit comprising Cys at position 349, Ser at position 366, Ala at position 368, and Val at position 407, and a second Fc region comprising Cys at position 354 and Trp at position 366 ; (e2) The first Fc region subunit containing Glu at position 439 and the second Fc region containing Lys at position 356 (amino acid positions are numbered according to EU numbering).
- the knob-into-hole technique has been described, for example, in US 5731168; US 7695936; Ridgway et al., Prot Eng 9, 617-621 (1996) and Carter, J Immunol Meth 248, 7- 15 (2001).
- the method creates a protrusion (“knob”) at the interface of the first polypeptide, and a corresponding cavity (“hole”) at the interface of the second polypeptide, forming a heterodimer. and to prevent the formation of homodimers, the protrusions can be introduced into the cavities.
- Protrusions are constructed by replacing small amino acid side chains from the interface of the first polypeptide with larger side chains (eg, tyrosine or tryptophan).
- a compensatory cavity of identical or similar size to the protrusion is created at the interface of the second polypeptide by replacing large amino acid side chains with smaller ones (eg, alanine or threonine).
- antigen-binding molecules of the present invention can be efficiently prepared by complementary association of CH3 with the strand-exchange engineering domain CH3, which introduces (Protein Engineering Design & Selection, 23: 195-202, 2010).
- bispecific antibody for example, different isoelectric points are imparted by making different amino acid modifications to each of the variable regions of the two types of H chains, and for purification by ion exchange chromatography
- Targeted bispecific antibodies can be prepared by utilizing the difference in their isoelectric points (WO 2007/114325).
- the site associated with binding between IgG and protein A, to an amino acid with different binding strength to protein A, such as Arg, is also It may be used for the antigen-binding molecules of the present invention in combination with the techniques described above.
- the interaction between the H chain and protein A can be altered and only heterodimeric antigen-binding molecules can be efficiently purified using a protein A column.
- This technique can also be used independently without combination with the techniques described above.
- Modifications of the invention may be used to promote association of, for example, a first VH (VH1) with a first VL (VL1) and/or a second VH (VH2) with a second VL (VL2)
- VH1 is linked to an Fc region through a first CH1
- VL1 is linked to a first CL
- VH2 is linked to another Fc region through a second CL
- VL2 is linked to a second
- It can be used for antigen-binding molecules such as antigen-binding molecules having structures linked to CH1 (WO 09/80254).
- antigen-binding molecules of the present invention may be prepared based on antibodies that have undergone modifications of the aforementioned known techniques.
- a preferred embodiment of the production method of the present invention is a method for producing an antigen-binding molecule with modulated association between heavy and light chains comprising the steps of: (1) One amino acid residue set or two or more amino acid residue sets selected from the group consisting of the amino acid residue sets shown in (a) to (c) below are amino acids that electrostatically repel each other Modifying the nucleic acids encoding CH1 and CL so that they are residues: (a) the amino acid residue in the heavy chain constant region (CH1), which is position 175 according to EU numbering, and the amino acid residue in the light chain constant region (CL), which is position 131 according to Kabat numbering; (b) the amino acid residue in CH1, which is position 175 according to EU numbering, and the amino acid residue in CL, which is position 160 according to Kabat numbering; (c) the amino acid residue in CH1, position 175 according to EU numbering, and the amino acid residue in CL
- the amino acid residues electrically repelling each other are amino acid residues contained in any of the groups (X) and (Y) described above. It relates to methods of production, including modifying the nucleic acids, as selected.
- the present invention modifies the nucleic acid such that two or more amino acid residues forming the interface between VH and VL are amino acid residues that electrically repel each other.
- the amino acid residues that electrically repel each other are, for example, any amino acid residue set selected from the group consisting of the amino acid residue sets shown in (a) and (b) below: (a) the amino acid residue contained in VH at position 39 according to Kabat numbering and the amino acid residue contained in VL at position 38 according to Kabat numbering; or (b) the amino acid residue contained in VH at position 45 according to Kabat numbering. and the amino acid residue contained in VL at position 44 according to Kabat numbering.
- the aforementioned amino acid residues that electrically repel each other are preferably selected from amino acid residues contained in any of the aforementioned sets of (X) and (Y).
- a preferred embodiment of the method for regulating association of the present invention is one amino acid residue set or two or more amino acid residue sets selected from the group consisting of the amino acid residue sets shown in (a) to (c) below
- a method for modulating the association of heavy and light chains of an antigen-binding molecule comprising the step of modifying a nucleic acid such that the set of residues are amino acid residues that electrostatically repel each other: (a) the amino acid residue in the heavy chain constant region (CH1), which is position 175 according to EU numbering, and the amino acid residue in the light chain constant region (CL), which is position 131 according to EU numbering; (b) the amino acid residue in CH1, which is position 175 according to EU numbering, and the amino acid residue in CL, which is position 160 according to EU numbering; (c) the amino acid residue in CH1, which is position 175 according to EU numbering, and the amino acid residue in CL, which is positions
- the present invention provides that in the above step (1), the amino acid residues that electrostatically repel each other are selected from amino acid residues contained in either the above group of (X) or (Y). As such, it relates to methods for modulating association, including modifying nucleic acids.
- the nucleic acid is modified such that the two or more amino acid residues forming the VH-VL interface are amino acid residues that electrostatically repel each other.
- the amino acid residues that electrostatically repel each other are preferably, for example, any one amino acid residue set selected from the group consisting of the amino acid residue sets shown in (a) and (b) below is: (a) the amino acid residue in VH, which is position 39 according to Kabat numbering, and the amino acid residue in VL, which is position 38 according to Kabat numbering; (b) The amino acid residue in VH, position 45 according to Kabat numbering, and the amino acid residue in VL, position 44 according to Kabat numbering.
- the desired bispecific antibodies can be preferentially and efficiently obtained as previously described.
- the desired heteromeric multimers in the form of bispecific antibodies can be efficiently formed from a mixture of monomers.
- modify a nucleic acid in the above-described method of the present invention refers to modifying nucleic acids so that they correspond to the amino acid residues guided by the "modification" of the present invention. More specifically, this refers to modifying a nucleic acid encoding the original (before modification) amino acid residue into a nucleic acid encoding the amino acid residue to be modified. Generally, this is a genetic manipulation or mutation that will result in at least one nucleotide insertion, deletion, or substitution in the original nucleic acid such that a codon encoding the desired amino acid residue is formed. means to process. More specifically, codons encoding the original amino acid residue are replaced with codons encoding the amino acid residue to be modified.
- nucleic acid modification can be suitably performed by those skilled in the art using known techniques such as site-directed mutagenesis and PCR mutagenesis.
- the invention provides nucleic acids encoding the antigen-binding molecules of the invention. Additionally, vectors carrying nucleic acids are also included in the present invention.
- the Fc domain of the multispecific antigen-binding molecule consists of a pair of polypeptide chains comprising the heavy chain domain of an immunoglobulin molecule.
- the Fc domain of immunoglobulin G (IgG) molecules is a dimer, each subunit of which contains CH2 and CH3 IgG heavy chain constant domains. The two subunits of the Fc domain are capable of stable association with each other.
- the multispecific antigen binding molecules described herein comprise no more than one Fc domain.
- the Fc domain of the multispecific antigen-binding molecule is an IgG Fc domain.
- the Fc domain is an IgG1 Fc domain.
- the Fc domain is an IgG1 Fc domain.
- the Fc domain is a human IgG1 Fc region.
- the present disclosure provides multispecific antigen binding molecules further comprising an Fc domain that exhibits reduced binding affinity for human Fc ⁇ receptors compared to native human IgG1 Fc domains, said The Fc domain further exhibits stronger FcRn binding affinity for human FcRn compared to the native human IgG1 Fc domain.
- the present disclosure provides multispecific antigen binding molecules further comprising an Fc domain that exhibits reduced binding affinity for human Fc ⁇ receptors compared to native human IgG1 Fc domains, said The first and/or Fc region subunit comprised in the Fc domain comprises Leu at position 428, Ala at position 434, Arg at position 438, and Glu at position 440, with amino acid positions numbered according to EU numbering. ing.
- the Fc domain further exhibits stronger FcRn binding affinity for human FcRn compared to native human IgG1 Fc domain.
- the first and/or Fc region subunit comprises Leu at position 428, Ala at position 434, Arg at position 438, and Glu at position 440, and amino acid Positions are numbered according to EU numbering.
- IgG-type bispecific antibodies are secreted by introducing into cells the L-chain and H-chain genes that constitute the two types of IgG of interest, that is, four genes in total, and by co-expressing them. be done.
- the number of combinations of IgG H and L chains that can be produced by these methods is theoretically 10 combinations. Therefore, it is difficult to purify an IgG containing a desired combination of H and L chains from 10 types of IgG.
- the secretion of IgG with the desired combination would be significantly reduced, thus requiring large-scale culture, further increasing production costs.
- multispecific antigen-binding molecules of the present invention a technique for suppressing undesired H-chain association by introducing electrostatic repulsion at the interface of the second or third constant region (CH2 or CH3) of antibody H-chains is called multispecificity. It can be applied to antibody association (WO2006/106905).
- amino acid residues to be modified are not limited to the above amino acid residues of antibody variable regions or antibody constant regions.
- One skilled in the art can identify the amino acid residues that form the interface in the mutant polypeptide or heteromultimer, such as by homology modeling using commercially available software; can be subject to modification to modulate association.
- the multispecific antibody of the present invention can be obtained by separating and purifying the multispecific antibody of interest from the produced antibody. be able to.
- the introduction of amino acid substitutions in the variable regions of the two types of heavy chains to impart a difference in isoelectric point allows the purification of the two types of homomeric forms and the heteromeric antibody of interest by ion-exchange chromatography. A method for this has been reported (WO2007114325).
- protein A has been used as a method for purifying heteromeric antibodies to purify heterodimeric antibodies containing mouse IgG2a heavy chains that bind to protein A and rat IgG2b heavy chains that do not bind to protein A.
- the heterodimeric antibody is an H chain containing substitutions of the IgG-Protein A binding site, amino acid residues at EU numbering positions 435 and 436, with amino acids that give rise to different Protein A affinities, Tyr, His, etc. or using H chains with different Protein A affinities obtained according to the method of Reference Example 5 to alter the interaction of each of the H chains with Protein A, and then using a Protein A column can be efficiently purified by itself by using
- an Fc region with improved C-terminal heterogeneity can be appropriately used as the Fc region of the present invention. More specifically, the present invention uses glycine at position 446 and lysine at position 447, designated by EU numbering, in the amino acid sequences of two polypeptides that make up the Fc region derived from IgG1, IgG2, IgG3, or IgG4. provides an Fc region produced by deleting from
- a plurality of, for example, two or more of these techniques can be used in combination. Moreover, these techniques can be applied appropriately and separately to the two heavy chains to be associated. Additionally, these techniques can be used in combination with the Fc regions described above that have reduced binding activity for Fc ⁇ receptors. Furthermore, the antigen-binding molecules of the present invention may be molecules separately produced to have the same amino acid sequence based on the antigen-binding molecules that have been subjected to the modification described above.
- the multispecific antigen binding molecule comprises one or more of the following amino acid residues (i)-(xii): (i) glutamic acid or lysine at position 175 (EU numbering) in the heavy chain constant region; (ii) glutamic acid at position 147 (EU numbering) in the heavy chain constant region; (iii) a glutamic acid or lysine at position 131 (Kabat numbering) in the light chain constant region; (iv) glutamic acid or lysine at position 160 (Kabat numbering) in the light chain constant region; (v) an arginine at position 235 (EU numbering) in the heavy chain constant region; (vi) an arginine at position 236 (EU numbering) in the heavy chain constant region; (vii) a lysine at position 356 (EU numbering) in the heavy chain constant region; (viii) a leucine at position 428 (EU numbering) in the heavy chain constant region; (ix) an alan
- the multispecific antigen binding molecule further comprises glutamic acid at position 419 (EU numbering) and proline at position 445 (EU numbering), and amino acid deletions at positions 446 and 447 (EU numbering); further comprises a lysine at position 196 (EU numbering), a proline at position 445 (EU numbering) and amino acid deletions at positions 446 and 447 (EU numbering).
- the multispecific antigen binding molecule comprises: glycine at position 16 (Kabat numbering), alanine at position 32 (Kabat numbering), valine at position 35a (Kabat numbering), alanine at position 50 (Kabat numbering), alanine at position 61 (Kabat numbering).
- the first light chain comprises glutamic acid at position 28 (Kabat numbering), tyrosine at position 55 (Kabat numbering), glutamic acid or tyrosine at position 56 (Kabat numbering), glutamic acid at position 92 (Kabat numbering), and position 94 (Kabat numbering).
- the second heavy chain contains glutamic acid at position 28 (Kabat numbering), alanine or glutamic acid at position 30 (Kabat numbering), glutamic acid at position 31 (Kabat numbering), tryptophan at position 32 (Kabat numbering), and position 34 (Kabat numbering).
- Antibodies of the invention may be isolated by screening combinatorial libraries for antibodies with the desired activity or activities. For example, various methods are known in the art for generating phage display libraries and screening such libraries for antibodies with desired binding characteristics. Such methods are reviewed in Hoogenboom et al. in Methods in Molecular Biology 178:1-37 (O'Brien et al., ed., Human Press, Totowa, NJ, 2001) and also see, for example, McCafferty et al., Nature 348:552-554; Clackson et al., Nature 352: 624-628 (1991); Marks et al., J. Mol. Biol.
- repertoires of VH and VL genes are separately cloned by the polymerase chain reaction (PCR) and randomly recombined into a phage library, which is derived from Winter et al. ., Ann. Rev. Immunol., 12: 433-455 (1994).
- Phage typically display antibody fragments, either as single-chain Fv (scFv) fragments or as Fab fragments.
- Libraries from immunized sources provide high affinity antibodies to the immunogen without the need to construct hybridomas.
- a naive repertoire can be cloned (e.g., from humans) to provide a wide range of non-self and It can also provide a single source of antibodies to self antigens.
- naive library was cloned from stem cells with pre-rearranged V-gene segments and hypervariable CDR3 as described in Hoogenboom and Winter, J. Mol. Biol., 227: 381-388 (1992). It can also be made synthetically by using PCR primers that encode the region and contain randomized sequences to accomplish the rearrangement in vitro.
- Patent literature describing human antibody phage libraries includes, for example: U.S. Patent No. 5,750,373, and U.S. Patent Application Publication Nos. 2005/0079574, 2005/0119455, 2005/0266000, 2007/0117126, 2007 /0160598, 2007/0237764, 2007/0292936, and 2009/0002360.
- Antibodies or antibody fragments isolated from human antibody libraries are considered human antibodies or human antibody fragments herein.
- the antibodies provided herein have been modified to increase or decrease the degree to which the antibody is glycosylated.
- the addition or deletion of glycosylation sites to the antibody can be conveniently accomplished by altering the amino acid sequence to create or remove one or more glycosylation sites.
- the carbohydrate added to it may be modified.
- Native antibodies produced by mammalian cells typically contain branched, biantennary oligosaccharides, which are usually attached by N-linkage to Asn297 of the CH2 domain of the Fc region. See, for example, Wright et al. TIBTECH 15:26-32 (1997).
- Oligosaccharides include various carbohydrates such as mannose, N-acetylglucosamine (GlcNAc), galactose, and sialic acid, as well as fucose attached to the GlcNAc in the "stem" of the biantennary oligosaccharide structure.
- modifications of oligosaccharides in antibodies of the invention may be made to generate antibody variants with certain improved properties.
- antibody variants are provided that have carbohydrate structures that lack fucose attached (directly or indirectly) to the Fc region.
- the amount of fucose in such antibodies can be 1%-80%, 1%-65%, 5%-65% or 20%-40%.
- the amount of fucose is the sum of all sugar structures (e.g. complex, hybrid and high mannose structures) attached to Asn297 measured by MALDI-TOF mass spectrometry as described in e.g. WO2008/077546. is determined by calculating the average amount of fucose within the sugar chain at Asn297 relative to Asn297 represents the asparagine residue located around position 297 of the Fc region (EU numbering of Fc region residues).
- Asn297 could be located ⁇ 3 amino acids upstream or downstream of position 297, ie somewhere between positions 294-300.
- Such fucosylation variants may have improved ADCC function. See, for example, U.S. Patent Application Publication Nos. 2003/0157108 (Presta, L.); 2004/0093621 (Kyowa Hakko Kogyo Co., Ltd).
- a cell line capable of producing defucosylated antibodies is Lec13 CHO cells, which lack protein fucosylation (Ripka et al. Arch. Biochem. Biophys. 249:533-545 (1986); US Patent Application Publication No. US2003/0157108 A1, Presta, L; and WO2004/056312 A1, Adams et al., especially Example 11) and knockout cell lines such as alpha-1,6-fucosyltransferase gene FUT8 knockout CHO cells (e.g. Yamane-Ohnuki). 87: 614 (2004); Kanda, Y. et al., Biotechnol. Bioeng., 94(4):680-688 (2006); and WO2003/085107). .
- Antibody variants with bisected oligosaccharides are further provided, for example, where a biantennary oligosaccharide attached to the Fc region of the antibody is bisected by GlcNAc. Such antibody variants may have reduced fucosylation and/or improved ADCC function. Examples of such antibody variants are described, for example, in WO2003/011878 (Jean-Mairet et al.); US Pat. No. 6,602,684 (Umana et al.); and US2005/0123546 (Umana et al.). there is Antibody variants with at least one galactose residue in the oligosaccharide attached to the Fc region are also provided. Such antibody variants may have improved CDC function. Such antibody variants are described, for example, in WO1997/30087 (Patel et al.); WO1998/58964 (Raju, S.); and WO1999/22764 (Raju, S.).
- the antibodies described above may have their first H chain CH3 region and second H chain CH3 region crosslinked by disulfide bonds.
- Multispecific antigen-binding molecules prepared as described herein can be analyzed using methods in the art such as high performance liquid chromatography, ion exchange chromatography, gel electrophoresis, affinity chromatography, size exclusion chromatography, and the like. You may refine
- matrices with protein A or protein G may be used for affinity chromatography purification of the multispecific antigen-binding molecules of the invention.
- Sequential protein A or G affinity chromatography and size exclusion chromatography can be used to isolate multispecific antigen binding molecules. Purity of multispecific antigen binding molecules can be determined by any of a variety of well-known analytical methods, including gel electrophoresis, high pressure liquid chromatography, and the like.
- cysteine-engineered antibodies eg, “thioMAbs”
- cysteine residues of the antibody are replaced with cysteine residues.
- the residues undergoing substitution occur at accessible sites of the antibody.
- reactive thiol groups are placed at accessible sites of the antibody, which reactive thiol groups connect the antibody to other moieties (drug moieties or linker-drug moieties). etc.) to create immunoconjugates as further detailed herein.
- any one or more of the following residues may be replaced with cysteine: V205 of the light chain (Kabat numbering); A118 of the heavy chain (EU numbering); and S400 of the heavy chain Fc region. (EU numbering).
- Cysteine engineered antibodies may be generated, for example, as described in US Pat. No. 7,521,541.
- the antibodies provided herein may be further modified to contain additional non-protein moieties that are known in the art and readily available. Suitable moieties for antibody derivatization include, but are not limited to, water-soluble polymers.
- Non-limiting examples of water-soluble polymers include, but are not limited to, polyethylene glycol (PEG), ethylene glycol/propylene glycol copolymers, carboxymethylcellulose, dextran, polyvinyl alcohol, polyvinylpyrrolidone, poly-1, 3-dioxolane, poly-1,3,6-trioxane, ethylene/maleic anhydride copolymer, polyamino acid (either homopolymer or random copolymer), and dextran or poly(n-vinylpyrrolidone) polyethylene glycol, polypropylene glycol Including homopolymers, polypropylene oxide/ethylene oxide copolymers, polyoxyethylated polyols (eg, glycerol), polyvinyl alcohol, and mixtures thereof.
- PEG polyethylene glycol
- ethylene glycol/propylene glycol copolymers carboxymethylcellulose
- dextran polyvinyl alcohol
- polyvinylpyrrolidone poly-1,
- Polyethylene glycol propionaldehyde may have manufacturing advantages due to its stability in water.
- the polymer can be of any molecular weight and can be branched or unbranched.
- the number of polymers attached to the antibody can vary, and if two or more polymers are attached they can be the same or different molecules. Generally, the number and/or types of polymers used for derivatization include, but are not limited to, the specific property or function of the antibody to be improved, the The decision can be made based on considerations such as whether to be used for therapy.
- conjugates of antibodies and non-protein moieties that can be selectively heated by exposure to radiation are provided.
- the non-protein portion is a carbon nanotube (Kam et al., Proc. Natl. Acad. Sci. USA 102: 11600-11605 (2005)).
- the radiation can be of any wavelength, including but not limited to, such that it heats the non-protein moiety to a temperature that kills cells in close proximity to the antibody-non-protein moiety while not harming normal cells. Including wavelength.
- an isolated nucleic acid that encodes an anti-HLA-DQ2.5 antigen binding molecule (antibody) as described herein.
- nucleic acids may encode VL-comprising amino acid sequences and/or VH-comprising amino acid sequences of an antibody (eg, antibody light and/or heavy chains).
- vectors eg, expression vectors
- host cells containing such nucleic acids are provided.
- the host cell comprises (1) a vector comprising a nucleic acid encoding an amino acid sequence comprising the VL of the antibody and an amino acid sequence comprising the VH of the antibody; or (2) an amino acid sequence comprising the VL of the antibody.
- a first vector containing nucleic acid encoding the sequence and a second vector containing nucleic acid encoding the amino acid sequence comprising the VH of the antibody are included (eg, transformed).
- the host cells are eukaryotic (eg, Chinese Hamster Ovary (CHO) cells) or lymphoid cells (eg, Y0, NS0, Sp2/0 cells).
- Methods of making anti-HLA-DQ2.5 antigen binding molecules (antibodies) are provided, including recovering from cell culture medium).
- nucleic acids encoding the antibodies are isolated and subjected to further cloning and/or expression in host cells. To do so, insert into one or more vectors.
- nucleic acids may be readily isolated and sequenced using conventional procedures (e.g., oligonucleotide probes capable of specifically binding to the genes encoding the heavy and light chains of the antibody). by using).
- Suitable host cells for cloning or expression of antibody-encoding vectors include prokaryotic or eukaryotic cells described herein.
- antibodies may be produced in bacteria, particularly if glycosylation and Fc effector functions are not required. See, eg, US Pat. Nos. 5,648,237, 5,789,199, and 5,840,523 regarding expression of antibody fragments and polypeptides in bacteria. (In addition, see Charlton, Methods in Molecular Biology, Vol. 248 (B.K.C. Lo, ed., Humana Press, Totowa, NJ, 2003), pp. 245-254 describing expression of antibody fragments in E. coli. ) After expression, the antibody may be isolated from the bacterial cell paste in the soluble fraction and may be further purified.
- fungi or yeast In addition to prokaryotes, fungi or yeast, including strains of fungi and yeast in which the glycosylation pathway has been "humanized", resulting in the production of antibodies with a partial or complete human glycosylation pattern.
- Nuclear microbes are preferred cloning or expression hosts for antibody-encoding vectors. See Gerngross, Nat. Biotech. 22:1409-1414 (2004) and Li et al., Nat. Biotech. 24:210-215 (2006).
- invertebrates and vertebrates are also suitable host cells for the expression of glycosylated antibodies.
- invertebrate cells include plant and insect cells.
- a number of baculovirus strains have been identified for use in conjugation with insect cells, particularly for transformation of Spodoptera frugiperda cells.
- Plant cell cultures can also be used as hosts. See, for example, US Pat. Nos. 5,959,177, 6,040,498, 6,420,548, 7,125,978, and 6,417,429 (describing PLANTIBODIESTM technology for producing antibodies in transgenic plants).
- Vertebrate cells can also be used as hosts.
- mammalian cell lines adapted to grow in suspension would be useful.
- Other examples of useful mammalian host cell lines are the SV40-transformed monkey kidney CV1 strain (COS-7); the human embryonic kidney strain (Graham et al., J. Gen Virol. 36:59 (1977 ) 293 or 293 cells described in Etc.); baby hamster kidney cells (BHK); mouse Sertoli cells (TM4 cells described in Mather, Biol. Reprod.
- monkey kidney cells (CV1 ); African green monkey kidney cells (VERO-76); human cervical carcinoma cells (HELA); canine kidney cells (MDCK); Buffalo rat hepatocytes (BRL 3A); Hep G2); mouse mammary carcinoma (MMT 060562); TRI cells (described, for example, in Mather et al., Annals N.Y. Acad. Sci. 383:44-68 (1982)); MRC5 cells;
- Other useful mammalian host cell lines are Chinese Hamster Ovary (CHO) cells, including DHFR-CHO cells (Urlaub et al., Proc. Natl. Acad. Sci.
- the anti-HLA-DQ2.5 antigen-binding molecules (antibodies) provided herein can be identified, screened, or tested for physical/chemical properties and/or by various assays known in the art. or characterized for biological activity.
- the antibodies of the invention are tested for their antigen binding activity by known methods, eg, ELISA, Western blot, and the like.
- competition assays are used to identify antibodies that compete with, for example, any of the antibodies described above for binding to HLA-DQ2.5 (or HLA-DQ2.5/gluten peptide complexes). obtain.
- such competing antibodies bind to the same epitopes (eg, linear or conformational epitopes) that the aforementioned antibodies bind.
- epitopes eg, linear or conformational epitopes
- mapping epitopes bound by antibodies are provided in Morris (1996) "Epitope Mapping Protocols," in Methods in Molecular Biology vol. 66 (Humana Press, Totowa, NJ).
- immobilized HLA-DQ2.5 interacts with HLA-DQ2.5 (or HLA-DQ2.5/gluten peptide complexes).
- a second antibody may be present in the hybridoma supernatant.
- HLA-DQ2.5 As a control, immobilized HLA-DQ2.5 (or HLA-DQ2.5/gluten peptide complex) in a solution containing the first labeled antibody but no second unlabeled antibody. Incubated. After incubation under conditions permissive for binding of the first antibody to HLA-DQ2.5 (or HLA-DQ2.5/gluten peptide complex), excess unbound antibody was removed and immobilized. The amount of label bound to HLA-DQ2.5 (or HLA-DQ2.5/gluten peptide complex) is measured.
- HLA-DQ2.5 or HLA-DQ2.5/gluten peptide complex
- HLA-DQ2.5/gluten peptide complex If the amount of label bound to immobilized HLA-DQ2.5 (or HLA-DQ2.5/gluten peptide complex) is substantially decreased in the test sample compared to the control sample, it competes with the first antibody for binding to HLA-DQ2.5 (or HLA-DQ2.5/gluten peptide complex). See Harlow and Lane (1988) Antibodies: A Laboratory Manual ch.14 (Cold Spring Harbor Laboratory, Cold Spring Harbor, NY).
- Animals such as rabbits, mice, rats, and other animals suitable for immunization, are immunized with an antigen (eg, HLA-DQ2.5 or HLA-DQ2.5/gluten peptide complex).
- the antigen can be prepared as a recombinant protein using any method, eg, as described herein.
- Antibody-containing samples such as blood and spleen are collected from immunized animals.
- biotinylated antigen is prepared, antigen-binding B cells are allowed to bind to the biotinylated antigen, and the cells are subjected to cell sorting and culture for sorting. Specific binding of the cell to the antigen can be assessed by any suitable method, such as an ELISA method.
- RNA is purified from the cells and DNA encoding regions of the antibody prepared by reverse transcription of the RNA and PCR amplification. Additionally, the cloned antibody genes can be expressed in appropriate cells and the antibody purified from the culture supernatant for further analysis.
- the anti-HLA-DQ2.5 antigen-binding molecule binds to the antigen of interest (e.g., complexes formed by HLA-DQ2.5 and gluten peptides such as those described herein)
- the antigen of interest e.g., complexes formed by HLA-DQ2.5 and gluten peptides such as those described herein
- Any method for assessing binding can be used to test .
- FACS-based cell sorting method cells expressing the antigen are incubated with a test antibody, followed by the addition of an appropriate secondary antibody directed against the test antibody (ie, primary antibody) and incubation. Binding between the antigen and the test antibody is detected by FACS analysis, eg, using a chromogenic/fluorescent label attached to the secondary antibody (eg, as described herein).
- any of the measurement methods described in "Antibody Affinity" herein can be utilized.
- measurement of Kd by a BIACORE surface plasmon resonance assay can be used to assess binding between a test antibody and an antigen of interest as described herein.
- the methods of the invention are characterized in that the antibody binds between HLA-DQ2.5 (or HLA-DQ2.5/gluten peptide complex) and the TCR (or HLA-DQ2.5 (or HLA-DQ2) .5/gluten peptide complexes) and HLA-DQ2.5-restricted CD4+ T cells); Further comprising the step of selecting.
- the methods of the invention are characterized in that the antibody binds between HLA-DQ2.2 (or HLA-DQ2.2/gluten peptide complex) and the TCR (or HLA-DQ2.2 (or HLA-DQ2) .2/gluten peptide complex) and HLA-DQ2.2-restricted CD4+ T cell interaction); Further comprising the step of selecting.
- These steps can be performed in the presence of a gluten peptide such as those described herein, ie with HLA-DQ2.5 or HLA-DQ2.2 bound to the peptide.
- Neutralizing activity can be assessed, eg, as described herein.
- beads eg, streptavidin-coated yellow particles
- peptide-conjugated soluble HLA-DQ is added to the beads.
- the plate is washed and blocked, antibody is added to it and incubated.
- D2 TCR tetramer-PE can be added and incubated. . Binding between the two can be assessed based on chromogenic/fluorescent labeling of TCR bound to HLA-DQ2.5 (or HLA-DQ2.5/gluten peptide complex).
- the multispecific antigen binding molecules block interactions between HLA-DQ2.5/gluten peptide complexes and HLA-DQ2.5/gluten peptide-restricted CD4+ T cells. In some embodiments, the multispecific antigen binding molecules block interactions between HLA-DQ2.2/gluten peptide complexes and HLA-DQ2.2/gluten peptide-restricted CD4+ T cells.
- a gluten peptide is a peptide in a complex bound by any of the above antigen binding molecules/domains.
- the gluten peptide is an ⁇ 1 gliadin peptide, ⁇ 1b gliadin peptide, ⁇ 2 gliadin peptide, ⁇ 1 gliadin peptide, ⁇ 2 gliadin peptide, ⁇ 1 gliadin peptide, ⁇ 2 gliadin peptide, ⁇ 3 gliadin peptide, ⁇ 4a gliadin peptide, ⁇ 4d gliadin peptide, and BC hordein peptides.
- the multispecific antigen binding molecules are HLA-DP, HLA-DR, HLA-DQ5.1, HLA-DQ6.3, HLA-DQ7.3, HLA-DQ7.5, and HLA-DQ8 has substantially no binding activity for
- the antigen-binding molecules of the present invention have enhanced binding activity to complexes formed by HLA-DQ2.5 and gluten peptides.
- the gluten peptide can be any of the gluten peptides described above.
- the degree of enhancement is relative to complexes formed by HLA-DQ2.5 and unrelated peptides, or to cells without complexes of interest, e.g., HLA-DQ2.5-positive PBMC B cells and/or HLA-DQ2.5 It may be determined by comparison with binding activity to Ba/F3 cells expressing DQ2.5 or HLA-DQ2.2.
- a bispecific antibody of the present invention comprises heavy and light chains of a first arm/half-antibody and heavy and light chains of a second arm/half-antibody.
- the term "arm” or “half-antibody” refers to a portion of an antibody comprising one heavy chain and one light chain.
- the bispecific antibody comprises VH (heavy chain variable region) and VL (light chain variable region) of a first arm/half antibody and VH and VL of a second arm/half antibody. include.
- the bispecific antibody comprises first arm/half antibody HCDR1, HCDR2, HCDR3, LCDR1, LCDR2, and LCDR3 and second arm/half antibody HCDR1, HCDR2, HCDR3, LCDR1 , LCDR2, and LCDR3.
- the first arm/half-antibody is derived from DQN0344xx (DQN0344Hx/DQN0344Lx) described herein and the second arm/half-antibody is Derived from DQN0385ee (DQN0385He/DQN0385Le) described herein.
- the sequence ID numbers (SEQ ID NOs) of the VH, VL, HCDR1, HCDR2, HCDR3, LCDR1, LCDR2, LCDR3, and the full length heavy (H) and light (L) chains of the bispecific antibodies of the invention are shown in Table 2. -3 to 2-6 (below).
- the antibodies of the invention comprise HCDR1 comprising the sequence of SEQ ID NO: 129 or 164; HCDR2 comprising the sequence of SEQ ID NO: 130 or 165; and HCDR3 comprising the sequence of SEQ ID NO: 131 or 166.
- the antibodies of the invention comprise LCDR1 comprising the sequence of SEQ ID NO: 132 or 167; LCDR2 comprising the sequence of SEQ ID NO: 133 or 168; and LCDR3 comprising the sequence of SEQ ID NO: 134 or 169.
- an antibody of the invention comprises a heavy chain variable region comprising the sequence of SEQ ID NO:88 or 89.
- an antibody of the invention comprises a heavy chain constant region comprising the sequence of SEQ ID NO:105 or 162. In some embodiments, an antibody of the invention comprises a light chain variable region comprising the sequence of SEQ ID NO:90 or 91. In some embodiments, an antibody of the invention comprises a light chain constant region comprising the sequence of SEQ ID NO:106. In some embodiments, an antibody of the invention comprises a (full length) heavy chain comprising the sequence of SEQ ID NO: 41, 42, 44, or 45. In some embodiments, an antibody of the invention comprises a (full length) light chain comprising the sequence of SEQ ID NO:43 or 46.
- the antibody of the invention is HCDR1 comprising the sequence of SEQ ID NO: 135, 144, 147, 153, 156, or 159; and HCDR3 comprising the sequence of SEQ ID NO: 137, 146, 149, 155, 158, or 161.
- the antibodies of the invention are LCDR1, comprising the sequence of SEQ ID NO: 138, 141, or 150; LCDR2, comprising the sequence of SEQ ID NO: 139, 142, or 151; Or including LCDR3, which contains 152 sequences.
- an antibody of the invention comprises a heavy chain variable region comprising the sequence of SEQ ID NO:92, 93, 94, 95, 96, or 97.
- an antibody of the invention comprises a heavy chain constant region comprising the sequence of SEQ ID NO:104 or 163. In some embodiments, an antibody of the invention comprises a light chain variable region comprising the sequence of SEQ ID NO:98, 99, or 100. In some embodiments, an antibody of the invention comprises a light chain constant region comprising the sequence of SEQ ID NO:107. In some embodiments, an antibody of the invention comprises a (full length) heavy chain comprising the sequence of SEQ ID NO: 53, 54, 57, 58, 59, 60, 62, 63, 64, 65, 66, or 67 . In some embodiments, an antibody of the invention comprises a (full length) light chain comprising the sequence of SEQ ID NO:55, 56, or 61.
- Table 1-2 shows the specific sequences of the full-length H and L chains of the arm/half antibody (included in the bispecific antibody of the present invention).
- H and L chains of bispecific antibodies H (or L) chains are HCDR1, HCDR2, and HCDR3 (or LCDR1, LCDR2, and LCDR3) from N-terminus to C-terminus. , which are underlined in this table.
- the disclosure provides a multispecific antigen binding molecule comprising a first antigen binding portion and a second antigen binding portion, wherein A multispecific antigen-binding molecule is provided, wherein the first antigen-binding portion comprises any one of (a1)-(a3): (a1) a first antibody variable region comprising complementarity determining region (CDR) 1 of SEQ ID NO: 129, CDR 2 of SEQ ID NO: 130, CDR 3 of SEQ ID NO: 131, and CDR 1 of SEQ ID NO: 132, a second antibody variable region comprising CDR 2 of SEQ ID NO: 133, CDR 3 of SEQ ID NO: 134; (a2) a first antibody variable region comprising complementarity determining region (CDR) 1 of SEQ ID NO: 164, CDR 2 of SEQ ID NO: 165, CDR 3 of SEQ ID NO: 166, and CDR 1 of SEQ ID NO: 167, a second antibody variable region comprising CDR 2 of SEQ ID NO:
- the multispecific antigen-binding molecule comprising a second antigen-binding portion, wherein the second antigen-binding portion comprises any one of (b1)-(b8) below: (b1) a third antibody variable region comprising complementarity determining region (CDR) 1 of SEQ ID NO: 135, CDR 2 of SEQ ID NO: 136, CDR 3 of SEQ ID NO: 137, and CDR 1 of SEQ ID NO: 138, a fourth antibody variable region comprising CDR 2 of SEQ ID NO: 139, CDR 3 of SEQ ID NO: 140; (b2) a third antibody variable region comprising complementarity determining region (CDR) 1 of SEQ ID NO: 135, CDR 2 of SEQ ID NO: 136, CDR 3 of SEQ ID NO: 137, and CDR 1 of SEQ ID NO: 141; a fourth antibody variable region comprising CDR 2 of SEQ ID NO: 142, CDR 3 of SEQ ID NO: 143; (b3) a third antibody variable region comprising C
- the disclosure provides a multispecific antigen binding molecule comprising a first antigen binding portion and a second antigen binding portion, wherein
- the first antigen-binding portion comprises (c1)-(c3): (c1) a first antibody variable region comprising complementarity determining region (CDR) 1 of SEQ ID NO: 129, CDR 2 of SEQ ID NO: 130, CDR 3 of SEQ ID NO: 131, and CDR 1 of SEQ ID NO: 132, a second antibody variable region comprising CDR 2 of SEQ ID NO: 133, CDR 3 of SEQ ID NO: 134; (c2) a first antibody variable region comprising complementarity determining region (CDR) 1 of SEQ ID NO: 164, CDR 2 of SEQ ID NO: 165, CDR 3 of SEQ ID NO: 166, and CDR 1 of SEQ ID NO: 167, a second antibody variable region comprising CDR 2 of SEQ ID NO: 168, CDR 3 of SEQ ID NO: 169; and (c1)
- the disclosure provides a multispecific antigen binding portion comprising a first antigen binding portion comprising first and second antibody variable regions and a second antigen binding portion comprising third and fourth antibody variable regions.
- a multispecific antigen-binding molecule comprising any one of the following (1) to (15): (1) a first antibody variable region comprising complementarity determining region (CDR) 1 of SEQ ID NO: 129, CDR 2 of SEQ ID NO: 130, CDR 3 of SEQ ID NO: 131, and CDR 1 of SEQ ID NO: 132; Second antibody variable region comprising CDR 2 of SEQ ID NO: 133, CDR 3 of SEQ ID NO: 134; complementarity determining region (CDR) 1 of SEQ ID NO: 135, CDR 2 of SEQ ID NO: 136, SEQ ID NO: 137 and a fourth antibody variable region comprising CDR 1 of SEQ ID NO: 138, CDR 2 of SEQ ID NO: 139, CDR 3 of SEQ
- the antibody variable regions included in the first antigen-binding portion and/or the second antigen-binding portion comprise human antibody frameworks or humanized antibody frameworks.
- the disclosure provides a multispecific antigen binding molecule comprising a first antigen binding portion and a second antigen binding portion, wherein A multispecific antigen-binding molecule is provided, wherein the first antigen-binding portion comprises any one of the following (e1)-(e3): (e1) a first antibody variable region comprising the amino acid sequence of SEQ ID NO:88 and a second antibody variable region comprising the amino acid sequence of SEQ ID NO:90; (e2) a first antibody variable region comprising the amino acid sequence of SEQ ID NO:89, and a second antibody variable region comprising the amino acid sequence of SEQ ID NO:91; a first amino acid sequence having at least 70%, 75%, 80%, 85%, 90%, or 95% sequence identity to the first antibody variable region that is (e1) or (
- the second antigen-binding portion comprises any one of (f1)-(f8): (f1) a third antibody variable region comprising the amino acid sequence of SEQ ID NO:92 and a fourth antibody variable region comprising the amino acid sequence of SEQ ID NO:98; (f2) a third antibody variable region comprising the amino acid sequence of SEQ ID NO:92 and a fourth antibody variable region comprising the amino acid sequence of SEQ ID NO:99; (f3) a third antibody variable region comprising the amino acid sequence of SEQ ID NO:93 and a fourth antibody variable region comprising the amino acid sequence of SEQ ID NO:99; (f4) a third antibody variable region comprising the amino acid sequence of SEQ ID NO:94 and a fourth antibody variable region comprising the amino acid sequence of SEQ ID NO:100; (f5) a third antibody variable region comprising the amino acid sequence of SEQ ID NO:95 and a fourth antibody variable region comprising the amino acid sequence of SEQ ID NO:100; (f6)
- the disclosure provides a multispecific antigen binding molecule comprising a first antigen binding portion and a second antigen binding portion, wherein
- the first antigen-binding portion is (e1)-(e3) as follows: (e1) a first antibody variable region comprising the amino acid sequence of SEQ ID NO:88 and a second antibody variable region comprising the amino acid sequence of SEQ ID NO:90; (e2) a first antibody variable region comprising the amino acid sequence of SEQ ID NO:89, and a second antibody variable region comprising the amino acid sequence of SEQ ID NO:91; a first amino acid sequence having at least 70%, 75%, 80%, 85%, 90%, or 95% sequence identity to the first antibody variable region that is (e1) or (e2) A second amino acid sequence having at least 70%, 75%, 80%, 85%, 90%, or 95% sequence identity to the described second antibody variable region.
- the second antigen-binding portion comprises any one of the following (f1)-(f8): (f1) a third antibody variable region comprising the amino acid sequence of SEQ ID NO:92 and a fourth antibody variable region comprising the amino acid sequence of SEQ ID NO:98; (f2) a third antibody variable region comprising the amino acid sequence of SEQ ID NO:92 and a fourth antibody variable region comprising the amino acid sequence of SEQ ID NO:99; (f3) a third antibody variable region comprising the amino acid sequence of SEQ ID NO:93 and a fourth antibody variable region comprising the amino acid sequence of SEQ ID NO:99; (f4) a third antibody variable region comprising the amino acid sequence of SEQ ID NO:94 and a fourth antibody variable region comprising the amino acid sequence of SEQ ID NO:100; (f5) a third antibody variable region comprising the amino acid sequence of SEQ ID NO:95 and a fourth antibody variable region comprising the amino acid sequence of SEQ ID NO:100; (f6) a third antibody variable region comprising the amino acid sequence of S
- the disclosure provides a multispecific antigen binding portion comprising a first antigen binding portion comprising first and second antibody variable regions and a second antigen binding portion comprising third and fourth antibody variable regions.
- a multispecific antigen-binding molecule comprising any one of the following (1) to (15): (1) a first antibody variable region comprising the amino acid sequence of SEQ ID NO:88; a second antibody variable region comprising the amino acid sequence of SEQ ID NO:90; a third antibody variable region comprising the amino acid sequence of SEQ ID NO:92 and a fourth antibody variable region comprising the amino acid sequence of SEQ ID NO:98; (2) a first antibody variable region comprising the amino acid sequence of SEQ ID NO:88; and a second antibody variable region comprising the amino acid sequence of SEQ ID NO:90; and a third antibody variable region comprising the amino acid sequence of SEQ ID NO:92.
- the present disclosure provides multispecific antigen-binding molecules comprising a combination of two polypeptide chains selected from the group consisting of (A1)-(A3) below: (A1) a first heavy chain comprising the amino acid sequence of SEQ ID NO:42 and a first light chain comprising the amino acid sequence of SEQ ID NO:43; (A2) a first heavy chain comprising the amino acid sequence of SEQ ID NO:45, and a first light chain comprising the amino acid sequence of SEQ ID NO:46; a first amino acid sequence having at least 70%, 75%, 80%, 85%, 90%, or 95% sequence identity to the heavy chain sequence of 1 and described in (A1) or (A2); a second amino acid sequence having at least 70%, 75%, 80%, 85%, 90%, or 95% sequence identity to the first light chain sequence.
- the multispecific antigen-binding molecule further comprises a combination of two polypeptide chains selected from the group consisting of (B1)-(B8) below: (B1) a second heavy chain comprising the amino acid sequence of SEQ ID NO:54 and a second light chain comprising the amino acid sequence of SEQ ID NO:55; (B2) a second heavy chain comprising the amino acid sequence of SEQ ID NO:54 and a second light chain comprising the amino acid sequence of SEQ ID NO:56; (B3) a second heavy chain comprising the amino acid sequence of SEQ ID NO:58 and a second light chain comprising the amino acid sequence of SEQ ID NO:56; (B4) a second heavy chain comprising the amino acid sequence of SEQ ID NO:60 and a second light chain comprising the amino acid sequence of SEQ ID NO:61; (B5) a second heavy chain comprising the amino acid sequence of SEQ ID NO:63 and a second light chain comprising the amino acid sequence of SEQ ID NO:61; (B6) a second heavy chain
- the multispecific antigen-binding molecule further comprises a combination of two polypeptide chains selected from the group consisting of (B1)-(B8) below: (B1) a second heavy chain comprising the amino acid sequence of SEQ ID NO:53 and a second light chain comprising the amino acid sequence of SEQ ID NO:55; (B2) a second heavy chain comprising the amino acid sequence of SEQ ID NO:53 and a second light chain comprising the amino acid sequence of SEQ ID NO:56; (B3) a second heavy chain comprising the amino acid sequence of SEQ ID NO:57 and a second light chain comprising the amino acid sequence of SEQ ID NO:56; (B4) a second heavy chain comprising the amino acid sequence of SEQ ID NO:59 and a second light chain comprising the amino acid sequence of SEQ ID NO:61; (B5) a second heavy chain comprising the amino acid sequence of SEQ ID NO:62 and a second light chain comprising the amino acid sequence of SEQ ID NO:61; (B6) a second heavy chain
- the disclosure provides multispecific antigen-binding molecules comprising a combination of four polypeptide chains selected from the group consisting of (1) to (15) below: (1) a first heavy chain comprising the amino acid sequence of SEQ ID NO:42 and a first light chain comprising the amino acid sequence of SEQ ID NO:43 and a second heavy chain comprising the amino acid sequence of SEQ ID NO:54 and sequences number: a second light chain comprising a sequence of 55 amino acids; (2) a first heavy chain comprising the amino acid sequence of SEQ ID NO:42 and a first light chain comprising the amino acid sequence of SEQ ID NO:43 and a second heavy chain comprising the amino acid sequence of SEQ ID NO:54 and sequences number: a second light chain comprising a sequence of 56 amino acids; (3) a first heavy chain comprising the amino acid sequence of SEQ ID NO:42 and a first light chain comprising the amino acid sequence of SEQ ID NO:43 and a second heavy chain comprising the amino acid sequence of SEQ ID NO:58 and sequences number
- the disclosure provides multispecific antigen-binding molecules comprising a combination of four polypeptide chains selected from the group consisting of (1) to (15) below: (1) a first heavy chain comprising the amino acid sequence of SEQ ID NO:41 and a first light chain comprising the amino acid sequence of SEQ ID NO:43, and a second heavy chain comprising the amino acid sequence of SEQ ID NO:53 and sequences number: a second light chain comprising a sequence of 55 amino acids; (2) a first heavy chain comprising the amino acid sequence of SEQ ID NO:41 and a first light chain comprising the amino acid sequence of SEQ ID NO:43 and a second heavy chain comprising the amino acid sequence of SEQ ID NO:53 and sequences number: a second light chain comprising a sequence of 56 amino acids; (3) a first heavy chain comprising the amino acid sequence of SEQ ID NO:41 and a first light chain comprising the amino acid sequence of SEQ ID NO:43 and a second heavy chain comprising the amino acid sequence of SEQ ID NO:57 and sequences
- the disclosure provides a combination of any one of (i)-(iii): (i) a multispecific antigen-binding molecule comprising a sequence described in any one of (a1) to (a3) above, and described in any one of (b1) to (b8) above; a multispecific antigen binding molecule comprising a sequence; (ii) a multispecific antigen-binding molecule comprising a sequence described in any one of (e1) to (e3) above, and described in any one of (f1) to (f8) above; and (iii) a multispecific antigen-binding molecule comprising a sequence described in any one of (A1)-(A3) above, and (B1)-(B1)-( A multispecific antigen-binding molecule comprising the sequence described in any one of B8).
- the antigen binding molecules of the invention are bispecific antigen binding molecules.
- the bispecific antigen binding molecule is a bispecific antibody.
- the disclosure provides nucleic acids encoding the antigen-binding molecules of the invention.
- the nucleic acid is an isolated nucleic acid.
- the disclosure provides a vector comprising the nucleic acid.
- the present disclosure provides vectors into which nucleic acids have been introduced.
- the disclosure provides a cell comprising the nucleic acid or vector.
- the cell is a host cell.
- the present disclosure provides methods of producing multispecific antigen binding molecules of the invention comprising culturing cells such that the multispecific antigen binding molecules are produced.
- the method further comprises recovering the multispecific antigen binding molecule from the culture of cells.
- Nucleic acids, vectors, cells, and methods can be suitably produced/performed in light of the present disclosure and technical knowledge in the art.
- Immunoconjugates of the present invention also include one or more cytotoxic agents (e.g., chemotherapeutic agents or chemotherapeutic agents, growth inhibitory agents, toxins (e.g., protein toxins of bacterial, fungal, plant or animal origin, enzymatically active Immunoconjugates are provided comprising an anti-HLA-DQ2.5 antigen binding molecule (antibody) herein conjugated to a toxin (or fragment thereof) or radioisotope).
- cytotoxic agents e.g., chemotherapeutic agents or chemotherapeutic agents, growth inhibitory agents, toxins (e.g., protein toxins of bacterial, fungal, plant or animal origin, enzymatically active Immunoconjugates are provided comprising an anti-HLA-DQ2.5 antigen binding molecule (antibody) herein conjugated to a toxin (or fragment thereof) or radioisotope).
- the immunoconjugate is an antibody-drug conjugate (ADC), wherein the antibody is conjugated to one or more drugs, including but not limited to There are: maytansinoids (see U.S. Pat. Nos. 5,208,020, 5,416,064, and EP 0,425,235 B1); e.g. monomethylauristatin drug moieties DE and DF (MMAE and MMAF) (U.S. Pat. Nos. 5,635,483 and 5,780,588) dolastatin; calicheamicin or derivatives thereof (U.S. Pat. Nos.
- ADC antibody-drug conjugate
- the immunoconjugate comprises an antibody described herein conjugated to an enzymatically active toxin or fragment thereof, including but not limited to: Diphtheria A chain , non-binding active fragment of diphtheria toxin, exotoxin A chain (from Pseudomonas aeruginosa), ricin A chain, abrin A chain, modeccin A chain, alpha-sarcin, Aleurites fordii protein, diantin Proteins, Phytolacca americana protein (PAPI, PAPII and PAP-S), momordica charantia inhibitor, curcin, crotin, saponaria officinalis inhibitor, gelonin, mitogellin, restrictocins, phenomycins, enomycins, and trichothecenes.
- Diphtheria A chain non-binding active fragment of diphtheria toxin
- exotoxin A chain from Pseudomonas aeruginosa
- an immunoconjugate comprises an antibody described herein conjugated to a radioactive atom to form a radioconjugate.
- radioisotopes are available for the production of radioconjugates. Examples include radioactive isotopes of 211 At, 131 I, 125 I, 90 Y, 186 Re, 188 Re, 153 Sm, 212 Bi, 32 P, 212 Pb and Lu.
- the radioactive conjugate can be used for scintigraphic examination (e.g. Tc-99m or 123 I) or for nuclear magnetic resonance (NMR) imaging (magnetic resonance imaging, as MRI). (also known as .
- Conjugates of antibodies and cytotoxic agents can be made using a variety of bifunctional protein linking agents. e.g. N-succinimidyl-3-(2-pyridyldithio)propionate (SPDP), succinimidyl-4-(N-maleimidomethyl)cyclohexane-1-carboxylate (SMCC), iminothiolane (IT), bifunctional derivatives of imidoesters (e.g. dimethyl adipimidate HCl), active esters (e.g. disuccinimidyl suberate), aldehydes (e.g. glutaraldehyde), bis-azido compounds (e.g.
- SPDP N-succinimidyl-3-(2-pyridyldithio)propionate
- SMCC succinimidyl-4-(N-maleimidomethyl)cyclohexane-1-carboxylate
- IT iminothiolane
- bis(p-azidobenzoyl)hexanediamine), bis- diazonium derivatives (e.g. bis-(p-diazoniumbenzoyl)-ethylenediamine), diisocyanates (e.g. toluene 2,6-diisocyanate), and bis-active fluorine compounds (e.g. 1,5-difluoro-2,4-dinitrobenzene) is.
- a ricin immunotoxin can be prepared as described in Vitetta et al., Science 238:1098 (1987).
- Carbon-14 labeled 1-isothiocyanatobenzyl-3-methyldiethylenetriaminepentaacetic acid is an exemplary chelating agent for conjugation of radionuclides to antibodies. See WO94/11026.
- the linker can be a "cleavable linker" that facilitates intracellular release of the cytotoxic agent.
- acid-labile linkers, peptidase-sensitive linkers, photolabile linkers, dimethyl linkers, or disulfide-containing linkers (Chari et al., Cancer Res. 52:127-131 (1992); U.S. Patent No. 5,208,020) have been used. obtain.
- Immunoconjugates or ADCs herein are commercially available (e.g. from Pierce Biotechnology, Inc., Rockford, IL., U.S.A.) BMPS, EMCS, GMBS, HBVS, LC-SMCC, MBS, MPBH, SBAP, SIA, SIAB, SMCC, SMPB, SMPH, sulfo-EMCS, sulfo-GMBS, sulfo-KMUS, sulfo-MBS, sulfo-SIAB, sulfo-SMCC, and sulfo-SMPB, and SVSB (succinimidyl-(4-vinylsulfone) Conjugates prepared using cross-linking reagents including, but not limited to, benzoate) are expressly contemplated.
- cross-linking reagents including, but not limited to, benzoate
- compositions/formulations of the anti-HLA-DQ2.5 antigen binding molecules (antibodies) described herein contain antibodies having the desired purity, combined with one or more of any pharmaceutical agents. are prepared in the form of lyophilized formulations or aqueous solutions by admixture with an acceptable carrier (Remington's Pharmaceutical Sciences 16th edition, Osol, A. Ed. (1980)).
- Pharmaceutically acceptable carriers are generally nontoxic to recipients at the dosages and concentrations employed and include, but are not limited to: phosphates, citrates, buffers such as acid salts and other organic acids; antioxidants, including ascorbic acid and methionine; preservatives (octadecyldimethylbenzyl ammonium chloride; hexamethonium chloride; benzalkonium chloride; benzethonium chloride; phenol, butyl, or benzyl alcohol; alkylparabens such as methyl or propylparaben; catechol; resorcinol; cyclohexanol; 3-pentanol; and m-cresol); proteins such as immunoglobulins; hydrophilic polymers such as polyvinylpyrrolidone; amino acids such as glycine, glutamine, asparagine, histidine, arginine, or lysine; monosaccharides, disaccharides, and other carbohydrates,
- Exemplary pharmaceutically acceptable carriers herein further include soluble neutrally active hyaluronidase glycoprotein (sHASEGP) (e.g., human soluble hyaluronidase glycoprotein such as rHuPH20 (HYLENEX®, Baxter International, Inc.)). PH-20 hyaluronidase glycoprotein).
- sHASEGP soluble neutrally active hyaluronidase glycoprotein
- rHuPH20 HYLENEX®, Baxter International, Inc.
- PH-20 hyaluronidase glycoprotein e.g., human soluble hyaluronidase glycoprotein such as rHuPH20 (HYLENEX®, Baxter International, Inc.)
- PH-20 hyaluronidase glycoprotein e.g., PH-20 hyaluronidase glycoprotein.
- Certain exemplary sHASEGPs and methods of their use are described in US Patent Application Publication Nos. 2005/0260186 and
- Aqueous antibody formulations include those described in US Pat. No. 6,171,586 and WO2006/044908, the latter formulation containing a histidine-acetate buffer.
- compositions/formulations herein may contain more than one active ingredient if required for the particular indication being treated. Those with complementary activities that do not adversely affect each other are preferred. For example, it is desirable to provide further agents that can be combined with anti-HLA-DQ2.5 antigen binding molecules (antibodies). Such active ingredients are present in any suitable combination in amounts that are effective for the purpose intended.
- the active ingredient is incorporated into microcapsules prepared, for example, by droplet formation (coacervation) techniques or by interfacial polymerization (for example, hydroxymethylcellulose or gelatin microcapsules, and poly(methyl methacrylate) microcapsules, respectively).
- microcapsules prepared, for example, by droplet formation (coacervation) techniques or by interfacial polymerization (for example, hydroxymethylcellulose or gelatin microcapsules, and poly(methyl methacrylate) microcapsules, respectively).
- colloidal drug delivery systems eg, liposomes, albumin microspheres, microemulsions, nanoparticles, and nanocapsules
- macroemulsions eg, incorporated into macroemulsions.
- sustained release formulation may be prepared.
- sustained-release preparations include semipermeable matrices of solid hydrophobic polymers containing the antibody, which matrices are in the form of shaped articles, eg films or microcapsules.
- compositions/formulations to be used for in vivo administration are usually sterile. Sterility is readily accomplished, for example, by filtration through sterile filtration membranes.
- anti-HLA-DQ2.5 antigen binding molecules any of the anti-HLA-DQ2.5 antigen binding molecules (antibodies) provided herein may be used in therapeutic methods.
- anti-HLA-DQ2.5 antigen binding molecules are provided for use as a pharmaceutical.
- anti-HLA-DQ2.5 antigen binding molecules are provided for use in treating celiac disease.
- anti-HLA-DQ2.5 antigen binding molecules are provided for use in therapeutic methods.
- the present invention provides for use in a method of treating an individual with celiac disease comprising administering to the individual an effective amount of an anti-HLA-DQ2.5 antigen binding molecule (antibody). provides an anti-HLA-DQ2.5 antigen-binding molecule (antibody) for In one such embodiment, the method further comprises administering to the individual an effective amount of at least one additional therapeutic agent (eg, as described below).
- the present invention provides use of anti-HLA-DQ2.5 antigen-binding molecules (antibodies) in the manufacture or preparation of medicaments.
- the medicament is for treatment of celiac disease.
- the medicament is for use in a method of treating celiac disease comprising administering an effective amount of the medicament to an individual with celiac disease.
- the method further comprises administering to the individual an effective amount of at least one additional therapeutic agent (eg, as described below).
- the present disclosure provides uses of the multispecific antigen-binding molecules of the invention in the manufacture of medicaments.
- the medicament is for treatment and/or prevention of celiac disease.
- the present invention provides methods for treating celiac disease.
- the method comprises administering to an individual with celiac disease an effective amount of an anti-HLA-DQ2.5 antigen binding molecule (antibody).
- the method further comprises administering to the individual an effective amount of at least one additional therapeutic agent, such as those described below.
- An "individual” according to any of the above aspects may be a human.
- the disclosure provides a method of treating an individual with celiac disease comprising administering to the individual an effective amount of a multispecific antigen-binding molecule of the invention. In some aspects, the disclosure provides use of the multispecific antigen binding molecules of the invention to treat an individual with celiac disease.
- the present invention provides any of the anti-HLA-DQ2.5 antigen binding molecules (antibodies) provided herein for use in any of the above therapeutic methods, e.g., against celiac disease.
- a pharmaceutical composition/formulation comprising: In one aspect, the pharmaceutical composition/formulation comprises any of the anti-HLA-DQ2.5 antigen binding molecules (antibodies) provided herein and a pharmaceutically acceptable carrier. In another embodiment, the pharmaceutical composition/formulation comprises any of the anti-HLA-DQ2.5 antigen binding molecules (antibodies) provided herein and at least one additional therapeutic agent, e.g. include.
- the disclosure provides pharmaceutical compositions/formulations comprising a multispecific antigen-binding molecule of the invention and a pharmaceutically acceptable carrier.
- the composition/formulation is a pharmaceutical composition/formulation for use in treating and/or preventing celiac disease.
- the antibodies of the invention can be used either alone or in combination with other agents in therapy.
- an antibody of the invention may be co-administered with at least one additional therapeutic agent.
- the additional therapeutic agent is any agent suitable for co-administration and available to those of skill in the art.
- the antibodies of the invention can be used either alone or in combination with another antibody in therapy.
- an antibody of the invention may be co-administered with at least one additional antibody of the invention.
- these antibodies are administered concurrently or simultaneously or subsequently.
- mixtures, cocktails or combinations of these antibodies suitable for co-administration are administered.
- These antibodies can be any antibodies disclosed herein.
- these antibodies are two or more homomeric antibodies disclosed herein, e.g., DQN0344xx and DQN0385ee, or any optimized and/or humanized variants of DQN0344xx and DQN0385ee.
- Combination therapy includes combined administration (where two or more therapeutic agents are contained in the same or separate formulations), and separate administration, where administration of an antibody of the invention is additional therapy. It can occur prior to, concurrently with, and/or subsequent to administration of the agent.
- administration of the anti-HLA-DQ2.5 antigen binding molecule (antibody) and administration of the additional therapeutic agent are within about 1 month, or within about 1, 2, or 3 weeks, or within about 1, 2 weeks of each other. , within 3, 4, 5, or 6 days.
- Antibodies of the invention may be administered by any suitable means, including parenteral, intrapulmonary, and nasal administration, and intralesional administration if desired for local treatment.
- can be administered by Parenteral injection includes intramuscular, intravenous, intraarterial, intraperitoneal, or subcutaneous administration.
- Dosing may be by any suitable route, eg, by injection, such as intravenous or subcutaneous injection, depending in part on whether the administration is short or long term.
- Various dosing schedules are contemplated herein, including, but not limited to, single doses or repeated doses over various time points, bolus doses, and pulse infusions.
- Two or more of the antibodies of the invention can be administered during the course of treatment. They may be administered separately or simultaneously. They may be administered in combination. In co-administration, the two or more antibodies may be administered simultaneously or separately. In some cases, one antibody/agent may be administered first, symptoms monitored, and another antibody/agent administered further, if indicated, depending on the symptoms. Alternatively, more than one antibody of the invention can be included in a combination drug/agent. Such drug combinations/drugs can be administered as described herein. The dosage/dosage of each antibody involved can be determined appropriately as described herein.
- the antibodies of the invention are formulated, dosed, and administered in a manner consistent with good medical practice. Factors to be considered in this regard are the particular disorder being treated, the particular mammal being treated, the clinical presentation of the individual patient, the cause of the disorder, the site of delivery of the agent, the method of administration, the schedule, and other factors known to health care practitioners.
- the antibody is optionally, but not necessarily, formulated with one or more agents currently used to prevent or treat the disorder in question. Effective amounts of such other agents will depend on the amount of antibody present in the formulation, the type of disorder or treatment, and other factors discussed above. These will generally be at the same doses and routes of administration as stated herein, or at about 1 to 99% of the doses stated herein, or any dose determined empirically/clinically appropriate. and in any route, used.
- an antibody of the invention when used alone or with one or more other additional therapeutic agents, will depend on the type of disease to be treated, the amount of antibody It will depend on the type, severity and course of the disease, whether the antibody is administered prophylactically or therapeutically, medication history, the patient's clinical history and response to the antibody, and the discretion of the attending physician. .
- the antibody is suitably administered to the patient at one time or over a series of treatments. Depending on the type and severity of the disease, for example, about 1 ⁇ g/kg to 15 mg/kg (e.g., 0.1 mg/kg to 10 mg /kg) of antibody can be the first candidate dose for administration to a patient.
- One typical daily dosage might range from about 1 ⁇ g/kg to 100 mg/kg or more, depending on the factors mentioned above. For repeated administrations over several days or longer, depending on the circumstances, treatment is usually maintained until a desired suppression of disease symptoms occurs.
- One exemplary dose of antibody is within the range of about 0.05 mg/kg to about 10 mg/kg.
- one or more doses (or any combination thereof) of about 0.5 mg/kg, 2.0 mg/kg, 4.0 mg/kg, or 10 mg/kg may be administered to the patient.
- Such doses may be administered intermittently, eg, every week or every three weeks (eg, such that the patient receives from about 2 to about 20, or eg, about 6 doses of the antibody).
- a high loading dose may be followed by one or more lower doses. The progress of this therapy is easily monitored by conventional techniques and measurements.
- any of the above formulations or therapeutic methods may be practiced using the immunoconjugates of the invention instead of or in addition to anti-HLA-DQ2.5 antigen binding molecules (antibodies); be understood.
- kits or articles of manufacture containing instruments useful for the treatment, prevention, and/or diagnosis of the disorders described above are provided.
- a kit or article of manufacture includes a container and a label on or associated with the container.
- Preferred containers include, for example, bottles, vials, syringes, IV solution bags, and the like.
- Containers may be formed from a variety of materials, such as glass or plastic.
- the container may hold the composition alone or in combination with another composition effective for treating, preventing, and/or diagnosing a condition, and may have a sterile access port.
- the container may be an intravenous solution bag or vial having a stopper pierceable by a hypodermic injection needle).
- kits or package insert indicates that the composition is used for treating the condition of choice.
- the kit or article of manufacture further comprises (a) a first container with a composition comprising an antibody of the invention contained therein; and (b) a second container. and may include a second container with a composition comprising an additional cytotoxic or otherwise therapeutic agent contained therein. Kits or articles of manufacture in this aspect of the invention may further include a package insert indicating that the composition can be used to treat a particular condition.
- the kit or article of manufacture further comprises a second pharmaceutically acceptable buffer, such as Bacterial Bacterial Water for Injection (BWFI), phosphate-buffered saline, Ringer's solution, and dextrose solution. (or a third) container may be included. It may further include other commercially desirable or user-desirable equipment such as other buffers, diluents, filters, needles, and syringes.
- BWFI Bacterial Bacterial Water for Injection
- kit or the product may contain the immunoconjugate of the present invention instead of or in addition to the anti-HLA-DQ2.5 antigen binding molecule (antibody).
- kits for use in treating and/or preventing celiac disease comprising at least a multispecific antigen-binding molecule of the invention and instructions for use.
- the antigen-binding molecules of the present disclosure can be combined with various existing techniques of medical use.
- techniques that can be combined with the antigen-binding molecule of the present disclosure include a method of directly expressing the antigen-binding molecule by incorporating a nucleic acid encoding the antigen-binding molecule into the body using a viral vector or the like. is included.
- viral vectors include, but are not limited to adenovirus.
- a nucleic acid encoding an antigen-binding molecule can be directly incorporated into the body without using a viral vector, for example, by electroporation or direct administration of the nucleic acid.
- cells genetically modified to secrete/express an antigen-binding molecule can be administered to a living body to continuously secrete the antigen-binding molecule in the living body.
- Antibody-Containing Injectable Preparation Determination of Risk of Visually Detectable Particle Formation It has a particle size. Among them, particles that can be visually detected under the standard illuminance (approximately 2,000 to 3,000 lx) specified in the Pharmacopoeia are called “visible particles” or “insoluble visible particles.” Visible particles generally have a size greater than 100 ⁇ m [12]. They are smaller than visible particles and cannot be seen with the naked eye under the standard illumination (about 2,000-3,000 lx) specified in the Pharmacopoeia, but can be visually detected by increasing the illumination or prolonging the observation time. The particles are "visually detectable particles only in high illumination” and have a particle size of 40 ⁇ m to 100 ⁇ m.
- Visible particles are confirmed by visual inspection with the naked eye for 5 seconds or more by gently turning or overturning the container in front of a black or white background under standard illumination (approximately 2,000 to 3,000 lx). be done. Particles that are visually detectable only at high illuminance can be visually inspected with the naked eye under high illuminance (6,000 lx or more) under illumination for at least 30 seconds by gently turning or inverting the container in front of a black background. It is confirmed. Visible particles can also be seen when inspected in high light. Particles originating from other than protein molecules in solution are not considered “visually detectable particles" regardless of size. Microscopic Raman spectroscopy can confirm that the visually detectable particles are protein molecules.
- the size and number of visually detectable particles can be determined by light shielding particle counting, microscopic particle counting, flow-site particle image analysis, visual inspection, isolated particles followed by infrared spectroscopy (IR). It can be measured by measurement or microscopic Raman spectrometry, preferably by a combination of visual inspection and microscopic infrared spectroscopy or microscopic Raman spectrometry.
- high risk of forming particles in a solution of a pharmaceutical preparation means that protein molecules in the solution tend to aggregate and form visually detectable particles.
- proteins with a high risk of forming particles include proteins that form visually detectable particles even after addition of an appropriate amount of surfactant.
- bubble refers to a gas space between the liquid in the container and the wall surface of the container or in the liquid. It is of such size that it can be seen with the naked eye or by optical microscopy.
- Inside the container for example, in the case of a prefilled syringe with a needle, includes the entire space plugged with a rigid needle shield (RNS) and a stopper, and specifically refers to the space inside the needle and inside the barrel. Less than the entire diameter of the container is in contact with the bottom surface of the lid (eg, stopper) of the container when the container is in a vertical position, but not all of the liquid.
- the bubbles are spherical. In some embodiments, the bubbles are not spherical. In some such embodiments, the bubbles are oval.
- the bubble volume is measured as the combined bubble volume of all the bubbles contained in the container.
- the volume of air bubbles can be determined by ⁇ actually measuring the volume of air bubbles by expelling the gas and then the solution from the tip of the needle into an appropriate graduated container such as a pipette already containing a solution,'' or ⁇ obtaining an image and measuring the area of the air bubbles. It can be measured by methods such as "calculate the bubble volume” and “calculate the bubble volume from the height of the bubble portion based on the known barrel inner diameter information".
- homology modeling is used to determine proteins with a high risk of forming particles in solution.
- Homology modeling is a method of estimating the three-dimensional structure of a protein having a particular sequence based on sequence similarity to one or more proteins having a known three-dimensional structure. Homology modeling for a particular amino acid sequence typically involves the following steps. 1) identify homologues of known structures in the Protein Data Bank, 2) align the sequence of interest to the template structure, 3) build a model based on the alignment, 4) model evaluation and refinement. (Xiang, Curr Protein Pept Sci. 2006 June; 7(3):217-227). Molecular Operating Environment (MOE; Chemical Computing Group Inc.
- antibody modeling is a three-dimensional structure estimation function and database specialized for monoclonal antibodies.
- the overall structure can be assembled based on the structures of the fragments.
- an antibody Fab fragment can be added to an Fc fragment crystal structure, or a Fab fragment can be formed as a putative protein structure and added to an Fc fragment crystal structure.
- it can be implemented using the functions installed in the MOE.
- a "patch” refers to a surface region of residue clusters that exhibit specific physicochemical properties in the three-dimensional structure of a protein or antibody.
- Patches include hydrophobic patches and charged patches.
- Hydrophobic patches are surface areas where hydrophobic residues are clustered together.
- the portion where hydrophobic residues are clustered may also contain residues other than hydrophobic residues.
- a charge patch is a surface area where charged residues are clustered together.
- the portion where charged residues are clustered may also contain uncharged residues.
- the protein properties function of MOE can calculate the feature amount related to the patch area of the protein, and the area of the patch on the surface of the specific protein is ranked by the area of the hydrophobic patch.
- the risk of protein particle formation is determined based on X+Y ⁇ 1.5.
- a protein having a value of X+Y ⁇ 1.5 of 1700 or more is determined as a protein with a high risk of particle formation.
- proteins with a value of X+Y ⁇ 1.5 of 2000 or more, 2500 or more, 3000 or more, 3500 or more, or 4000 or more are determined to be proteins with a high risk of particle formation.
- the protein properties function of MOE can calculate a feature value related to the patch area of a protein, and the area of the patch on the surface of a specific protein can be calculated based on the total charge patch area Y ( ⁇ 2 )
- the particle formation risk of proteins is determined.
- a protein with a Y value of 600 or more is determined as a protein with a high risk of particle formation.
- proteins with a Y value of 700 or more, 800 or more, 900 or more, 1000 or more, 1500 or more, 2000 or more, 2500 or more, 3000 or more, or 4000 or more are determined to be proteins with a high risk of particle formation. .
- the ranking by area of hydrophobic patches is a list of hydrophobic patches observed on the protein surface arranged in order of area.
- a hydrophobic patch consisting of clusters of volatile residues.
- the sum of the areas ( ⁇ 2 ) of the top five hydrophobic patches in the ranking is calculated as X.
- the sum of the areas of the top five hydrophobic patches refers to the total area of the top five hydrophobic patches.
- the number of hydrophobic patches in the molecule is 4 or less, it refers to the total area of all existing hydrophobic patches.
- Total charge patch area means the sum of the areas ( ⁇ 2 ) of all positively or negatively charged charge patches present on the protein surface.
- a "molecular force field” is a parameterized function of what kind of force each atom in a molecule receives.
- the forces acting between atoms are variables that represent the bonds between atoms (bond distances, bond angles, etc.), and the potentials determined by the types of atoms and bonding modes. Expressed as a number in a function.
- the molecular force field that can be used is not particularly limited and can be appropriately selected according to the purpose.
- the molecular force field of Amber-based molecular force fields include, for example, Amber10/14:EHT, Amber ff99SB-ILDN, and Amber 12SB.
- Examples of the CHARMm-based molecular force field include CHARMm36.
- Amber10:EHT is preferable when using MOE.
- “reduce particle formation” refers to the volume of air bubbles in a solution of a pharmaceutical formulation in which visually detectable particles are formed under predetermined conditions. To prevent the formation of visually detectable particles or to reduce the number of particles formed by adjusting the The reduction in visually detectable particle formation can be confirmed by counting the number of particles before and after adjustment of the bubble volume.
- the size and number of particles can be determined by light obscuration particle counting, microscopic particle counting, flow site particle image analysis, visual inspection, isolated spectroscopy (IR) or micro Raman spectroscopy after particle isolation. Preferably, it is measured by a combination of visual inspection and microscopic infrared spectroscopy or microscopic Raman spectroscopy.
- the pharmaceutical formulation is a solution containing protein as an active ingredient.
- the pharmaceutical formulation may be an injectable formulation.
- an injectable preparation is a pharmaceutical preparation containing a protein as an active ingredient in a solution, which is filled in an injection container for administration by injection.
- the “obtained injectable formulation” refers to the injectable formulation obtained as the final product after adjusting the bubble volume.
- the pharmaceutical formulation is stored at -30°C to 25°C, preferably the freezing point of the solution to 25°C, more preferably 1°C to 10°C, more preferably 1°C to 10°C, more preferably without freezing the solution in the container.
- the protein used in the solution formulation is the anti-HLA-DQ2.5 antibody of the invention.
- the antibody is an anti-HLA-DQ2.5 bispecific antibody.
- the antibody is VH and VL, HCDR1, HCDR2, and HCDR3, LCDR1, LCDR2, and LCDR3, or Contains full-length heavy (H) and light (L) chains.
- the antibody is DQN0344H0976/L0591//DQN0385H1255/L0605-F6.v2 (see Table 2-4 for SEQ IDs, etc. (where "full length H" of both arms is "different Fc”) ).
- proteins used in pharmaceutical formulations have substantially the same biological activity as physiologically active proteins of mammals, particularly humans, and are naturally occurring and genetically modified.
- proteins obtained by Proteins obtained by genetic recombination include those that have the same amino acid sequence as the natural protein, or those that have one or more of the amino acid sequences deleted, substituted, or added and have the biological activity described above.
- the concentration of protein in the solution may be 0.1 mg/mL or higher, in the range of 0.1-300 mg/mL, in the range of 1-200 mg/mL. In one aspect of the invention, the concentration of protein in the solution may be greater than or equal to 50 mg/mL, in the range of 50-200 mg/mL, in the range of 50-300 mg/mL.
- pharmaceutical formulations can be prepared by mixing with appropriate pharmaceutically acceptable carriers, vehicles, etc., as necessary, to form solution formulations.
- the solvent for solution formulations is water or a pharmaceutically acceptable organic solvent.
- organic solvents include propylene glycol (1,2-propanediol), polyethylene glycol 300, polyethylene glycol 400, ethanol, glycerol, acetic acid and the like.
- Suitable pharmaceutically acceptable carriers and media include, for example, sterile water, physiological saline, stabilizers, antioxidants (ascorbic acid, etc.), buffers (phosphoric acid, citric acid, histidine, other organic acids, etc.), preservatives, surfactants (PEG, Tween, etc.), chelating agents (EDTA, etc.), binders and the like.
- low molecular weight polypeptides proteins such as serum albumin, gelatin and immunoglobulins, amino acids such as glycine, glutamine, asparagine, glutamic acid, aspartic acid, methionine, arginine and lysine, sugars and carbohydrates such as polysaccharides and monosaccharides , sugar alcohols such as mannitol and sorbitol.
- Injection solutions include, for example, physiological saline, isotonic solutions containing glucose and other adjuvants, such as D-sorbitol, D-mannose, D-mannitol and sodium chloride.
- Adjuvants such as alcohols (ethanol, etc.), polyalcohols (propylene glycol, PEG, etc.), nonionic surfactants (polysorbate 80, polysorbate 20, poloxamer 188, HCO-50) and the like may be used in combination.
- buffers used in solution formulations are prepared using substances to maintain the pH of the solution.
- the pH of the solution in the high-concentration antibody-containing solution formulation, is preferably 4.5 to 7.5, more preferably 5.0 to 7.0. More preferably 5 to 6.5.
- the buffering agents that can be used are those that can adjust the pH in this range and are pharmaceutically acceptable.
- buffers are known to those skilled in the art of solution formulation and include inorganic salts such as phosphate (sodium or potassium), sodium bicarbonate; citrate (sodium or potassium), sodium acetate, succinate Organic acid salts such as sodium phosphate; or acids such as phosphoric acid, carbonic acid, citric acid, succinic acid, malic acid, gluconic acid and the like can be used.
- inorganic salts such as phosphate (sodium or potassium), sodium bicarbonate; citrate (sodium or potassium), sodium acetate, succinate Organic acid salts such as sodium phosphate; or acids such as phosphoric acid, carbonic acid, citric acid, succinic acid, malic acid, gluconic acid and the like can be used.
- Tris and Good's buffers such as MES, MOPS, HEPES, histidine (eg histidine hydrochloride), glycine and the like may be used.
- the concentration of the buffering agent is generally 1-500 mmol/L, preferably 5-100 mmol/L, more preferably 10-20 mmol/L.
- the buffer preferably contains 5-25 mmol/L histidine, more preferably 10-20 mmol/L histidine.
- the high-concentration antibody-containing solution formulation is preferably stabilized by adding a suitable stabilizer for the antibody, which is the active ingredient.
- the "stable" high-concentration antibody-containing solution formulations are stored at refrigerated temperatures (2-8°C) for at least 12 months, preferably 2 years, more preferably 3 years; °C) for at least 3 months, preferably 6 months, more preferably 1 year, no significant changes are observed.
- the total amount of dimers and degradation products after storage at 5 ° C. for 2 years is 5.0% or less, preferably 2% or less, more preferably 1.5% or less, or after storage at 25 ° C. for 6 months
- the total amount of dimers and degradation products is 5.0% or less, preferably 2% or less, more preferably 1.5% or less.
- surfactants include nonionic surfactants such as sorbitan fatty acid esters such as sorbitan monocaprylate, sorbitan monolaurate, sorbitan monopalmitate; glycerin monocaprylate, glycerin monomyritate.
- nonionic surfactants such as sorbitan fatty acid esters such as sorbitan monocaprylate, sorbitan monolaurate, sorbitan monopalmitate; glycerin monocaprylate, glycerin monomyritate.
- glycerin fatty acid esters such as glycerin monostearate; polyglycerin fatty acid esters such as decaglyceryl monostearate, decaglyceryl distearate, decaglyceryl monolinoleate; polyoxyethylene sorbitan monolaurate, polyoxyethylene sorbitan monooleate , polyoxyethylene sorbitan monostearate, polyoxyethylene sorbitan monopalmitate, polyoxyethylene sorbitan trioleate, polyoxyethylene sorbitan fatty acid esters such as polyoxyethylene sorbitan tristearate; polyoxyethylene sorbitan tetrastearate, polyoxy polyoxyethylene sorbitol fatty acid esters such as ethylene sorbitol tetraoleate; polyoxyethylene glycerin fatty acid esters such as polyoxyethylene glyceryl monostearate; polyethylene glycol fatty acid esters such as polyethylene glycol distearate; Oxyethylene alky
- polyoxyethylene alkylphenyl ether polyoxyethylene hydrogenated castor oil such as polyoxyethylene castor oil, polyoxyethylene hydrogenated castor oil (polyoxyethylene hydrogenated castor oil); polyoxyethylene beeswax derivatives such as polyoxyethylene sorbitol beeswax; Polyoxyethylene lanolin derivatives such as polyoxyethylene lanolin; polyoxyethylene fatty acid amides such as polyoxyethylene stearamide having HLB 6-18; anionic surfactants such as sodium cetyl sulfate, sodium lauryl sulfate, oleyl Alkyl sulfates having an alkyl group of 10 to 18 carbon atoms, such as sodium sulfate; sodium polyoxyethylene lauryl sulfate, etc., having an average number of added moles of ethylene oxide of 2 to 4 and an alkyl group having 10 to 18 carbon atoms; certain polyoxyethylene alkyl ether sulfates; alkyl sulfosuccinate salts
- Preferred surfactants are polyoxyethylene sorbitan fatty acid esters and polyoxyethylene polyoxypropylene alkyl ethers, particularly preferred are polysorbates 20, 21, 40, 60, 65, 80, 81, 85 and Pluronic type Surfactants, most preferred are Polysorbate 20, 80 and Pluronic F-68 (Poloxamer 188).
- the amount of surfactant added to the antibody preparation is generally 0.0001-10% (mg/mL), preferably 0.001-5%, more preferably is 0.005-3%.
- the concentration of the surfactant in the antibody preparation (solution) is preferably 0.01 mg/mL or higher, in the range of 0.01-5 mg/mL, or 0.25-0. It is in the range of 75 mg/mL.
- the formulation of the present invention may optionally contain a cryoprotectant, a suspending agent, a solubilizing agent, a tonicity agent, a preservative, an antiadsorption agent, a diluent, an excipient, a pH adjuster, and a soothing agent.
- a cryoprotectant e.g., a cryoprotectant, a suspending agent, a solubilizing agent, a tonicity agent, a preservative, an antiadsorption agent, a diluent, an excipient, a pH adjuster, and a soothing agent.
- a cryoprotectant e.g., a suspending agent, e.g., a solubilizing agent, e.glycerin, glycerin, glycerin, glycerin, a glycerin, a glycerin, a glycerin, a glycerin, a glycer
- cryoprotectants include saccharides such as trehalose, sucrose and sorbitol.
- solution adjuvants include polyoxyethylene hydrogenated castor oil, polysorbate 80, nicotinic acid amide, polyoxyethylene sorbitan monolaurate, tuna gol, and castor oil fatty acid ethyl ester.
- isotonizing agents include sodium chloride, potassium chloride, calcium chloride and the like.
- preservatives include methyl parahydroxybenzoate, ethyl parahydroxybenzoate, sorbic acid, phenol, cresol, and chlorocresol.
- antiadsorption agents examples include human serum albumin, lecithin, dextran, ethylene oxide/propylene oxide copolymer, hydroxypropyl cellulose, methyl cellulose, polyoxyethylene hydrogenated castor oil, and polyethylene glycol.
- Sulfur-containing reducing agents such as N-acetylcysteine, N-acetylhomocysteine, thioctic acid, thiodiglycol, thioethanolamine, thioglycerol, thiosorbitol, thioglycolic acid and salts thereof, sodium thiosulfate, glutathione, carbon atoms Those having a sulfhydryl group such as thioalkanoic acids of numbers 1 to 7 can be mentioned.
- Antioxidants such as erythorbic acid, dibutylhydroxytoluene, butylhydroxyanisole, ⁇ -tocopherol, tocopherol acetate, L-ascorbic acid and its salts, L-ascorbic acid palmitate, L-ascorbic acid stearate, sodium bisulfite, sulfurous acid
- Chelating agents such as sodium, triamyl gallate, propyl gallate or disodium ethylenediaminetetraacetate (EDTA), sodium pyrophosphate, sodium metaphosphate and the like are included.
- containers filled with pharmaceutical formulations include syringes and cartridges.
- the container filled with the pharmaceutical formulation is a syringe, preferably a prefilled syringe.
- a "prefilled syringe” means a syringe in which a syringe as a container is filled with a liquid composition.
- the pre-filled syringe is filled with a pharmaceutical composition for administration to a patient.
- the syringe may be capped by a syringe closure, such as, but not limited to, a stopper.
- the composition is filled into syringes at a manufacturing filling facility.
- the syringe is sterilized prior to filling the composition into the syringe.
- the prefilled syringe is administered 1 day, or at least 7 days, or at least 14 days, or at least 1 month, or at least 6 months, or at least 1 year, or at least 2 years prior to administration of the composition to the patient. has a retention period of In some embodiments, the pre-filled syringe is exposed to storage and/or shipping conditions.
- a prefilled syringe as shown in FIG. 7, includes a syringe for administering a drug. Also, the prefilled syringe has a stopper that is inserted into the syringe. Additionally, the prefilled syringe includes an injection needle connected to the syringe. A prefilled syringe has a cap that caps the injection needle.
- a drug is a liquid drug, for example, a protein formulation.
- the syringe includes a cylindrically-shaped barrel having a distal end and a proximal end. Moreover, the syringe is substantially cylindrical.
- a barrel is a member that contains a drug inside.
- the barrel of this embodiment includes a distal end and a proximal end, as well as a cylindrical portion that connects the distal end and the proximal end (see FIG. 7). Further, the barrel has a flange portion extending outward (diametrically outward direction of the tubular portion) from the entire outer circumference of the other end of the tubular portion in the axial direction of the tubular portion.
- the barrel is transparent and made of a material that can withstand the internal pressure applied when administering the drug.
- the material of the barrel is a resin that simply includes repeating cyclic olefins such as norbornene.
- the material of the barrel is a transparent resin such as COP (cycloolefin polymer), which is a homopolymer of cyclic olefin, or COC (cycloolefin copolymer), which is a copolymer of cyclic olefin and ethylene.
- COP cyclolefin polymer
- COC cycloolefin copolymer
- the barrel may be made of PP (polypropylene) or glass.
- the inner surface of the barrel (for example, the inner surface of the cylindrical portion) may be coated with silicone oil as a lubricant in order to suppress the sliding resistance of the piston against the inner surface of the barrel.
- the silicone oil is polydimethylsiloxane.
- Some exemplary polydimethylsiloxanes include, for example, Dow Corning® 360 Medical Fluid with a viscosity of 350 centistokes; Dow Corning® 360 Medical Fluid with a viscosity of 1000 centistokes; Dow Corning® 360 Medical Fluid, including but not limited to Dow Corning® 360 Medical Fluid that is 12,500 centistokes and Dow Corning® MDX4-4159 fluid .
- the size (standard) of the capacity of the syringe is not particularly limited. Specifically, in one aspect of the present invention, the advantageous effect is remarkable in the case of a small size syringe with a capacity of 0.5 mL to 5.0 mL, preferably 1 mL. Also, the volume of the solution contained within a 1 mL standard syringe is in the range of 0.1 to 1.2 mL, preferably in the range of 0.2 to 1.1 mL. The volume of solution contained within a 2.5 mL standard syringe is in the range of 0.1-2.5 mL, preferably in the range of 0.3-2.3 mL.
- the volume of the aqueous solution contained within a 1 mL standard syringe is in the range of 0.1 to 1.2 mL, preferably in the range of 0.2 to 1.1 mL.
- the volume of aqueous solution contained within a 2.5 mL standard syringe is in the range of 0.1-2.5 mL, preferably in the range of 0.3-2.3 mL.
- the size (standard) of the cartridge capacity is not particularly limited.
- the volume may be from 0.5 mL to 20.0 mL, such as 1.0 mL, 1.5 mL, 1.8 mL, 2.0 mL, 2.2 mL, 3.0 mL, 5.0 mL, 10. It may be 0 mL, 15.0 mL, 20.0 mL, but is not limited to these amounts.
- the cartridge used is a standard injection cartridge made of plastic or glass.
- the dimensions and tolerances of glass injection cartridges are specified in the international standard ISO 13926-1. Stoppers and seals (caps and discs) are described in standard international standards ISO 13926-2 and 3. Dimensions and tolerances for ready-filled or pre-filled syringes are defined in international standard ISO 11040-4.
- the cartridge used is a plastic or glass injection cartridge that meets one or more of the above international standards.
- the cartridge used is a plastic or glass injection cartridge that does not meet international standards such as ISO.
- a method for preparing an injectable formulation of the invention includes adding a solution (e.g., antibody solution containing as an active ingredient). In one embodiment, the method for preparing an injectable preparation includes adding a solution (e.g., antibody solution containing as an active ingredient). In one embodiment, the filling of the solution into the container includes the stoppering of the container by means of a vacuum stopper arrangement or a mechanical stopper arrangement.
- HLA-DQA1 * 0501 has a C47S mutation, a GGGG linker (SEQ ID NO: 171) and a c-fos leucine zipper sequence (PNAS, 1998 Sep 29;95(20): 11828-33), and a Flag tag to HLA-DQA1 *. It is located at the C-terminus of 0501.
- HLA-DQB1 * 0201 is a 33mer gliadin peptide sequence: LQLQPFPQPELPYPQPELPYPQPELPYPQPQPF (SEQ ID NO: 172), and a factor X cleavage linker (Acta Crystallogr Sect F Struct Biol Cryst Commun.
- Conditioned media expressing HLA-DQ2.5/33mer gliadin peptide complexes were incubated with immobilized metal affinity chromatography (IMAC) resin and subsequently eluted with imidazole. After collecting the fraction containing the HLA-DQ2.5/33mer gliadin peptide complex, it was applied to a Superdex 200 gel filtration column (GE healthcare) equilibrated with 1 ⁇ PBS. Fractions containing the HLA-DQ2.5/33mer gliadin peptide complex were then pooled and stored at -80°C.
- IMAC immobilized metal affinity chromatography
- HLA-DQA1*0501 has a C47S mutation, a 3C protease-cleavable linker: LEVLFQGP (SEQ ID NO: 174) and a GGGG linker (SEQ ID NO: 171), and a c-fos leucine zipper sequence (PNAS, 1998 Sep 29;95(20) : 11828-33) and a Flag tag at the C-terminus of HLA-DQA1*0501.
- HLA-DQB1*0201 has the ⁇ 2 gliadin peptide sequence: IIQPEQPAQLP (SEQ ID NO: 175), and a factor X cleavage linker (Acta Crystallogr Sect F Struct Biol Cryst Commun.
- HLA-DQ2.5/ ⁇ 2 gliadin peptide complexes were transiently expressed using the FreeStyle293-F cell line.
- Conditioned media expressing HLA-DQ2.5/ ⁇ 2 gliadin peptide complexes were incubated with IMAC resin and subsequently eluted with imidazole.
- Fractions containing HLA-DQ2.5/ ⁇ 2 gliadin peptide complexes were collected and applied to a Superdex 200 gel filtration column equilibrated with 1 ⁇ PBS. Fractions containing the HLA-DQ2.5/ ⁇ 2 gliadin peptide complex were then pooled and stored at -80°C.
- HLA-DQA1*0501 has a C47S mutation, a 3C protease-cleavable linker: LEVLFQGP (SEQ ID NO: 174) and a GGGG linker (SEQ ID NO: 171), and a c-fos leucine zipper sequence (PNAS, 1998 Sep 29;95(20) : 11828-33) and a Flag tag at the C-terminus of HLA-DQA1*0501.
- HLA-DQB1*0201 has a BC hordein peptide sequence: EPEQPIPEQPQPYPQQP (SEQ ID NO: 176), and a factor X cleavage linker (Acta Crystallogr Sect F Struct Biol Cryst Commun.
- Recombinant HLA-DQ2.5/BC hordein peptide complexes were transiently expressed using the FreeStyle293-F cell line.
- Conditioned media expressing HLA-DQ2.5/BC hordein peptide complexes were incubated with IMAC resin and subsequently eluted with imidazole.
- Fractions containing the HLA-DQ2.5/BC hordein peptide complex were collected and applied to a Superdex 200 gel filtration column equilibrated with 1 ⁇ PBS. Fractions containing the HLA-DQ2.5/BC hordein peptide complex were then pooled and stored at -80°C.
- Example 2 2.1 HLA-DQ2.5, HLA-DQ2.2, HLA-DQ7.5, HLA-DQ8, HLA-DQ5.1, HLA-DQ6.3, HLA-DQ7.3, HLA-DR, and HLA-DP Establishment of Ba/F3 cell lines expressing HLA-DQA1*0501 cDNA (IMGT/HLA Accession No. HLA00613), HLA-DQA1*0201 cDNA (IMGT/HLA Accession No. HLA00607), HLA-DQA1*0505 cDNA (IMGT/HLA Accession No. HLA00607) HLA Accession No. HLA00619), HLA-DQA1*0301 cDNA (IMGT/HLA Accession No.
- HLA00608 HLA-DQA1*0101 cDNA (IMGT/HLA Accession No. HLA00601), HLA-DQA1*0103 cDNA (IMGT/HLA Accession No. HLA00601) HLA00604), HLA-DQA1*0303 cDNA (IMGT/HLA Accession No. HLA00611), HLA-DRA1*0101 cDNA (GenBank Accession No. NM_019111.4), or HLADPA1*0103 cDNA (IMGT/HLA Accession No. HLA00499) ) was inserted into the expression vector pCXND3 (WO2008/156083).
- HLA-DQB1*0201 cDNA (IMGT/HLA Accession No. HLA00622), HLA-DQB1*0202 cDNA (IMGT/HLA Accession No. HLA00623), HLA-DQB1*0301 cDNA (IMGT/HLA Accession No. HLA00625), HLA- DQB1*0302 cDNA (IMGT/HLA Accession No. HLA00627), HLA-DQB1*0501 cDNA (IMGT/HLA Accession No. HLA00638), HLA-DQB1*0603 cDNA (IMGT/HLA Accession No.
- HLA00647 HLA-DRB1* 0301 cDNA (IMGT/HLA Accession No. HLA00671) or HLA-DPB1*0401 cDNA (IMGT/HLA Accession No. HLA00521) was inserted into the expression vector pCXZD1 (US/20090324589).
- Each established cell line was named as follows: Ba/F3-HLA-DQ2.5 (HLA-DQA1*0501, HLA-DQB1*0201), Ba/F3-HLA-DQ2.2 (HLA-DQA1 *0201, HLA-DQB1*0202), Ba/F3-HLA-DQ7.5 (HLA-DQA1*0505, HLA-DQB1*0301), Ba/F3-HLA-DQ8 (HLA-DQA1*0301, HLA-DQB1 *0302), Ba/F3-HLA-DQ5.1 (HLA-DQA1*0101, HLA-DQB1*0501), Ba/F3-HLA-DQ6.3 (HLA-DQA1*0103, HLA-DQB1*0603), Ba/F3-HLA-DQ7.3 (HLA-DQA1*0303, HLA-DQB1*0301), Ba/F3-HLA-DR (HLA-DR
- HLA-DQ2.5/CLIP peptide HLA-DQ2.5/Hepatitis B virus peptide, HLA-DQ2.5/Salmonella peptide, HLA-DQ2.5/Tyroperoxidase peptide, HLA-DQ2.5/Mycobacterium ⁇ Bovis peptide, HLA-DQ2.5/ ⁇ 1 gliadin peptide, HLA-DQ2.5/ ⁇ 2 gliadin peptide, HLA-DQ2.5/ ⁇ 1 gliadin peptide, HLA-DQ2.5/ ⁇ 2 gliadin peptide, HLA-DQ2.5/ ⁇ 1 gliadin peptide, HLA-DQ2.5/ ⁇ 2 gliadin peptide, HLA-DQ2.5/BC hordein peptide, HLA-DQ2.5/ ⁇ 3 gliadin peptide, HLA-DQ2.5/ ⁇ 1b gliadin peptide, HLA-DQ2.5/ ⁇ 4a Gliadin P
- HLA-DQB1*0201 cDNA (IMGT/HLA accession number HLA00622) was inserted into the expression vector pCXZD1 (US/20090324589).
- HLA-DQ2.5/HLA-DQB1*0201 for each peptide complex was obtained from each peptide sequence and a factor X cleavage linker (Acta Crystallogr Sect F Struct Biol Cryst Commun. 2007 Dec 1; 63(Pt 12): 1021 -1025.) at the N-terminus of HLA-DQB1*0201.
- KLPPKPPKPVSKMRMATPLLMQALPMGALP (SEQ ID NO: 177) was used for the CLIP (hCLIP) peptide sequence
- PDRVHFASPLHVAWR (SEQ ID NO: 178) was used for the hepatitis B virus peptide sequence.
- MMAWRMMRY SEQ ID NO: 179 for Salmonella peptide sequences
- YIDVWLGGLAENFLPY SEQ ID NO: 180
- KPLLIIAEDVEGEY SEQ ID NO: 1 for Mycobacterium bovis peptide sequences
- QPFPQPELPYP SEQ ID NO: 182 for ⁇ 1 gliadin peptide sequences
- used FPQPELPYPQP SEQ ID NO: 183 for ⁇ 2 gliadin peptide sequences
- QPQQSFPEQQQ for ⁇ 1 gliadin peptide sequences.
- QPYPEQEEPFV (SEQ ID NO: 193) for Avenin 1 peptide sequences; use QPYPEQEQPFV (SEQ ID NO: 194) for Avenin 2 peptide sequences; use QPYPEQEQPIL (SEQ ID NO: 194) for Avenin 3 peptide sequences 195); for hordein 1 peptide sequences use PQQPFPQPEQPFRQ (SEQ ID NO: 196); for hordein 2 peptide sequences use QEFPQPEQPFPQQP (SEQ ID NO: 197); for secalin 1 peptide sequences use QPFPQPEQPFPQSQ (SEQ ID NO: 199) for secalin 2 peptide sequences; use PQQQTLQPEQPAQLP (SEQ ID NO: 200) for 14mer 1 peptide sequences; 33mer gliadin LQLQPFPQPELPYPQPELPYPQPELPYPQPQPF
- HLA-DQA1*0501-pCXND3 and HLA-DQB1*0201/each peptide-pCXZD1, respectively, were isolated into mouse IL-3-dependent pro-B cell-derived cell lines by electroporation (LONZA, 4D-Nucleofector X). Simultaneously introduced into Ba/F3. Transfected cells were then cultured in medium containing geneticin and zeocin.
- HLA-DQ2.5/CLIP HLA-DQA1*0501, HLA-DQB1*0201 of HLA-DQ2.5/CLIP peptide
- Ba/ F3-HLA-DQ2.5/HBV1 HLA-DQA1*0501, HLA-DQ2.5/HLA-DQB1*0201 of hepatitis B virus peptide
- Ba/F3-HLA-DQ2.5/Salmonella HLA-DQA1 *0501, HLA-DQ2.5/HLA-DQB1 of salmonella peptide*0201
- Ba/F3-HLA-DQ2.5/TPO HLA-DQA1*0501, HLA-DQ2.5/HLA-DQB1 of tyroperoxidase peptid
- HLA-DQA1*0501, HLA-DQ2.5/ ⁇ 1 gliadin peptide HLA-DQB1*0201 Ba/F3-HLA-DQ2.5/ ⁇ 2 gliadin (HLA-DQA1*0501, HLA- DQ2.5/ ⁇ 2 gliadin peptide HLA-DQB1*0201), Ba/F3-HLA-DQ2.5/ ⁇ 1 gliadin (HLA-DQA1*0501, HLA-DQ2.5/ ⁇ 1 gliadin peptide HLA-DQB1*0201)
- Ba/F3-HLA-DQ2.5/ ⁇ 2 gliadin Ba/F3-HLA-DQ2.5/ ⁇ 2 gliadin (HLA-DQA1*0501, HLA-DQB1*0201 of HLA-DQ2.5/ ⁇ 2 gliadin peptide)
- Ba/F3-HLA-DQ2.5/ ⁇ 1 gliadin HLA-DQA1*0501
- Example 3 Identification of lead antibodies Anti -DQ2.5 lead antibodies DQN0344xx (heavy chain: DQN0344Hx, SEQ ID NO:71 and light chain: DQN0344Lx, SEQ ID NO:75) and DQN0385ee (heavy chain: DQN0385He, SEQ ID NO:79 and light chain: DQN0385Le, SEQ ID NO:83) was selected according to the procedure described in WO2019069993.
- VH 49 types were designed by replacing the DQN0344Hx and DQN0385He frameworks with human germline frameworks (SEQ ID NOs: 1, 2, 3, 4, 5, 6, or 7 as FR1, for DNQ0344Hx as FR2 SEQ ID NO:9 and SEQ ID NO:10 for DQN0385He, SEQ ID NO:11, 12, 13, 14, 15, 16, or 17 as FR3, SEQ ID NO:18 for DNQ0344Hx as FR4 and SEQ ID NO:18 for DQN0385He 19).
- VLs Sixteen types of VLs were designed by replacing the frameworks of DQN0344Lx and DQN0385Le with human germline frameworks (SEQ ID NO: 20, 21, 22, or 23 as FR1, SEQ ID NO: 24 and SEQ ID NO: 34 for DQN0385Le, SEQ ID NO: 26, 27, 28, or 29 as FR3, SEQ ID NO: 30 as FR4).
- Polynucleotides encoding DQN0344Hx, DQN0385He and the designed VH were each cloned into an expression vector containing a polynucleotide encoding the heavy chain constant region SG1 (SEQ ID NO:31).
- Polynucleotides encoding DQN0344Lx, DQN0385Le and the designed VL were each cloned into an expression vector containing a polynucleotide encoding the light chain constant region SK1 (SEQ ID NO:32). Heavy chains containing DQN0344Hx or DQN0385He with their respective designed VHs were then transiently incubated with their corresponding light chains DQN0344Lx, DQN0385Le, or their respective designed VLs in Expi293 (Invitrogen). Expression was followed by Protein A purification.
- the binding profiles of these antibodies to HLA-DQ2.5/multiple gluten peptides were evaluated by FCM analysis.
- the binding activity of each antibody is expressed by the mean fluorescence intensity value (MFI).
- Antibodies were incubated with HLA-DQ2.5-gluten peptide-Ba/F3 cells for 30 minutes at room temperature and washed with FACS buffer (2% FBS, 2 mM EDTA in PBS).
- Goat F(ab')2 anti-human IgG, mouse ads-PE (Southern Biotech, catalog number 2043-09) was then added and incubated in the dark at 4°C for 20 minutes followed by washing. Data collection was performed on an LSRFortessa X-20 (Becton Dickinson) and subsequently analyzed using FlowJo software (Tree Star) and Microsoft Office Excel2013.
- DQN0344xx and DQN0385ee were humanized but CDRH1 commonly found in rabbit antibody sequences (position 35a according to Kabat numbering, Kabat et al., Sequence of proteins of immunological interest, 5th Ed., Public Health Service, National Institutes of Health, Bethesda, MD (1991)) and two cysteine residues located at CDRH2 (position 50 according to Kabat numbering) could lead to heterogeneity in disulfide bond formation. Therefore, replacement of these cysteine residues with other amino acids was performed.
- substitutions significantly decreased binding affinity to HLA-DQ2.5/gluten peptides and/or decreased antibody expression levels.
- S32A, N73T, and D95E were introduced into DQN034425H; N28E, A55Y, S56E, H92E, I94V, and N95aA were introduced into DQN034409L; and A25T, L54K, and S67L were introduced into DQN0385ee009L.
- R16G, S61K, K64E and L102V were introduced into DQN034425H and S31E and I35M into DQN0385ee0054H.
- R16G and K64E were introduced into DQN034425H; S56Y was introduced into DQN034409L; T28E, S30A, S61E, and G65E were introduced into DQN0385ee0054H, and S56E and Y94K into DQN0385ee009L.
- S30E, N64E were introduced into DQN0385ee0054H to lower the pI, and E79Q was introduced into DQN0385ee009L to lower the negative charge.
- bispecific antibodies were generated that exhibit broad cross-reactive binding to multiple HLA-DQ2.5/gluten peptide complexes. Thirteen multiplex gluten peptide-selective HLA-DQ2.5 bivalent antibodies were used to generate bispecific antibodies (DQN0344xx, DQN0385ee, DQN034425H/09L, DQN0385ee0054H/009L, DQN0344H0976/L0591, DQN0344H1013/L0620 , DQN0385H1270/L0722, DQN0385H1521/L0605, DQN0385H1270/L0681, DQN0385H1352/L0681, DQN0385H1527/L0605, DQN0385H1353/L0681, and DQN0585H1605).
- bispecific antibodies were produced by Fab arm exchange technology.
- bispecific antibodies can also be produced by transfecting plasmids of two different heavy chains and two different light chains into mammalian cells.
- amino acid substitutions and combinations at the CHI-CL domain interface that promote the desired H chain-L chain association (WO2019065795).
- Such constant regions dasheavy chain constant region for DQN0344 arm: SEQ ID NO: 162, light chain constant region for DQN0344 arm: SEQ ID NO: 106, heavy chain constant region for DQN0385 arm: SEQ ID NO: 163, DQN0385 arm
- Light chain constant region for HLA-DQ2.5/multiple gluten peptides SEQ ID NO: 107.
- Full length SEQ ID NOs are summarized in Tables 2-3 to 2-6) are known to exhibit similar binding properties to
- Example 4 Binding analysis of antibodies to class II HLA
- Figures 1-1 to 1-16 show a panel of Ba/F3 cell lines expressing HLA-DQ in the form of complexes with several peptides measured by FACS. Binding of each anti-HLA-DQ antibody is shown.
- Anti-HLA-DQ antibody at 50 ng/mL and control DQN0139bb and IC17dK antibodies at 1 ⁇ g/mL were incubated with each cell line for 30 minutes at room temperature. Exceptions are for DQN0344H0976/L0591//DQN0385H1521/L0605-F6, DQN0344H0976/L0591//DQN0385H1353/L0681-F6, and DQN0344H1013/L0620//DQN0385H1255/L060 for DQN0344H1013/L0620//DQN0385H1255/L060 For Ba/F3-HLA-DQ2.5/CLIP only, these anti-HLA-DQ antibodies were used at 313 ng/mL and the respective control DQN0139bb and IC17dK antibodies were used at 20 ⁇ g/mL.
- FACS buffer 2% FBS, 2 mM EDTA in PBS.
- Goat F(ab')2 anti-human IgG, mouse ads-PE was then added and incubated for 20 minutes at 4°C, followed by washing with FACS buffer.
- Data collection was performed on an LSRFortessa X-20 (Becton Dickinson) and subsequently analyzed using FlowJo software (Tree Star) and Microsoft Office Excel2013.
- the %MFI of the antibody was determined by setting the MFI value of IC17dK to 0% and the MFI value of DQN0139bb to 100%.
- Figures 1-1 to 1-13 show 13 bispecific anti-HLA-DQ antibodies (variants DQN0344H0976/L0591//DQN0385H1270/L0722-F6, DQN0344H0976/L0591) against a panel of Ba/F3 cell lines as described above.
- Figures 1-15 and 1-16 are the positive binding control (DQN0139bb) and negative binding control (IC17dK), respectively.
- FIG. 2 shows the binding of each anti-HLA-DQ antibody to HLA-DQ2.5-positive PBMC-B cells measured by FACS.
- Human FcR blocking reagent (Miltenyi, catalog number 130-059-901) was added and incubated at 4°C for 10 minutes.
- Anti-HLA-DQ antibody at 50 ng/mL and control DQN0139bb and IC17dK antibodies at 1 ⁇ g/mL were incubated with each cell line for 30 minutes at room temperature.
- FACS buffer 2% FBS, 2 mM EDTA in PBS.
- Biotin-conjugated anti-human antibody Chougai, BIO12-deltaGK Ab
- Pacific BlueTM anti-human CD19 antibody mouse IgG1k Biolegend, catalog number 302232
- PE-streptavidin Biolegend, cat#405203 was added and incubated for 15 minutes at 4°C, which was then washed with FACS buffer.
- the %MFI of the antibody was determined by setting the MFI value of IC17dk to 0% and the MFI value of DQN0139bb to 100%.
- Figure 2 shows 13 bispecific anti-HLA-DQ antibodies (variants DQN0344H0976/L0591//DQN0385H1270/L0722-F6, DQN0344H0976/L0591//DQN0385H1270/L0681-F6, DQN0344H0976/L06N85F0591//DQN0385H1270/L0681-F6, ⁇ DQN0344H0976/L0591//DQN0385H1527/L0605-F6 ⁇ DQN0344H0976/L0591//DQN0385H1255/L0605-F6 ⁇ DQN0344H1013/L0620//DQN0385H1270/L0722-F6 ⁇ DQN0344H1013/L0620//DQN0385H1521/L0605-F6 ⁇ DQN0344H1013/L0620//DQN0385H1521/L0605-F6
- Example 6 Establishment of ⁇ TCR KO Jurkat NFAT-Luc cell line
- a ribonucleoprotein (RNP) complex (Takara Bio) was introduced into the NFAT-RE-luc2 Jurkat cell line (Promega Corporation, CS176401) by electroporation (LONZA, Nucleofector 2b). All single guide RNAs for the TCR ⁇ and TCR ⁇ chains were mixed and introduced simultaneously.
- RNP-transduced cells were cultured in media containing hygromycin B, followed by single-cell cloning on a FACS Aria III (Becton, Dickinson and Company).
- TCR KO Jurkat NFAT-Luc The sequences of the TCR ⁇ and TCR ⁇ chains were then checked to identify clones derived from Jurkat NFAT-Luc in which the TCR ⁇ and TCR ⁇ chains were knocked out.
- the established clone was named TCR KO Jurkat NFAT-Luc.
- HLA-DQ2.5/ ⁇ 1 gliadin-restricted TCR TCC ID: 387.9
- HLA-DQ2.5/ ⁇ 1b gliadin-restricted TCR TCC ID: 370.2.25
- HLA-DQ2.5/ ⁇ 1 gliadin-restricted TCR TCC ID: 442D.A.2
- HLA-DQ2.5/ ⁇ 2 gliadin-restricted TCR TCC ID: 578.42
- HLA-DQ2.5/ ⁇ 1 gliadin-restricted TCR TCC ID: 820.27
- TCR beta chain sequence was linked to the corresponding TCR alpha chain sequence by a 2A self-cleaving peptide sequence (P2A, amino acid sequence: GSGATNFSLLKQAGDVEENPGP, SEQ ID NO:203).
- HLA-DQ2.5/ ⁇ 2 gliadin-restricted TCRs and HLA-DQ2.5/ ⁇ 2 gliadin-restricted TCRs all TCR ⁇ and TCR ⁇ chains have their own native signal peptide sequences.
- the native signal sequence of the HLA-DQ2.5/ ⁇ 2 gliadin-restricted TCR was replaced by the Campath signal sequence (MGWSCIILFLVATATGVHS, SEQ ID NO: 170).
- a Campath signal sequence was also attached to the N-terminus of the HLA-DQ2.5/ ⁇ 2 gliadin-restricted TCR.
- Each codon-optimized TCR beta chain-P2A-TCR alpha chain cDNA was then inserted into the expression vector pCXZD1 (US/20090324589) with Genscript. Electroporation of the vector into ⁇ TCR-KO Jurkat-NFAT-luc2 was performed by following the protocol of the SE Cell Line 4D-NucleofectorTM Kit.
- Anti-HLA where the average counts per second (cps) of wells in the absence of antigenic peptide without antibody was taken as 100% and the cps of wells in the presence of antigen without antibody was taken as 0%
- the inhibitory effect (%) of the DQ antibody was determined.
- IC50 values were determined using the XLfit Excel add-in software (IDBS).
- Anti-HLA where the average counts per second (cps) of wells in the absence of antigenic peptide without antibody was taken as 100% and the cps of wells in the presence of antigen without antibody was taken as 0%
- the inhibitory effect (%) of the DQ antibody was determined.
- IC50 values were determined using the XLfit Excel add-in software (IDBS).
- the 10 tested anti-HLA-DQ antibodies relied specifically on the ⁇ 2 gliadin peptide, the BC hordein peptide, the ⁇ 1 gliadin peptide, the ⁇ 2 gliadin peptide, the ⁇ 4a gliadin peptide, and the ⁇ 4d gliadin peptide. It showed an inhibitory effect (neutralizing activity) on Jurkat T cell activation. Prior antibodies prior to the modification of the present invention showed no neutralizing activity against these gluten peptides. That is, the antigen-binding molecules of the present invention have enhanced cross-reactivity to gluten peptides compared to before modification.
- Example 7 Example 7-1 Anti-HLA-DQ2.5 Binding to Human HLA-DQ2.5/33mer Gliadin Peptide Complexes, HLA-DQ2.5/ ⁇ 2 Gliadin Peptide Complexes, and HLA-DQ2.5/BC-Holding Gliadin Peptide Complexes at pH 7.4 Antibody affinities were measured at 37° C. using a Biacore 8k instrument (GE Healthcare). An anti-human Fc antibody (GE Healthcare) was immobilized on all flow cells of the CM4 sensor chip using an amine coupling kit (GE Healthcare).
- All antibodies and analytes were prepared in ACES pH 7.4 containing 20 mM ACES, 150 mM NaCl, 0.05% Tween 20, 0.005% NaN3 . Each antibody was captured on the sensor surface by an anti-human Fc antibody. The antibody capture level was aimed at 200 resonance units (RU).
- Human HLA-DQ2.5/33mer gliadin peptide complexes were injected at 12.5-200 nM prepared by 2-fold serial dilutions followed by dissociation.
- Human HLA-DQ2.5/ ⁇ 2 gliadin peptide complexes were injected at 25-400 nM prepared by two-fold serial dilutions followed by dissociation.
- Human HLA-DQ2.5/BC-hordein gliadin peptide complexes were injected at 25-400 nM prepared by 2-fold serial dilutions followed by dissociation. The sensor surface was regenerated with 3M MgCl2 each cycle. Binding affinities were determined by processing data and fitting to a 1:1 binding model using Biacore Insight Evaluation software (GE Healthcare).
- Affinity of anti-HLA-DQ2.5 antibodies binding to human HLA-DQ2.5/33mer gliadin peptide complexes, HLA-DQ2.5/ ⁇ 2 gliadin peptide complexes, and HLA-DQ2.5/BC-hordein gliadin peptide complexes. are shown in Table 3-1.
- Example 7-2 The affinity of anti-HLA-DQ2.5 antibodies binding to 33mer gliadin peptides at pH 7.4 was measured at 25°C using a Biacore 8k instrument (GE Healthcare). An anti-human Fc antibody (GE Healthcare) was immobilized on all flow cells of the CM4 sensor chip using an amine coupling kit (GE Healthcare). All antibodies and analytes were prepared in ACES pH 7.4 containing 20 mM ACES, 150 mM NaCl, 0.05% Tween 20, 0.005% NaN3 . Each antibody was captured on the sensor surface by an anti-human Fc antibody. The antibody capture level was aimed at 600 resonance units (RU).
- RU 600 resonance units
- Example 8 Establishment of ⁇ / ⁇ TCR KO Jurkat NFAT-Luc Cell Line Ribonucleoprotein (RNP) complex composed of Cas9 and a single guide RNA targeting the TCR constant region (Blood. 2018;131:311-22.) was introduced into the NFAT-RE-luc2 Jurkat cell line (Promega corporation, CS176401) by electroporation (LONZA, Nucleofector 2b). All single guide RNAs for the TCR ⁇ and TCR ⁇ chains were mixed and introduced simultaneously. RNP-transduced cells were cultured in media containing hygromycin B, followed by single-cell cloning on a FACS Aria III (Becton, Dickinson and Company).
- RNP ⁇ / ⁇ TCR KO Jurkat NFAT-Luc Cell Line Ribonucleoprotein
- TCR KO Jurkat NFAT-Luc The sequences of the TCR ⁇ and TCR ⁇ chains were then checked to identify clones derived from Jurkat NFAT-Luc in which the TCR ⁇ and TCR ⁇ chains were knocked out.
- the established clone was named TCR KO Jurkat NFAT-Luc.
- HLA-DQ2.5/ ⁇ 1a gliadin-restricted TCR (TCC ID: 387.9), HLA-DQ2.5/ ⁇ 1b gliadin-restricted TCR (TCC ID: 370.2.25), HLA-DQ2.5/ ⁇ 1 gliadin-restricted TCR ( TCC ID: 442D.A.2), HLA-DQ2.5/ ⁇ 2 gliadin-restricted TCR (TCC ID: 578.42), HLA-DQ2.5/ ⁇ 1 gliadin-restricted TCR (TCC ID: 820.27), HLA-DQ2.
- HLA-DQ2.5/ ⁇ 2 gliadin-restricted TCR was obtained from Nat Struct Mol Biol. 2014;21:480-8, HLA-DQ2.
- Amino acid sequence information for the 5/BC hordein-restricted TCR was obtained from Eur J Immunol. 2020; 50: 256-269.
- TCR beta chain sequence was linked to the corresponding TCR alpha chain sequence by a 2A self-cleaving peptide sequence (P2A, amino acid sequence: GSGATNFSLLKQAGDVEENPGP, SEQ ID NO:203).
- HLA-DQ2.5/ ⁇ 2 gliadin-restricted TCRs and HLA-DQ2.5/ ⁇ 2 gliadin-restricted TCRs all TCR ⁇ and TCR ⁇ chains have their own native signal peptide sequences.
- the native signal sequence of the HLA-DQ2.5/ ⁇ 2 gliadin-restricted TCR was replaced by the Campath signal sequence (MGWSCIILFLVATATGVHS, SEQ ID NO: 170).
- a Campath signal sequence was also attached to the N-terminus of the HLA-DQ2.5/ ⁇ 2 gliadin-restricted TCR.
- Each codon-optimized TCR beta chain-P2A-TCR alpha chain cDNA was then inserted into the expression vector pCXZD1 (US/20090324589) with Genscript. Electroporation of the vector into ⁇ TCR-KO Jurkat-NFAT-luc2 was performed by following the protocol of the SE Cell Line 4D-NucleofectorTM Kit.
- Anti-HLA where the average counts per second (cps) of wells in the absence of antigenic peptide without antibody was taken as 100% and the cps of wells in the presence of antigen without antibody was taken as 0% The inhibitory effect (%) of the DQ antibody was determined. IC50 values were determined using the XLfit Excel add-in software (IDBS).
- Anti-HLA where the average counts per second (cps) of wells in the absence of antigenic peptide without antibody was taken as 100% and the cps of wells in the presence of antigen without antibody was taken as 0%
- the inhibitory effect (%) of the DQ antibody was determined.
- IC50 values were determined using the XLfit Excel add-in software (IDBS).
- Anti-HLA where the average counts per second (cps) of wells in the absence of antigenic peptide without antibody was taken as 100% and the cps of wells in the presence of antigen without antibody was taken as 0%
- the inhibitory effect (%) of the DQ antibody was determined.
- IC50 values were determined using the XLfit Excel add-in software (IDBS).
- Anti-HLA where the average counts per second (cps) of wells in the absence of antigenic peptide without antibody was taken as 100% and the cps of wells in the presence of antigen without antibody was taken as 0%
- the inhibitory effect (%) of the DQ antibody was determined.
- IC50 values were determined using the XLfit Excel add-in software (IDBS).
- Example 9 9.1 Establishment of ⁇ TCR KO Jurkat NFAT-Luc cell line transiently expressing HLA-DQ2.5/gluten peptide-restricted TCR. Obtained from Amino acid sequence information for HLA-DQ2.5/ ⁇ 1a gliadin-restricted TCR (TCC ID: 387.9) was obtained from Oslo University under a material transfer agreement. Amino acid sequence information of HLA-DQ2.5/ ⁇ 2 gliadin-restricted TCR (HLA-DQ2.5/ ⁇ 2 gliadin-restricted TCR) was obtained from Nat Struct Mol Biol. 2014;21:480-8.
- TCRs are HLA-DQ2.5-restricted, but cross-reactive to HLA-DQ2.2 when HLA-DQ2.2 is in the form of complexes with ⁇ 1a and ⁇ 2 gliadin. Yes ( Figures 5-1 and 5-2).
- Each TCR beta chain sequence was linked to the corresponding TCR alpha chain sequence by a 2A self-cleaving peptide sequence (P2A, amino acid sequence: GSGATNFSLLKQAGDVEENPGP, SEQ ID NO:203).
- P2A amino acid sequence: GSGATNFSLLKQAGDVEENPGP, SEQ ID NO:203.
- the TCR ⁇ and TCR ⁇ chains of HLA-DQ2.5/ ⁇ 1a gliadin-restricted TCRs have their own native signal peptide sequences.
- a Campath signal sequence (MGWSCIILFLVATATGVHS, SEQ ID NO: 170) was attached to the N-terminus of the HLA-DQ2.5/ ⁇ 2 gliadin-restricted TCR.
- Each codon-optimized TCR beta chain-P2A-TCR alpha chain cDNA was then inserted into the expression vector pCXZD1 (US/20090324589) with Genscript. Electroporation of the vector into ⁇ TCR-KO Jurkat-NFAT-luc2 was performed by following the protocol of the SE Cell Line 4D-NucleofectorTM Kit.
- HLA-DQ2.2+ Human Blood B Booster B Cells HBBB2.2
- HLA-DQ2.2+ PBMCs Precision for Medicines. Isolated B cells were then immortalized by using Human Blood B Booster® (DENDRITICS).
- DQN0344H0976/L0591//DQN0385H1255/L0605-F6.v2 DQN0344H1013/L0620//DQN0385H1521/L0605-F6.v2
- DQN0344H1013/L0620//DQN0385H1521/L0605-F6.v2 as shown in Figures 5-3 to 5-4 and Table 5 -F6.v2 mediated concentration-dependent neutralization of HLA-DQ2.2/ ⁇ 1 and ⁇ 2 gliadin.
- DQN0344H0976/L0591//DQN0385H1255/L0605-F6.v2 DQN0344H1013/L0620//DQN0385H1521/L0605-F6.v2, DQN0344H1013//L0620 as shown in Figures 4-1 to 5-4 and Tables 4 and 5 DQN0385H1270/L0681-F6.v2 mediated concentration-dependent neutralization against all tested gluten epitopes.
- DQN0344H0976/L0591//DQN0385H1255/L0605-F6.v2 DQN0344H1013/L0620//DQN0385H1521/L0605-F6.v2, DQN0344H1013/L06N0/8
- the neutralizing activity of F6.v2 was comparable to that of DQN0344H0976/L0591//DQN0385H1255/L0605-F6, DQN0344H1013/L0620//DQN0385H1521/L0605-F6, and DQN0344H1013/L0620//DQN0385H681-F687, respectively. .
- Example 10 Counting Visually Detectable Particles
- the anti-HLA-DQ2.5 bispecific antibody of the present invention, mAb6 an alias for DQN0344H0976/L0591//DQN0385H1255/L0605-F6.v2.
- the antibody-containing solution 50 mg / mL, buffer: 20 mmol /L histidine, stabilizer: 150 mmol/L arginine and 162 mmol/L aspartic acid, surfactant: 0.01 mg/mL poloxamer 188, pH 6.0
- the antibody-containing solution 50 mg / mL, buffer: 20 mmol /L histidine, stabilizer: 150 mmol/L arginine and 162 mmol/L aspartic acid, surfactant: 0.01 mg/mL poloxamer 188, pH 6.0
- kGy A sterilized 27G needle-equipped COP syringe (1 mL standard) was filled with 1.0 mL of the solution and capped with a stopper.
- Visually detectable particle evaluation 1 was performed on the filled and capped samples immediately after capping, and samples judged to contain visually detectable particles in the syringe were excluded. Since mAb6 had a high degree of instability and the frequency of generation of visually detectable particles immediately after filling was extremely high, three tubes of each were subjected to the test. Samples having bubble volumes of 120 ⁇ L and 10 ⁇ L at 1 atm and 25° C. were prepared by adjusting the stopper position of the syringe based on a calibration curve prepared by the following bubble volume measurement and setting method. Visually Detectable Particle Rating 2 was performed on each bubble volume sample after 1 day storage at 5°C.
- [Visually detectable particle evaluation 1] Clean the outer surface of the sample syringe container and perform a visual inspection with the naked eye for about 30 seconds by gently swirling or overturning the syringe in front of a black background at a brightness of about 10000 lx directly below a white light source. The presence or absence of visually detectable particles in the solution filled in the syringe was examined by performing a test.
- [Visually detectable particle evaluation 2] Clean the outer surface of the sample syringe container and perform a visual inspection for approximately 30 seconds by gently swirling or tipping the syringe in front of a black background at a brightness of approximately 8000 lx directly below a white light source. was examined for the presence or absence of visually detectable particles in the solution filled in the syringe. For samples in which the presence of visually detectable particles is recognized, gently swirl or tip over in front of a black background at a position of about 8000 lx brightness directly under a white light source, and visually inspect the syringe with the naked eye. The number of detectable particles was counted.
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Engineering & Computer Science (AREA)
- Public Health (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Veterinary Medicine (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Immunology (AREA)
- Epidemiology (AREA)
- Organic Chemistry (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Biophysics (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Physics & Mathematics (AREA)
- Biochemistry (AREA)
- Molecular Biology (AREA)
- Spectroscopy & Molecular Physics (AREA)
- Medical Informatics (AREA)
- Oil, Petroleum & Natural Gas (AREA)
- Genetics & Genomics (AREA)
- Hematology (AREA)
- Bioinformatics & Computational Biology (AREA)
- Mycology (AREA)
- Theoretical Computer Science (AREA)
- Evolutionary Biology (AREA)
- Microbiology (AREA)
- Biotechnology (AREA)
- Vascular Medicine (AREA)
- Anesthesiology (AREA)
- Biomedical Technology (AREA)
- Heart & Thoracic Surgery (AREA)
- Crystallography & Structural Chemistry (AREA)
- Inorganic Chemistry (AREA)
- Dermatology (AREA)
Priority Applications (10)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN202280080532.3A CN118369115A (zh) | 2021-10-08 | 2022-10-06 | 抗hla-dq2.5抗体的药物制剂 |
| MX2024004112A MX2024004112A (es) | 2021-10-08 | 2022-10-06 | Formulacion de farmaco de anticuerpo anti-hla-dq2.5. |
| JP2022562975A JP7220335B1 (ja) | 2021-10-08 | 2022-10-06 | 抗hla-dq2.5抗体の製剤 |
| AU2022361874A AU2022361874A1 (en) | 2021-10-08 | 2022-10-06 | Drug formulation of anti-hla-dq2.5 antibody |
| KR1020227044177A KR102614250B1 (ko) | 2021-10-08 | 2022-10-06 | 항hla-dq2.5 항체의 제제 |
| IL311811A IL311811A (en) | 2021-10-08 | 2022-10-06 | Drug formulation of an anti-HLA-DQ2.5 antibody |
| EP22878573.9A EP4413997A4 (en) | 2021-10-08 | 2022-10-06 | ANTI-HLA-DQ2.5 ANTIBODY DRUG FORMULATION |
| CA3232707A CA3232707A1 (en) | 2021-10-08 | 2022-10-06 | Drug formulation of anti-hla-dq2.5 antibody |
| US18/697,831 US20240400693A1 (en) | 2021-10-08 | 2022-10-06 | Drug formulation of anti-hla-dq2.5 antibody |
| JP2023011902A JP2023058542A (ja) | 2021-10-08 | 2023-01-30 | 抗hla-dq2.5抗体の製剤 |
Applications Claiming Priority (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| JP2021166336 | 2021-10-08 | ||
| JP2021-166336 | 2021-10-08 | ||
| JP2022-042112 | 2022-03-17 | ||
| JP2022042112 | 2022-03-17 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2023058705A1 true WO2023058705A1 (ja) | 2023-04-13 |
Family
ID=85804301
Family Applications (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/JP2022/037375 Ceased WO2023058705A1 (ja) | 2021-10-08 | 2022-10-06 | 抗hla-dq2.5抗体の製剤 |
| PCT/JP2022/037469 Ceased WO2023058723A1 (ja) | 2021-10-08 | 2022-10-06 | プレフィルドシリンジ製剤の調製方法 |
Family Applications After (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/JP2022/037469 Ceased WO2023058723A1 (ja) | 2021-10-08 | 2022-10-06 | プレフィルドシリンジ製剤の調製方法 |
Country Status (11)
| Country | Link |
|---|---|
| US (1) | US20240404622A1 (https=) |
| EP (1) | EP4413998A4 (https=) |
| JP (2) | JPWO2023058723A1 (https=) |
| KR (1) | KR20240082388A (https=) |
| AR (1) | AR127269A1 (https=) |
| AU (1) | AU2022361184A1 (https=) |
| CA (1) | CA3233924A1 (https=) |
| IL (1) | IL311956A (https=) |
| MX (1) | MX2024004117A (https=) |
| TW (2) | TW202333781A (https=) |
| WO (2) | WO2023058705A1 (https=) |
Families Citing this family (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP4722378A1 (en) * | 2023-05-31 | 2026-04-08 | FUJIFILM Corporation | Method for producing product |
Citations (108)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4816567A (en) | 1983-04-08 | 1989-03-28 | Genentech, Inc. | Recombinant immunoglobin preparations |
| EP0404097A2 (de) | 1989-06-22 | 1990-12-27 | BEHRINGWERKE Aktiengesellschaft | Bispezifische und oligospezifische, mono- und oligovalente Rezeptoren, ihre Herstellung und Verwendung |
| EP0425235A2 (en) | 1989-10-25 | 1991-05-02 | Immunogen Inc | Cytotoxic agents comprising maytansinoids and their therapeutic use |
| WO1993001161A1 (en) | 1991-07-11 | 1993-01-21 | Pfizer Limited | Process for preparing sertraline intermediates |
| US5208020A (en) | 1989-10-25 | 1993-05-04 | Immunogen Inc. | Cytotoxic agents comprising maytansinoids and their therapeutic use |
| WO1993016185A2 (en) | 1992-02-06 | 1993-08-19 | Creative Biomolecules, Inc. | Biosynthetic binding protein for cancer marker |
| WO1994011026A2 (en) | 1992-11-13 | 1994-05-26 | Idec Pharmaceuticals Corporation | Therapeutic application of chimeric and radiolabeled antibodies to human b lymphocyte restricted differentiation antigen for treatment of b cell lymphoma |
| WO1994029351A2 (en) | 1993-06-16 | 1994-12-22 | Celltech Limited | Antibodies |
| WO1995033844A1 (de) | 1994-06-03 | 1995-12-14 | GSF - Forschungszentrum für Umwelt und Gesundheit GmbH | Verfahren zur herstellung von heterologen bispezifischen antikörpern |
| US5571894A (en) | 1991-02-05 | 1996-11-05 | Ciba-Geigy Corporation | Recombinant antibodies specific for a growth factor receptor |
| US5587458A (en) | 1991-10-07 | 1996-12-24 | Aronex Pharmaceuticals, Inc. | Anti-erbB-2 antibodies, combinations thereof, and therapeutic and diagnostic uses thereof |
| US5624821A (en) | 1987-03-18 | 1997-04-29 | Scotgen Biopharmaceuticals Incorporated | Antibodies with altered effector functions |
| US5635483A (en) | 1992-12-03 | 1997-06-03 | Arizona Board Of Regents Acting On Behalf Of Arizona State University | Tumor inhibiting tetrapeptide bearing modified phenethyl amides |
| US5648237A (en) | 1991-09-19 | 1997-07-15 | Genentech, Inc. | Expression of functional antibody fragments |
| WO1997030087A1 (en) | 1996-02-16 | 1997-08-21 | Glaxo Group Limited | Preparation of glycosylated antibodies |
| US5712374A (en) | 1995-06-07 | 1998-01-27 | American Cyanamid Company | Method for the preparation of substantiallly monomeric calicheamicin derivative/carrier conjugates |
| US5714586A (en) | 1995-06-07 | 1998-02-03 | American Cyanamid Company | Methods for the preparation of monomeric calicheamicin derivative/carrier conjugates |
| US5731168A (en) | 1995-03-01 | 1998-03-24 | Genentech, Inc. | Method for making heteromultimeric polypeptides |
| US5739116A (en) | 1994-06-03 | 1998-04-14 | American Cyanamid Company | Enediyne derivatives useful for the synthesis of conjugates of methyltrithio antitumor agents |
| US5750373A (en) | 1990-12-03 | 1998-05-12 | Genentech, Inc. | Enrichment method for variant proteins having altered binding properties, M13 phagemids, and growth hormone variants |
| US5770429A (en) | 1990-08-29 | 1998-06-23 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US5770701A (en) | 1987-10-30 | 1998-06-23 | American Cyanamid Company | Process for preparing targeted forms of methyltrithio antitumor agents |
| US5770710A (en) | 1987-10-30 | 1998-06-23 | American Cyanamid Company | Antitumor and antibacterial substituted disulfide derivatives prepared from compounds possessing a methlytrithio group |
| US5780588A (en) | 1993-01-26 | 1998-07-14 | Arizona Board Of Regents | Elucidation and synthesis of selected pentapeptides |
| US5789199A (en) | 1994-11-03 | 1998-08-04 | Genentech, Inc. | Process for bacterial production of polypeptides |
| US5821337A (en) | 1991-06-14 | 1998-10-13 | Genentech, Inc. | Immunoglobulin variants |
| WO1998050431A2 (en) | 1997-05-02 | 1998-11-12 | Genentech, Inc. | A method for making multispecific antibodies having heteromultimeric and common components |
| US5840523A (en) | 1995-03-01 | 1998-11-24 | Genetech, Inc. | Methods and compositions for secretion of heterologous polypeptides |
| WO1998058964A1 (en) | 1997-06-24 | 1998-12-30 | Genentech, Inc. | Methods and compositions for galactosylated glycoproteins |
| US5869046A (en) | 1995-04-14 | 1999-02-09 | Genentech, Inc. | Altered polypeptides with increased half-life |
| WO1999022764A1 (en) | 1997-10-31 | 1999-05-14 | Genentech, Inc. | Methods and compositions comprising glycoprotein glycoforms |
| US5959177A (en) | 1989-10-27 | 1999-09-28 | The Scripps Research Institute | Transgenic plants expressing assembled secretory antibodies |
| US6040498A (en) | 1998-08-11 | 2000-03-21 | North Caroline State University | Genetically engineered duckweed |
| US6075181A (en) | 1990-01-12 | 2000-06-13 | Abgenix, Inc. | Human antibodies derived from immunized xenomice |
| WO2000061739A1 (fr) | 1999-04-09 | 2000-10-19 | Kyowa Hakko Kogyo Co., Ltd. | Methode de regulation de l'activite d'une molecule immunologiquement fonctionnelle |
| US6150584A (en) | 1990-01-12 | 2000-11-21 | Abgenix, Inc. | Human antibodies derived from immunized xenomice |
| WO2000042072A3 (en) | 1999-01-15 | 2000-11-30 | Genentech Inc | Polypeptide variants with altered effector function |
| US6171586B1 (en) | 1997-06-13 | 2001-01-09 | Genentech, Inc. | Antibody formulation |
| WO2001029246A1 (fr) | 1999-10-19 | 2001-04-26 | Kyowa Hakko Kogyo Co., Ltd. | Procede de production d'un polypeptide |
| US6248516B1 (en) | 1988-11-11 | 2001-06-19 | Medical Research Council | Single domain ligands, receptors comprising said ligands methods for their production, and use of said ligands and receptors |
| US6267958B1 (en) | 1995-07-27 | 2001-07-31 | Genentech, Inc. | Protein formulation |
| WO2002031140A1 (en) | 2000-10-06 | 2002-04-18 | Kyowa Hakko Kogyo Co., Ltd. | Cells producing antibody compositions |
| US6420548B1 (en) | 1999-10-04 | 2002-07-16 | Medicago Inc. | Method for regulating transcription of foreign genes |
| US20020164328A1 (en) | 2000-10-06 | 2002-11-07 | Toyohide Shinkawa | Process for purifying antibody |
| WO2003011878A2 (en) | 2001-08-03 | 2003-02-13 | Glycart Biotechnology Ag | Antibody glycosylation variants having increased antibody-dependent cellular cytotoxicity |
| US20030115614A1 (en) | 2000-10-06 | 2003-06-19 | Yutaka Kanda | Antibody composition-producing cell |
| US6602684B1 (en) | 1998-04-20 | 2003-08-05 | Glycart Biotechnology Ag | Glycosylation engineering of antibodies for improving antibody-dependent cellular cytotoxicity |
| US20030157108A1 (en) | 2001-10-25 | 2003-08-21 | Genentech, Inc. | Glycoprotein compositions |
| US6630579B2 (en) | 1999-12-29 | 2003-10-07 | Immunogen Inc. | Cytotoxic agents comprising modified doxorubicins and daunorubicins and their therapeutic use |
| WO2003085119A1 (en) | 2002-04-09 | 2003-10-16 | Kyowa Hakko Kogyo Co., Ltd. | METHOD OF ENHANCING ACTIVITY OF ANTIBODY COMPOSITION OF BINDING TO FcϜ RECEPTOR IIIa |
| WO2003085107A1 (en) | 2002-04-09 | 2003-10-16 | Kyowa Hakko Kogyo Co., Ltd. | Cells with modified genome |
| WO2003084570A1 (en) | 2002-04-09 | 2003-10-16 | Kyowa Hakko Kogyo Co., Ltd. | DRUG CONTAINING ANTIBODY COMPOSITION APPROPRIATE FOR PATIENT SUFFERING FROM FcϜRIIIa POLYMORPHISM |
| US20040093621A1 (en) | 2001-12-25 | 2004-05-13 | Kyowa Hakko Kogyo Co., Ltd | Antibody composition which specifically binds to CD20 |
| US20040109865A1 (en) | 2002-04-09 | 2004-06-10 | Kyowa Hakko Kogyo Co., Ltd. | Antibody composition-containing medicament |
| US20040110282A1 (en) | 2002-04-09 | 2004-06-10 | Kyowa Hakko Kogyo Co., Ltd. | Cells in which activity of the protein involved in transportation of GDP-fucose is reduced or lost |
| WO2004056312A2 (en) | 2002-12-16 | 2004-07-08 | Genentech, Inc. | Immunoglobulin variants and uses thereof |
| US20040132140A1 (en) | 2002-04-09 | 2004-07-08 | Kyowa Hakko Kogyo Co., Ltd. | Production process for antibody composition |
| WO2004092219A2 (en) | 2003-04-10 | 2004-10-28 | Protein Design Labs, Inc | Alteration of fcrn binding affinities or serum half-lives of antibodies by mutagenesis |
| US20050014934A1 (en) | 2002-10-15 | 2005-01-20 | Hinton Paul R. | Alteration of FcRn binding affinities or serum half-lives of antibodies by mutagenesis |
| US20050079574A1 (en) | 2003-01-16 | 2005-04-14 | Genentech, Inc. | Synthetic antibody phage libraries |
| WO2005035778A1 (ja) | 2003-10-09 | 2005-04-21 | Kyowa Hakko Kogyo Co., Ltd. | α1,6-フコシルトランスフェラーゼの機能を抑制するRNAを用いた抗体組成物の製造法 |
| WO2005035586A1 (ja) | 2003-10-08 | 2005-04-21 | Kyowa Hakko Kogyo Co., Ltd. | 融合蛋白質組成物 |
| US20050119455A1 (en) | 2002-06-03 | 2005-06-02 | Genentech, Inc. | Synthetic antibody phage libraries |
| US20050123546A1 (en) | 2003-11-05 | 2005-06-09 | Glycart Biotechnology Ag | Antigen binding molecules with increased Fc receptor binding affinity and effector function |
| WO2005053742A1 (ja) | 2003-12-04 | 2005-06-16 | Kyowa Hakko Kogyo Co., Ltd. | 抗体組成物を含有する医薬 |
| US20050260186A1 (en) | 2003-03-05 | 2005-11-24 | Halozyme, Inc. | Soluble glycosaminoglycanases and methods of preparing and using soluble glycosaminoglycanases |
| US20050266000A1 (en) | 2004-04-09 | 2005-12-01 | Genentech, Inc. | Variable domain library and uses |
| US6982321B2 (en) | 1986-03-27 | 2006-01-03 | Medical Research Council | Altered antibodies |
| WO2006044908A2 (en) | 2004-10-20 | 2006-04-27 | Genentech, Inc. | Antibody formulation in histidine-acetate buffer |
| US7041870B2 (en) | 2000-11-30 | 2006-05-09 | Medarex, Inc. | Transgenic transchromosomal rodents for making human antibodies |
| US20060104968A1 (en) | 2003-03-05 | 2006-05-18 | Halozyme, Inc. | Soluble glycosaminoglycanases and methods of preparing and using soluble glycosaminogly ycanases |
| US7087409B2 (en) | 1997-12-05 | 2006-08-08 | The Scripps Research Institute | Humanization of murine antibody |
| WO2006106905A1 (ja) | 2005-03-31 | 2006-10-12 | Chugai Seiyaku Kabushiki Kaisha | 会合制御によるポリペプチド製造方法 |
| US7125978B1 (en) | 1999-10-04 | 2006-10-24 | Medicago Inc. | Promoter for regulating expression of foreign genes |
| US7189826B2 (en) | 1997-11-24 | 2007-03-13 | Institute For Human Genetics And Biochemistry | Monoclonal human natural antibodies |
| US20070061900A1 (en) | 2000-10-31 | 2007-03-15 | Murphy Andrew J | Methods of modifying eukaryotic cells |
| US20070117126A1 (en) | 1999-12-15 | 2007-05-24 | Genentech, Inc. | Shotgun scanning |
| US20070160598A1 (en) | 2005-11-07 | 2007-07-12 | Dennis Mark S | Binding polypeptides with diversified and consensus vh/vl hypervariable sequences |
| WO2007114325A1 (ja) | 2006-03-31 | 2007-10-11 | Chugai Seiyaku Kabushiki Kaisha | 二重特異性抗体を精製するための抗体改変方法 |
| US20070237764A1 (en) | 2005-12-02 | 2007-10-11 | Genentech, Inc. | Binding polypeptides with restricted diversity sequences |
| US20070292936A1 (en) | 2006-05-09 | 2007-12-20 | Genentech, Inc. | Binding polypeptides with optimized scaffolds |
| WO2008077546A1 (en) | 2006-12-22 | 2008-07-03 | F. Hoffmann-La Roche Ag | Antibodies against insulin-like growth factor i receptor and uses thereof |
| WO2008119353A1 (en) | 2007-03-29 | 2008-10-09 | Genmab A/S | Bispecific antibodies and methods for production thereof |
| WO2008156083A1 (ja) | 2007-06-18 | 2008-12-24 | Chugai Seiyaku Kabushiki Kaisha | 抗体依存性細胞障害活性を模擬する抗体の結合活性測定法 |
| US20090002360A1 (en) | 2007-05-25 | 2009-01-01 | Innolux Display Corp. | Liquid crystal display device and method for driving same |
| WO2009011941A2 (en) | 2007-04-04 | 2009-01-22 | The Government Of U.S.A., As Represented By The Secretary, Departmetnt Of Health & Human Services | Monoclonal antibodies against dengue and other viruses with deletion in fc region |
| US7498298B2 (en) | 2003-11-06 | 2009-03-03 | Seattle Genetics, Inc. | Monomethylvaline compounds capable of conjugation to ligands |
| US7521541B2 (en) | 2004-09-23 | 2009-04-21 | Genetech Inc. | Cysteine engineered antibodies and conjugates |
| US7527791B2 (en) | 2004-03-31 | 2009-05-05 | Genentech, Inc. | Humanized anti-TGF-beta antibodies |
| WO2009080254A1 (en) | 2007-12-21 | 2009-07-02 | F. Hoffmann-La Roche Ag | Bivalent, bispecific antibodies |
| US20090324589A1 (en) | 2006-03-31 | 2009-12-31 | Chugai Seiyaku Kabushiki Kaisha | Methods for controlling blood pharmacokinetics of antibodies |
| WO2011028952A1 (en) | 2009-09-02 | 2011-03-10 | Xencor, Inc. | Compositions and methods for simultaneous bivalent and monovalent co-engagement of antigens |
| JP2011519347A (ja) * | 2008-02-07 | 2011-07-07 | アムジエン・インコーポレーテツド | 安定化されたタンパク質組成物 |
| WO2011131746A2 (en) | 2010-04-20 | 2011-10-27 | Genmab A/S | Heterodimeric antibody fc-containing proteins and methods for production thereof |
| WO2012023053A2 (en) | 2010-08-16 | 2012-02-23 | Novimmune S.A. | Methods for the generation of multispecific and multivalent antibodies |
| WO2012058768A1 (en) | 2010-11-05 | 2012-05-10 | Zymeworks Inc. | Stable heterodimeric antibody design with mutations in the fc domain |
| WO2013065708A1 (ja) | 2011-10-31 | 2013-05-10 | 中外製薬株式会社 | 重鎖と軽鎖の会合が制御された抗原結合分子 |
| WO2013063702A1 (en) | 2011-11-04 | 2013-05-10 | Zymeworks Inc. | Stable heterodimeric antibody design with mutations in the fc domain |
| WO2014018572A2 (en) | 2012-07-23 | 2014-01-30 | Zymeworks Inc. | Immunoglobulin constructs comprising selective pairing of the light and heavy chains |
| US20140080153A1 (en) | 2011-01-07 | 2014-03-20 | Chugai Seiyaku Kabushiki Kaisha | Method for improving physical properties of antibody |
| WO2016159213A1 (ja) | 2015-04-01 | 2016-10-06 | 中外製薬株式会社 | ポリペプチド異種多量体の製造方法 |
| EP2101823B1 (en) | 2007-01-09 | 2016-11-23 | CureVac AG | Rna-coded antibody |
| US20170304445A1 (en) * | 2016-04-20 | 2017-10-26 | Coherus Biosciences, Inc. | Method of filling a container with no headspace |
| WO2018155692A1 (en) | 2017-02-27 | 2018-08-30 | Chugai Seiyaku Kabushiki Kaisha | Anti-hla-dq2.5/8 antibody and its use for the treatment of celiac disease |
| WO2019065795A1 (ja) | 2017-09-29 | 2019-04-04 | 中外製薬株式会社 | 血液凝固第viii因子(fviii)補因子機能代替活性を有する多重特異性抗原結合分子および当該分子を有効成分として含有する薬学的製剤 |
| WO2019069993A1 (en) | 2017-10-03 | 2019-04-11 | Chugai Seiyaku Kabushiki Kaisha | ANTI-HLA-DQ2.5 ANTIBODIES |
| WO2020204054A1 (en) * | 2019-04-01 | 2020-10-08 | Chugai Seiyaku Kabushiki Kaisha | Anti-hla-dq2.5 antibody |
| JP2022051553A (ja) * | 2020-09-18 | 2022-03-31 | 中外製薬株式会社 | 抗hla-dq2.5抗体およびセリアック病の治療のためのその使用 |
Family Cites Families (34)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4676980A (en) | 1985-09-23 | 1987-06-30 | The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services | Target specific cross-linked heteroantibodies |
| GB8607679D0 (en) | 1986-03-27 | 1986-04-30 | Winter G P | Recombinant dna product |
| JPS6459878A (en) | 1987-08-31 | 1989-03-07 | Matsushita Electric Industrial Co Ltd | Semiconductor laser protective circuit |
| GB9015198D0 (en) | 1990-07-10 | 1990-08-29 | Brien Caroline J O | Binding substance |
| EP0585287B1 (en) | 1990-07-10 | 1999-10-13 | Cambridge Antibody Technology Limited | Methods for producing members of specific binding pairs |
| ATE300615T1 (de) | 1990-08-29 | 2005-08-15 | Genpharm Int | Transgene mäuse fähig zur produktion heterologer antikörper |
| EP0628639B1 (en) | 1991-04-25 | 1999-06-23 | Chugai Seiyaku Kabushiki Kaisha | Reconstituted human antibody against human interleukin 6 receptor |
| AU665025B2 (en) | 1991-09-23 | 1995-12-14 | Cambridge Antibody Technology Limited | Production of chimeric antibodies - a combinatorial approach |
| WO1993008829A1 (en) | 1991-11-04 | 1993-05-13 | The Regents Of The University Of California | Compositions that mediate killing of hiv-infected cells |
| ES2341666T3 (es) | 1991-12-02 | 2010-06-24 | Medimmune Limited | Produccion de autoanticuerpos de repertorios de segmentos de anticue rpos expresados en la superficie de fagos. |
| CA2124967C (en) | 1991-12-17 | 2008-04-08 | Nils Lonberg | Transgenic non-human animals capable of producing heterologous antibodies |
| DE69333823T2 (de) | 1992-03-24 | 2006-05-04 | Cambridge Antibody Technology Ltd., Melbourn | Verfahren zur herstellung von gliedern von spezifischen bindungspaaren |
| NZ255101A (en) | 1992-07-24 | 1997-08-22 | Cell Genesys Inc | A yeast artificial chromosome (yac) vector containing an hprt minigene expressible in murine stem cells and genetically modified rodent therefor |
| CA2161351C (en) | 1993-04-26 | 2010-12-21 | Nils Lonberg | Transgenic non-human animals capable of producing heterologous antibodies |
| GB9313509D0 (en) | 1993-06-30 | 1993-08-11 | Medical Res Council | Chemisynthetic libraries |
| EP0731842A1 (en) | 1993-12-03 | 1996-09-18 | Medical Research Council | Recombinant binding proteins and peptides |
| CA2194907A1 (en) | 1994-07-13 | 1996-02-01 | Kouji Matsushima | Reshaped human antibody against human interleukin-8 |
| CA2219361C (en) | 1995-04-27 | 2012-02-28 | Abgenix, Inc. | Human antibodies derived from immunized xenomice |
| EP0823941A4 (en) | 1995-04-28 | 2001-09-19 | Abgenix Inc | HUMAN ANTIBODIES DERIVED FROM IMMUNIZED XENO MOUSES |
| SK40599A3 (en) | 1996-09-26 | 2000-06-12 | Chugai Pharmaceutical Co Ltd | Antibody against human parathormone related peptides |
| UA76934C2 (en) | 1996-10-04 | 2006-10-16 | Chugai Pharmaceutical Co Ltd | Reconstructed human anti-hm 1.24 antibody, coding dna, vector, host cell, method for production of reconstructed human antibody, pharmaceutical composition and drug for treating myeloma containing reconstructed human anti-hm 1.24 antibody |
| US6677436B1 (en) | 1998-04-03 | 2004-01-13 | Chugai Seiyaku Kabushiki Kaisha | Humanized antibody against human tissue factor (TF) and process of production of the humanized antibody |
| CN101289511A (zh) | 2000-04-11 | 2008-10-22 | 杰南技术公司 | 多价抗体及其应用 |
| CN1842540B (zh) | 2004-07-09 | 2012-07-04 | 中外制药株式会社 | 抗-磷脂酰肌醇蛋白聚糖3抗体 |
| WO2008027236A2 (en) | 2006-08-30 | 2008-03-06 | Genentech, Inc. | Multispecific antibodies |
| AU2008304748C1 (en) | 2007-09-26 | 2014-06-12 | Chugai Seiyaku Kabushiki Kaisha | Modified antibody constant region |
| CA2708532C (en) | 2007-12-05 | 2018-06-05 | Chugai Seiyaku Kabushiki Kaisha | Anti-il31ra antibody and use thereof |
| ES2563027T3 (es) | 2008-01-07 | 2016-03-10 | Amgen Inc. | Método para fabricación de moléculas heterodímeras Fc de anticuerpos utilizando efectos de conducción electrostática |
| PH12016502073B1 (en) | 2010-11-17 | 2024-04-05 | Chugai Pharmaceutical Co Ltd | Multi-specific antigen-binding molecule having alternative function to function of blood coagulation factor viii |
| JP6130983B2 (ja) * | 2015-02-27 | 2017-05-17 | 中外製薬株式会社 | Il−6関連疾患治療用組成物 |
| MA44780A (fr) * | 2016-04-28 | 2019-03-06 | Chugai Pharmaceutical Co Ltd | Préparation contenant un anticorps |
| GB201809341D0 (en) * | 2018-06-07 | 2018-07-25 | Ucb Biopharma Sprl | Multi-domain proteins with increased native state colloidal stability |
| WO2020021073A1 (en) * | 2018-07-27 | 2020-01-30 | F. Hoffmann-La Roche Ag | Method of filling at least one degassed drug product into containers and drug product filling device |
| JPWO2020202839A1 (https=) * | 2019-03-29 | 2020-10-08 |
-
2022
- 2022-10-06 TW TW111137980A patent/TW202333781A/zh unknown
- 2022-10-06 WO PCT/JP2022/037375 patent/WO2023058705A1/ja not_active Ceased
- 2022-10-06 JP JP2023552944A patent/JPWO2023058723A1/ja active Pending
- 2022-10-06 AR ARP220102706A patent/AR127269A1/es unknown
- 2022-10-06 EP EP22878590.3A patent/EP4413998A4/en active Pending
- 2022-10-06 CA CA3233924A patent/CA3233924A1/en active Pending
- 2022-10-06 MX MX2024004117A patent/MX2024004117A/es unknown
- 2022-10-06 AU AU2022361184A patent/AU2022361184A1/en active Pending
- 2022-10-06 TW TW111137979A patent/TW202323810A/zh unknown
- 2022-10-06 KR KR1020247014321A patent/KR20240082388A/ko active Pending
- 2022-10-06 WO PCT/JP2022/037469 patent/WO2023058723A1/ja not_active Ceased
- 2022-10-06 IL IL311956A patent/IL311956A/en unknown
- 2022-10-06 US US18/698,507 patent/US20240404622A1/en active Pending
-
2025
- 2025-02-05 JP JP2025017506A patent/JP2025072514A/ja active Pending
Patent Citations (117)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4816567A (en) | 1983-04-08 | 1989-03-28 | Genentech, Inc. | Recombinant immunoglobin preparations |
| US6982321B2 (en) | 1986-03-27 | 2006-01-03 | Medical Research Council | Altered antibodies |
| US5624821A (en) | 1987-03-18 | 1997-04-29 | Scotgen Biopharmaceuticals Incorporated | Antibodies with altered effector functions |
| US5648260A (en) | 1987-03-18 | 1997-07-15 | Scotgen Biopharmaceuticals Incorporated | DNA encoding antibodies with altered effector functions |
| US5770710A (en) | 1987-10-30 | 1998-06-23 | American Cyanamid Company | Antitumor and antibacterial substituted disulfide derivatives prepared from compounds possessing a methlytrithio group |
| US5770701A (en) | 1987-10-30 | 1998-06-23 | American Cyanamid Company | Process for preparing targeted forms of methyltrithio antitumor agents |
| US6248516B1 (en) | 1988-11-11 | 2001-06-19 | Medical Research Council | Single domain ligands, receptors comprising said ligands methods for their production, and use of said ligands and receptors |
| EP0404097A2 (de) | 1989-06-22 | 1990-12-27 | BEHRINGWERKE Aktiengesellschaft | Bispezifische und oligospezifische, mono- und oligovalente Rezeptoren, ihre Herstellung und Verwendung |
| EP0425235A2 (en) | 1989-10-25 | 1991-05-02 | Immunogen Inc | Cytotoxic agents comprising maytansinoids and their therapeutic use |
| US5208020A (en) | 1989-10-25 | 1993-05-04 | Immunogen Inc. | Cytotoxic agents comprising maytansinoids and their therapeutic use |
| US5416064A (en) | 1989-10-25 | 1995-05-16 | Immunogen, Inc. | Cytotoxic agents comprising maytansinoids and their therapeutic use |
| US5959177A (en) | 1989-10-27 | 1999-09-28 | The Scripps Research Institute | Transgenic plants expressing assembled secretory antibodies |
| US6417429B1 (en) | 1989-10-27 | 2002-07-09 | The Scripps Research Institute | Transgenic plants expressing assembled secretory antibodies |
| US6150584A (en) | 1990-01-12 | 2000-11-21 | Abgenix, Inc. | Human antibodies derived from immunized xenomice |
| US6075181A (en) | 1990-01-12 | 2000-06-13 | Abgenix, Inc. | Human antibodies derived from immunized xenomice |
| US5770429A (en) | 1990-08-29 | 1998-06-23 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US5750373A (en) | 1990-12-03 | 1998-05-12 | Genentech, Inc. | Enrichment method for variant proteins having altered binding properties, M13 phagemids, and growth hormone variants |
| US5571894A (en) | 1991-02-05 | 1996-11-05 | Ciba-Geigy Corporation | Recombinant antibodies specific for a growth factor receptor |
| US5821337A (en) | 1991-06-14 | 1998-10-13 | Genentech, Inc. | Immunoglobulin variants |
| WO1993001161A1 (en) | 1991-07-11 | 1993-01-21 | Pfizer Limited | Process for preparing sertraline intermediates |
| US5648237A (en) | 1991-09-19 | 1997-07-15 | Genentech, Inc. | Expression of functional antibody fragments |
| US5587458A (en) | 1991-10-07 | 1996-12-24 | Aronex Pharmaceuticals, Inc. | Anti-erbB-2 antibodies, combinations thereof, and therapeutic and diagnostic uses thereof |
| WO1993016185A2 (en) | 1992-02-06 | 1993-08-19 | Creative Biomolecules, Inc. | Biosynthetic binding protein for cancer marker |
| WO1994011026A2 (en) | 1992-11-13 | 1994-05-26 | Idec Pharmaceuticals Corporation | Therapeutic application of chimeric and radiolabeled antibodies to human b lymphocyte restricted differentiation antigen for treatment of b cell lymphoma |
| US5635483A (en) | 1992-12-03 | 1997-06-03 | Arizona Board Of Regents Acting On Behalf Of Arizona State University | Tumor inhibiting tetrapeptide bearing modified phenethyl amides |
| US5780588A (en) | 1993-01-26 | 1998-07-14 | Arizona Board Of Regents | Elucidation and synthesis of selected pentapeptides |
| WO1994029351A2 (en) | 1993-06-16 | 1994-12-22 | Celltech Limited | Antibodies |
| WO1995033844A1 (de) | 1994-06-03 | 1995-12-14 | GSF - Forschungszentrum für Umwelt und Gesundheit GmbH | Verfahren zur herstellung von heterologen bispezifischen antikörpern |
| US5773001A (en) | 1994-06-03 | 1998-06-30 | American Cyanamid Company | Conjugates of methyltrithio antitumor agents and intermediates for their synthesis |
| US5767285A (en) | 1994-06-03 | 1998-06-16 | American Cyanamid Company | Linkers useful for the synthesis of conjugates of methyltrithio antitumor agents |
| US5739116A (en) | 1994-06-03 | 1998-04-14 | American Cyanamid Company | Enediyne derivatives useful for the synthesis of conjugates of methyltrithio antitumor agents |
| US5877296A (en) | 1994-06-03 | 1999-03-02 | American Cyanamid Company | Process for preparing conjugates of methyltrithio antitumor agents |
| US5789199A (en) | 1994-11-03 | 1998-08-04 | Genentech, Inc. | Process for bacterial production of polypeptides |
| US5840523A (en) | 1995-03-01 | 1998-11-24 | Genetech, Inc. | Methods and compositions for secretion of heterologous polypeptides |
| US5731168A (en) | 1995-03-01 | 1998-03-24 | Genentech, Inc. | Method for making heteromultimeric polypeptides |
| US7695936B2 (en) | 1995-03-01 | 2010-04-13 | Genentech, Inc. | Knobs and holes heteromeric polypeptides |
| US5869046A (en) | 1995-04-14 | 1999-02-09 | Genentech, Inc. | Altered polypeptides with increased half-life |
| US5712374A (en) | 1995-06-07 | 1998-01-27 | American Cyanamid Company | Method for the preparation of substantiallly monomeric calicheamicin derivative/carrier conjugates |
| US5714586A (en) | 1995-06-07 | 1998-02-03 | American Cyanamid Company | Methods for the preparation of monomeric calicheamicin derivative/carrier conjugates |
| US6267958B1 (en) | 1995-07-27 | 2001-07-31 | Genentech, Inc. | Protein formulation |
| WO1997030087A1 (en) | 1996-02-16 | 1997-08-21 | Glaxo Group Limited | Preparation of glycosylated antibodies |
| WO1998050431A2 (en) | 1997-05-02 | 1998-11-12 | Genentech, Inc. | A method for making multispecific antibodies having heteromultimeric and common components |
| US6171586B1 (en) | 1997-06-13 | 2001-01-09 | Genentech, Inc. | Antibody formulation |
| WO1998058964A1 (en) | 1997-06-24 | 1998-12-30 | Genentech, Inc. | Methods and compositions for galactosylated glycoproteins |
| WO1999022764A1 (en) | 1997-10-31 | 1999-05-14 | Genentech, Inc. | Methods and compositions comprising glycoprotein glycoforms |
| US7189826B2 (en) | 1997-11-24 | 2007-03-13 | Institute For Human Genetics And Biochemistry | Monoclonal human natural antibodies |
| US7087409B2 (en) | 1997-12-05 | 2006-08-08 | The Scripps Research Institute | Humanization of murine antibody |
| US6602684B1 (en) | 1998-04-20 | 2003-08-05 | Glycart Biotechnology Ag | Glycosylation engineering of antibodies for improving antibody-dependent cellular cytotoxicity |
| US6040498A (en) | 1998-08-11 | 2000-03-21 | North Caroline State University | Genetically engineered duckweed |
| US7371826B2 (en) | 1999-01-15 | 2008-05-13 | Genentech, Inc. | Polypeptide variants with altered effector function |
| WO2000042072A3 (en) | 1999-01-15 | 2000-11-30 | Genentech Inc | Polypeptide variants with altered effector function |
| WO2000061739A1 (fr) | 1999-04-09 | 2000-10-19 | Kyowa Hakko Kogyo Co., Ltd. | Methode de regulation de l'activite d'une molecule immunologiquement fonctionnelle |
| US7125978B1 (en) | 1999-10-04 | 2006-10-24 | Medicago Inc. | Promoter for regulating expression of foreign genes |
| US6420548B1 (en) | 1999-10-04 | 2002-07-16 | Medicago Inc. | Method for regulating transcription of foreign genes |
| WO2001029246A1 (fr) | 1999-10-19 | 2001-04-26 | Kyowa Hakko Kogyo Co., Ltd. | Procede de production d'un polypeptide |
| US20070117126A1 (en) | 1999-12-15 | 2007-05-24 | Genentech, Inc. | Shotgun scanning |
| US6630579B2 (en) | 1999-12-29 | 2003-10-07 | Immunogen Inc. | Cytotoxic agents comprising modified doxorubicins and daunorubicins and their therapeutic use |
| WO2002031140A1 (en) | 2000-10-06 | 2002-04-18 | Kyowa Hakko Kogyo Co., Ltd. | Cells producing antibody compositions |
| US20020164328A1 (en) | 2000-10-06 | 2002-11-07 | Toyohide Shinkawa | Process for purifying antibody |
| US20030115614A1 (en) | 2000-10-06 | 2003-06-19 | Yutaka Kanda | Antibody composition-producing cell |
| US20070061900A1 (en) | 2000-10-31 | 2007-03-15 | Murphy Andrew J | Methods of modifying eukaryotic cells |
| US7041870B2 (en) | 2000-11-30 | 2006-05-09 | Medarex, Inc. | Transgenic transchromosomal rodents for making human antibodies |
| WO2003011878A2 (en) | 2001-08-03 | 2003-02-13 | Glycart Biotechnology Ag | Antibody glycosylation variants having increased antibody-dependent cellular cytotoxicity |
| US20030157108A1 (en) | 2001-10-25 | 2003-08-21 | Genentech, Inc. | Glycoprotein compositions |
| US20040093621A1 (en) | 2001-12-25 | 2004-05-13 | Kyowa Hakko Kogyo Co., Ltd | Antibody composition which specifically binds to CD20 |
| WO2003084570A1 (en) | 2002-04-09 | 2003-10-16 | Kyowa Hakko Kogyo Co., Ltd. | DRUG CONTAINING ANTIBODY COMPOSITION APPROPRIATE FOR PATIENT SUFFERING FROM FcϜRIIIa POLYMORPHISM |
| WO2003085107A1 (en) | 2002-04-09 | 2003-10-16 | Kyowa Hakko Kogyo Co., Ltd. | Cells with modified genome |
| US20040109865A1 (en) | 2002-04-09 | 2004-06-10 | Kyowa Hakko Kogyo Co., Ltd. | Antibody composition-containing medicament |
| US20040110704A1 (en) | 2002-04-09 | 2004-06-10 | Kyowa Hakko Kogyo Co., Ltd. | Cells of which genome is modified |
| US20040110282A1 (en) | 2002-04-09 | 2004-06-10 | Kyowa Hakko Kogyo Co., Ltd. | Cells in which activity of the protein involved in transportation of GDP-fucose is reduced or lost |
| WO2003085119A1 (en) | 2002-04-09 | 2003-10-16 | Kyowa Hakko Kogyo Co., Ltd. | METHOD OF ENHANCING ACTIVITY OF ANTIBODY COMPOSITION OF BINDING TO FcϜ RECEPTOR IIIa |
| US20040132140A1 (en) | 2002-04-09 | 2004-07-08 | Kyowa Hakko Kogyo Co., Ltd. | Production process for antibody composition |
| US20050119455A1 (en) | 2002-06-03 | 2005-06-02 | Genentech, Inc. | Synthetic antibody phage libraries |
| US20050014934A1 (en) | 2002-10-15 | 2005-01-20 | Hinton Paul R. | Alteration of FcRn binding affinities or serum half-lives of antibodies by mutagenesis |
| WO2004056312A2 (en) | 2002-12-16 | 2004-07-08 | Genentech, Inc. | Immunoglobulin variants and uses thereof |
| US20050079574A1 (en) | 2003-01-16 | 2005-04-14 | Genentech, Inc. | Synthetic antibody phage libraries |
| US20060104968A1 (en) | 2003-03-05 | 2006-05-18 | Halozyme, Inc. | Soluble glycosaminoglycanases and methods of preparing and using soluble glycosaminogly ycanases |
| US20050260186A1 (en) | 2003-03-05 | 2005-11-24 | Halozyme, Inc. | Soluble glycosaminoglycanases and methods of preparing and using soluble glycosaminoglycanases |
| WO2004092219A2 (en) | 2003-04-10 | 2004-10-28 | Protein Design Labs, Inc | Alteration of fcrn binding affinities or serum half-lives of antibodies by mutagenesis |
| WO2005035586A1 (ja) | 2003-10-08 | 2005-04-21 | Kyowa Hakko Kogyo Co., Ltd. | 融合蛋白質組成物 |
| WO2005035778A1 (ja) | 2003-10-09 | 2005-04-21 | Kyowa Hakko Kogyo Co., Ltd. | α1,6-フコシルトランスフェラーゼの機能を抑制するRNAを用いた抗体組成物の製造法 |
| US20050123546A1 (en) | 2003-11-05 | 2005-06-09 | Glycart Biotechnology Ag | Antigen binding molecules with increased Fc receptor binding affinity and effector function |
| US7498298B2 (en) | 2003-11-06 | 2009-03-03 | Seattle Genetics, Inc. | Monomethylvaline compounds capable of conjugation to ligands |
| WO2005053742A1 (ja) | 2003-12-04 | 2005-06-16 | Kyowa Hakko Kogyo Co., Ltd. | 抗体組成物を含有する医薬 |
| US7527791B2 (en) | 2004-03-31 | 2009-05-05 | Genentech, Inc. | Humanized anti-TGF-beta antibodies |
| US20050266000A1 (en) | 2004-04-09 | 2005-12-01 | Genentech, Inc. | Variable domain library and uses |
| US7521541B2 (en) | 2004-09-23 | 2009-04-21 | Genetech Inc. | Cysteine engineered antibodies and conjugates |
| WO2006044908A2 (en) | 2004-10-20 | 2006-04-27 | Genentech, Inc. | Antibody formulation in histidine-acetate buffer |
| WO2006106905A1 (ja) | 2005-03-31 | 2006-10-12 | Chugai Seiyaku Kabushiki Kaisha | 会合制御によるポリペプチド製造方法 |
| US20070160598A1 (en) | 2005-11-07 | 2007-07-12 | Dennis Mark S | Binding polypeptides with diversified and consensus vh/vl hypervariable sequences |
| US20070237764A1 (en) | 2005-12-02 | 2007-10-11 | Genentech, Inc. | Binding polypeptides with restricted diversity sequences |
| WO2007114325A1 (ja) | 2006-03-31 | 2007-10-11 | Chugai Seiyaku Kabushiki Kaisha | 二重特異性抗体を精製するための抗体改変方法 |
| US20090324589A1 (en) | 2006-03-31 | 2009-12-31 | Chugai Seiyaku Kabushiki Kaisha | Methods for controlling blood pharmacokinetics of antibodies |
| US20070292936A1 (en) | 2006-05-09 | 2007-12-20 | Genentech, Inc. | Binding polypeptides with optimized scaffolds |
| WO2008077546A1 (en) | 2006-12-22 | 2008-07-03 | F. Hoffmann-La Roche Ag | Antibodies against insulin-like growth factor i receptor and uses thereof |
| EP2101823B1 (en) | 2007-01-09 | 2016-11-23 | CureVac AG | Rna-coded antibody |
| WO2008119353A1 (en) | 2007-03-29 | 2008-10-09 | Genmab A/S | Bispecific antibodies and methods for production thereof |
| WO2009011941A2 (en) | 2007-04-04 | 2009-01-22 | The Government Of U.S.A., As Represented By The Secretary, Departmetnt Of Health & Human Services | Monoclonal antibodies against dengue and other viruses with deletion in fc region |
| US20090002360A1 (en) | 2007-05-25 | 2009-01-01 | Innolux Display Corp. | Liquid crystal display device and method for driving same |
| WO2008156083A1 (ja) | 2007-06-18 | 2008-12-24 | Chugai Seiyaku Kabushiki Kaisha | 抗体依存性細胞障害活性を模擬する抗体の結合活性測定法 |
| WO2009080254A1 (en) | 2007-12-21 | 2009-07-02 | F. Hoffmann-La Roche Ag | Bivalent, bispecific antibodies |
| JP2011519347A (ja) * | 2008-02-07 | 2011-07-07 | アムジエン・インコーポレーテツド | 安定化されたタンパク質組成物 |
| WO2011028952A1 (en) | 2009-09-02 | 2011-03-10 | Xencor, Inc. | Compositions and methods for simultaneous bivalent and monovalent co-engagement of antigens |
| WO2011131746A2 (en) | 2010-04-20 | 2011-10-27 | Genmab A/S | Heterodimeric antibody fc-containing proteins and methods for production thereof |
| WO2012023053A2 (en) | 2010-08-16 | 2012-02-23 | Novimmune S.A. | Methods for the generation of multispecific and multivalent antibodies |
| WO2012058768A1 (en) | 2010-11-05 | 2012-05-10 | Zymeworks Inc. | Stable heterodimeric antibody design with mutations in the fc domain |
| US20140080153A1 (en) | 2011-01-07 | 2014-03-20 | Chugai Seiyaku Kabushiki Kaisha | Method for improving physical properties of antibody |
| WO2013065708A1 (ja) | 2011-10-31 | 2013-05-10 | 中外製薬株式会社 | 重鎖と軽鎖の会合が制御された抗原結合分子 |
| WO2013063702A1 (en) | 2011-11-04 | 2013-05-10 | Zymeworks Inc. | Stable heterodimeric antibody design with mutations in the fc domain |
| WO2014018572A2 (en) | 2012-07-23 | 2014-01-30 | Zymeworks Inc. | Immunoglobulin constructs comprising selective pairing of the light and heavy chains |
| WO2016159213A1 (ja) | 2015-04-01 | 2016-10-06 | 中外製薬株式会社 | ポリペプチド異種多量体の製造方法 |
| US20170304445A1 (en) * | 2016-04-20 | 2017-10-26 | Coherus Biosciences, Inc. | Method of filling a container with no headspace |
| WO2018155692A1 (en) | 2017-02-27 | 2018-08-30 | Chugai Seiyaku Kabushiki Kaisha | Anti-hla-dq2.5/8 antibody and its use for the treatment of celiac disease |
| WO2019065795A1 (ja) | 2017-09-29 | 2019-04-04 | 中外製薬株式会社 | 血液凝固第viii因子(fviii)補因子機能代替活性を有する多重特異性抗原結合分子および当該分子を有効成分として含有する薬学的製剤 |
| WO2019069993A1 (en) | 2017-10-03 | 2019-04-11 | Chugai Seiyaku Kabushiki Kaisha | ANTI-HLA-DQ2.5 ANTIBODIES |
| WO2020204054A1 (en) * | 2019-04-01 | 2020-10-08 | Chugai Seiyaku Kabushiki Kaisha | Anti-hla-dq2.5 antibody |
| JP2022051553A (ja) * | 2020-09-18 | 2022-03-31 | 中外製薬株式会社 | 抗hla-dq2.5抗体およびセリアック病の治療のためのその使用 |
Non-Patent Citations (128)
| Title |
|---|
| "A Laboratory Manual", 1988, article "Antibodies" |
| "GenBank", Database accession no. NM_019111.4 |
| "Methods in Enzymology", 1995, ACADEMIC PRESS, INC, article "PCR 2: A Practical Approach" |
| "NIH Publication No. 91-3242", article "Sequences of Proteins of Immunological Interest" |
| "Remington's Pharmaceutical Sciences", 1980 |
| "Sequences of proteins of immunological interest", NIH PUBLICATION NO. 91-3242 |
| ACTA CRYSTALLOGR SECT F STRUCT BIOL CRYST COMMUN, vol. 63, 1 December 2007 (2007-12-01), pages 1021 - 1025 |
| ALMAGROFRANSSON, FRONT. BIOSCI., vol. 13, 2008, pages 1619 - 1633 |
| ALTSCHUL ET AL., J. MOL. BIOL., vol. 215, 1990, pages 403 - 10 |
| AM J CLIN NUTR, vol. 85, 2007, pages 160 - 6 |
| ANAL. BIOCHEM., vol. 360, no. 1, 1 January 2007 (2007-01-01), pages 75 - 83 |
| BACA ET AL., J. BIOL. CHEM., vol. 272, 1997, pages 10678 - 10684 |
| BATES ET AL., PROTEINS: STRUCTURE, FUNCTION AND GENETICS, vol. 5, 2001, pages 39 - 46 |
| BLOOD, vol. 109, 2007, pages 1185 - 1192 |
| BLOOD, vol. 131, 2018, pages 311 - 22 |
| BMC BIOTECHNOL, vol. 8, 2008, pages 41 |
| BOERNER ET AL., J. IMMUNOL., vol. 147, 1991, pages 86 |
| CAPEL ET AL., IMMUNOMETHODS, vol. 4, 1994, pages 25 - 34 |
| CARTER ET AL., PROC. NATL. ACAD. SCI. USA, vol. 89, 1992, pages 4285 |
| CARTER, J IMMUNOL METH, vol. 248, 2001, pages 7 - 15 |
| CHARI ET AL., CANCER RES., vol. 52, 1992, pages 127 - 131 |
| CHEN ET AL., J. MOL. BIOL., vol. 293, 1999, pages 865 - 881 |
| CHOTHIALESK, J. MOL. BIOL., vol. 196, 1987, pages 901 - 917 |
| CHRISTOPH ET AL., NATURE BIOTECHNOLOGY, vol. 31, 2013, pages 753 - 758 |
| CLACKSON ET AL., NATURE, vol. 352, 1991, pages 624 - 628 |
| DAERON, ANNU. REV. IMMUNOL., vol. 15, 1997, pages 203 - 234 |
| DALBADIE-MCFARLAND, G ET AL., PROC. NATL. ACAD. SCI. USA, vol. 79, 1982, pages 6409 - 13 |
| DALL'ACQUA ET AL., METHODS, vol. 36, 2005, pages 61 - 68 |
| DAVIS ET AL., IMMUNOLOGICAL REVIEWS, vol. 190, 2002, pages 123 - 136 |
| DE HAAS ET AL., J. LAB. CLIN. MED., vol. 126, 1995, pages 330 - 41 |
| DIG DIS SCI, vol. 49, 2004, pages 1479 - 1484 |
| DUBOWCHIK ET AL., BIOORG. & MED. CHEM. LETTERS, vol. 12, 2002, pages 1529 - 1532 |
| ESWAR ET AL.: "Current Protocols in Bioinformatics", JOHN WILEY & SONS, INC., article "Comparative Protein Structure Modeling With MODELLER" |
| EUR J IMMUNOL, vol. 50, 2020, pages 256 - 269 |
| FELLOUSE, PROC. NATL. ACAD. SCI. USA, vol. 101, no. 34, 2004, pages 12467 - 12472 |
| FLATMAN ET AL., J. CHROMATOGR. B, vol. 848, 2007, pages 79 - 87 |
| GASTROENTEROLOGY, vol. 141, 2011, pages 610 - 620 |
| GASTROENTEROLOGY, vol. 146, 2014, pages 1649 - 58 |
| GERHARDT ALANA, NGUYEN BAO H., LEWUS RACHAEL, CARPENTER JOHN F., RANDOLPH THEODORE W.: "Effect of the Siliconization Method on Particle Generation in a Monoclonal Antibody Formulation in Pre-filled Syringes", JOURNAL OF PHARMACEUTICAL SCIENCES, AMERICAN CHEMICAL SOCIETY AND AMERICAN PHARMACEUTICAL ASSOCIATION, US, vol. 104, no. 5, 1 January 2015 (2015-01-01), US , pages 1601 - 1609, XP009544894, ISSN: 0022-3549, DOI: 10.1002/jps.24387 * |
| GERHARDT ET AL., J. PHARM. SCI., vol. 103, 2014, pages 1601 - 1612 |
| GERNGROSS, NAT. BIOTECH., vol. 22, 2004, pages 1409 - 1414 |
| GHETIE ET AL., NATURE BIOTECHNOLOGY, vol. 15, no. 7, 1997, pages 637 - 640 |
| GHETIEWARD., IMMUNOL. TODAY, vol. 18, no. 12, 1997, pages 592 - 598 |
| GIANNOS STEVEN A.; KRAFT EDWARD R.; ZHAO ZHEN-YANG; MERKLEY KEVIN H.; CAI JIYANG: "Formulation Stabilization and Disaggregation of Bevacizumab, Ranibizumab and Aflibercept in Dilute Solutions", ENVIRONMENTAL SCIENCE AND POLLUTION RESEARCH, SPRINGER BERLIN HEIDELBERG, BERLIN/HEIDELBERG, vol. 35, no. 4, 28 February 2018 (2018-02-28), Berlin/Heidelberg, pages 1 - 15, XP036443450, ISSN: 0724-8741, DOI: 10.1007/s11095-018-2368-7 * |
| GRAHAM ET AL., J. GEN VIROL., vol. 36, 1977, pages 59 |
| GRIFFITHS ET AL., EMBO J, vol. 12, 1993, pages 725 - 734 |
| GUT, vol. 52, 2003, pages 960 - 965 |
| GUT, vol. 54, 2005, pages 1217 - 1223 |
| GUYER ET AL., J. IMMUNOL., vol. 117, 1976, pages 587 |
| HARLOWLANE: "Antibodies: A Laboratory Manual", 1988, COLD SPRING HARBOR LABORATORY |
| HASHIMOTO-GOTOH, T.MIZUNO, T.OGASAHARA, Y.NAKAGAWA, M.: "The Antibodies", vol. 152, 1995, HARWOOD ACADEMIC PUBLISHERS, article "An oligodeoxyribonucleotide-directed dual amber method for site-directed mutagenesis", pages: 271 - 275 |
| HINMAN ET AL., CANCER RES., vol. 53, 1993, pages 3336 - 3342 |
| HINTON ET AL., J. BIOL. CHEM., vol. 279, no. 8, 2004, pages 6213 - 6216 |
| HOLLINGER ET AL., PROC. NATL. ACAD. SCI. USA, vol. 90, 1993, pages 6444 - 6448 |
| HOOGENBOOM ET AL.: "Methods in Molecular Biology", vol. 248, 1996, HUMANA PRESS, article "Epitope Mapping Protocols", pages: 255 - 268 |
| HOOGENBOOMWINTER, J. MOL. BIOL., vol. 227, 1992, pages 381 - 388 |
| HUDSON ET AL., NAT. MED., vol. 9, 2003, pages 129 - 134 |
| HUM. ANTIBOD. HYBRIDOMAS, vol. 1, no. 1, 1990, pages 47 - 54 |
| J BIOMED SCI, vol. 19, no. 1, 2012, pages 88 |
| J CLIN INVEST, vol. 117, no. 1, 2007, pages 41 - 49 |
| J. MOL. RECOGNIT., vol. 16, 2003, pages 113 - 120 |
| J. RHEUMATOL, vol. 34, 2007, pages 11 |
| JAMES A. MELCHORE, AAPS PHARMSCITECH, vol. 12, no. 1, 2011, pages 215 - 221 |
| JEFFREY ET AL., BIOORGANIC & MED. CHEM. LETTERS, vol. 16, 2006, pages 358 - 362 |
| KABAT, E.A. ET AL.: "Sequence of proteins of immunological interest", 1991, PUBLIC HEALTH SERVICE, NATIONAL INSTITUTES OF HEALTH |
| KABAT, E.A. ET AL.: "Sequences of Proteins of Immunological Interest", vol. 1-3, 1991, PUBLIC HEALTH SERVICE, NATIONAL INSTITUTES OF HEALTH, article "Sequences of Proteins of Immunological Interest" |
| KAM ET AL., PROC. NATL. ACAD. SCI. USA, vol. 102, 2005, pages 11600 - 11605 |
| KANDA, Y ET AL., BIOTECHNOL. BIOENG., vol. 94, no. 4, 2006, pages 680 - 688 |
| KIM ET AL., J. IMMUNOL., vol. 113, 1994, pages 249 - 315 |
| KING ET AL., J. MED. CHEM., vol. 45, 2002, pages 4336 - 4343 |
| KLIMKA ET AL., BR. J. CANCER, vol. 83, 2000, pages 252 - 260 |
| KOEHLDELARUE, CURR OPIN STRUCT BIOL, vol. 6, no. 2, 1996, pages 222 - 226 |
| KOZBOR, J. IMMUNOL., vol. 133, 1984, pages 3001 |
| KRAMER, W., DRUTSA, V., JANSEN, H.W., KRAMER, B., PFLUGFELDER, M., FRITZ, H.J.: "The gapped duplex DNA approach to oligonucleotide-directed mutation construction", NUCLEIC ACIDS RES., vol. 12, 1984, pages 9441 - 9456, XP002026371 |
| KRAMER, W.FRITZ, H.J.: "Oligonucleotide-directed construction of mutations via gapped duplex DNA Methods", ENZYMOL, vol. 154, 1987, pages 350 - 367 |
| KRATZ ET AL., CURRENT MED. CHEM., vol. 13, 2006, pages 477 - 523 |
| KUNKEL, T.A.: "Rapid and efficient site-specific mutagenesis without phenotypic selection", PROC NATL ACAD. SCI. USA., vol. 82, 1985, pages 488 - 492, XP002052322, DOI: 10.1073/pnas.82.2.488 |
| LEE ET AL., J. IMMUNOL. METHODS, vol. 284, no. 1-2, 2004, pages 119 - 132 |
| LEVITT M, J MOL BIOL, vol. 226, 1992, pages 507 - 533 |
| LI ET AL., NAT. BIOTECH., vol. 24, 2006, pages 210 - 215 |
| LI ET AL., PROC. NATL. ACAD. SCI. USA, vol. 103, no. 11, 2006, pages 4005 - 4010 |
| LODE ET AL., CANCER RES., vol. 58, 1998, pages 2925 - 2928 |
| LONBERG, CURR. OPIN. IMMUNOL., vol. 20, 2008, pages 450 - 459 |
| LONBERG, NAT. BIOTECH., vol. 23, 2005, pages 1117 - 1125 |
| MACCALLUM ET AL., J. MOL. BIOL., vol. 262, 1996, pages 732 - 745 |
| MARK, D. F. ET AL., PROC. NATL. ACAD. SCI. USA, vol. 81, 1984, pages 6851 - 6855 |
| MATHER ET AL., ANNALS N.Y. ACAD. SCI., vol. 383, 1982, pages 44 - 68 |
| MATHER, BIOL. REPROD., vol. 23, 1980, pages 243 - 251 |
| MCCAFFERTY ET AL., NATURE, vol. 348, pages 552 - 554 |
| MILSTEIN ET AL., NATURE, vol. 305, 1983, pages 537 - 540 |
| N ENGL J MED, vol. 348, 2003, pages 2517 - 2524 |
| N ENGL J MED, vol. 357, 2007, pages 1731 - 1743 |
| NAGY ET AL., PROC. NATL. ACAD. SCI. USA, vol. 97, 2000, pages 829 - 834 |
| NAT BIOTECHNOL., vol. 32, no. 2, February 2014 (2014-02-01), pages 191 - 8 |
| NAT STRUCT MOL BIOL, vol. 21, 2014, pages 480 - 8 |
| NI, XIANDAI MIANYIXUE, vol. 26, no. 4, 2006, pages 265 - 268 |
| NUTRIENTS, vol. 5, no. 10, October 2013 (2013-10-01), pages 3975 - 3992 |
| OKAZAKI ET AL., J. MOL. BIOL., vol. 336, no. 5, 2004, pages 1239 - 1249 |
| PADLAN, MOL. IMMUNOL., vol. 28, 1991, pages 489 - 498 |
| PNAS, vol. 95, no. 20, 29 September 1998 (1998-09-29), pages 11828 - 33 |
| PORTOLANO ET AL., J. IMMUNOL., vol. 151, 1993, pages 2623 - 887 |
| PRESTA ET AL., CANCER RES., vol. 57, 1997, pages 4593 - 4599 |
| PROTEIN ENGINEERING DESIGN & SELECTION, vol. 23, 2010, pages 195 - 202 |
| QUEEN ET AL., PROC. NAT'L ACAD. SCI. USA, vol. 86, 1989, pages 10029 - 10033 |
| RAVETCHKINET, ANNU. REV. IMMUNOL, vol. 9, 1991, pages 457 - 92 |
| RIDGWAY ET AL., PROT ENG, vol. 9, 1996, pages 617 - 621 |
| RIECHMANN ET AL., NATURE, vol. 322, 1988, pages 738 - 329 |
| RIPKA ET AL., ARCH. BIOCHEM. BIOPHYS., vol. 249, 1986, pages 533 - 545 |
| ROSOK ET AL., J. BIOL. CHEM., vol. 271, 1996, pages 22611 - 22618 |
| SCHWEDE TKOPP JGUEX NPEITSCH M C., NUCLEIC ACIDS RESEARCH, vol. 31, 2003, pages 3381 - 3385 |
| SCIENCE TRANSLATIONAL MEDICINE, vol. 2, 21 July 2010 (2010-07-21), pages 41 - 51 |
| SHIELDS ET AL., J. BIOL. CHEM., vol. 9, no. 2, 2001, pages 6591 - 6604 |
| STADLER, NATURE MEDICINE, 12 June 2017 (2017-06-12) |
| TORGOV ET AL., BIOCONJ. CHEM., vol. 16, 2005, pages 717 - 721 |
| TORISU ET AL., J. PHARM. SCI., vol. 106, 2017, pages 2966 - 2978 |
| URLAUB ET AL., PROC. NATL. ACAD. SCI. USA, vol. 77, 1980, pages 4216 |
| VAN DIJKVAN DE WINKEL, CURR. OPIN. PHARMACOL., vol. 5, 2001, pages 368 - 74 |
| VITETTA ET AL., SCIENCE, vol. 238, 1987, pages 1098 - 63 |
| VOLLMERSBRANDLEIN, HISTOLOGY AND HISTOPATHOLOGY, vol. 20, no. 3, 2005, pages 927 - 937 |
| VOLLMERSBRANDLEIN, METHODS AND FINDINGS IN EXPERIMENTAL AND CLINICAL PHARMACOLOGY, vol. 27, no. 3, 2005, pages 185 - 91 |
| WANG, A ET AL., SCIENCE, vol. 224, 1984, pages 1431 - 3 |
| WINTER ET AL., ANN. REV. IMMUNOL., vol. 12, 1994, pages 433 - 455 |
| WRIGHT ET AL., TIBTECH, vol. 15, 1997, pages 26 - 32 |
| XIANG, CURR PROTEIN PEPT SCI, vol. 7, no. 3, June 2006 (2006-06-01), pages 217 - 227 |
| XIANG, CURR PROTEIN PEPT SCI., vol. 7, no. 3, June 2006 (2006-06-01), pages 217 - 227 |
| YAMANE-OHNUKI ET AL., BIOTECH. BIOENG., vol. 87, 2004, pages 614 |
| ZOLLER, M. J.SMITH, M., NUCLEIC ACIDS RES., vol. 10, 1982, pages 6487 - 500 |
| ZOLLER, M.J.SMITH, M.: "Oligonucleotide-directed mutagenesis of DNA fragments cloned into M13 vectors", METHODS ENZYMOL., vol. 100, 1983, pages 468 - 500, XP001088749, DOI: 10.1016/0076-6879(83)00074-9 |
Also Published As
| Publication number | Publication date |
|---|---|
| TW202323810A (zh) | 2023-06-16 |
| WO2023058723A1 (ja) | 2023-04-13 |
| AU2022361184A1 (en) | 2024-05-09 |
| MX2024004117A (es) | 2024-04-19 |
| JP2025072514A (ja) | 2025-05-09 |
| EP4413998A1 (en) | 2024-08-14 |
| AR127269A1 (es) | 2024-01-03 |
| IL311956A (en) | 2024-06-01 |
| US20240404622A1 (en) | 2024-12-05 |
| EP4413998A4 (en) | 2026-02-25 |
| TW202333781A (zh) | 2023-09-01 |
| JPWO2023058723A1 (https=) | 2023-04-13 |
| CA3233924A1 (en) | 2023-04-13 |
| KR20240082388A (ko) | 2024-06-10 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| JP7147030B2 (ja) | 抗hla-dq2.5抗体およびセリアック病の治療のためのその使用 | |
| JP7689495B2 (ja) | 抗hla-dq2.5抗体 | |
| KR20220119433A (ko) | 항ctla-4 항체 및 그의 사용 | |
| WO2023058705A1 (ja) | 抗hla-dq2.5抗体の製剤 | |
| JP7220335B1 (ja) | 抗hla-dq2.5抗体の製剤 | |
| HK40106801A (zh) | 抗hla-dq2.5抗体的药物制剂 | |
| CN118369115A (zh) | 抗hla-dq2.5抗体的药物制剂 | |
| HK40101674A (zh) | 抗-hla-dq2.5抗体及其在治疗乳糜泻中的用途 | |
| HK40101688A (zh) | 抗-hla-dq2.5抗体及其在治疗乳糜泻中的用途 | |
| HK40084713A (en) | Anti-hla-dq2.5 antibody and its use for the treatment of celiac disease | |
| HK40084713B (zh) | 抗-hla-dq2.5抗体及其在治疗乳糜泻中的用途 | |
| EA052398B1 (ru) | Антитело к hla-dq2.5 и его применение для лечения глютеновой энтеропатии | |
| HK40062978B (zh) | 抗hla-dq2.5抗体 |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| WWE | Wipo information: entry into national phase |
Ref document number: 2022562975 Country of ref document: JP |
|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 22878573 Country of ref document: EP Kind code of ref document: A1 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 3232707 Country of ref document: CA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: AU2022361874 Country of ref document: AU Ref document number: 2022361874 Country of ref document: AU Ref document number: 311811 Country of ref document: IL |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112024005776 Country of ref document: BR |
|
| WWE | Wipo information: entry into national phase |
Ref document number: MX/A/2024/004112 Country of ref document: MX |
|
| ENP | Entry into the national phase |
Ref document number: 2022361874 Country of ref document: AU Date of ref document: 20221006 Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2022878573 Country of ref document: EP |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2022878573 Country of ref document: EP Effective date: 20240508 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 202280080532.3 Country of ref document: CN |
|
| ENP | Entry into the national phase |
Ref document number: 112024005776 Country of ref document: BR Kind code of ref document: A2 Effective date: 20240322 |
|
| WWW | Wipo information: withdrawn in national office |
Ref document number: 311811 Country of ref document: IL |