WO2022268983A2 - Interleukin-15 based immunocytokines - Google Patents

Interleukin-15 based immunocytokines Download PDF

Info

Publication number
WO2022268983A2
WO2022268983A2 PCT/EP2022/067236 EP2022067236W WO2022268983A2 WO 2022268983 A2 WO2022268983 A2 WO 2022268983A2 EP 2022067236 W EP2022067236 W EP 2022067236W WO 2022268983 A2 WO2022268983 A2 WO 2022268983A2
Authority
WO
WIPO (PCT)
Prior art keywords
antibody
seq
immunocytokine
cells
rli
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/EP2022/067236
Other languages
English (en)
French (fr)
Other versions
WO2022268983A3 (en
Inventor
Irena ADKINS
Eva NEDVEDOVA
Guy Luc Michel De Martynoff
Ulrich Moebius
David BÉCHARD
Sárka PECHOUCKOVÁ
Zuzana ANTOSOVÁ
Lenka KYRYCH SADILKOVA
Roger Renzo Beerli
Lukas BAMMERT
Lorenz WALDMEIER
Iva VALENTOVÁ
Simona HOSKOVÁ
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Sotio Biotech AS
Cytune Pharma SAS
Original Assignee
Sotio Biotech AS
Cytune Pharma SAS
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Sotio Biotech AS, Cytune Pharma SAS filed Critical Sotio Biotech AS
Priority to JP2023576235A priority Critical patent/JP2024524891A/ja
Priority to MX2023015444A priority patent/MX2023015444A/es
Priority to AU2022296794A priority patent/AU2022296794A1/en
Priority to US18/573,397 priority patent/US20240294594A1/en
Priority to CN202280045358.9A priority patent/CN117597356A/zh
Priority to KR1020247002543A priority patent/KR20240024242A/ko
Priority to EP22736247.2A priority patent/EP4359428A2/en
Priority to BR112023027312A priority patent/BR112023027312A2/pt
Priority to CA3221886A priority patent/CA3221886A1/en
Priority to IL309533A priority patent/IL309533A/en
Publication of WO2022268983A2 publication Critical patent/WO2022268983A2/en
Publication of WO2022268983A3 publication Critical patent/WO2022268983A3/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/52Cytokines; Lymphokines; Interferons
    • C07K14/54Interleukins [IL]
    • C07K14/5443IL-15
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K35/00Medicinal preparations containing materials or reaction products thereof with undetermined constitution
    • A61K35/12Materials from mammals; Compositions comprising non-specified tissues or cells; Compositions comprising non-embryonic stem cells; Genetically modified cells
    • A61K35/14Blood; Artificial blood
    • A61K35/17Lymphocytes; B-cells; T-cells; Natural killer cells; Interferon-activated or cytokine-activated lymphocytes
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • A61P35/02Antineoplastic agents specific for leukemia
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/715Receptors; Cell surface antigens; Cell surface determinants for cytokines; for lymphokines; for interferons
    • C07K14/7155Receptors; Cell surface antigens; Cell surface determinants for cytokines; for lymphokines; for interferons for interleukins [IL]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • C07K16/2818Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against CD28 or CD152
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2887Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against CD20
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/24Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/40Immunoglobulins specific features characterized by post-translational modification
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/73Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
    • C07K2317/732Antibody-dependent cellular cytotoxicity [ADCC]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76Antagonist effect on antigen, e.g. neutralization or inhibition of binding
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/94Stability, e.g. half-life, pH, temperature or enzyme-resistance
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/30Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/32Fusion polypeptide fusions with soluble part of a cell surface receptor, "decoy receptors"

Definitions

  • Interleukin 15 is a naturally occurring cytokine that induces the generation of cytotoxic lymphocytes and memory phenotype CD8 + T cells, and stimulates proliferation and maintenance of natural killer (NK) cells but - in contrast to interleukin 2 - does not mediate activation-induced cell death, does not consistently activate Tregs and causes less capillary leak syndrome (Waldmann, Dubois et al. 2020).
  • NK natural killer
  • Extensive preclinical and clinical studies demonstrating the effectiveness and limitation of IL-15 and of an increasing number of IL-15 analogs/superagonists especially in the treatment of cancer have been conducted, reviewed by Robinson and Schluns (Robinson and Schluns 2017).
  • IL-15 like interleukin 2 (IL-2), acts through a heterotrimeric receptor having a, b and g subunits, whereas they share the common gamma-chain receptor (y c or g) - also shared with IL-4, IL-7, IL-9 and IL-21 - and the IL-2/IL-15RP (also known as IL-2RP, CD122).
  • the heterotrimeric receptors contain a specific subunit for IL-2 or IL-15, i.e., the IL-2Ra (CD25) or the IL-15Ra (CD215).
  • JAK1 Janus kinase 1
  • JAK 3 signal transducer and activator of transcription 3 and 5
  • both cytokines also have distinct roles as reviewed in Waldmann (2015, see e.g. table 1) and Conlon (2019).
  • novel compounds comprising IL-15 or IL-15 variants were designed aiming at specifically targeting the activation of NK cells and CD8 + T cells.
  • These are compounds targeting the mid-affinity IL-2/IL- 15RPy. i.e., the receptor consisting of the IL-2/IL-15RP and the y c subunits, which is expressed on NK cells, CD8 + T cells, NKT cells and gd T cells.
  • SO-C101 binds to the mid- affinity IL-15RPy only, as it comprises the covalently attached sushi+ domain of IL-15Ra. In turn, SO- C101 does bind neither to IL-15Ra nor to IL-2Ra.
  • ALT-803 and hetIL-15 carry an IL-15Ra sushi domain or the soluble IL-15Ra, respectively, and therefore bind to the mid-affinity IL-15RPy receptor. Accordingly, IL-15 and IL-15 analogues/superagonists are promising clinical stage development candidate for the treatment of cancer and infectious diseases.
  • immunocytokine fusion molecules termed immunocytokines.
  • Such proteins retain both antigen-binding properties and cytokine activity.
  • the immunocytokines are sequestered in the tumour microenvironment, where the cytokine portion can signal through its cognate receptors expressed on immune cells and induce an anti -tumour response.
  • the antibody is a check point inhibitor (CPI)
  • CPI check point inhibitor
  • the combination of the antibody and cytokine will boost the immune response against cancer by lifting the “brakes” on the immune system through the CPI and stimulating the immune cells through the cytokine.
  • the antibody effector functions may be enhanced by the presence of cytokines activating the immune cells involved in the antibody effector functions.
  • the inventors have now developed a mutation/protein modification toolbox allowing modulation of the IL-15 superagonists (based on IL-15 and the sushi domain of IL-15Ra) activity and of the antibody forming the immunocytokine.
  • the inventors identified suitable single or double mutations reducing the binding of the IL-15 superagonists to the IL-2/IL-15RP and/or to the y c receptor, to minimize target mediated drug deposition due to too high affinity to immune effector cells, resulting in increasing the half-life of the immunocytokine.
  • Different mutations allow to tune the level of reduced binding.
  • Other mutations in IL-15 superagonists may improve the homogeneity of the IL-15 variant with respect to post-translational modifications.
  • Modulating the IL-15 superagonists’ activity may also include varying the presence of one or two cytokines fused to the antibody. Therefore, the toolbox also includes mutations allowing heterodimeric antibodies. Toolbox mutations to modulate the antibody effector functions may include Fc mutations enhancing or reducing antibody-dependent cell toxicity and/or mutations increasing in vivo half-life or stability of the antibody. The toolbox also includes enhancing antibody-dependent cell toxicity by producing afucosylated antibodies. The toolbox further includes different formats of antibodies adapted to specific needs, such as IgGl or IgG4 antibodies. The inventors have now also designed exemplary immunocytokines aimed to combine CPI activity or tumour-antigen targeting antibodies and IL-15 superagonists’ activity.
  • An immunocytokine based on a heterodimerized pembrolizumab, with decreased ADCC activity fused to an RLI molecule with reduced binding to the IL-2/IL-15RP is a combination of a CPI with a cytokine.
  • An immunocytokine based on a heterodimerized hClla, an anti-CLDN18.2 antibody, optionally with enhanced ADCC activity, fused to an RLI molecule with reduced binding to the IL-2/IL-15RP is a combination of a tumour-antigen targeting antibody with a cytokine.
  • FIG. 1 (A) LMW SDS-PAGE and Western-blot (anti-RLI-15) analysis of RLI2 (RLI2 wt), RLI2 with G78A substitution (RLI2 A) and RLI2 with G78A/N79Q substitutions (RLI2 AQ) under non-reducing conditions.
  • RLI2 RLI2 wt
  • RLI2 with G78A substitution RLI2 A
  • RLI2 with G78A/N79Q substitutions (RLI2 AQ) under non-reducing conditions.
  • Coomassie staining 0.5 mg or 2 mg or protein were used (lanes 2, 4, 6, 8, 10 and 12) and for Western blotting 25 ng of protein were used (lanes 3, 7, 11).
  • Dotted box 1 represents band for glycosylation site #2 (main)
  • box 2 represents band for glycosylation site #1 (minor)
  • dotted box 3 represents new glycosylation site for RLI2 A.
  • Non-named lanes are marker with 16, 21, 30, 48 and 68 kDa.
  • FIG. 2 Analysis of the 3 deglycosylated RLI variants expressed in CHO cells by SDS-PAGE (7.5- 18%) stained by Coomassie blue (left pane), by silver nitrate (middle pane) and detected by an anti- IL15 western blot (right pane): lanes 1: molecular weight marker; lanes 2: RLI2 N I 76 Q, lanes 3: RLI2NI68S/N176Q/N209S, lanes 4: RLI 1 N Ki8*/N 17 ⁇ O/N2(I1 ⁇ 2 ⁇
  • FIG. 3 Potency of RLI2 and RLI2 AQ from supernatants determined by activation of 32Db cells or Kit225 cells.
  • A 32Db cells, 21h
  • B Kit225 cells, 4h.
  • FIG. 4 Relative potency of RLI2 purified or from supernatant compared to RLI2 AQ from supernatant determined by activation of Kit225 cells.
  • FIG. 5 Comparison of highly glycosylated RLI2 and low glycosylated RLI2
  • A CPI HIC elution profile in dependence of Concentration of Buffer B measured at 280 nm.
  • Left box indicates pooled fraction 2B1 1-3 for highly glycosylated RLI2 (“RLI-15-HG”) and right box indicates pooled fractions 4B1 1-3 for low glycosylated RLI2 (“RLI- 15 -LG”).
  • B SDS PAGE of fractions 2B1 1-3 of RLI- 15 -HG, RLI2 reference standards and molecular weight ladders of given kDa.
  • C SDS PAGE of fraction 4B1 1-3 of RLI-15-LG, RLI2 reference standards and molecular weight ladders of given kDa.
  • FIG. 6 Capillary electrophoresis of selected PEM-RLI constructs.
  • FIG. 7 Therapeutic efficacy in vivo of PEM-RLI NA xl in comparison to pembrolizumab in treating HuCell MC38-hPD-Ll tumour cell line implanted in female hPD-1 single KI HuGEMM mice.
  • FIG. 8 Mixed lymphocyte reaction (hPBMC donors): INFy secretion in pg/ml for control (PBMC only), pembrolizumab and PEM LE-RLI2 AQ NA xl.
  • FIG. 9 Pharmacokinetics and pharmacodynamics of PEM-RLI construct with reduced IL-2RPy binding compared to PEM-RLI with normal binding in cynomolgus monkeys after the IV administration of 10 or 30 pg/kg PEM-RLI xl, and 30 or 90 pg/kg PEM LE/YTE-RLI NA xl on day 1 and day 15, respectively.
  • A Concentration of construct in serum in dependence of time in hours after administration. 10 pg/kg PEM-RLI xl (solid grey line), 30 pg/kg PEM-RLI xl (dotted grey line), 30 pg/kg PEM LE/YTE-RLI NA xl (dotted black line), or 90 pg/kg PEM LE/YTE-RLI NA xl (solid black line); LLOQ for lower limit of quantitation.
  • B Count of lymphocytes (fold change) in dependence of time in days.
  • C % of Ki67 + NK cells.
  • D % of Ki67 + CD8 + T cells: PEM-RLI xl in grey, PEM LE/YTE-RLI NA xl in black, with two animals per group (full and open circles for individual animals in group).
  • FIG. 10 Comparison of pharmacokinetics and pharmacodynamics of PEM-RLI NA xl and PEM-RLI NA x2 in cynomolgus monkeys after a single IV administration of 30 pg/kg.
  • A Concentration of construct in serum in dependence of time in hours with LLOQ for lower limit of quantitation;
  • B Count of lymphocytes (fold change) in dependence of time in days.
  • C % of Ki67 + NK cells;
  • D % of Ki67 + CD8 + T cells: PEM-RLI NA xl in black with two individual animals with filled circles and empty circles, and PEM-RLI NA x2 in grey with two individual animals with filled circles and empty circles.
  • FIG. 11 Comparison of pharmacokinetics of PEM LE/YTE-RLI NA xl and PEM LE-RLI NA xl in cynomolgus monkeys after a single IV administration of 600 pg/kg. Concentration of construct in serum is depicted in dependence of time in hours with LLOQ for lower limit of quantitation: PEM LE/YTE-RLI NA xl with black circles/dotted line and PEM LE-RLI NA xl with grey circles and solid line.
  • FIG. 12 Comparison of pharmacokinetics of PEM LE-RLI NA xl and PEM-RLI NQD xl in cynomolgus monkeys after a single IV administration of 600 pg/kg. Concentration of construct in serum is depicted in dependence of time in hours with LLOQ for lower limit of quantitation: PEM LE-RLI NA xl with grey circles/line and PEM-RLI NQD xl with black circles/line.
  • FIG. 13 Comparison of ADCC activity of immunocytokines based on the hClla antibody with non- modified effector functions to immunocytokines with reduced ADCC activity and antibodies hClla and Zolbetuximab.
  • ADCC target cells were A549 cells overexpressing CLDN18.2 (A549-CLDN18.2) or PA-TU-8988S cells (PATU) endogenously expressing CLDN18.2.
  • FIG. 14 Comparison of ADCC activity of immunocytokines based on the hClla antibody with non- modified effector functions to immunocytokines with enhanced ADCC activity and antiodies hCl la and Zolbetuximab.
  • ADCC target cells were A549 cells overexpressing CLDN18.2 (A549-CLDN18.2) or PA-TU-8988S cells (PATU) endogenously expressing CLDN18.2.
  • F afucosylated immunocytokines.
  • FIG. 15 PD activity of RTX-RLI2 AQ immunocytokines in Balb/c mice: percent of (left panels) or activated (Ki67 + - right panels) CD8 + T cells or NK cells was determined by flow cytometry.
  • FIG. 16 Anti-metastatic activity of RTX-RLI2 AQ immunocytokines in Renca mouse metastatic model in vivo as determined by lung weight.
  • FIG. 17 Anti -tumor efficacy of RTX-RLI immunocytokines in A20-hCD20/Balb/c mice: Tumor growth is depicted for individual mice in dependence of time.
  • FIG. 18 ADCC activity of RTX-RLI immunocytokines based on rituximab compared to rituximab alone. % of dead tumor cells determined by DAPI positivity was determined in dependence of the concentration of the tested polypeptide: black circles: rituximab, grey circles: rituximab + NK92 cells; black triangles with dotted line: RTX-RLI2 AQ X 2, black triangles with solid line: RTX-RLI2 AQ x2 + NK92 cells; grey squares: RTX-RLI2 AQ xl, black squares: RTX-RLI2 AQ xl with NK92 cells.
  • FIG. 19 (A) % of PD-1/PD-L1 blocking is shown in dependence of increasing concentrations in pM of Keytruda and SOT201
  • mSOT201 anti -murine PD-1 antibody RMP1-14 fused RLI-15 AQA
  • CAFs cancer associated fibroblasts
  • (C) % Ki67 + cells of CD8 + T cells in spleen or lymph nodes at day 7 of C57BL/6 mice bearing MC38 tumors treated IV with mSOT201, mPDl-IL-2v or the combination of RLI-15 AQA and mPD-1. Randomization day 1, tumor volumes 100 mm 3 (n 10/group).
  • FIG. 23 (A) % of Ki67 + and fold change of absolute cell counts of NK and CD8 + T cells in blood of cynomolgus monkeys after a single IV administration of 0.6 mg/kg of SOT201 at day 1 determined at indicated days by flow cytometry and haematology, each graph curve representing one animal.
  • FIG. 24 NK and CD8 + T cell proliferation upon treatment with mouse SOT201 surrogates in vivo.
  • mSOT201 on day 1 at doses equimolar to 5 mg/kg of mSOT201: hPDl-mSOT201 at 5.37 mg/kg, mPD-1 at 4.51 mg/kg, and at a dose equimolar to 0.25 mg/kg of mSOT201 wt: mPDl-IL2v at 0.26 mg/kg.
  • Flow cytometry analysis was performed on day 5 and day 8. The data represent mean ⁇ SEM for 2 individuals per group per day.
  • mSOT201 on day 1 at doses equimolar to 10 mg/kg of mSOT201: hPDl-mSOT201 at 10.74 mg/kg, mPD-1 at 9.02 mg/kg, and at dose equimolar to 0.1 mg/kg of mSOT201 wt: mPDl-IL2v at 0.1 mg/kg.
  • Flow cytometry analysis was performed on day 5 and day 8. The data represent mean ⁇ SEM for 2 individuals per group per day.
  • FIG. 25 mouse SOT201 surrogates in PD-1 sensitive and PD-1 resistant tumor models in vivo.
  • MC38/C57BL/6 mouse model ⁇ single i.v. administration at Day 0 of 4.51 mg/kg mPD-1 (sub-optimal dose as compared to literature, selected as equimolar to mSOT201), 5 mg/kg mSOT201 or 5.37 mg/kg hPDl-mSOT201 (equimolar to mSOT201); DO randomization day with tumor volume of -80-100 mm 3 , 10 mice/group;
  • B16F10/C57BL/6 mouse model four i.p.
  • FIG. 26 Comparison of mSOT201 vs. RLI-15 A q A mutein + anti-PD-1 in vivo.
  • G4 a single administration of 0.64 mg/kg RLI-15 AQA , s.c. at Day 0 + a single administration of 4.51 mg/kg mPD-1, i.p. at Day 0.
  • G2 a single administration of 5 mg/kg mSOT201, i.v. at Day 0
  • G3 a single administration of 2 mg/kg mSOT201, i.v. at Day 0
  • G6 a single administration of 4.51 mg/kg single mPDl, i.p. at Day 0 (suboptimal dose as compared to literature, selected as equimolar to mSOT201), Gi l a single administration of 5 mg/kg hPDl-mSOT201, i.v. at Day 0 + a single administration of 4.36 mg/kg mPD-1, i.p. at Day 0,
  • FIG. 28 Comparison of mSOT201 vs. RLI2 AQ + anti-PD- 1 tumor growth in vivo. MC38/C57BL/6 mouse model
  • (A) average tumor volume in mm 3 in dependence of time and shown for individual animals at day 16, with the horizonal line showing the mean tumor volume.
  • DO randomization day at tumor volume of ⁇ 80-100 mm 3 , 10 mice/group.
  • NK cells The relative expansion of NK cells, CD8 + T cells and cells expressing apTCR and ydTCR (T cells) was investigated in spleen, lymph nodes and tumor at day 7 after SOT201 (G2 from above) and RLI2 AQ + anti-PD- 1 (G3 from above) treatment using flow cytometry. 3 tumor samples were pooled and 3 spleen and lymph node samples were analyzed separately.
  • B Frequency of parent (relative percentage compared to parent population) in % is shown for CD8 + T cells (top row) and NK cells (bottom row) from lymph nodes, spleen and tumor.
  • FIG. 29 (A) Immunogenicity in DC-T cell-based assay. T cell response to PEM-RLI-15 candidate molecules shown as % CFSE low stained CD4 + T cells after loading of iDCs with candidate molecules, incubation with autologous CD4 + T cells pre-stained with CFSE and detection of CFSE staining with CFSE low as a surrogate for cycling cells. Mean of 11 donors ⁇ SEM is shown. Significant differences compared to control DCs incubated with no protein and thus inducing non-specific T cell proliferation are shown. * p ⁇ 0.05, *** p ⁇ 0.001.
  • FIG. 30 Comparison of the capacity to induce proliferation of hPBMCs of SOT202 molecules with modified effector functions. Proliferation of isolated hPBMC was assessed for SOT202-DANA, SOT202-afuc-DANA, SOT202-DLE-DANA, SOT202-D E-DANA and SOT202-LALAPG-DANA. Cells were stimulated in vitro for 7 days. Mean of 6 donors ⁇ SEM is shown. Proliferation of NK (top) and CD8 + T cells (bottom) was measured by counting Ki67 + cells by flow cytometry.
  • FIG. 31 Comparison of the capacity to induce proliferation of hPBMCs of SOT202 molecules and SOT201. Proliferation of isolated hPBMC was assessed for SOT202, SOT202-afuc, SOT201-DANA, SOT202-DANA and SOT202-afuc-DANA. Proliferation of NK (top) and CD8 + T cells (bottom) was measured by counting Ki67 + cells by flow cytometry.
  • FIG. 32 Comparison of the capacity to induce proliferation of hPBMCs of SOT202-DANA molecules with modified effector functions and SOT201-DANA. Proliferation of isolated hPBMC was assessed for SOT201-DANA, SOT202-DANA, SOT202-afuc-DANA, SOT202-LALAPG-DANA and hClla (also labelled SOT202-mab). Proliferation of NK (top) and CD8 + T cells (bottom) was measured by counting Ki67 + cells by flow cytometry.
  • FIG. 33 (A) Cell proliferation (Ki67 + ) of CD8 + T cells or NK cells detected in spleen of healthy C57BL/6 mice after stimulation with mSOT202. Cell proliferation was detected by Ki67 staining and measured by flow cytometry 5 days after IV injection of compounds of mSOT202 (hClla-mIgG2a-NA lx) at 5, 10 or 20 mg/kg or of hClla-mIgG2a.
  • FIG. 34 Cell proliferation of NK cells (A) or CD8 + T cells (B) detected in spleen of healthy C57BL/6 mice after stimulation with mSOT202, mSOT202-LALAPG and hClla-mIgG2a. Top: Cell proliferation was detected by Ki67 staining and measured by flow cytometry 5 and 10 days after IV injection of the compounds at 5 mg/kg. Bottom: Percentage ofNK cell and CD8 + T cell.
  • Antibody also known as an immunoglobulin (Ig) is a large, Y -shaped protein composed in humans and most mammals of two heavy chains (HC) and two light chains (LC) connected by disulfide bonds.
  • Light chains consist of one variable domain V L and one constant domain C L
  • heavy chains contain one variable domain V H and three constant domains C H 1, C H 2, C H 3.
  • Structurally an antibody is also partitioned into two antigen-binding fragments (Fab), containing one V L , V H , C L , and C H 1 domain each, as well as the Fc fragment or domain containing the two C H 2 and C H 3 of the two heavy chains.
  • Fab antigen-binding fragments
  • antibody variant or “antibody functional variant”, as used herein, relates to antibodies with modifications for e.g., modulating their effector functions, modulating the antibody stability and in vivo half-life and/or inducing heterodimerization of the antibody Fc domains. Such variants may be achieved by mutations and/or posttranslational modifications.
  • Antibody variants also include antibody heavy chains with truncation of the N-terminal lysine. Other included variations are N- or C-terminal tags of the heavy and/or light chains for chemical or enzymatic coupling to other moieties such as dyes, radionuclides, toxins or other binding moieties. Further, antibody variants may comprise chemical modifications, modifications of their glycosylation or substitutions with artificial amino acids for chemical linkage to other moieties.
  • Antibody variant also relates to immunoglobulin gamma (IgG)-based bispecific antibodies that potentially recognize two or more different epitopes.
  • IgG immunoglobulin gamma
  • Various formats of bispecific antibodies are known in the art, e.g. reviewed by Godar et al. (2016) and Spiess et al. (2015).
  • Bispecific formats according to this invention include an Fc domain.
  • two RLI conjugates may, if not otherwise linked to a moiety, be either fused to the C- terminus of both light chains or to the C-terminus of both heavy chains; alternatively, one RLI conjugate may be fused to the C-terminus of one heavy chain for heterodimeric bispecific formats, or to the heavy chain or one light chain of heterodimeric bispecific formats with different light chains.
  • Antibody functional variants are capable of binding to the same epitope or target as their corresponding non-modified antibody.
  • the term “antibody” when generically used includes the antibody variants as defined herein.
  • a “conjugate”, as used herein, relates to either a non-covalent or a covalent complex of an interleukin 15 (IL-15) or a derivative thereof and the sushi domain of an interleukin 15-receptor alpha (IL-15Ra) or a derivative thereof.
  • the non-covalent complex may be formed either by co-expression of the two polypeptides or by separate expression, (partial) purification and subsequent combination to form such complex due to the affinity of such polypeptides.
  • the conjugate is a fusion protein, where the two polypeptides are genetically fused and recombinantly expressed to result in a single polypeptide chain to form the intact complex.
  • immunocytokine relates to polypeptide comprising an antibody or a functional variant thereof, genetically fused to a conjugate according to the invention.
  • RLI When RLI is mentioned within a specific immunocytokine construct, it is RLI2.
  • the EU numbering scheme has been applied to the disclosed antibodies or partial antibody sequences.
  • In vivo half-life refers to the (terminal) plasma half-life or T1 ⁇ 2 is the half-life of elimination or half-life of the terminal phase, i.e. following administration the in vivo half-life is the time required for plasma/blood concentration to decrease by 50% after pseudo-equilibrium of distribution has been reached (Toutain and Bousquet-Melou 2004).
  • the determination of the drug, here the immunocytokine agonist being a polypeptide, in the blood/plasma is typically done through a polypeptide-specific ELISA.
  • the in vivo half-life of a particular drug can be determined in any mammal. For example, the in vivo half-life can be determined in humans, primates or mice.
  • the in vivo half-life determined in humans may considerably differ from the in vivo half-life in mice, i.e., the in vivo half-life in mice for a certain drug is commonly shorter than the in vivo half-life determined for the same drug in humans, such in vivo half-life determined in mice still gives an indication for a certain in vivo half-life in humans.
  • the in vivo half-life of the drug in humans can be extrapolated. This is particularly important since the direct determination of the in vivo half-life of a certain drug in humans is rarely possible due to prohibitions of experiments for merely scientific purposes involving humans.
  • the half-life can be determined in primates (e.g., cynomolgus monkeys) which is more similar to the half-life in humans.
  • the immunocytokine is for use in treating or managing cancer, wherein the use comprises simultaneously, separately, or sequentially administering the immunocytokine and a further therapeutic agent, or vice e versa.
  • the two combined agents are provided as a bundle or kit, or even are co-formulated and administered together where dosing schedules match.
  • “administered in combination” includes (i) that the drugs are administered together in a joint infusion, in a joint injection or alike, (ii) that the drugs are administered separately but in parallel according to the given way of administration of each drug, and (iii) that the drugs are administered separately and sequentially.
  • Parallel administration in this context preferably means that both treatments are initiated together, e.g. the first administration of each drug within the treatment regimen are administered on the same day. Given potential different treatment schedules it is clear that during following days/weeks/months administrations may not always occur on the same day. In general, parallel administration aims for both drugs being present in the body at the same time at the beginning of each treatment cycle. Sequential administration in this context preferably means that both treatments are started sequentially, e.g., the first administration of the first drug occurs at least one day, preferably a few days or one week, earlier than the first administration of the second drug in order to allow a pharmacodynamic response of the body to the first drug before the second drug becomes active. Treatment schedules may then be overlapping or intermittent, or directly following each other.
  • At least one such as in “at least one chemotherapeutic agent” may thus mean that one or more chemotherapeutic agents are meant.
  • the term “combinations thereof’ in the same context refers to a combination comprising more than one chemotherapeutic agents.
  • the invention in a first aspect relates to an immunocytokine comprising a cytokine conjugate and an antibody or a functional fragment thereof.
  • the cytokine conjugate comprises a polypeptide comprising the amino acid sequence of an interleukin 15 (IL-15) or a derivative thereof and the sushi domain of an interleukin 15-receptor alpha (IL-15Ra) or a derivative thereof.
  • IL-15 interleukin 15
  • IL-15Ra interleukin 15-receptor alpha
  • the antibody or functional variant thereof comprised in the immunocytokine is characterized by a heterodimeric Fc domain, a modified effector function (compared to the same immunocytokine with a wildtype Fc domain of the same IgG class) and/or having an increased in vivo half-life (compared to the same immunocytokine with a wildtype Fc domain of the same IgG class).
  • the conjugate may be fused directly or indirectly to the C- terminus of both antibody heavy chains or antibody light chains, or, in case of a heterodimeric Fc domain, to the C-terminus of one antibody heavy chain.
  • the increase in in vivo half-life of the immunocytokine may be achieved through Fc mutations that increase FcRn binding.
  • the Fc domain of the antibody or functional variant thereof may also comprise further modifications such as truncation of the C-terminal lysine of heavy chains, or in case of a heterodimeric Fc domain, of one or both heavy chains. Additionally, for indirect fusion a flexible linker composed of residues like glycine and serine may be introduced at the C-terminus of the heavy or light chains of the antibody so that the adjacent conjugate is free to move relative to the antibody Fc domain.
  • the antibody or functional variant thereof comprised in the immunocytokine is not the antibody hClla, hCllb, hCllc, hClld, hClle, hCllf, hCllg, hCllh, hClli and hCllj as disclosed in Table 4.
  • the antibody or functional variant thereof comprised in the immunocytokine is the antibody hClla, hCllb, hCllc, hClld, hClle, hCllf, hCllg, hCllh, hClli and hCllj as disclosed in Table 4.
  • the invention provides an antibody or functional variant thereof binding to its target, the antibody being an IgGl, IgG2, IgG4, synthetic IgG or a bispecific antibody, or Fc-engineered versions thereof.
  • the antibody is an IgGl or IgG4 class antibody.
  • the preferred antibody format is IgGl.
  • the preferred antibody format is IgG4.
  • the Fc region of immunoglobulins preferentially interacts with multiple Fey receptors (FcyR) and complement proteins (e.g., Clq), and mediates immune effector functions, such as elimination of targeted cells via antibody-dependent cellular cytotoxicity (ADCC), antibody-dependent cellular phagocytosis (ADCP) or complement-dependent cytotoxicity (CDC).
  • ADCC antibody-dependent cellular cytotoxicity
  • ADCP antibody-dependent cellular phagocytosis
  • CDC complement-dependent cytotoxicity
  • Fc-mediated effector functions such as ADCC may be enhanced when the antibody is targeting tumour cells and silenced when the antibody is targeting check point inhibitors present on immune cells such as PD-1 or CTLA-4.
  • the antibody When the antibody is targeting check point inhibitors present on immune cells such as PD-1 or CTLA-4, the antibody may be in the IgG4 format which is a poor inducer of Fc-mediated effector functions.
  • the antibody targeting a check point inhibitor such as PD-1 or CTLA-4 may be in the IgGl format engineered to have strongly reduce or silenced ADCC and/or CDC activity, e.g., having reduced FcyR and Clq binding.
  • IgG subclasses in developing anti-tumour therapeutic antibodies may be found in Yu J. et al (Yu, Song et al. 2020).
  • Antibody Fc-mediated function may be modulated using Fc-engineered immunoglobulins.
  • Table 2 shows example of such Fc engineering.
  • Table 2 Examples of modifications to modulate antibody effector function. Unless otherwise noted, the mutations are on the IgGl subclass. Adapted from Wang et al. (Wang, Mathieu et al. 2018).
  • a target cell line expressing a certain surface-exposed antigen is incubated with antibody or immunocytokine specific for that antigen.
  • effector cells expressing Fc receptor CD 16 Fc receptors FcyRIIIa (CD 16a) and FcyRIIIb (CD 16b)
  • PBMCs peripheral blood mononuclear cell
  • NK cells alternatively purified NK cells may be used.
  • a further alternative is the use of the human NK cell line NK92 (ATCC CRU-2407) exogenously expressing human CD16 (NK92-hCD16).
  • NK92-hCD16 exogenously expressing human CD16
  • NK92-hCD16 exogenously expressing human CD16
  • Cytotoxicity can be quantified by measuring the amount of label in solution compared to the amount of label that remains within healthy, intact cells.
  • the label may be the radiolabel 51 Cr, as described Perussia and Uoza (Perussia and Uoza 2000).
  • ADCC activity may also be measured using an UDH cytotoxicity assay.
  • UDH cytotoxicity assay is a colorimetric assay that provides a simple and reliable method for determining cellular cytotoxicity.
  • Uactate dehydrogenase is a cytosolic enzyme present in many different cell types that is released into the cell culture medium upon damage to the plasma membrane, such as plasma membrane damage occurring during ADCC.
  • the UDH assay protocol is based on an enzymatic coupling reaction: UDH released from the cell oxidizes lactate to generate NADH, which then can react with water soluble tetrazolium salt (WST) to generate a yellow colour. The intensity of the generated colour correlates directly with the number of lysed cells.
  • ADCC activity may also be measured as disclosed in Example 9.
  • Fc receptor binding of immunocytokine s can also be tested by surface plasmon resonance (SPR), as described in
  • the modified effector function of the antibody or functional variant thereof comprised in the immunocytokine is a reduced antibody-dependent cell toxicity as compared to the same immunocytokine with a wildtype Fc domain of the same IgG class.
  • the antibody effector functions may be reduced by reducing FcyR and Clq binding via the mutations listed in Table 2 in the corresponding section.
  • reduced ADCC may be achieved through mutations selected from L234A/L235A, P329G, L234A/L235A/P329G, G236R/L328R, D265A, N297A, N297Q, N297G or
  • reduced ADCC may be achieved through mutations selected from L235E, F234A/L235A, F234A/L235A/P329G, P329G, S228P/L235E, S228P/F234A/L235A or E233P/F234V/L235A/D265A/R409K, preferably L235E.
  • reduced ADCC may be achieved through mutation selected from H268Q/V309L/A330S/P331S or V234A/G237A/P238S/H268A/V309L/A330S/P331S.
  • reduced ADCC may be achieved when the antibody of functional variant thereof is an IgG2 (IgG2a or IgG2b) and IgG4 hybrid or a functional variant thereof and comprises a CHI + hinge region from IgG2, and CH2 + CH3 regions from IgG4 (IgG2 amino acids 118 to 260 and IgG4 amino acids 261 to 447).
  • IgG2a or IgG2b IgG2a or IgG2b
  • IgG4 hybrid or a functional variant thereof comprises a CHI + hinge region from IgG2, and CH2 + CH3 regions from IgG4 (IgG2 amino acids 118 to 260 and IgG4 amino acids 261 to 447).
  • reduced ADCC of an IgGl antibody is achieved via the L234A/L235A (“LALA”) mutations, and may comprise the IgGl Fc region of SEQ ID NO: 26.
  • LALA L234A/L235A
  • reduced ADCC of an IgGl antibody is achieved via the L234A/L235A/P329G (“LALAPG”) mutations, and may comprise the IgGl Fc region of SEQ ID NO: 27.
  • LALAPG L234A/L235A/P329G
  • Example 23 and FIG. 13 show that the immunocytokine hClla LALAPG-RLI DANA has nearly abolished ADCC activity when tested on A549-CLDN18.2 cells or PA-TU-8988 in the presence of NK92 cells, when compared to the hClla-RLI DANA immunocytokine of hClla antibody alone.
  • the hClla LALA antibody has also reduced ADCC activity when compared to the hClla antibody, however the ADCC activity is not fully abolished.
  • the already poor induction of Fc- mediated effector functions may be further reduced via the L235E mutation, the F234A/L235A or the E233P/F234V/L235A/D265A/L309V/R409K mutations.
  • reduced ADCC of an IgG4 antibody is achieved via the L235E mutation, and may comprise the IgG4 FC region of SEQ ID NO: 43.
  • the modified effector function of the antibody or functional variant thereof comprised in the immunocytokine is enhanced ADCC.
  • the antibody may be modified to enhance ADCC through increased FcyRIIIa binding via the mutation listed in Table 2 in the corresponding section and/or by afucosylation.
  • ADCC is enhanced in IgGl antibodies or variants thereof via mutation selected from F243L/R292P/Y300L/V305I/P396L, S239D/I332E, S239D/I332E/A330L, S298A/E333A/ K334A, K392T/P396L, V264I/I332E or L234Y/L235Q/G236W/S239M/H268D/D270E/S298A.
  • ADCC is enhanced in IgGl antibodies or variants thereof via preferably from mutations selected from S239D/I332E (“DE”), S239D/I332E/A330L (“DLE”),
  • AAA S298A/E333A/K334A
  • TL K392T/P396L
  • IE V264I/I332E
  • ADCC is enhanced in IgGl antibodies via the DE mutations and may comprise the IgGl Fc region of SEQ ID NO: 30.
  • ADCC is enhanced in IgGl antibodies via the DLE mutations and may comprise the IgGl Fc region of SEQ ID NO: 31.
  • ADCC is enhanced in IgGl antibodies via the AAA mutations and may comprise the IgGl Fc region of SEQ ID NO: 34.
  • ADCC is enhanced in IgGl antibodies via the TL mutations and may comprise the IgGl Fc region of SEQ ID NO: 36.
  • ADCC is enhanced in IgGl antibodies via the IE mutations and may comprise the IgGl Fc region of SEQ ID NO: 37.
  • ADCC may also be enhanced by reducing the fiicose content of the antibody via afucosylation (Pereira, Chan et al. 2018).
  • Fucose (6-deoxy-L-galactose) is a common component of many N- and O-linked glycans produced in mammalian cells. Absence of core fucose on the Fc N- glycan of IgGl at the conserved N-glycosylation site Asn297 (N297) in each of the CH2 domains has been shown to increase IgGl Fc binding affinity to the FcyRIIIa present on immune effector cells such as natural killer cells and lead to enhanced ADCC activity.
  • Fucosyltransferases transfer a fucose residue from GDP-fucose to an acceptor substrate.
  • FUT8 is the only al,6-fucosyltransferase that transfers fucose via an a 1,6 linkage to the innermost N-acetylglucosamine on N-glycans for core fucosylation of IgGl.
  • Afucosylated antibodies may be produced in CHO cells where the FUT8 gene has been knocked-out (POTELLIGENT ® technology). Antibodies produced in such a cell line have shown enhanced ADCC compared to the same antibody produced in conventional CHO cells (Y amane- Ohnuki, Kinoshita et al. 2004).
  • antibodies may be produced in glycoengineered cell lines in which the fticose synthesis pathway has been deflected, also resulting in afucosylated antibodies (GlymaX®, ProBioGen) (Rosenlocher, Bohrsch et al. 2015, Dekkers, Plomp et al. 2016).
  • the antibody may be modified to enhance ADCC through increased FcyRIIIa binding via afucosylation of the antibody.
  • the antibody may be modified to enhance ADCC through increased FcyRIIIa binding via one of the mutations listed in Table 2 in the corresponding section, combined with afucosylation of the antibody.
  • the IgGl antibody may be modified to enhance ADCC through increased FcyRIIIa binding via the AAA mutations, combined with afucosylation of the antibody.
  • the ADCC activity of immunocytokines with different Fc mutation enhancing ADCC activity, or afucosylated, or mutations combined with afucosylation is shown in Example 23 and FIG. 14, when measured by a cell based ADCC assay. All the mutations increased the ADCC activity of the tested immunocytokine to a similar extend, compared to the heterodimeric immunocytokine without the Fc domain mutations or the antibody alone. Likewise, afucosylation also enhanced ADCC activity of the immunocytokine. The combination of afucosylation with the AAA mutations also enhanced ADCC, whereas combination of DE or DLE with afucosylation even lowered ADCC activity compared to DE, DLE or afucosylation alone.
  • Example 24 SPR allowed to evaluation the antibody Fc binding to ADCC-activating receptors FcyRIIIa V158, and FcyRIIIa F158 and ADCC-inhibitory receptor FcyRIIb.
  • the SPR testing confirmed that overall, the immunocytokines with mutations enhancing ADCC show a higher A/I ration than the immunocytokine without mutations enhancing ADCC, unless the antibody glycosylation was affected by the mutation.
  • Fc domain may also impact the stability and developability of immunocytokines and may depend on each particular antibody used for the immunocytokine. More specifically, the meting temperature and glycosylation of immunocytokines with Fc mutations have been tested (see example 25). Overall, for the hClla-based immunocytokine, while the TL and IE mutations introduced unfavourable glycosylation and the DE and DLE mutations decreased the C H 2 domain melting temperature impacting its stability, the AAA mutations, optionally combined with afucosylation, did not impact the stability and developability of the hCl la-based immunocytokine.
  • modifications made in the Fc domain of the antibody to improve its stability may be the S228P mutation in IgG4 antibodies to avoid Fab arm exchange (Silva, Vetterlein et al. 2015) (SEQ ID NO: 39).
  • the antibody Fc domains may be heterodimeric in order the have only one heavy chain fused to the cytokine. Heterodimerization may be achieved by mutations in the CH3 chains of each of the two Fc domains of the antibody (C H 3A chain and C H 3B chain). Table 3 below summarizes designs for heterodimeric Fc variants (Ha, Kim et al. 2016).
  • heterodimerization of the antibody may be achieved by using any one of the following heterodimeric Fc variants: KiH, KiHS-S, HA-TF, ZW1, 7.8.60, DD-KK, EW-RVT, EW- RVTS-S, SEED or A 107.
  • heterodimerization of the antibody is achieved via the T366W mutation in the CH3 domain of one heavy chain (SEQ ID NO: 28) and the T366S/L368A/Y407V mutations in the CH3 domain of the opposing heavy chain (SEQ ID NO: 29), resulting in a “Knobs-into-Holes (KiH)” Fc variant.
  • the potency of a homodimerized with two RLI2 conjugates is compared to the potency of an heterodimerized immunocytokine.
  • Table 11 show that, although only one RLI2 conjugate is present in the heterodimeric immunocytokine (RTX-RLI xl), surprisingly its potency is nevertheless still above 50% of the potency of the homodimeric immunocytokine (RTX-RLI 2x).
  • Example 3 Methods to produce heterodimeric immunocytokines can be found in Example 3. Measurements of the potency of such heterodimeric immunocytokines, compared to homodimeric immunocytokine can be found in Example 5 and Table 15. As one aim of the present invention is to reduce the potency of the conjugate, the inventors now show that, whereas the homodimeric immunocytokine having two RLL2 conjugates fused the C-termini had a minor reduction of potency, the heterodimeric immunocytokine having only one RLI2 conjugate showed an about lOfold reduction in potency on kit225 cells.
  • the RLI2 conjugate is fused to the knob heavy chain.
  • SEQ ID NO: 21 (“ HC knob-RLI2 AQ NA”), SEQ ID NO: 22 or SEQ ID NO: 101 (“HC hole” with or without the terminal lysine deletion) and SEQ ID NO: 23 (LC), preferably SEQ ID NO: 21, SEQ ID NO: 101 and SEQ ID NO: 23 for SOT201 (pembrolizumab-variant based heterodimeric immunocytokine); SEQ ID NO: 85 (“HC knob-RLI2 AQ DANA”), SEQ ID NO: 87 (“HC hole”) and SEQ ID NO: 88 (LC) for a hCl la-variant based heterodimeric immunocytokine; SEQ ID NO: 111 (“HC knob- RLI2 AQ NA”), SEQ ID NO: 110 (“HC hole”) and SEQ ID NO: 88 ((LC) for another hCl la-variant based heterodimeric immunocytokine; SEQ ID NO:
  • the heterodimeric Fc domain leads to higher yield of the immunocytokine upon expression in cell culture, compared to an immunocytokine with homodimeric Fc domain.
  • the heterodimeric antibody formats have lower expression due to mispairing of the heavy and light chains, surprisingly, it was observed for the heterodimeric immunocytokines, that heterodimeric constructs using the KiH technology had a higher expression compared to respective homodimeric constructs (see Example 3).
  • the conjugate may also be fused to the C-termini of the light chains of the antibody (e.g., SEQ ID NO: 45).
  • a linker consisting of glycines or serines and glycines may be between the C-terminus of the light chain and the N-terminus of the conjugate to allow for flexibility of the fused conjugate relative to the antibody.
  • a linker may be used for fusing RLI2 AQ to the C-terminus of one or both heavy chains.
  • Such linker is preferably composed of glycines or glycines and serines, more preferably composed of GGGGS units with a length of 30 to 50 amino acids, especially the L40 linker of SEQ ID NO: 100.
  • the invention relates to an immunocytokine wherein the in vivo half-life of the immunocytokine is increased and wherein the antibody or functional variant thereof is an IgGl or an IgG4 antibody or a functional variant thereof and comprises a mutation selected from M252Y/S254T/T256E, M428L/N434S or T250Q/M428L.
  • the Fc domain plays a central role in the stability and serum half-life of antibodies.
  • Antibody in vivo half-life may be increased via the M252Y/S254T/T256E or M428L/N434S mutation in the Fc domain increasing FcRn binding (Dall'Acqua, Woods et al. 2002, Zalevsky, Chamberlain et al. 2010).
  • the half-life of antibodies of the IgGl or IgG4 type is increased via the M252Y/S254T/T256E (“YTE”) mutations, respectively the Fc domain of SEQ ID NO: 35 and SEQ ID NO: 44.
  • YTE M252Y/S254T/T256E
  • the invention relates to an immunocytokine wherein the antibody or functional variant thereof has reduced ADCC and wherein the antibody or functional variant thereof is an IgG4 antibody or a functional variant thereof and comprises a L235E mutation and a KiH-heterodimeric Fc domain.
  • Reducing ADCC may be beneficial when the antibody target is a check-point inhibitor present on an immune cell, such as PD-1 or CTLA-4 on the surface of T cells, to avoid NK cell-induced cytotoxicity toward these immune cells.
  • the IgG4 antibody may also optionally contain the S228P mutation to stabilize the antibody.
  • the IgG4 Fc domain with the F235E mutation may be of the sequence SEQ ID NO: 43.
  • the IgG4 CHl-hinge domain with the S228P mutation may be of the sequence SEQ ID NO: 39.
  • KiH-heterodimeric Fc domain of the IgG4 antibody may be of the sequence SEQ ID NO: 41 (“knob”) and SEQ ID NO: 42 (“hole”).
  • one or preferably both heavy chains may have the terminal lysine deletion (dK), i.e. the sequence SEQ ID NO: 41 (“knob”) and SEQ ID NO: 42 (“hole”).
  • both heavy chains have the terminal lysine.
  • Example 10 to Example 26 relate to such an immunocytokine.
  • the conjugate of the immunocytokine is a fusion protein comprising, in N- to C- terminal order, the IL-15Ra sushi domain or a derivative thereof, a linker and the IL-15 or a derivative thereof, preferably wherein the IL-15Ra sushi domain comprises the sequence of SEQ ID NO: 5, more preferably the IL-15Ra sushi+ fragment of SEQ ID NO: 6, and wherein the linker has a length of 18 to 22 amino acids and is composed preferably of glycines or serines and glycines, more preferably has the sequence of SEQ ID NO: 7, and wherein the IL-15 has the sequence of SEQ ID NO: 2.
  • the fusion protein of having the IL-15Ra sushi+ fragment of SEQ ID NO: 6 fused via the flexible linker of SEQ ID NO: 7 to the N-terminus of the mature human IL-15 of SEQ ID NO: 2 is referred to as RLI2 for Receptor-Linker-Interleukin 2 or SO-C101 having the sequence of SEQ ID NO: 8, and is a clinical stage IL-2/IL- 15RPy superagonist with low immunogenicity. This make such fusion protein a preferred conjugate to be used in an immunocytokine format.
  • the immunocytokine comprises an IL-15 variant which comprises at least one mutation increasing the homogeneity of the IL-15 variant with respect to post-translational modifications, preferably wherein the mutation reduces deamidation atN77 and/or glycosylation atN79 of IL-15 mature human IL-15 (SEQ ID NO: 2), more preferably wherein the mutation is selected from mutations G78A, G78V, G78L or G78I, and N79Q, N79S or N79T, most preferably wherein the mutation is G78A/N79Q; (the “AQ mutation”).
  • the IL-15 mutations increasing the homogeneity of the immunocytokine and the IL-15 mutations reducing the binding to the IL-2/IL-15RP and/or to the y c receptor may be used independently in immunocytokine s of the invention or may be combined in immunocytokines of the invention.
  • the immunocytokine comprises an IL-15 variant which comprises at least one mutation that reduces the binding to the IL-2/IL-15RP and/or to the y c receptor, preferably wherein the mutated amino acid is selected from Nl, N4, S7, D8, K10, Kll, D30, D61, E64, N65, L69, N72, E92, Q101, Q108, 1111 of IL-15 mature human IL-15 having the sequence of SEQ ID NO: 2, more preferably wherein the mutated amino acid is selected from D61, N65 and Q101, most preferably wherein the mutated amino acid is N65.
  • the mutation that reduces the binding to the IL-2/IL-15RP and/or to the yc receptor is preferably a substitution selected from N1D, N1A, NIG, N4D, S7Y, S7A, D8A, D8N, K10A, K11A, D30N, D61A, D61N, E64Q, N65D, N65A, N65E, N65R, N65K, L69R, N72R, Q101D, Q101E, Q108D, Q108A, Q108E and Q108R, preferably D8A, D8N, D61A, D61N, N65A, N65D, N72R, Q101D, Q101E and Q108A, more preferably D61A, N65A and Q101, most preferably N65A or a combined substitution selected from D8N/N65A, D61A/N65A or D61A/N65A/Q101D.
  • the immunocytokine comprises an antibody or functional variant thereof, which binds to a tumour antigen, preferably selected from EGFR, HER2, FGFR2, FOLR1, CLDN18.2, CEA, GD2, O-Acetyl-GD-2, GM1, CAIX, EPCAM, MUC1, PSMA, c-Met, ROR1, GPC3, CD19, CD20, CD38; to a tumour extracellular matrix antigen, preferably selected from FAP, the EDA domain of fibronectin, the EDB domain of fibronectin and LRRC15, preferably FAP and the EDB domain of fibronectin; to a neovascularization antigen, preferably VEGF, or Endoglin; (CD 105); or is an immunomodulatory antibody or a functional variant thereof, wherein the immunomodulatory antibody stimulates a co-stimulatory receptor, preferably selected from CD40 agonists, CD 137/4- IBB agonists, CD 134/0X40 agonists and TN
  • Antibodies against the listed targets above are well known in the art or can be generated by standard immunization or phage display protocols.
  • Non-human antibodies can be humanized.
  • Examples of anti- EGFR antibodies are cetuximab, panitumumab, zalutumumab, nimotuzumab, and matuzumab.
  • Examples of anti-HER2 antibodies are trastuzumab, permtuzumab or margetuximab.
  • Examples of anti- CLDN18.2 antibodies are zolbetuximab and antibodies of the invention below.
  • An example of an anti- CEA antibody is arcitumomab.
  • An example of an anti-GD2 is hul4.18K322A.
  • An example of an anti O-Acetyl-GD-2 is c.8B6.
  • anti-CD20 antibodies are rituximab, ocrelizumab, obinutuzumab, ofatumumab, ibritumomab, tositumomab and ublituximab.
  • Examples of anti-CD38 antibodies are daratumumab, MOR202 and isatuximab.
  • anti-FAP antibodies are Sibrotuzumab and B12 (US 2020-0246383A1).
  • An example of an anti-EDA domain antibody of fibronectin is the F8 antibody ((Villa, Trachsel et al. 2008), WO 2010/078945, WO 2014/174105), an example of an anti-EDB domain of fibronectin is the L19 antibody ((Pini, Viti et al. 1998), WO 1999/058570), and an example of an anti-LRRC15 antibody is Samrotamab/huM25 (WO 2017/095805).
  • anti-VEGF antibodies examples include bevacizumab and ranibizumab.
  • An example of an anti-Endoglin antibody is TRC 105 (WO 2010039873A2).
  • anti-CD40 agonistic antibodies are selicrelumab, APX005M, ChiLob7/4, ADC-1013, SEA-CD40 and CDX-1140 (Vonderheide 2020).
  • anti-CD 137/4- IBB agonistic antibodies are urelumab and utomilumab (Chester, Sanmamed et al. 2018).
  • anti-CD 134/0X40 agonistic antibodies PF-04518600, MEDI6469, MOXR0916, MEDI0562, INCAGN01949 Fu, Lin et al. 2020.
  • An example of an anti-TNFRSF18/GITR agonistic antibody is DTA-1.
  • Examples of PD-1 antagonists are anti-PD-1 antibodies, anti-PD-Ll antibodies or anti-PD-L2 antibodies
  • anti-PD-1 antagonistic antibodies are pembrolizumab, nivolumab, pidilizumab, toripalimab and tislelizumab (Dolgin 2020).
  • Examples of anti-PD-Ll antagonistic antibodies are atezolizumab and avelumab.
  • An example of an anti-CTLA-4 antagonistic antibody is ipilimumab.
  • An example of an anti-LAG3 antagonistic antibody is relatlimab.
  • anti -TIGIT antagonistic antibodies examples include Tiragolumab, Vibostolimab, Domvanalimab, Etigilimab, BMS-986207, EOS-448, COM902, ASP8374, SEA-TGT, BGB-A1217, IBI-939 and M6223.
  • an anti-BTLA antagonistic antibody is TAB004.
  • anti-HAVCR2/TIM-3 antagonistic antibodies are LY3321367, MBG453 and TSR-022.
  • a preferred embodiment is an immunocytokine, wherein the conjugate comprises the sequence of SEQ ID NO: 10 and the antibody comprises the pembrolizumab-derived heavy chain knob sequence of SEQ ID NO: 20, the pembrolizumab-derived heavy chain hole sequence of SEQ ID NO: 22, and the light chain sequence of SEQ ID NO: 16, wherein the conjugate is fused to the C-terminus heavy chain knob sequence without a linker, preferably SEQ ID NO: 21.
  • the immunocytokine of the present invention comprises the conjugate of the sequence SEQ ID NO: 10) or SEQ ID NO: 11 and the antibody is an anti-CLDN18.2 heterodimeric IgGl antibody variant having a VH and VL domain sequence of Table 4, the IgGl variant being heterodimeric through the KiH mutation of Table 3, having enhanced ADCC activity through the DE, DLE, AAA, TL or IE mutations of Table 2 or through afucosylation, or through the combination of a mutation listed above and afucosylation.
  • the immunocytokine of the present invention comprises the conjugate of the sequence SEQ ID NO: 10) or SEQ ID NO: 11 and the antibody is an anti-CLDN18.2 heterodimeric IgGl antibody variant having a VH and VL domain sequence of Table 4, the IgGl variant being heterodimeric through the KiH mutation of Table 3.
  • Table 4 VH and VL domain sequences of anti-CLDN18.2 antibodies
  • the immunocytokine of the present invention comprises the conjugate of the sequence SEQ ID NO: 10 and the anti-CLDN18.2 heterodimeric IgGl antibody variant having a VH and VL domain sequence of SEQ ID NO: 46 and SEQ ID NO: 47, respectively, the IgGl variant being heterodimeric through the KiH mutation of Table 3.
  • the immunocytokine of the present invention comprises the conjugate of the sequence SEQ ID NO: 10 and the anti-CLDN18.2 heterodimeric IgGl antibody variant having a VH and VL domain sequence of SEQ ID NO: 46 and SEQ ID NO: 47, respectively, the IgGl variant being heterodimeric through the KiH mutation of Table 3, having enhanced ADCC activity through the DE, DLE, AAA, TL or IE mutations of Table 2 or through afucosylation, or through the combination of a mutation listed above and afucosylation.
  • the immunocytokine of the present invention comprises the conjugate of the sequence SEQ ID NO: 10 and the anti-CLDN18.2 heterodimeric IgGl antibody variant having a VH and VL domain sequence of SEQ ID NO: 46 and SEQ ID NO: 47, respectively, the IgGl variant being heterodimeric through the KiH mutation of Table 3, having enhanced ADCC activity through afucosylation.
  • the immunocytokine comprises a conjugate of the sequence of SEQ ID NO: 11
  • the antibody variant is a heterodimeric IgG 1 anti-CLDN 18.2 antibody having heavy chain knob sequence of SEQ ID NO: 84, heavy chain hole sequence of SEQ ID NO: 87 and the light chain sequence of SEQ ID NO: 88.
  • An exemplary sequence for a preferred immunocytokine may be SEQ ID NO: 85 (“HC knob”), SEQ ID NO: 87 (“HC hole”) and SEQ ID NO: 88 (LC).
  • Another exemplary sequence for a preferred immunocytokine may be SEQ ID NO: 86 (“HC knob”), SEQ ID NO: 87 (“HC hole”) and SEQ ID NO: 88 (LC).
  • Yet another exemplary sequence for a preferred immunocytokine may be SEQ ID NO: 111 (“HC knob”), SEQ ID NO: 110 (“HC hole”) and SEQ ID NO: 88 (LC).
  • the immunocytokine of the present invention comprises the conjugate ofthe sequence SEQ ID NO: 10 and where the antibody variant is a heterodimeric IgGl anti-CLDN18.2 antibody having heavy chain knob sequence of SEQ ID NO: 84, heavy chain hole sequence of SEQ ID NO: 87 and the light chain sequence of SEQ ID NO: 88.
  • the RLI2AQ DANA mutant fused to the anti-Claudinl8.2 antibody hClla showed higher ADCC compared to the RLI2AQ NA mutant.
  • the immunocytokine of the present invention comprises the conjugate of the sequence SEQ ID NO: 10 and an anti-CLDN18.2 heterodimeric IgGl antibody variant having a VH and VL domain sequence of SEQ ID NO: 46 and SEQ ID NO: 47, respectively, the IgGl variant being heterodimeric through the KiH mutation of Table 3, having the S239D/I332E (DE) ADCC-enhancing mutation in the IgGl Fc domain.
  • the immunocytokine of the present invention comprises the conjugate of the sequence SEQ ID NO: Hand an anti-CLDN18.2 heterodimeric IgGl antibody variant having a VH and VL domain sequence of SEQ ID NO: 46 and SEQ ID NO: 47, respectively, the IgGl variant being heterodimeric through the KiH mutation of Table 3, having the S239D/I332E (DE) ADCC-enhancing mutation in the IgGl Fc domain.
  • the immunocytokine of the present invention comprises a the fusion protein having the sequence of SEQ ID NO: 10 and the antibody variant is a heterodimeric IgGl anti-EGFR antibody having the VH sequence of SEQ ID NO: 91 and the VL sequence of SEQ ID NO: 92, the IgGl variant being heterodimeric through the KiH mutation of Table 3, having enhanced ADCC activity through FC mutations listed in Table 2 in the corresponding section or through afucosylation, or through the combination of mutations and afucosylation.
  • the invention relates to a nucleic acid encoding the immunocytokine s herein disclosed. In yet another embodiment, the invention relates to a vector comprising the nucleic acid coding for the immunocytokine s .
  • the invention relates to a host cell comprising the vector or nucleic acid coding for the immunocytokines.
  • Another embodiment of the invention relates to the immunocytokine, the nucleic acid or the vector for use in treatment.
  • Yet another embodiment of the invention relates to a pharmaceutical composition
  • a pharmaceutical composition comprising the immunocytokine, the nucleic acid or the vector and a pharmaceutically acceptable carrier.
  • the immunocytokine, the nucleic acid or the vector may be for use in the treatment of a subject suffering from, at risk of developing and/or being diagnosed for a neoplastic disease or an infectious disease.
  • the invention in another embodiment, relates to a method for treating a patient suffering from, at risk of developing and/or being diagnosed for a neoplastic disease or an infectious disease comprising administering the immunocytokine, the nucleic acid or the vector.
  • the immunocytokines of the invention may be administration in combination with other agents, typically the standard of care of the specific indication is it approved in.
  • the immunocytokine of the invention may be combined with a checkpoint inhibitor, which may be an anti -PD- 1 antibody, an anti-PD-Ll antibody, an anti-PD- L2 antibody, an anti-LAG3, an anti-TIM-3.
  • a checkpoint inhibitor which may be an anti -PD- 1 antibody, an anti-PD-Ll antibody, an anti-PD- L2 antibody, an anti-LAG3, an anti-TIM-3.
  • an anti-CTLA4 antibody or an anti-TIGIT antibody preferably an anti-PD-Ll antibody or an anti -PD- 1 antibody.
  • anti-PD-1 antibodies examples are pembrolizumab, nivolumab, cemiplimab (REGN2810), BMS-936558, SHR1210, IBI308, PDR001, BGB-A317, BCD-100 and JS001; examples of anti-PD-Ll antibodies are avelumab, atezolizumab, durvalumab, KN035 and MGD013 (bispecific for PD-1 and LAG-3); an example for PD- L2 antibodies is sHIgM12; examples of anti-LAG-3 antibodies are relatlimab (BMS 986016), Sym022, REGN3767, TSR-033, GSK2831781, MGD013 (bispecific for PD-1 and LAG-3) and LAG525 (IMP701); examples of anti-TIM-3 antibodies are TSR-022 and Sym023; examples of anti-CTLA-4 antibodies are ipilimumab and tremelimumab (t
  • SEQ ID NO: 1 human IL- 15
  • SEQ ID NO: 2 mature human IL-15
  • SEQ ID NO: 3 mature human IL-15 AQ
  • SEQ ID NO: 4 human IL-15Ra
  • SEQ ID NO: 5 sushi domain of IL-15Ra
  • SEQ ID NO: 6 sushi+ fragment of IL-15 Rot
  • SEQ ID NO: 8 RLI2 (SOT101)
  • SEQ ID NO: 11 RLI2 AQ D158A/N162A (D158A/N162A)
  • SEQ ID NO: 12 pembrolizumab heavy chain (HC) - human IgG4 k isotype
  • the pembrolizumab HC has stabilizing S228P mutation; for immunocytokines herein, terminal K has been deleted (dK) to reduce heterogeneity.
  • SEQ ID NO: 13 pembrolizumab HC CDR1
  • SEQ ID NO: 14 pembrolizumab HC CDR2
  • SEQ ID NO: 15 pembrolizumab HC CDR3
  • SEQ ID NO: 16 pembrolizumab light chain
  • SEQ ID NO: 17 pembrolizumab LC CDR1
  • SEQ ID NO: 18 pembrolizumab LC CDR2
  • SEQ ID NO: 21 SOT201 HC knob: IgG4 S228P/L235E/T366W/dK-RLI2.N162A/G175A/N176Q
  • SEQ ID NO: 22 HC hole: S228P.L235E.T366S.L368A.Y407V
  • SEQ ID NO: 23 SOT201 LC
  • SEQ ID NO: 24 IgGl CHI with hinge
  • SEQ ID NO: 27 IgGl Fc LALA PG
  • SEQ ID NO: 28 IgGl Fc KiH - knob
  • SEQ ID NO: 29 IgGl Fc KiH - hole
  • SEQ ID NO: 30 IgGl Fc DE (S239D/I332E)
  • SEQ ID NO: 31 IgGl Fc DLE (S239D/A330L/I332E)
  • SEQ ID NO: 32 IgGl Fc DAE (S239D/I332E/G236A)
  • SEQ ID NO: 33 IgGl Fc GASDALIE (G236A/S239D/A330L/I332E)
  • SEQ ID NO: 34 IgGl Fc AAA (S298A/E333A/K334A)
  • SEQ ID NO: 36 IgGl Fc TL (K392T/P396L)
  • SEQ ID NO: 37 IgGl Fc IE (V264I/I332E)
  • SEQ ID NO: 38 CL (kappa)
  • SEQ ID NO: 41 IgG4 Fc KiH - knob
  • SEQ ID NO: 42 IgG4 Fc KiH - hole
  • SEQ ID NO: 43 IgG4 Fc LE (L235E)
  • SEQ ID NO: 44 IgG4 Fc YTE (M252Y/S254T/T256E)
  • SSLQPEDFATYYCLQGSNFPLTFGQGTKVEIK SEQ ID NO: 56: hCllf VH
  • SEQ ID NO: 90 Zolbetuximab (IMAB362) VL
  • SEQ ID NO: 92 Cetuximab VL
  • SEQ ID NO: 93 Cetuximab HC AAA Knob
  • SEQ ID NO: 102 mPDl.VH-hl.HC.D265A.E356K.N399K.dk-RLI.N162A.G175A.N176Q murine antiPD-1 (mlgGl D265A HC1 - RLI-15 AQA )
  • SEQ ID NO: 103 mPDl.VH-hl.HC.D265A.K409E.K439D.dk murine antiPD-1 (mlgGl D265A HC2)
  • SEQ ID NO: 104 mPDl.VL-hk.LC murine antiPD-1 (mlgGl Light Chain)
  • SEQ ID NO: 105 human IL-2
  • SEQ ID NO: 106 IL-2v
  • SEQ ID NO: 112 PDl-IL2v HC1: HC with IL2v (Fc knob, LALAPG), IL2v.T3A.F42A.Y45A.L72G.C125A
  • SEQ ID NO: 113 PDl-IL2v HC2: HC (Fc hole LALAPG)
  • SEQ ID NO: 114 PDl-IL2v LC
  • SEQ ID NO: 115 mPDl-IL2v HC1: mPD-l.VH-hl.HC.D265A.E356K.N399K.dk- IL2v.T3A.F42A.Y45A.L72G.C125A murine antiPD-1 (mlgGl D265A HC1 - IL-2v)
  • SEQ ID NO: 116 mPDl-IL2v HC2: mPD-l.VH-hl.HC.D265A.K409E.K439D.dk murine antiPD- 1 (mlgGl D265A HC2)
  • SEQ ID NO: 118 hPD-l-IL15 (Ml) HC1: xhPD-l.VH- hl.HC.L234A.L235A.G237A.T366S.L368A.Y407V.dk-IL15ml.NlA.D30N.E46G.V49R anti -human PD-1 (Fc LALA KiH hole - IL-15ml)
  • NLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS SEQ ID NO: 119: hPD-l-IL15 (Ml) HC2: xhPD-l.VH-hl.HC.L234A.L235A.G237A.T366W.dk anti -human PD-1 (Fc LALA KiH knob)
  • SEQ ID NO: 120 hPD-l-IL15 (Ml)
  • LC xhPD-l.VL-hk.LC anti-human PD- 1 (Light Chain)
  • SEQ ID NO: 122 hPD-l-IL15 (M2)
  • HC2 xhPD-l.VH-hl.HC.L234A.L235A.G237A.T366W.dk anti -human PD-1 (Lc LALA KiH knob)
  • SEQ ID NO: 124 Kadmon HC1: 2-8 S354C/T366W LALAPG improved linker
  • SEQ ID NO: 125 Kadmon HC2: SEQ ID 223: 1-4 Y349C/T366S/L368A/Y407V LALAPG
  • SEQ ID NO: 126 Kadmon LC: SEQ ID NO: 219 - 38B2:
  • SEQ ID NO: 128 mSOT202 HC hole
  • SEQ ID NO: 130 mSOT202 LALAPG HC knob
  • SEQ ID NO: 135 mSOT202 isotype LALAPG HC knob
  • SEQ ID NO: 136 mSOT202 isotype LALAPG HC hole
  • SEQ ID NO: 140 RLI-15 AQA peptide
  • kit225 cells The activity of both IL-2 and IL-15 can be determined by induction of proliferation of kit225 cells as described by Hori et al. (1987). Kit225 cells (Hori, Uchiyama et al. 1987) were passaged in kit225 base medium and used for the potency assay at passage 4-7. Before the potency assay, kit225 cell were cultivated in kit225 base medium without IL-2 for 24h (starvation period). lxlO 4 kit225 cells were plated in 96-well plate and a serial dilution of RLI- 15 and respective molecules PEM-RLI-15 was added to cells. Cells were incubated at 37°C, 5% C0 2 for 72 ⁇ 3h.
  • IL-2 or IL-15 stimulation are used to determine proliferation activation due to IL-2 or IL-15 stimulation, as for example described by Soman et al. using CTLL-2 cells (Soman, Yang et al. 2009).
  • PBMCs peripheral blood mononuclear cells
  • buffy coats can be used as an alternative to cell lines such as the kit225 cells.
  • a preferred bioassay to determine the activity of IL-2 or IL-15 is the IL-2/IL-15 Bioassay Kit using STAT5-RE CTLL-2 cells (Promega Catalog number CS2018B03/B07/B05).
  • RLI2 supernatant 0.133 mg/ml (ELISA, average from 2 exps)
  • RLI2 AQ supernatant 0.0297 mg/ml (ELISA, average from 2 exps)
  • Buffy coats were obtained from healthy donors. PBMC were isolated by Ficoll Paque gradient, washed three times and resuspended in T cell complete medium in 96-well plate. Immunocytokines were added at the indicated concentrations and plates were incubated in 37 °C with 5% C0 2 for 7 days. The proliferation of immune cell population was detected by flow cytometry.
  • RPMI 1640 medium CTS GlutaMAX - I IX, 100 U/mL Penicillin-Streptomycin, ImM Sodium pyruvate, NEAA IX (non-essential amino acid mix), 2-Mercaptoethanol 0.05 mM and 10% AB human serum (heat inactivated).
  • hNK human NK cells
  • the assay was performed according to manufacturer’s instructions (Promega PD-1/PD-L1 Blockade Bioassay J1250).
  • PD-L1 aAPC/CHO-Kl cells were plated in 96 well plate and incubated 16- 20 hours in a 37 °C, 5% CO2 incubator.
  • PEM-RLI immunocytokines at the indicated concentrations and PD-1 Effector Cells were added to the cells and incubated for 6 hours in a 37 °C, 5% C0 2 incubator.
  • Bio-GloTM Reagent was added to the wells and incubated at room temperature for 15 min, luminescence measurement was performed. Cynomolgus monkey studies
  • Blood for serum separation was collected at lh, 4h, 8h, 24h, 48h, 60h, 72h, 84h, 96h, 120h and 168h after administration (some timepoints may have been omitted in some cases).
  • the concentration of immunocytokines in serum was determined by ELISA using the antibodies of Table 5.
  • Blood for flow cytometry evaluation of selected immune cell populations (NK and CD8 + T cells) was collected at pre-dose, day 5, 8, 12, 15, 19, 22 and 26.
  • Each mouse was inoculated subcutaneously in the right lower flank region with MC38-hPD-Ll tumour cells (lx 10 6 ) in 0.1 ml of PBS for tumour development. The randomization was started when the mean tumour size reached 108 mm 3 . 40 mice were enrolled in the study.
  • PEM-RLI2 NA xl was administered IV at 20 mg/kg at day 0 and pembrolizumab was administered IP at 5 mg/kg at days 0,3,6 and 9. Tumour observation was followed for 18 days. Concomitantly to this, PEM-RLI2 NA xl (IL-15 with N65A and AQ mutation) was administered IV at 5, 10 at day 0. Tumour observation was followed for 6 days.
  • Buffy coats were obtained from healthy donors. PBMC were isolated by Ficoll Paque gradient, washed three times. PBMC were isolated by Ficoll Paque gradient, washed three times. Pairs of hPBMCs donors were cultivated with equimolar concentration of pembrolizumab and PEM F-RFI NA xl at 1 nM for six days. IFNy production in cell supernatants was determined using human IFN-g DuoSet EFISA (R&D systems, No. DY258B). Data are expressed as relative response of IFNy production [%] and represent mean ⁇ SEM from - 12 pairs of hPBMC healthy donors.
  • the purified proteins were analyzed by SDS-PAGE and anti-RFI Western blot.
  • Coomassie staining protein bands are visualized according to their molecular weight in denatured conditions.
  • Western-blot analysis the gel is then transferred to a nitrocellulose membrane and used for Western- blot analysis with different antibodies. At the end of migration, the gel is used for protein transfer to nitrocellulose membrane.
  • the transfer parameters are 2.5 A, 25 V, 7 minutes (for Criterion gels) or 2.5 A, 25 V, 3 minutes (for Mini -PROTEAN gels).
  • iBindTM Flex solution After membrane saturation in iBindTM Flex solution, antibody incubation and wash steps are then done in iBind system. After revelation and when completely dry, the membrane is scanned for analysis.
  • Primary antibody used was anti RFI2-PR01 antibody (Cytune, dilution 1:25000), secondary antibody used was donkey anti-Rabbit IgG-AP antibody (Santa Cruz Biotechnology, dilution 1:5000).
  • Protein analysis by capillary electrophoresis relies on separation of FDS-labeled protein variants by a sieving matrix in a constant electric field.
  • the Fabchip GXII instrument uses a single sipper icrofluidic chip to characterize protein samples loaded on a 96-well plate.
  • the microfluidic chip technology allows the separation and analysis of the protein samples. After laser-induced signal detection and analysis, the provided data are: relative protein concentration, molecular size and percent purity using ladder and marker calibration standards.
  • Samples are denatured by mixing 5 pL-sample and 35 pL of HT Protein Sample Buffer in presence or not of DTT at final concentration of 35 mM. If required, samples are prediluted at 1 mg/mL in HT Protein Sample Buffer. Denaturation is performed by heating mix at 100°C for 5 min. Then, 70 pL of water are added and samples are centrifuged 10 minutes at 2,000g. Samples (in a 96-well plate) are then loaded on LabChip GXII instrument for chip transfer and analysis.
  • the RLI2 molecule has the major glycosylation site is N176 (RLI numbering) and a minor site at N168. No glycosylation is seen at N209.
  • the glycans are complex, majorly biantennary, fucosylated, GO to G2 with little sialylation.
  • In cell culture about 40 to 50% of the protein are glycosylated with about 5% at N168. After purification as described above, about 14 - 25% of RLI2 are glycosylated.
  • N77 IL- 15 numbering
  • N 174 RLI numbering
  • the inventors indeed saw in mass spectrometry that N77 was deamidated in CHO-expressed RLI2 and identified deamidation as a real problem for potential heterogeneity of RLI2 and RLI-based products and therefore deamidation should be avoided.
  • FIG. 1A shows that RLI2 wt (without a mutation) indeed is a heterogenous product with two major bands at about 20 and 25 kDa and a few minor bands, all being immune reactive to the anti-RLI2 antibody and thereby being different modifications of the RLI2 protein.
  • the single substitution G78A (IL-15 numbering)/G175A (RLI numbering) in RLI2 (RLI2 A) was introduced instead to abolish potential deamidation at position N77.
  • the major acidic peak (pi 6.0) in RP-UPLC was significantly reduced in cIEF as it would be expected for loss of deamidation, which confirms that deamidation hot spot N 174 indeed was deamidated (data not shown).
  • mass spectrometry analysis of the PEM-RLI AQ constructs showed zero deamidation (data not shown).
  • the band of box 1 may represent RLI2 glycosylated at N176
  • the band of box 3 may represent RLI2 glycosylated at N176 and N 168.
  • the band of box 3 may however also be RLI2 glycosylated with unfavorable Sialic acid glycan structures at N 176. Without being bound by any theory, this surprising increase of glycosylation atN71 may be explained that the glycosylation at the major site N79 sterically hindered glycosylation at N71 in RLI2 wt, such hinderance being relieved once N79 is mutated.
  • RLI2 AQ and accordingly also IL-15 AQ , with the AQ substitutions represent an RLI2, or IL- 15, variant with a highly improved homogeneity and a reduced risk for deamidation.
  • IL-15 AQ IL-15 AQ
  • IL-15 AQ IL-15 AQ
  • AQ substitutions represent an RLI2, or IL- 15, variant with a highly improved homogeneity and a reduced risk for deamidation.
  • N71 was substituted by S
  • N79 was substituted by Q
  • N160 was substituted by S, thereby generating RLI2 N168S/N176Q/N20 9s and RLI1 N168S/N176Q/N20 9s.
  • the RLI2 N176Q mutant was made. Transient expression in CHO cells lead to a unique 25 kDa band (see FIG. 2, right pane).
  • the RLI protein mutated only on its major glycosylation site (RLI2 N176Q ) exhibited also a unique 25 kDa band, therefore confirming the main glycosylation occupancy on the N176 residue of RLI expressed in CHO (transient expression).
  • Secretion yields of the deglycosylated mutants expressed in in transient CHO cells were similar to their glycosylation/original counterpart. Accordingly, there was no significant influence of the deglycosylation on the expression levels. Same was observed in the Pichia pastoris expression system (data not shown).
  • kit225 cells The activity of both IL-2 and IL-15 can be determined by induction of proliferation of kit225 cells as described by Hori et al. (1987). Kit225 cells (Hori, Uchiyama et al. 1987) were passaged in kit225 base medium and used for the potency assay at passage 4-7. Before the potency assay, kit225 cell were cultivated in kit225 base medium without IL-2 for 24h (starvation period). lxlO 4 kit225 cells were plated in 96-well plate and a serial dilution of RLI- 15 and respective molecules PEM-RLI-15 was added to cells. Cells were incubated at 37°C, 5% C0 2 for 72 ⁇ 3h.
  • IL-2 or IL-15 stimulation are used to determine proliferation activation due to IL-2 or IL-15 stimulation, as for example described by Soman et al. using CTLL-2 cells (Soman, Yang et al. 2009).
  • PBMCs peripheral blood mononuclear cells
  • buffy coats can be used as an alternative to cell lines such as the kit225 cells.
  • a preferred bioassay to determine the activity of IL-2 or IL-15 is the IL-2/IL-15 Bioassay Kit using STAT5-RE CTLL-2 cells (Promega Catalog number CS2018B03/B07/B05).
  • RLI2 supernatant 0.133 mg/ml (ELISA, average from 2 exps)
  • RLI2 AQ supernatant 0.0297 mg/ml (ELISA, average from 2 exps)
  • Table 8 EC50 values (nM) of RLI2 compared to RLI2 AQ from supernatants determined by activation of 32Db cells or kit225 cells
  • Table 9 Relative potency of RLI2 compared to RLI2 A qfrom supernatants determined by activation of Kit225 cell proliferation.
  • the glycosylation mutant RLI2 AQ as supernatant showed a very similar potency to stimulate kit225 and/or 32Db cells if compared to RLI2 from supernatant. This was surprising as for many glycoproteins loss of glycosylation leads to a lower activity.
  • RLI2 AQ and accordingly also IL-15 AQ , with the AQ substitutions represents an RLI2, or IL-15, variant with a highly improved homogeneity, a reduced risk for deamidation with a comparable potency to activate immune cells.
  • the RLI preparation was polished on an Capto Impres Phenyl column (CPI Phenyl HIC) and selected fractions for highly glycosylated RLI2 were pooled (RLI-15-HG), and selected fractions for low glycosylated RLI2 were pooled (RLI- 15-LG), see FIG. 5A-C.
  • UFDF filtration was performed on a 10 kDa cut-off UF membrane into final formulation buffer (20 mM Histidine, 6% Sorbitol pH6.5).
  • RLI-15-HG shows most of RLI in the upper band for the glycosylated RLI isomer, whereas RLI- 15 -LG contains only a smaller fraction of glycosylated RLI isomer (FIG. 5B and C).
  • a total of three male and three female cynomolgus monkeys were included in PK/PD study. Animals were allocated into two groups receiving RLI2 as RLI-15-HG and RL1-15-LG at 15 pg/'kg (nominal dose) by subcutaneous daily administration according to a cross-over dosing design. Administration was performed for 2 periods of 4 days (2x4), separated by a washout interval of 10 days (Day 1 to Day 4: RLI-15 -LG for males and RLI-15-HG for females. Day 15 to Day 18: RLI- 15 -HG for males and RLI- 15-LG for females). Pharmacodynamic parameters (including Ki67 expression inNK, CD4 + and CD8 + cells) were analyzed from the blood samples collected on pretreatment period.
  • PK analysis was performed using non-compartmental analysis on PhoenixTM WinNonlin® software (version 6.4. Certara L.P.).
  • Exposure by means of C ma and AUC 0-t was different between male and female animals.
  • C max and AUC 0t was about 2-fold higher in females than in males.
  • a difference in the pharmacokinetics of RLI-15-HG and RLI-15-LG was also observed.
  • exposure by RLI- 15-HG was lower than exposure by RLI-15-LG.
  • the ratio between RLI-15-HG and RLI-15-LG were 0.606 and 0.453 for C max and AUC 0-t respectively, independently on animal sex.
  • Buffy coats were obtained from healthy donors.
  • the blood was diluted with PBS-EDTA (to get 175 mL of diluted blood) and PBMCs were isolated by Ficoll Paque gradient (15 mL Ficoll + 35 mL diluted blood).
  • CD14 + monocytes were isolated using EasySepTM Human CD14 Positive Selection Kit II (17858, StemCell) according to manufacturer’s instructions.
  • CD14- fraction was pipetted into a new falcon tube, the rest was centrifuged at 1200 rpm, 10 min, then resuspended in CryoStore media, frozen and temporarily stored at -80°C.
  • Isolated CD14 + monocytes were resuspended in DC media (CellGro supplemented with IL-4 and GM-CSF). Cells were incubated at 37 °C with 5% CO 2 for 5 days, harvested and seeded into 48-well plates. iDCs were loaded with proteins for 4 h and maturated with a cytokine cocktail (TNF-a, IL-Ib plus IL-4 and GM-CSF) overnight. Washing followed for 4 times with PBS and T cell medium. Cells were co-cultured with autologous, CFSE stained CD4 + T cells at a 1: 10 ratio (negative magnetic separation) and cultivated for 7 days. CFSE dilution was detected by flow cytometry.
  • the immunocytokine was based on rituximab (VH: SEQ ID NO: 96, VL: SEQ ID NO: 99).
  • the immunocytokines listed in Table 11 were generated and tested for their provided assays.
  • RTX-RLI immunocytokines showed an increases potency in vivo at a reduced dosing compared to RLI2 and different RTX-RLI immunocytokines were comparable amongst each other whether comprising RLI2 or RLI2 AQ , whether being x2 or xl or whether with or without a linker.
  • Immunocytokines were expressed transiently in CHO cells and purified using standard antibody purification protocols using Protein A. Briefly, Mab select sure (GE) was used to capture immunocytokine products due to the presence of the Fc. Nuvia HR-S (CEX) was used in a binding/elution mode to separate oligomerized immunocytokine material and partly the uncoupled antibody RTX or PEM, as well as endotoxin and DNA contaminants. Preparative gel filtration (Superdex 200) was used for removing residual oligomerized ICK uncoupled antibody. The immunocytokines were concentrated to 2 mg/ml using Vivaspin 30 kDa.
  • RTX-ICKs Upstream production of RTX immunocytokines
  • RTX KiH-RLI xl naked RTX or RTX-RLI x2
  • oligomerized RTX-RLI with a difference of productions between homodimeric having 2 RLI2 molecules and heterodimeric constructs having one RLI2 molecule using the KiH technology.
  • the heterodimeric antibody formats have lower expression due to mispairing of the heavy chains, surprisingly, it was observed for the heterodimeric immunocytokines, that heterodimeric constructs using the KiH technology had a higher expression compared to respective homodimeric constructs.
  • the inventors speculate that the significant loss in expression of correctly folded homodimeric immunocytokines is linked to the interference of two RLI molecules linked to each heavy chain of the to be folded antibody with the proper antibody folding, as the RLI molecules have the tendency to interact with each other and thereby limit the freedom of the heavy chain C-termini to form the proper homodimer.
  • Example 4 IL-15 muteins for reduced in vitro potency
  • Table 12 Amino acid substitutions in IL-15 and respective position in RLI2
  • Table 13 Potency of RLI2 muteins having IL-15 variants (fused to pembrolizumab-derived antibody) on kit225 cells
  • the NA mutation lead to an about 2 log reduction of activity, here measured as EC50 on kit 225 cells.
  • Immunocytokines based on the anti-CD20 antibody rituximab were generated by fusion of the RLI2 wt conjugate to the C-terminus of the antibody heavy chains (“x2”) or by using a KiH variant of rituximab by fusion of one RLI2 mutein to one C-terminus of one heavy chain (“xl”).
  • Immunocytokines based on rituximab (“RTX”) were tested for their in vitro potency on kit225 cells (see Example 1 and Table 15). Table 15: Potency of homodimeric or heterodimeric RTX-RLI2 immunocytokines on kit225 cells
  • the heterodimeric immunocytokine having only one RLI2 conjugate showed an about lOfold reduction in potency on kit225 cells.
  • Table 16 EC50 (pM) of selected immune cell population from human PBMC Potency of immunocytokines on kit225 can be correlated with potency of immunocytokines on activated human NK cells, CD8 + T cells and CD8 + memory T cells. Only the RTX-RLI2 xl had a about 3fold reduction.
  • Example 6 PD activity of anti-CD20 immunocytokines based on rituximab
  • Immunocytokines were tested for their PD activity on immune cells from spleen after administration of the equimolar doses of RTX-ICKs administered IV at day 1 in healthy Balb/c mice (2 mice/group). RLI2 was injected SC at 20 pg/mouse daily at four consecutive days (day 1 - day 4). The activation of immune cell population was detected at day 5 by flow cytometry. Following antibodies (Table 17) were used for the PD study (mouse).
  • Table 17 antibody panel for flow cytometry
  • RTX-RLI2 x2 There was no difference in PD activity between RTX-RLI2 x2, RTX-RLI AQ x2 and RTX-L40-RLI2 x2 in vivo (FIG. 15).
  • the PD activity of RTX-RLI2 xl in equimolar amount was lower due to only one RLI2 molecule/antibody, but only of about around 20-30% less in relative number of immune cells in comparison to double RTX-RLI x2 molecule.
  • Example 7 Anti-metastatic activity of anti-CD20 immunocytokines based on rituximab in Renca mouse metastatic model in vivo
  • the anti-metastatic activity of anti-CD20 immunocytokines at the equimolar doses was tested in Renca renal cell carcinoma metastatic model in Balb/c mice. 3 qg/dose ICKs was injected IV at Dl, lungs were harvested at Day 16 and the lung wet weight was determined.
  • Example 8 Anti-tumour efficacy of anti-CD20 RTX-RLI2 AQ immunocytokines in A20- hCD20/Balb/c mice
  • RTX-RLI2 AQ X 2 Anti-tumour efficacy of RTX-RLI2 AQ X 2 immunocytokines was tested in Balb/c mice s.c. implanted with the A20-hCD20 tumour cell line (CrownBiosciences, USA). Mice were randomised intotreatment groups based on tumour volumes using a matched distribution function provided by the StudyDirector animal management software package (v3.0, Study Log Systems, US) to achieve a minimum amount of variation between and within groups at day 1. RTX-RLI2 AQ X 2 was administered at 0.15 mg/kg at day 1 and 8 and RLI2 was administered at 1 mg/kg for four consecutive days at day 1-4.
  • RTX-RLI2 AQ X 2 Two i.v. injections of RTX-RLI2 AQ X 2 showed a significant anti-tumour efficacy in the A20- hCD20/balbc mouse tumour model when compared to control. Similar efficacy was shown for RLI2 when administered 4 times at a nearly lOfold higher dose (or even higher comparing equimolar doses due to the larger molecular weight of the immunocytokine) compared to the RTX-RLI immunocytokine (FIG. 17).
  • Example 9 ADCC activity anti-CD20 immunocytokines based on rituximab compared to rituximab alone
  • Daudi cell line was incubated with indicated concentrations of RTX and RTX-RLI2 molecules with or without NK92-CD 16 cells. The Daudi cell death was assessed as percentage of DAPI positive cells and detected by flow cytometry.
  • 4xl0 4 Daudi tumour cells (B cell lymphoma expressing CD20) per/ well were seeded in 96-well plate.
  • NK92-CD16 cells were added at ratio 1:5 together with a serial dilution of RTX-RLI2 AQ molecules (concentration 0.001, 0.01, 0.1, 1, 10 and 100 nM).
  • Cells were incubated for 4h at 37°C in humidified 5% C0 2 . After incubation, cells were stained with CD56-Alexa Fluor700, CD19-PE antibodies for NK cells and tumour cell distinctions, and with DAPI to identify dead tumour cells (CD19+DAPI+ cell) and analysed by flow cytometry.
  • ADCC activity of RTX-RLI2 AQ molecules was slightly lower than Rituximab control. However, only 60% of cells were killed by ADCC activity of Rituximab alone, compared to 70% or 80% for the RTX- RLI AQ and RTX-RLI lx, respectively (FIG. 18).
  • Example 10 IL-15 N65A mutation in a PD-l-targeted immunocytokine shows diminished potency on kit225 cells
  • Pembrolizumab is a humanized IgG4-K antibody having the stabilizing S228P mutation in the Fc part of the antibody. Variations of pembrolizumab (“PEM”) were tested in order to improve the construct for the use in an immunocytokine. Although the IgG4 antibody class is known to have relatively low ADCC activity, the L235E mutation (Alegre, Collins et al. 1992) (“LE”) was introduced in order to further reduce ADCC (SEQ ID NO: 43). More complex ADCC inactivating mutations were avoided in order to limit the potential of immunogenicity/anti-drug antibodies.
  • RLI2 Either one or two RLI2 molecules were genetically fused to the C-terminus of the PEM antibody.
  • one RLI2 molecule was fused to each heavy chain
  • heterodimeric PEM variants (“xl”) were made using the knob-in-hole (KiH) technology (Elliott, Ultsch et al. 2014)
  • one RLI2 molecule was fused to the knob heavy chain having the T336W substitution (SEQ ID NO: 41)
  • the hole heavy chain (with no RLI2 fusion) comprised the T366S/L368A/Y407V substitutions (SEQ ID NO: 42).
  • RLI2 When RLI2 was fused to a heavy chain, the terminal lysine (K) was deleted (“dK”) in order to reduce heterogeneity of the product. Further, different RLI2 muteins were used to fuse to the heavy chain of the antibody. All RLI2 molecules had the AQ (G78A/N79Q) substitution for reducing the heterogeneity of the product, and the following substitutions reducing the binding of RLI2 to the IL-2/IL- 15RPy were tested in the PEM-RLI immunocytokines: DA, NA, ND, AD (K10A Q101D), and NQD. Made PEM-RLI immunocytokines are listed in Table 18, left column.
  • RLI RLI2 AQ ; ND... not detected (limited sensitivity of the assay)
  • the RLI2 AQ NA within PEM-RLI-NA xl was identified as the least potent RLI mutein with a single mutation lowering the IL-2/IL- 15RPy. which still is about lOfold more active than the NQD mutation, which has three amino acid substitutions, thereby having a relatively higher risk of immunogenicity.
  • Heterodimeric PEM-RLI immunocytokines were analysed by capillary electrophoresis under reducing and non-reducing conditions (FIG. 1). All immunocytokines showed high purity with clear separation of the antibody heavy chain, heavy chain + RLI (HC-RLI) and light chains. The faint band just above the HC-RLI band represent glycosylated RLI on the heavy chain. Surprisingly, glycosylation seemed to be reduced for the NA mutant.
  • Example 11 PEM-RLI xl or PEM-RLI NA xl molecules with Fc variants (LE, YTE or LE-YTE) show no differences in their potency on kit225 cells in vitro.
  • Fc variants of PEM in the heterodimeric fusion with RFI2 AQ having no IF- 15 inactivating NA mutation in the RFI conjugate demonstrated similar potency as PEM-RLI xl on kit225.
  • all compared constructs having the inactivating IL-15 NA mutation in the RLI conjugate showed similar (reduced) potency on kit225 cells independent of the tested Fc variant.
  • tested mutations in the antibody Fc region did not influence the potency of PEM-RLI constructs.
  • Example 12 Evaluation of PEM LE-RLI NA xl, PEM LE/YTE-RLI NA xl and PEM-RLI NQD xl molecules in potency on kit225 in vitro Selected PEM-RLI immunocytokine constructs from two batches were compared with respect to potency in comparison to RLI2 in vitro using the kit225 cells. The potency of molecules was assessed as EC50 and also calculated as a relative potency related to the RLI2 molecule. The data represent one experiment. As shown in Table 20 a high batch-to-batch consistency was observed with regard to the potency of tested immunocytokines measured by determining the EC50 on kit225 cells.
  • PEM-RLI immunocytokine constructs bearing one or two RLI2 molecules (PEM-RLIs) with/without the LE/YTE Fc modification.
  • Indicated PEM-RLI immunocytokine s were used at various concentrations for stimulation of human PBMCs from 6 healthy donors for 7 days in vitro.
  • the potency on human NK and CD8 + T cells was compared to the potency on kit225 cells (see Table 21).
  • NA N65A IL-15 mutant
  • the LE/YTE in the Fc part of the antibody has no influence on the potency of the fused RLI molecule.
  • the immunocytokine containing the IL-15 NQD mutein had a further reduces potency by a factor of about 10.
  • Human PBMC potency data are mean of 6 donors.
  • Kit225 data are mean of 2-3 experiments.
  • Example 14 Evaluation of low potency PEM-RLI mutants attached to HC or LC on kit225 cells in vitro
  • Example 15 Comparison of low potency mutants with or without mutated Fc part The aim was to evaluate and compare potency of several lower potency muteins than PEM-RLI NA xl with or without mutated Fc antibody part (LE-YTE). These molecules are fusion proteins of pembrolizumab (IgG4) and RLI-15 (PEM-RLI-15). RLI2 was used as a standard. The in vitro potency testing was accomplished using the kit225 cell line. The potency of molecules was assessed as EC50 and also calculates as a relative potency related to the naked RLI-15 molecule. The data represent mean of several experiments after 3.5 or 7 day of kit225 proliferation.
  • the functionality of the anti -PD- 1 antibody derivative of pembrolizumab was determined by measuring the blockade of the PD-1/PD-L1 interaction using the bioluminescent cell-based assay “PD-1/PD-L1 Blockade Bioassay” (J1250, Promega) according to the instructions for use.
  • Indicated PEM RLI immunocytokines were tested to evaluate their potency with respect to their activity to block the PD- 1/PD-Ll interaction (see Table 24). No significant difference was observed between the tested immunocytokines. Therefore, the functionality (PD-1 blocking) of the PEM part of the immunocytokines has been preserved independently of the number of RLI2 molecules attached, of mutations in the RLI2 conjugate or the mutations in the Fc part of the antibody.
  • Table 24 Potency of PEM-RLI molecules in the PD-1/PD-L1 Blockade Bioassay (Promega).
  • Example 17 PEM-RLI NA xl immunocytokine displays anti-tumour efficacy in mouse tumour model
  • the treatment started when the mean tumour size reached 108 mm 3 at randomization day 0.
  • PEM-RLI NA xl was administered IV at 20 mg/kg at day 0 and pembrolizumab was administered IP at 5 mg/kg at days 0,3,6 and 9.
  • PEM-RLI NA xl strongly decreased tumour volume in this model in comparison to the control untreated group (p-value was ⁇ 0.05) and similarly to the pembrolizumab treatment group (see FIG. 7). While no marked difference to pembrolizumab was seen for the immunocytokine, it should be noted that a single injection of the immunocytokine achieved a similar result as four administrations of pembrolizumab. Further, as mouse is known to be about lOfold less sensitive to RLI, the full functionality of the PEM-RLI NA xl cannot be tested in this mouse model and accordingly treatment effect in humans is expected to be better.
  • Example 18 PEM LE/YTE-RLI NA xl molecule enhances IFN-g production in mixed lymphocytes reaction over pembrolizumab and RLI-15 monotherapies.
  • MLR mixed lymphocyte reaction
  • PEM-RLI constructs were compared to RLI2 and Pembrolizumab.
  • IFNy production increased when mismatched human PBMC donor pairs were incubated with PEM LE/YTE-RLI NA xl (1000 nM) in comparison to an equimolar amount of pembrolizumab and adjusted RLI2 concentration lowered 300x to equal the potency of RLI2 NA mutein.
  • the data represent mean ⁇ SE of 6 donor pairs for pembrolizumab and PEM LE/YTE-RLI NA xl and 3 donor pairs for RLI2 (see FIG. 8).
  • Example 19 PEM LE/YTE-RLI NA xl molecule shows prolonged half-life in vivo over PEM-RLI wt xl molecule which correlates with a high PD activity
  • Blood for serum separation was collected at lh, 4h, 8h, 12h, 24h, 48h, 60h, 72h, 96h, 120h and 168h.
  • the concentration of PEM-RLI xl and PEM LE/YTE-RLI NA xl in serum was determined by ELISA.
  • Blood for flow cytometry evaluation of selected immune cell populations (NK and CD8 + T cell proliferation - Ki67 + , lymphocyte count) was collected at pre-dose, day 5, 8, 12, 15, 19, 22 and 26.
  • PEM LE/YTE-RLI NA xl molecule with a decreased RLI-15 affinity to IL-2/15RPy displayed a significantly prolonged half-life over PEM-RLI xl after IV administration in cynomolgus monkeys (FIG. 9A).
  • Blood for serum separation was collected at lh, 4h, 8h, 12h, 24h, 48h, 72h, 96h and 168h.
  • the concentration of PEM-RLI NA xl and PEM-RLI NA x2 in serum was determined by ELISA.
  • Blood for flow cytometry evaluation of selected immune cell populations (NK and CD8 + T cell proliferation - Ki67 + , lymphocyte count) was collected at pre-dose, day 5, 8, 12, 15, 19, 22 and 26.
  • Example 21 PEM-RLI NA xl molecule with LE mutation display longer half-life than molecule with LE/YTE mutation
  • Blood for serum separation was collected at lh, 8h, 24h, 48h, 60h, 72h, 84h, 96h and 120h.
  • concentration of PEM LE/YTE-RLI NA xl and PEM LE-RLI NAxl in serum was determined by ELISA.
  • Example 22 Lower potency mutant PEM-RLI NQD xl display longer- half life than PEM-RLI NAxl molecule
  • Blood for serum separation was collected at lh, 8h, 24h, 48h, 60h, 72h, 84h, 96h, 120h and 144h.
  • the concentration of PEM L-RLI NA xl and PEM-RLI NQD xl in serum was determined by ELISA.
  • Human cell lines PA-TU-8988S (Creative Bioarray, catalog number CSC-C0326) and A549 (ATCC CCL-185) overexpressing Claudin 18.2 (A549-Cldnl8.2) were grown in DMEM medium (Gibco) supplemented with 10 % fetal bovine serum, 2 mM glutamine (GlutaMAX, Gibco), 100 U/ml penicillin, 0.1 mg/ml streptomycin (Invitrogen) and 2 ug/ml puromycin (Gibco).
  • A549 cells were co-transfected by electroporation with a transposase expression construct (pcDNA3.1- hy-mPB), a construct bearing transposable full-length huCLDN18.2 (pPB-Puro-huCLDN18.2) along with a puromycin resistance cassette and a construct carrying EGFP as transfection control (pEGFP- N3) (Waldmeier, Hellmann et al. 2016).
  • pEGFP- N3 transfection control
  • CFDN 18.2 were then selected by the addition of puromycin into culture at 1 pg/ml. and further expanded to allow the generation of frozen stocks in FCS with 10% DMSO. The expression of CFDN18.2 in the transfected cells was analyzed by FC.
  • PA-TU-8988S cells were sorted by FACS to select only cells with a the higher CFDN18.2 expression.
  • PA-TU-8988S cells suspended in FACS buffer PBS, 2% FCS
  • FACS buffer PBS, 2% FCS
  • the cells were incubated with the PE-labelled Fey specific IgG goat anti-human secondary antibody (eBioscience) on ice for 30 min.
  • the stained cells were resuspended in FACS buffer, analyzed and sorted by a FACSAriaTM instrument, separating medium expressing cells from high expressing cells.
  • PA-TU-8988S-High cells PaTu
  • the human NK cell line NK92 (ATCC CRF-2407) exogenously expressing human CD 16 (NK92- hCD16, here referred to as NK92) was generated as described in Clemenceau et al 2013(Clemenceau, Vivien et al. 2013).
  • the cells were grown in RPMI 1640 medium (Gibco) supplemented with 10 % AB human serum (One Fambda), 2 mM glutamine (GlutaMAX, Gibco) and 5 ng/ml IF-2 (Peprotech). All cells were maintained at 37 °C in a humidified atmosphere containing 5 % C0 2 .
  • A549-Cldnl8.2 or PaTu cells were seeded into 96-well plates at an appropriate concentration (A549- Cldnl8.2 - 20.000 cells, PaTu - 30.000 cells) and incubated for 24 h.
  • NK92 cells or isolated human NK cells were collected by centrifugation, washed and resuspended in ADCC assay medium (RPMI 1640 (no phenol red) supplemented with 2 mM glutamine and 10 % heat-inactivated (56 °C for 20 min) pooled complement human serum (Innovative Research)).
  • target cells T The medium from 96-well plates containing adhered cells (target cells T) was removed and NK92 cells in suspension in the ADCC assay medium (effector cells E) were added to the adherent target cells at an E:T ratio of 10 for A549-Cldnl8.2 and of 5 for PA-TU-8988S cells.
  • Antibodies or immunocytokines (ICK) to be tested were added in a concentration range of 0.001 - 100 nM or 0.0001-10 pg/ml.
  • a human IgGl isotype antibody (Ultra- LEAFTM Purified Human IgGl Isotype Control Recombinant Antibody, Biolegend, cat. no. 403502) was included as an unspecific control.
  • cytotoxicity was measured, expressed as the activity of lactate dehydrogenase enzyme released from dead cells, using the LDH Cytotoxicity Assay (Abeam, at>65393) according to manufacturer’s instructions: 10 m ⁇ of supernatant was transferred into a new 96-well plate, mixed with the LDH substrate and the developed colour change was measured using spectrophotometer at an OD of 450 nm.
  • FIG. 13 show the ADCC activity of immunocytokines based on the hClla antibody with modified effector function. All the tested immunocytokines had heterodimeric Fc domains, with one RLI2 AQ conjugate fused to the C-terminus of one of the heavy chains.
  • the immunocytokine hClla LALAPG-RLI DANA showed nearly abolished ADCC activity when tested on A549-CLDN18.2 cells (upper panel) or PA- TU-8988S (lower panel) in the presence of NK92 cells, when compared to the hClla-DANA immunocytokine of hClla antibody alone.
  • the hClla-LALA antibody showed also reduced ADCC activity when compared to the hClla antibody, however the ADCC activity was not fully abolished.
  • the addition of the conjugate did not affect the ADCC activity of the immunocytokines when ADCC activity was reduced, when compared to the ADCC activity of the antibody alone.
  • Table 25 recapitulates the ADCC EC50 values measured for each tested immunocytokine or antibody. The EC 50 values were determined using the Graphpad Prism Software with the built-in “log(AGONIST) vs. response - variable slope (four parameters)” EC50 determination.
  • FIG. 14F shows that, in A549-Cldnl8.2 and PA-TU-8988S cells, the afucosylated immunocytokine hClla-DANA afuc has enhanced ADCC activity when compared to hCl la-DANA, and comparable ADCC activity to the immunocytokines with the DE and DLE mutations described above.
  • afucosylation was combined with mutations of effector domain enhancing, afucosylation surprisingly negatively affected the ADCC enhancement induced by the DE or DLE mutations (see FIG. 14B and A). Nevertheless, enhanced ADCC activity was maintained when afucosylation was combined with the AAA mutations (FIG. 14. C)
  • Example 24 Evaluation of antibody Fc binding to ADCC-activating receptors FcyRIIIa V158, and FcyRIIIa F158 and ADCC-inhibitory receptor FcyRIIb by surface plasm on resonance (SPR)
  • the human FcyRIIIa receptor (hFcyRIIIa; CD 16a) exists as two polymorphic variants at position 158, hFcyRIIIaV158 and hFcyRIIIaF158.
  • FcyRIIIa activates ADCC activities, while FcyRIIb inhibits ADCC.
  • the ADCC activity of the immunocytokines when their affinity to the receptor is measured by SPR, can be expressed as the ratio of the EC50 binding affinity to FcyRIIIa to the EC50 binding affinity to FcyRIIb.
  • Association/dissociation rates were measured for each tested immunocytokine at a flow rate of 30 m ⁇ /min with concentration serial dilution in a suitable range with an association time/dissociation time of 300 s/300 s except for constructs with DLE and DE with and without afucosylation, where association/dissociation time of 120 s/1200 s was applied. Table 26 below summarizes the results of the SPR measurements.
  • Melting temperature of the C H 2 domain was measured by Differential scanning calorimetry (DSC) using a MicroCal PEAQ-DSC Automated system (Malvern Panalytical).
  • DSC Differential scanning calorimetry
  • the immunocytokine sample was diluted in its storage buffer to lmg/ml. The heating was performed from 20 °C to 100 °C at a rate of 1 °C/min. Protein solution was then cooled in situ and an identical thermal scan was run to obtain the baseline for subtraction from the first scan.
  • the protein was firstly reduced with DTT, and then transfer to an HPLC column with glass-insert vial for injection.
  • the protein was separated by reversed-phase chromatography and detected by Waters/ XEVOG2XS-QTOF on-line LC-MS combined with UV detector.
  • the molecular weight of detected glycan chains was matched with known N-glycan types, and the N-glycan relative abundance was calculated and represented by the intensity of the detected peaks.
  • Amino acid sequences of immunocytokine constructs bearing ADCC enhancement mutations were analysed for the presence of following additional sequence liabilities (not present in constructs without ADCC enhancement mutations) as described in Table 27.
  • the TL mutation introduced a N-glycosylation sequence liability (mutation K392T in close proximity to N390 in the IgGl sequence). No sequence liability was introduced by the other mutations (see Table 28). Table 28: Stability and developability summary.
  • Score 4 Parameter is in the range expected for a mAb-based drug product
  • Score 3 Careful monitoring/evaluation of quality attribute required during development; Score 2: Considerable impact on timeline and/or cost is likely;
  • Immunocytokines with the AAA mutations resulted in the increase of mannose species (see Table 30). However, production of afucosylated immunocytokine partially reverted the glycosylation to acceptable levels with regards to developability. Therefore, when enhancement of the immunocytokine based on hClla is desired, the AAA mutations, optionally combined with afucosylation, may be the recommended mutations affecting the least its stability and developability. Afucosylation had no impact on evaluated properties. DLE and DE mutations caused a considerable decrease in Tm, potentially destabilising the molecule. TL mutation introduced an additional glycosylation site into Fc. Construct with IE mutation had a high proportion of mannose species.
  • Example 26 Mouse in-vivo efficacy studies The purpose of this study is to test the in vivo therapeutic efficacy of hClla-RLI immunocytokines in a mouse model.
  • Table 31 mouse treatment regimen (“aftic” for afucosylated)
  • Example 27 anti-PD-1 antibody and SOT201 synergize in activation of CD8 + T cells
  • SOT201 is a heterodimeric immunocytokine with an antibody derived from the humanized IgG 4 pembrolizumab with T366W - knob/T366S, L368A, Y407V -hole substitutions, L235E substitution, and deleted terminal K of the heavy chains, fused to RLI-15 AQA at the C-terminus of the knob heavy chain, see SEQ ID NO: 21, SEQ ID NO: 101, SEQ ID NO: 23).
  • SOT201 and Keytruda ® pembrolizumab
  • FIG. 19A shows that SOT201 effectively blocks PD- 1/PD-L 1 interactions similarly to the anti -PD- 1 antibody Keytruda. Determined K D values for SOT201 and pembrolizumab are shown in Table 32.
  • SOT201 Human PBMC from 11 healthy donors were stimulated for 7 days in vitro with SOT201 having the RLI2AQ N65A (RLI-15 AQA ) variant or with a control molecule having identical antibody heavy and light chains as SOT201 but with the RLI2 AQ variant without a reduced binding of the IL-15 moiety to the IL-2/IL-15RPy (“SOT201 wt").
  • Cell proliferation was determined by measuring Ki-67 + NK cells and CD8 + T cells by flow cytometry analysis.
  • SOT201 activates proliferation ofNK and CD8 + T cells at higher EC50 concentration in comparison to the comparable immunocytokine molecule with an RLI- 15 molecule without reduced receptor binding (SOT201 wt) (FIG. 19B).
  • a murine surrogate SOT201 (mSOT201, see SEQ ID NO: 102, SEQ ID NO: 103 and SEQ ID NO: 104) comprising the anti-murine PD-1 antibody RMP1-14 (BioXCell, Riverside, NH, USA) with analogous substitutions for heterodimerization (E356K, N399K/K409E, K439D), ADCC silencing (D265A) and stabilization (dK) fused to RLI-15 AQA was compared to single activity controls represented by the monoclonal anti -murine PD-1 antibody RMP1-14 as such (mPDl) and the anti -human PD1 mouse IgGl-RLI-15 AQA (hPDl-mSOT201), which does not exert any PD-1 blocking activity in the C57BL/6 mouse, as an RLI-15 AQA control with a similar in vivo half-life as mSOT201.
  • Example 28 Tumor regression in MC38 mouse model
  • mice C57BL/6 mice (hPDl -transgenic) were implanted with syngeneic MC38 cell line.
  • mSOT201 induced tumor regression in 9 out of 10 mice after a single IV administration, whereas in comparison the monoclonal anti-mouse PD-1 antibody (mPDl) and the anti -human PD-1 mouse IgGl-RLI-15 mutein immunocytokine (hPDl-mSOT201) exerting no anti-PD-1 effect in mice only showed minor effects on tumor growth compared to the control mice (FIG. 20A).
  • mPDl monoclonal anti-mouse PD-1 antibody
  • hPDl-mSOT201 anti -human PD-1 mouse IgGl-RLI-15 mutein immunocytokine
  • the synergistic activity of the anti-murinePD-1 antibody and the RLI-15 AQA mutein in the fusion protein (mSOT201) compared to the anti-mousePD-1 antibody alone (mPDl) or the anti-humanPD 1 mouse IgGl-RLI-15 mutein immunocytokine (hPDl-mSOT201) as a control for the RLI-15 AQA mutein alone is shown in the surviving mice in the time course up to 100 days post treatment (FIG. 20B).
  • Example 29 Induction of pathways and genes connected to anti-tumor immunity in MC38 tumors and activation of immune cells in spleen and lymph nodes
  • RNA isolation RNA samples were isolated from tumors of syngeneic MC38 tumor bearing C57BL/6 mice 7 days after a single IV administration ofmSOT201 (5 mg/kg). 3 mice were treated with mSOT201 (5 mg/kg) IV on day 1 (randomization day, tumor volumes 80-100 mm3), 4 control mice were left untreated. RNA was isolated from tumour tissue by using RNeasy MicroKit. The quality of RNA samples was checked using the Agilent Bioanalyzer RNA Nano Chip and the Qubit HS RNA assay.
  • RNA seq analysis The sequencing libraries were prepared from RNA samples by the SMARTer® Stranded Total RNA-Seq Kit v3 - Pico Input Mammalian Kit (Takara Bio USA, Inc.), library quality control was performed employing the capillary gel electrophoresis system (Agilent Bioanalyzer with the HS DNA chip) and the Qubit HS DNA Assay, and sequencing was done on NovaSeq 6000 using the NovaSeq 6000 300 cycles Reagent Kit in 2x151 bp run.
  • Raw data were processed according to the standard RNA-seq pipeline including the following steps: quality control (via FastQC and FastqScreen), adapter trimming (trimmed 8bp in Read2 by using seqtk), mapping to the reference genome GRCm39 (using HISAT2) and transcript counting (with ht-seq).
  • quality control via FastQC and FastqScreen
  • adapter trimming trimmed 8bp in Read2 by using seqtk
  • mapping to the reference genome GRCm39 using HISAT2
  • transcript counting with ht-seq.
  • the obtained output, quantification files containing the number of transcripts for each sample, were further processed via R packages and ggplot2, tydiverse, dplyr.
  • Heatmaps were created using ComplexHeatmap package in R. Functional and enrichment analysis of DEGs was performed using the ClusterProfiler and the web-based tool Gene ontology (GO). To calculate TPM values for cell population analysis, salmon tool was used on trimmed fastq fries. Analysis of cell population was performed by TIMER 2.0 and xCell tools.
  • mSOT201 induced proliferation of selected immune cell populations in spleen and lymph nodes in MC38 tumor bearing mice (FIG. 2 IB).
  • Example 30 EC50 values of different IL2/IL-15R[5y agonists on kit225 cells EC50 values of RLI-15 (SOT101), SOT201 (PEM-RLI- 15 AQA ), hPD-l-IL-2v and ahPDl-IL-15m Ml were determined as described in Example 1.
  • RLI-15 SOT101
  • SOT201 POM-RLI- 15 AQA
  • hPD-l-IL-2v ahPDl-IL-15m Ml were determined as described in Example 1.
  • one IL-2 mutein IL-2v SEQ ID NO: 106
  • ahPDl-IL-15m Ml one IL- 15 mutein with the mutations N1A-D30N-E46G-V49R (SEQ ID NO: 107) is fused to the C-terminus of one heavy chain of an anti-humanPD-1 antibody as described in WO 2019/166946al (see Fig. ID therein, SEQ ID NO: 89, 74 and 65 therein).
  • EC50 values are show in Table 33.
  • a further interesting candidate to be tested is the ahPDl-IL-15m M2 with on IL-15 mutein with mutations N1G-D30N-E46G-V49R-E64Q (SEQ ID NO: 108) is fused to the C-terminus of one heavy chain of an anti-humanPD-1 antibody as described in WO 2019/166946al (see Fig. 1C therein, Seq id no: 90, 74 and 65 therein).
  • SOT201 has a substantially lower EC50 on kit225 cells than PDl-IL-2v and ahPDl-IL- 15m Ml, expected to allow for higher dosing and longer half-life in vivo to exert also a stronger and longer lasting effect with respect to the activity disrupting the anti-PD-l/PD-Ll interaction.
  • Example 31 Comparison of mSOT201 with mPDl-IL-2RPy agonist in the MC38 tumor model mSOT201 (mouse SOT201 surrogate) was compared to control (NaCl), the anti-murinePD-1 antibody RMPl-14 fused to the IL-2v IL-2 mutein (mPD 1 -IL-2RPy agonist) and the combination of the RLI- 15 AQA and the mPDl antibody in the MC38 tumor model in a single IV administration as described in Example 28.
  • mPD 1 -IL-2RPy The dosing of mPD 1 -IL-2RPy was selected to match the NK and CD8 + T cell proliferation on day 5 of 5 mg/kg of mSOT201 after IV administration in healthy C57/BL6 mice, resulting in an equivalent dose of 0.25 mg/kg mPDl-IL-2RPy.
  • Cell proliferation (Ki67 + ) was detected by flow cytometry.
  • mSOT201 induced activation of CD8 + T cells and NK cells which persisted up to day 8 in contrast to the mPDl-IL-2RPy agonist (FIG. 22B).
  • mPDl-IL-2RPy is an IL-2/IL-15RPy agonist
  • the IL-2 mutein IL-2v (SEQ ID NO: 106) comprises the substitutions F42A, Y45A and L72G relative to the IL-2 sequence reducing the affinity to the IL- 2Ra (see WO 2018/184964A1, e.g., bridging para, of pages 27 and 28) and the further substitutions T3A to eliminate O-glycosylation at position 3 (bridging para, of pages 28 and 29) and C125A to increase expression or stability (page 30, 3 rd para.).
  • the murine surrogate of SOT201 (mSOT201) induced tumor regression in 9 out of 10 MC38 tumorbearing mice after a single IV administration comparing to 5 out of 10 for the mPDl-IL-2RPy agonist, whereas the combination of the RLI- 15 AQA with the mPD 1 antibody only led to a delay of tumor growth compared to the control mice (FIG. 22A).
  • mSOT201 induced proliferation of NK and CD8 + T cells in MC38 tumor bearing mice which persisted 7 days after dosing in contrast to the mPDl-IL-2RPy agonist and the equimolar amount of RLI-15 AQA in combination with mPD 1.
  • SOT201 also induced proliferation of NK and CD8 + T cells in spleen and lymph nodes of MC38 tumor bearing mice which persisted 7 days after dosing in contrast to mPDl-IL-2v and the equimolar amount of the combination of RLI-15 AQA and the mPDl antibody (FIG. 22C).
  • Example 32 PK profile of SOT201 in cynomolgus monkeys SOT201 was administered IV at 0.6 mg/kg on day 1 to cynomolgus monkeys and proliferation (Ki67 + ) and absolute cell numbers of NK and CD8 + T cells were determined over time by flow cytometry and haematology. SOT201 induced high proliferation and expansion of NK (-90% at day 5) and CD8 + T cells (about 80% at day 5) in blood of cynomolgus monkeys after an IV administration ( FIG. 23A). Pharmacokinetic parameters are shown in Table 34.
  • Example 33 PD activity of mouse SOT201 surrogates
  • the first aim of the study was to evaluate whether the treatment with mouse surrogate molecule mSOT201 (see Example 27) has an additive/synergistic effect on the CD8 + T cell proliferation, when compared to the treatment with hPDl-mSOT201 or mPD-1 in C57BL/6 mice.
  • the second aim of the study was to compare the pharmacodynamic activity of mSOT201 wt mouse surrogate molecule with a mouse surrogate molecule mPDl-IL2v in C57BL/6 mice. The description of tested mouse surrogate molecules is described in Table 35. PD activity was evaluated on day 5 and day 8. FACS analysis was performed as described above.
  • the hPD-l-mSOT201 represents a control for an RLI-15 AQA bound to a non-binding antibody with a similar PK profde and therefore reflects the PD activity of the RLI-15 AQA molecule with such PK profde.
  • the mPD-1 molecule reflects the PD activity of the anti-PD-1 antibody alone.
  • mSOT201 shows a more than additive effect (i.e. synergistic) compared to its single component surrogates hPDl-mSOT201 and mPD-1 at Day 5 and even more at Day 8 dosed at equimolar amounts.
  • Example 34 Anti-tumor efficacy activity of mSOT201 in PD-1 sensitive and PD-1 treatment resistant mouse models
  • the aim of the study was to evaluate the anti -tumor activity of mSOT201 in anti-PD-1 treatment sensitive (CT26, MC38) and in anti-PD-1 treatment resistant (B16F10, CT26 STK11 ko) mouse models.
  • CT26, MC38 anti-PD-1 treatment sensitive
  • B16F10, CT26 STK11 ko anti-PD-1 treatment resistant mice models.
  • the description of tested mouse surrogate molecules is described in Table 37.
  • the murine surrogate molecule of SOT201 - mSOT201 - as compared to its single component surrogates mPD-1 and hPDl-mSOT201 shows a synergistic effect in the tested PD-1 sensitive tumor models CT26 and MC38 with 5 out of 10 and 9 out of 10 complete responses. (FIG. 25 A)
  • mSOT201 showed a synergistic effect compared to its single components, although the therapeutic effect was not as strong as for the sensitive models showing only 1 complete response out of 10 mice for the B16F10 model.
  • Example 35 Anti-tumor efficacy activity of mSOT201 vs RLI-15 AQA mutein + anti-PD-1 antibody
  • the aim of the study was to evaluate the anti-tumor activity of mSOT201 vs. RLI-15 AQA mutein + anti-PD-1 treatment in MC38 mouse models.
  • the description of tested mouse surrogate molecules is described in Table 38.
  • Example 36 Anti-tumor efficacy activity of mSOT201 vs SOT101 + anti-PD-1 antibody
  • the aim of the study was to evaluate the anti-tumor activity of mSOT201 vs SOT101 + anti-PD-1 treatment in the MC38 mouse model.
  • the description of tested mouse surrogate molecules is described in the Table 39.
  • a single dose of mSOT201 of 2 mg/kg (G3) showed about the same therapeutic effect as combined therapies with 4 administrations of 1 mg/kg RLI2 AQ + a single dose of 5 mg/kg mPDl (G8) or with 4 administrations of 1 mg/kg RLI2 AQ + a four doses of 5 mg/kg mPDl (G9).
  • a single dose of mSOT201 of 5 mg/kg (G2) outperforms the multiple administrations of the individual components (G8 and G9).
  • Example 37 Mechanistical studies on differences in immune cell activation under of mSOT201 vs SOT101 + anti-PD-1 antibody treatment
  • the aim of the study was to evaluate the anti -tumor activity of a similar efficacious dose of mSOT201 vs SOT101 + anti-PD-1 treatment in the MC38 mouse model.
  • the description of tested mouse surrogate molecules is described in the Table 39.
  • Example 38 DC-T cell-based assay and Fluorospot assay for determining Immunogenicity
  • the aim of the study was to assess the immunogenicity risk of pembrolizumab-based immunocytokines bearing one RLI-15 mutein (PEM-RLI-15 candidate molecules) in vitro.
  • the DC-T cell assay method was used for this purpose, where the test products were first incubated with immature dendritic cells (iDCs) leading to later presentation to autologous T cells as processed peptides of the candidate molecules loaded on the MHC molecules of the matured DCs (mDCs). After a 7-day co-incubation period, T cell proliferation was measured as a surrogate marker for anti-drug antibody formation.
  • iDCs immature dendritic cells
  • mDCs matured DCs
  • T cell proliferation induced by DCs was used to mitigate the stimulatory activity of the RLI-15 component in the test system that can have a strong influence on the result, which shall not be attributed to immunogenicity.
  • Keyhole limpet hemocyanin (KLH) was used as a positive control, as KLH is known to induce a strong immune response induction.
  • Pembrolizumab was used as a negative control.
  • Control DCs loaded with no protein were used as control for assessment of unspecific T cell proliferation.
  • PEM-RLI-15 candidate molecules according to Table 40 were used at two concentrations each for the stimulation of iDCs. Maturation of DCs was induced by proinflammatory cytokines. After 24 h, mDCs were washed and incubated with autologous CD4 + T cells that were pre-stained with CFSE. Proliferation of T cells was evaluated based on CFSE detection by flow cytometry after 7 days.
  • the assay could not be conducted with SOT201 (PEM L-RLI N65A xl), due still too high activity of the RLI N65A mutein leading to the direct T cell activation and spill over the RLI-15 activity.
  • DCs generated from human CD14 + monocytes were incubated with 10 pg/ml (not shown) or 50 pg/ml PEM-RLI-15 candidate molecules, pembrolizumab or KLH for 24h in the presence of maturation signal (proinflammatory cytokines TNFa and IL-Ib). Washed mDCs loaded with proteins were subsequently cultured with autologous, CFSE stained CD4 + T cells. T cell proliferation was measured after 7 days by flow cytometry. Proportion of proliferating CD4 + T cells was evaluated based on CFSE signal, where CFSE low cells were considered as cycling cells.
  • KLH was used as a positive control, pembrolizumab as a negative control (see FIG. 29).
  • the PEM-RLI-15 candidate molecule PEM L-RLI DANA xl/ PEM LY-RLI DANA xl did not induce significant proliferation of T cells compared to the negative control reflecting a low immunogenicity risk (positive response detected in 1 out of 11 donors).
  • the DC-T cell assay is not suitable to test the immunogenicity of the RLI- 15 AQA as compared to RLI- 15 (wildtype sequence) . Accordingly, pairs of peptides having introduced substitutions were generated spanning the substitutions and tested in the Fluorospot assay.
  • CD8-depleted PBMCs of 40 donors were seeded and incubated with test peptides in RPMI + 10% huAb and IL-7. Medium was refreshed on day 1 with IL-7 and day 4 with IL-7 and IL-2.
  • CD8- depleted PBMC were harvested and rested overnight, seeded the next day on FluoroSpot plates and re- stimulated with the peptides.
  • INF-g and TNF-a FluoroSpot plates were developed.
  • FIG. 29B shows that for all test conditions, the confidence intervals overlap with 0 meaning that there is no evidence of a shift in the mean dSFU comparing mutant peptides with the paired wildtype sequence. Therefore, for both the N65A substitution and the G175A/N176Q pair of substitutions, a relevant increase in the immunogenicity is not seen.
  • Example 39 Potency of different anti-PD-1 IL-2/IL-15RPy agonist immunocytokines
  • Table 42 anti-PD-1 IL-2/IL- 15I4bg agonist immunocytokines The potency of the anti-PD-1 IL-2/IL- 15I4bg agonist immunocytokines was determined on kit225 cells
  • Table 43 Potency of anti -PD- 1 IL-2/IL- 15RPy agonist immunocytokines in kit225 assay
  • Example 40 PD-1/PD-L1 blocking activity of anti-PD-1 IL-2/IL-15RPy agonist immunocytokines
  • Table 45 PD-1/PD-L1 blocking anti-PD-1 IL-2/IL- 15I4bg agonist immunocytokines in Promega blocking assay
  • SOT201 shows the highest PD-1/PD-L1 blocking activity of the three tested anti-PD-1 IL-2/IL- 15I4bg agonist immunocytokines.
  • SOT202 is a heterodimeric immunocytokine with an antibody derived from the humanized IgG 1 hCl la with T366W - knob/T366S, L368A, Y407V -hole substitutions, and deleted terminal K of the heavy chains, fused to RLI-15 AQA at the C-terminus of the knob heavy chain (see SEQ ID NO: 111, SEQ ID NO: 110 and SEQ ID NO: 88).
  • SOT202-XXX indicates molecules where further mutations of modification have been made to SOT202, such as the DANA mutation in RLI2 as shown in Table 13.
  • SOT202-DANA differs from SOT202 only by the additional DA (D61A) mutation, as SOT202 already contains the NA (N65A) mutation (numbers refer to IL-15 numbering).
  • Mutation in the effector domain of the IgGl molecule modifying ADCC properties of the antibody such as the AAA, DE and DLE mutations as shown in Table 2.
  • the term “aftic” stands for an afucosylation IgGl molecule.
  • Afucosylated antibodies have also modified ADCC properties.
  • the activity of human and murine surrogate SOT202 ADCC-modified molecules on the induction of proliferation ofkit225 cells was assessed as described in Example 1, and the EC50 and relative potency compared to SOT101 is shown in Table 46 and Table 47.
  • the murine SOT202 was generated by replacing the human hlgGl constant domain of SOT202 by its murine equivalent of mIgG2a (mSOT202: SEQ ID NO: 112, SEQ ID NO: 128 and SEQ ID NO: 129; mSOT2020 LALAPG: SEQ ID NO: 130, SEQ ID NO: 131 and SEQ ID NO: 129; mSOT202 isotype: mSOT202 isotype HC knob, SEQ ID NO: 133 and SEQ ID NO: 134; mSOT202 LALAPG isotype: SEQ ID NO: 135, SEQ ID NO: 136. SEQ ID NO: 134).
  • the ADCC modification did not affect the potency of the mouse SOT202 surrogates with regards to activation of kit225 cells.
  • mouse SOT202 surrogates are less potent than their human counterparts, likely is due to the kit225 cells expressing o CD16 required for co-signaling with IL-15RPy on human NK cells and mouse NK cells.
  • Example 42 Potency of human SOT202 ADCC-modified molecules on human NK and CD8 + T cells
  • Table 48 Potency of human SOT202 ADCC-modified molecules on human NK and CD8 + T cells SOT202-DANA with DLE and DE mutation enhancing ADCC greatly increased the human NK cell activity when compared to SOT202-DANA without ADCC-modifications. Afucosylated SOT202 also increased ADCC activity, but to a lesser extent than the DE and DLE mutations. On the other hand, mutations reducing ADCC, such as the LALAPG mutations, almost abolished activation of NK cells. These mutations had only minor effects on CD8 + T cells activation. Without being bound by a theory, it is assumed that higher binding to CD 16 receptors via enhancing mutations synergizes with the IL- 15 RPy signaling.
  • Example 43 Potency of human SOT202 molecules on human NK and CD8 + T cells compared to SOT201 molecules

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Organic Chemistry (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Immunology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Biophysics (AREA)
  • Molecular Biology (AREA)
  • Genetics & Genomics (AREA)
  • Biochemistry (AREA)
  • Zoology (AREA)
  • Cell Biology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • Toxicology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Hematology (AREA)
  • Engineering & Computer Science (AREA)
  • Epidemiology (AREA)
  • Biomedical Technology (AREA)
  • Virology (AREA)
  • Biotechnology (AREA)
  • Developmental Biology & Embryology (AREA)
  • Oncology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Medicines Containing Material From Animals Or Micro-Organisms (AREA)
PCT/EP2022/067236 2021-06-23 2022-06-23 Interleukin-15 based immunocytokines Ceased WO2022268983A2 (en)

Priority Applications (10)

Application Number Priority Date Filing Date Title
JP2023576235A JP2024524891A (ja) 2021-06-23 2022-06-23 インターロイキン-15に基づく免疫サイトカイン
MX2023015444A MX2023015444A (es) 2021-06-23 2022-06-23 Inmunocitocinas a base de interleucina-15.
AU2022296794A AU2022296794A1 (en) 2021-06-23 2022-06-23 Interleukin-15 based immunocytokines
US18/573,397 US20240294594A1 (en) 2021-06-23 2022-06-23 Interleukin-15 based immunocytokines
CN202280045358.9A CN117597356A (zh) 2021-06-23 2022-06-23 基于白细胞介素-15的免疫细胞因子
KR1020247002543A KR20240024242A (ko) 2021-06-23 2022-06-23 인터루킨-15 기반 면역 사이토카인
EP22736247.2A EP4359428A2 (en) 2021-06-23 2022-06-23 Interleukin-15 based immunocytokines
BR112023027312A BR112023027312A2 (pt) 2021-06-23 2022-06-23 Imunocitocina
CA3221886A CA3221886A1 (en) 2021-06-23 2022-06-23 Interleukin-15 based immunocytokines
IL309533A IL309533A (en) 2021-06-23 2022-06-23 Interleukin-15-based immunocytokines

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
EP21181271 2021-06-23
EP21181271.4 2021-06-23
EP22163748.1 2022-03-23
EP22163748 2022-03-23

Publications (2)

Publication Number Publication Date
WO2022268983A2 true WO2022268983A2 (en) 2022-12-29
WO2022268983A3 WO2022268983A3 (en) 2023-04-06

Family

ID=82361370

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/EP2022/067236 Ceased WO2022268983A2 (en) 2021-06-23 2022-06-23 Interleukin-15 based immunocytokines

Country Status (10)

Country Link
US (1) US20240294594A1 (cg-RX-API-DMAC7.html)
EP (1) EP4359428A2 (cg-RX-API-DMAC7.html)
JP (1) JP2024524891A (cg-RX-API-DMAC7.html)
KR (1) KR20240024242A (cg-RX-API-DMAC7.html)
AU (1) AU2022296794A1 (cg-RX-API-DMAC7.html)
BR (1) BR112023027312A2 (cg-RX-API-DMAC7.html)
CA (1) CA3221886A1 (cg-RX-API-DMAC7.html)
IL (1) IL309533A (cg-RX-API-DMAC7.html)
MX (1) MX2023015444A (cg-RX-API-DMAC7.html)
WO (1) WO2022268983A2 (cg-RX-API-DMAC7.html)

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP3444271B1 (en) 2013-08-08 2021-10-06 Cytune Pharma Il-15 and il-15ralpha sushi domain based modulokines
WO2025177263A1 (en) * 2024-02-25 2025-08-28 Biohaven Therapeutics Ltd. Myostatin-binding proteins

Families Citing this family (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20230030674A1 (en) * 2019-12-06 2023-02-02 Sotio Biotech A.S. Humanized cldn18.2 antibodies

Citations (8)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1999058570A2 (en) 1998-05-11 1999-11-18 Eidgenössische Technische Hochschule Zürich Antibodies to the ed-b domain of fibronectin, conjugates containing them and use therefor for diagnosis and therapy of tumors and diseases associated with angiogenesis
WO2010039873A2 (en) 2008-10-01 2010-04-08 Tracon Pharmaceuticals, Inc. Humanized endoglin antibodies
WO2010078945A2 (en) 2009-01-07 2010-07-15 Philogen S.P.A. Cancer treatment
WO2014174105A1 (en) 2013-04-25 2014-10-30 Philochem Ag Antibody-drug conjugates
WO2017095805A1 (en) 2015-11-30 2017-06-08 Abbvie Inc. ANTI-huLRRC15 ANTIBODY DRUG CONJUGATES AND METHODS FOR THEIR USE
WO2018184964A1 (en) 2017-04-03 2018-10-11 F. Hoffmann-La Roche Ag Immunoconjugates of an anti-pd-1 antibody with a mutant il-2 or with il-15
WO2019166946A1 (en) 2018-02-28 2019-09-06 Pfizer Inc. Il-15 variants and uses thereof
US20200246383A1 (en) 2019-02-01 2020-08-06 Regents Of The University Of Minnesota Compounds binding to fibroblast activation protein alpha and methods of making and using

Family Cites Families (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JP6594855B2 (ja) * 2013-03-15 2019-10-23 ゼンコア インコーポレイテッド ヘテロ二量体タンパク質
MY203000A (en) * 2016-10-14 2024-06-01 Xencor Inc Il15/il15r� heterodimeric fc-fusion proteins
CA3090407A1 (en) * 2018-03-01 2019-09-06 Glycotope Gmbh Fusion protein constructs comprising an anti-muc1 antibody and il-15
MA52289A (fr) * 2018-04-18 2021-02-24 Xencor Inc Protéines de fusion fc hétérodimères il-15/il-15ra et leurs utilisations
AU2019359475A1 (en) * 2018-10-12 2021-05-20 Xencor, Inc. PD-1 targeted IL-15/IL-15Ralpha Fc fusion proteins and uses in combination therapies thereof
CA3153542A1 (en) * 2019-09-25 2021-04-01 Leto Laboratories Co., Ltd Recombinant interleukin-15 analog

Patent Citations (8)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1999058570A2 (en) 1998-05-11 1999-11-18 Eidgenössische Technische Hochschule Zürich Antibodies to the ed-b domain of fibronectin, conjugates containing them and use therefor for diagnosis and therapy of tumors and diseases associated with angiogenesis
WO2010039873A2 (en) 2008-10-01 2010-04-08 Tracon Pharmaceuticals, Inc. Humanized endoglin antibodies
WO2010078945A2 (en) 2009-01-07 2010-07-15 Philogen S.P.A. Cancer treatment
WO2014174105A1 (en) 2013-04-25 2014-10-30 Philochem Ag Antibody-drug conjugates
WO2017095805A1 (en) 2015-11-30 2017-06-08 Abbvie Inc. ANTI-huLRRC15 ANTIBODY DRUG CONJUGATES AND METHODS FOR THEIR USE
WO2018184964A1 (en) 2017-04-03 2018-10-11 F. Hoffmann-La Roche Ag Immunoconjugates of an anti-pd-1 antibody with a mutant il-2 or with il-15
WO2019166946A1 (en) 2018-02-28 2019-09-06 Pfizer Inc. Il-15 variants and uses thereof
US20200246383A1 (en) 2019-02-01 2020-08-06 Regents Of The University Of Minnesota Compounds binding to fibroblast activation protein alpha and methods of making and using

Non-Patent Citations (70)

* Cited by examiner, † Cited by third party
Title
AHMED, A. A.S. R. KEREMANEJ. VIELMETTERP. J. BJORKMAN: "Structural characterization of GASDALIE Fc bound to the activating Fc receptor FcgammaRIIIa", J STRUCT BIOL, vol. 194, no. 1, 2016, pages 78 - 89, XP029422427, DOI: 10.1016/j.jsb.2016.02.001
ALEGRE, M. L.A. M. COLLINSV. L. PULITOR. A. BROSIUSW. C. OLSONR. A. ZIVINR. KNOWLESJ. R. THISTLETHWAITEL. K. JOLLIFFEJ. A. BLUESTO: "Effect of a single amino acid mutation on the activating and immunosuppressive properties of a ''humanized'' OKT3 monoclonal antibody", J IMMUNOL, vol. 148, no. 11, 1992, pages 3461 - 3468, XP000561187
AN, Z.G. FORRESTR. MOOREM. CUKANP. HAYTKOL. HUANGS. VITELLIJ. Z. ZHAOP. LUJ. HUA: "IgG2m4, an engineered antibody isotype with reduced Fc function", MABS, vol. 1, no. 6, 2009, pages 572 - 579, XP002665505, DOI: 10.4161/mabs.1.6.10185
BOLT, S.E. ROUTLEDGEI. LLOYDL. CHATENOUDH. POPES. D. GORMANM. CLARKH. WALDMANN: "The generation of a humanized, non-mitogenic CD3 monoclonal antibody which retains in vitro immunosuppressive properties", EUR J IMMUNOL, vol. 23, no. 2, 1993, pages 403 - 411
CHESTER, C.M. F. SANMAMEDJ. WANGI. MELERO: "Immunotherapy targeting 4-1BB: mechanistic rationale, clinical results, and future strategies", BLOOD, vol. 131, no. 1, 2018, pages 49 - 57, XP055636174, DOI: 10.1182/blood-2017-06-741041
CHOI, H. J.S. H. SEOKY. J. KIMM. D. SEOY. S. KIM: "Crystal structures of immunoglobulin Fc heterodimers reveal the molecular basis for heterodimer formation", MOL IMMUNOL, vol. 65, no. 2, 2015, pages 377 - 383, XP029204760, DOI: 10.1016/j.molimm.2015.02.017
CHOI, H. J.Y. J. KIMD. K. CHOIY. S. KIM: "Engineering of Immunoglobulin Fc Heterodimers Using Yeast Surface-Displayed Combinatorial Fc Library Screening", PLOS ONE, vol. 10, no. 12, 2015, pages e0145349
CHOI, H. J.Y. J. KIMS. LEEY. S. KIM: "A heterodimeric Fc-based bispecific antibody simultaneously targeting VEGFR-2 and Met exhibits potent antitumor activity", MOL CANCER THER, vol. 12, no. 12, 2013, pages 2748 - 2759, XP055177098, DOI: 10.1158/1535-7163.MCT-13-0628
CHU, S. Y.I. VOSTIARS. KARKIG. L. MOOREG. A. LAZARE. PONGP. F. JOYCED. E. SZYMKOWSKIJ. R. DESJARLAIS: "Inhibition of B cell receptor-mediated activation of primary human B cells by coengagement of CD19 and FcgammaRIIb with Fc-engineered antibodies", MOL IMMUNOL, vol. 45, no. 15, 2008, pages 3926 - 3933, XP002498116, DOI: 10.1016/j.molimm.2008.06.027
CLEMENCEAU, B.R. VIVIENC. PELLATM. FOSSG. THIBAULTH. VIE: "The human natural killer cytotoxic cell line NK-92, once armed with a murine CD 16 receptor, represents a convenient cellular tool for the screening of mouse mAbs according to their ADCC potential.", MABS, vol. 5, no. 4, 2013, pages 587 - 594, XP055333121, DOI: 10.4161/mabs.25077
CONLON, K. C.M. D. MILJKOVICT. A. WALDMANN: "Cytokines in the Treatment of Cancer", J INTERFERON CYTOKINE RES, vol. 39, no. 1, 2019, pages 6 - 21, XP055797213, DOI: 10.1089/jir.2018.0019
DALL'ACQUA, W. F.R. M. WOODSE. S. WARDS. R. PALASZYNSKIN. K. PATELY. A. BREWAHH. WUP. A. KIENERS. LANGERMANN: "Increasing the affinity of a human IgGl for the neonatal Fc receptor: biological consequences", J IMMUNOL, vol. 169, no. 9, 2002, pages 5171 - 5180
DAVIS, J. H.C. APERLOY. LIE. KUROSAWAY. LANK. M. LOJ. S. HUSTON: "SEEDbodies: fusion proteins based on strand-exchange engineered domain (SEED) CH3 heterodimers in an Fc analogue platform for asymmetric binders or immunofusions and bispecific antibodies", PROTEIN ENG DES SEL, vol. 23, no. 4, 2010, pages 195 - 202, XP055018770, DOI: 10.1093/protein/gzp094
DEKKERS, G.R. PLOMPC. A. KOELEMANR. VISSERH. H. VON HORSTENV. SANDIGT. RISPENSM. WUHRERG. VIDARSSON: "Multi-level glyco-engineering techniques to generate IgG with defined Fc-glycans", SCI REP, vol. 6, 2016, pages 36964
DIEBOLDER, C. A.F. J. BEURSKENSR. N. DE JONGR. I. KONINGK. STRUMANEM. A. LINDORFERM. VOORHORSTD. UGURLARS. ROSATIA. J. HECK: "Complement is activated by IgG hexamers assembled at the cell surface", SCIENCE, vol. 343, no. 6176, 2014, pages 1260 - 1263, XP055268751, DOI: 10.1126/science.1248943
DOLGIN, E: "Antibody engineers seek optimal drug targeting TIGIT checkpoint", NAT BIOTECHNOL, vol. 38, no. 9, 2020, pages 1007 - 1009, XP037523997, DOI: 10.1038/s41587-020-0666-1
ELLIOTT, J. M.M. ULTSCHJ. LEER. TONGK. TAKEDAC. SPIESSC. EIGENBROTJ. M. SCHEER: "Antiparallel conformation of knob and hole aglycosylated half-antibody homodimers is mediated by a CH2-CH3 hydrophobic interaction", J MOL BIOL, vol. 426, no. 9, 2014, pages 1947 - 1957, XP028844614, DOI: 10.1016/j.jmb.2014.02.015
FORERO-TORRES, A.S. DE VOSB. L. POHLMANM. PASHKEVICHD. M. CRONIERN. H. DANGS. P. CARPENTERB. W. ALLANJ. G. NELSONC. A. SLAPAK: "Results of a phase 1 study of AME-133v (LY2469298), an Fc-engineered humanized monoclonal anti-CD20 antibody, in FcgammaRIIIa-genotyped patients with previously treated follicular lymphoma", CLIN CANCER RES, vol. 18, no. 5, 2012, pages 1395 - 1403
FU, Y.Q. LINZ. ZHANGL. ZHANG: "Therapeutic strategies for the costimulatory molecule OX40 in T-cell-mediated immunity", ACTA PHARMACEUTICA SINICA B, vol. 10, no. 3, 2020, pages 414 - 433
GODAR, M.H. DE HAARDC. BLANCHETOTJ. RASSER: "Therapeutic bispecific antibody formats: a patent applications review (1994-2017", EXPERT OPINION ON THERAPEUTIC PATENTS, vol. 28, no. 3, 2018, pages 251 - 276, XP055512916, DOI: 10.1080/13543776.2018.1428307
GUNASEKARAN, K.M. PENTONYM. SHENL. GARRETTC. FORTEA. WOODWARDS. B. NGT. BORNM. RETTERK. MANCHULENKO: "Enhancing antibody Fc heterodimer formation through electrostatic steering effects: applications to bispecific molecules and monovalent IgG", J BIOL CHEM, vol. 285, no. 25, 2010, pages 19637 - 19646, XP055546816, DOI: 10.1074/jbc.M110.117382
HA, J.-H.J.-E. KIMY.-S. KIM: "Immunoglobulin Fc Heterodimer Platform Technology: From Design to Applications in Therapeutic Antibodies and Proteins", FRONTIERS IN IMMUNOLOGY, vol. 7, 2016, pages 394
HORI, T.T. UCHIYAMAM. TSUDOH. UMADOMEH. OHNOS. FUKUHARAK. KITAH. UCHINO: "Establishment of an interleukin 2-dependent human T cell line from a patient with T cell chronic lymphocytic leukemia who is not infected with human T cell leukemia/lymphoma virus", BLOOD, vol. 70, no. 4, 1987, pages 1069 - 1072
IDUSOGIE, E. E.P. Y. WONGL. G. PRESTAH. GAZZANO-SANTOROK. TOTPALM. ULTSCHM. G. MULKERRIN: "Engineered antibodies with increased activity to recruit complement", J IMMUNOL, vol. 166, no. 4, 2001, pages 2571 - 2575, XP002781370, DOI: 10.4049/jimmunol.166.4.2571
KLEIN, C.L. CODARRI-DEAKV. NICOLINIS. SEEBERL. LAUENERM. RICHARDE. BOMMERM. KARAGIANNIJ. SAMR. SCHLENKER: "Abstract 1552: A novel PDl-IL2v immunocytokine for preferential <em>cis</em>-activation of IL-2R signaling on PD-1 expressing T cell subsets strongly potentiates anti-tumor T cell activity of PD-1 checkpoint inhibition and IL-2R-beta-gamma agonism", CANCER RESEARCH, vol. 79, 2019, pages 1552 - 1552
LAZAR, G. A.W. DANGS. KARKIO. VAFAJ. S. PENGL. HYUNC. CHANH. S. CHUNGA. EIVAZIS. C. YODER: "Engineered antibody Fc variants with enhanced effector function", PROC NATL ACAD SCI U S A, vol. 103, no. 11, 2006, pages 4005 - 4010
LEABMAN, M. K.Y. G. MENGR. F. KELLEYL. E. DEFORGEK. J. COWANS. IYER: "Effects of altered FcgammaR binding on antibody pharmacokinetics in cynomolgus monkeys", MABS, vol. 5, no. 6, 2013, pages 896 - 903
LEAVER-FAY, A.K. J. FRONINGS. ATWELLH. ALDAZA. PUSTILNIKF. LUF. HUANGR. YUANS. HASSANALIA. K. CHAMBERLAIN: "Computationally Designed Bispecific Antibodies using Negative State Repertoires", STRUCTURE, vol. 24, no. 4, pages 641 - 651, XP055263232, DOI: 10.1016/j.str.2016.02.013
LO, M.H. S. KIMR. K. TONGT. W. BAINBRIDGEJ. M. VERNESY. ZHANGY. L. LINS. CHUNGM. S. DENNISY. J. ZUCHERO: "Effector-attenuating Substitutions That Maintain Antibody Stability and Reduce Toxicity in Mice.", J BIOL CHEM, vol. 292, no. 9, 2017, pages 3900 - 3908, XP055428854, DOI: 10.1074/jbc.M116.767749
LU, D.Z. POLONSKAYAT.-P. CHANGS. MARTOMOX. LUNAZ. ZHANGF. MIYARAJ. PATEL: "Abstract 525: A novel anti-PDl-IL15 immunocytokine potentiates anti-tumor T cell activity of PD-1 checkpoint inhibition and IL-2R-beta-gamma agonism", CANCER RESEARCH, vol. 80, 2020, pages 525 - 525
LU, X.R. P. NOBREGAH. LYNAUGHT. JAINK. BARLOWT. BOLANDA. SIVASUBRAMANIANM. VASQUEZY. XU: "Deamidation and isomerization liability analysis of 131 clinical-stage antibodies", MABS, vol. 11, no. 1, 2019, pages 45 - 57, XP055675424, DOI: 10.1080/19420862.2018.1548233
MERCHANT, A. M.Z. ZHUJ. Q. YUANA. GODDARDC. W. ADAMSL. G. PRESTAP. CARTER: "An efficient route to human bispecific IgG", NAT BIOTECHNOL, vol. 16, no. 7, 1998, pages 677 - 681, XP002141015, DOI: 10.1038/nbt0798-677
MIMOTO, F.T. IGAWAT. KURAMOCHIH. KATADAS. KADONOT. KAMIKAWAM. SHIDA-KAWAZOEK. HATTORI: "Novel asymmetrically engineered antibody Fc variant with superior FcgammaR binding affinity and specificity compared with afucosylated Fc variant", MABS, vol. 5, no. 2, 2013, pages 229 - 236, XP055108766, DOI: 10.4161/mabs.23452
MOORE, G. L.C. BAUTISTAE. PONGD. H. NGUYENJ. JACINTOA. EIVAZIU. S. MUCHHALS. KARKIS. Y. CHUG. A. LAZAR: "A novel bispecific antibody format enables simultaneous bivalent and monovalent co-engagement of distinct target antigens", MABS, vol. 3, no. 6, 2011, pages 546 - 557, XP055030488, DOI: 10.4161/mabs.3.6.18123
MOORE, G. L.H. CHENS. KARKIG. A. LAZAR: "Engineered Fc variant antibodies with enhanced ability to recruit complement and mediate effector functions", MABS, vol. 2, no. 2, 2010, pages 181 - 189, XP009143498, DOI: 10.4161/mabs.2.2.11158
NATSUME, A.M. INH. TAKAMURAT. NAKAGAWAY. SHIMIZUK. KITAJIMAM. WAKITANIS. OHTAM. SATOHK. SHITARA: "Engineered antibodies of IgGl/IgG3 mixed isotype with enhanced cytotoxic activities", CANCER RES, vol. 68, no. 10, 2008, pages 3863 - 3872
NELLIS, D. F.D. F. MICHIELM. S. JIANGD. ESPOSITOR. DAVISH. JIANGA. KORRELLG. C. T. KNAPPL. E. LUCERNONIR. E. NELSON: "Characterization of recombinant human IL-15 deamidation and its practical elimination through substitution of asparagine 77", PHARM RES, vol. 29, no. 3, 2012, pages 722 - 738, XP035016534, DOI: 10.1007/s11095-011-0597-0
NORDSTROM, J. L., S. GORLATOV, W. ZHANG, Y. YANG, L. HUANG, S. BURKE, H. LI, V. CICCARONE, T. ZHANG, J. STAVENHAGEN, S. KOENIG, S.: "Anti-tumor activity and toxicokinetics analysis of MGAH22, an anti-HER2 monoclonal antibody with enhanced Fcgamma receptor binding properties", BREAST CANCER RES, vol. 13, no. 6, 2011, pages R123, XP021094495, DOI: 10.1186/bcr3069
PEREIRA, N. A.K. F. CHANP. C. LINZ. SONG: "The ''less-is-more'' in therapeutic antibodies: Afucosylated anti-cancer antibodies with enhanced antibody-dependent cellular cytotoxicity", MABS, vol. 10, no. 5, 2018, pages 693 - 711, XP055781805, DOI: 10.1080/19420862.2018.1466767
PERUSSIA, B.M. J. LOZA: "Assays for antibody-dependent cell-mediated cytotoxicity (ADCC) and reverse ADCC (redirected cytotoxicity) in human natural killer cells", METHODS MOL BIOL, vol. 121, 2000, pages 179 - 192
PINI, A.F. VITIA. SANTUCCIB. CARNEMOLLAL. ZARDIP. NERID. NERI: "Design and use of a phage display library. Human antibodies with subnanomolar affinity against a marker of angiogenesis eluted from a two-dimensional gel", J BIOL CHEM, vol. 273, no. 34, 1998, pages 21769 - 21776, XP002124781, DOI: 10.1074/jbc.273.34.21769
RICHARDS, J. O.S. KARKIG. A. LAZARH. CHENW. DANGJ. R. DESJARLAIS: "Optimization of antibody binding to FcgammaRIIa enhances macrophage phagocytosis of tumor cells", MOL CANCER THER, vol. 7, no. 8, 2008, pages 2517 - 2527, XP002590014, DOI: 10.1158/1535-7163.mct-08-0201
ROBINSON, N. E.A. B. ROBINSON: "Prediction of primary structure deamidation rates of asparaginyl and glutaminyl peptides through steric and catalytic effects.", J PEPT RES, vol. 63, no. 5, 2004, pages 437 - 448, XP055912437
ROBINSON, T. O.K. S. SCHLUNS: "The potential and promise of IL-15 in immuno-oncogenic therapies", IMMUNOL LETT, vol. 190, 2017, pages 159 - 168, XP085196666, DOI: 10.1016/j.imlet.2017.08.010
ROSENLOCHER, J.V. BOHRSCHM. SACHARJATV. BLANCHARDC. GIESEV. SANDIGC. P. R. HACKENBERGERS. HINDERLICH: "Applying Acylated Fucose Analogues to Metabolic Glycoengineering", BIOENGINEERING (BASEL, vol. 2, no. 4, 2015, pages 213 - 234
ROTHER, R. P.S. A. ROLLINSC. F. MOJCIKR. A. BRODSKYL. BELL: "Discovery and development of the complement inhibitor eculizumab for the treatment of paroxysmal nocturnal hemoglobinuria", NAT BIOTECHNOL, vol. 25, no. 11, 2007, pages 1256 - 1264, XP002553743, DOI: 10.1038/nbt1344
SHANG, L.B. DAUBEUFM. TRIANTAFILOUR. OLDENF. DEPISA. C. RABYS. HERRENA. DOS SANTOSP. MALINGEI. DUNN-SIEGRIST: "Selective antibody intervention of Toll-like receptor 4 activation through Fc gamma receptor tethering", J BIOL CHEM, vol. 289, no. 22, 2014, pages 15309 - 15318
SHIELDS, R. L.A. K. NAMENUKK. HONGY. G. MENGJ. RAEJ. BRIGGSD. XIEJ. LAIA. STADLENB. LI: "High resolution mapping of the binding site on human IgGl for Fc gamma RI, Fc gamma RII, Fc gamma RIII, and FcRn and design of IgGl variants with improved binding to the Fc gamma R", J BIOL CHEM, vol. 276, no. 9, 2001, pages 6591 - 6604
SILVA, J. P.O. VETTERLEINJ. JOSES. PETERSH. KIRBY: "The S228P mutation prevents in vivo and in vitro IgG4 Fab-arm exchange as demonstrated using a combination of novel quantitative immunoassays and physiological matrix preparation", J BIOL CHEM, vol. 290, no. 9, 2015, pages 5462 - 5469, XP055299482, DOI: 10.1074/jbc.M114.600973
SOMAN, G.X. YANGH. JIANGS. GIARDINAV. VYASG. MITRAJ. YOVANDICHS. P. CREEKMORET. A. WALDMANNO. QUINONES: "MTS dye based colorimetric CTLL-2 cell proliferation assay for product release and stability monitoring of interleukin-15: assay qualification, standardization and statistical analysis", J IMMUNOL METHODS, vol. 348, 2009, pages 83 - 94, XP026470616, DOI: 10.1016/j.jim.2009.07.010
SPIESS, C.Q. ZHAIP. J. CARTER: "Alternative molecular formats and therapeutic applications for bispecific antibodies", MOL IMMUNOL, vol. 67, 2015, pages 95 - 106, XP029246892, DOI: 10.1016/j.molimm.2015.01.003
STAVENHAGEN, J. B.S. GORLATOVN. TUAILLONC. T. RANKINH. LIS. BURKEL. HUANGS. VIJHS. JOHNSONE. BONVINI: "Fc optimization of therapeutic antibodies enhances their ability to kill tumor cells in vitro and controls tumor expansion in vivo via low-affinity activating Fcgamma receptors", CANCER RES, vol. 67, no. 18, 2007, pages 8882 - 8890, XP002489883, DOI: 10.1158/0008-5472.CAN-07-0696
TAO, M. H.S. L. MORRISON: "Studies of aglycosylated chimeric mouse-human IgG. Role of carbohydrate in the structure and effector functions mediated by the human IgG constant region", J IMMUNOL, vol. 143, no. 8, 1989, pages 2595 - 2601
THAYSEN-ANDERSEN, M., E. CHERTOVA, C. BERGAMASCHI, E. S. MOH, O. CHERTOV, J. ROSER, R.SOWDER, J. BEAR, J. LIFSON, N. H. PACKER, B.: "Recombinant human heterodimeric IL-15 complex displays extensive and reproducible N-and O-linked glycosylation", GLYCOCONI J, vol. 33, no. 3, 2016, pages 417 - 433
TOUTAIN, P. L.A. BOUSQUET-MELOU: "Plasma terminal half-life.", J VET PHARMACOL THER, vol. 27, no. 6, 2004, pages 427 - 439, XP055909101, DOI: 10.1111/j.1365-2885.2004.00600.x
VAFA, O.G. L. GILLILANDR. J. BREZSKIB. STRAKET. WILKINSONE. R. LACYB. SCALLONA. TEPLYAKOVT. J. MALIAW. R. STROHL: "An engineered Fc variant of an IgG eliminates all immune effector functions via structural perturbations", METHODS, vol. 65, no. 1, 2014, pages 114 - 126
VILLA, A.E. TRACHSELM. KASPARC. SCHLIEMANNR. SOMMAVILLAJ. N. RYBAKC. ROSLIL. BORSID. NERI: "A high-affinity human monoclonal antibody specific to the alternatively spliced EDA domain of fibronectin efficiently targets tumor neo-vasculature in vivo", INT J CANCER, vol. 122, no. 11, 2008, pages 2405 - 2413, XP002499091, DOI: 10.1002/ijc.23408
VON KREUDENSTEIN, T. S.E. ESCOBAR-CARBRERAP. I. LARIOI. D'ANGELOK. BRAULTJ. KELLYY. DUROCHERJ. BAARDSNESR. J. WOODSM. H. XIE: "Improving biophysical properties of a bispecific antibody scaffold to aid developability: quality by molecular design", MABS, vol. 5, no. 5, 2013, pages 646 - 654, XP055526148, DOI: 10.4161/mabs.25632
VONDERHEIDE, R. H.: "CD40 Agonist Antibodies in Cancer Immunotherapy", ANNUAL REVIEW OF MEDICINE, vol. 71, no. 1, 2020, pages 47 - 58, XP055803180, DOI: 10.1146/annurev-med-062518-045435
WALDMANN, T. A.: "The shared and contrasting roles of IL2 and IL15 in the life and death of normal and neoplastic lymphocytes: implications for cancer therapy", CANCER IMMUNOL RES, vol. 3, no. 3, 2015, pages 219 - 227
WALDMANN, T. A.S. DUBOISM. D. MILJKOVICK. C. CONLON: "IL-15 in the Combination Immunotherapy of Cancer", FRONTIERS IN IMMUNOLOGY, 2020, pages 11
WALDMEIER, L.I. HELLMANNC. K. GUTKNECHTF. I. WOLTERS. C. COOKS. T. REDDYU. GRAWUNDERR. R. BEERLI: "Transpo-mAb display: Transposition-mediated B cell display and functional screening of full-length IgG antibody libraries", MABS, vol. 8, no. 4, 2016, pages 726 - 740, XP055271728, DOI: 10.1080/19420862.2016.1160990
WALKER, M. R.J. LUNDK. M. THOMPSONR. JEFFERIS: "Aglycosylation of human IgGl and IgG3 monoclonal antibodies can eliminate recognition by human cells expressing Fc gamma RI and/or Fc gamma RII receptors", BIOCHEM J, vol. 259, no. 2, 1989, pages 347 - 353
WANG, X.M. MATHIEUR. J. BREZSKI: "IgG Fc engineering to modulate antibody effector functions", PROTEIN CELL, vol. 9, no. 1, 2018, pages 63 - 73, XP055457296, DOI: 10.1007/s13238-017-0473-8
XU, D.M. L. ALEGRES. S. VARGAA. L. ROTHERMELA. M. COLLINSV. L. PULITOL. S. HANNAK. P. DOLANP. W. PARRENJ. A. BLUESTONE: "In vitro characterization of five humanized OKT3 effector function variant antibodies", CELL IMMUNOL, vol. 200, no. 1, 2000, pages 16 - 26, XP002376698, DOI: 10.1006/cimm.2000.1617
XU, Y.L. C. CARRASCOSAY. A. YEUNGM. L. CHUW. YANGI. DJURETICD. C. PAPPASJ. ZEYTOUNIANZ. GEV. DE RUITER: "An Engineered IL15 Cytokine Mutein Fused to an Anti-PDl Improves Intratumoral T-cell Function and Antitumor Immunity", CANCER IMMUNOL RES, vol. 9, no. 10, 2021, pages 1141 - 1157
YAMANE-OHNUKI, N.S. KINOSHITAM. INOUE-URAKUBOM. KUSUNOKIS. IIDAR. NAKANOM. WAKITANIR. NIWAM. SAKURADAK. UCHIDA: "Establishment of FUT8 knockout Chinese hamster ovary cells: an ideal host cell line for producing completely defucosylated antibodies with enhanced antibody-dependent cellular cytotoxicity", BIOTECHNOL BIOENG, vol. 87, no. 5, 2004, pages 614 - 622, XP002984450, DOI: 10.1002/bit.20151
YU, J.Y. SONGW. TIAN: "How to select IgG subclasses in developing anti-tumor therapeutic antibodies", J HEMATOL ONCOL, vol. 13, no. 1, 2020, pages 45, XP055884120, DOI: 10.1186/s13045-020-00876-4
ZALEVSKY, J.A. K. CHAMBERLAINH. M. HORTONS. KARKII. W. LEUNGJ. SPROULEG. A. LAZARD. C. ROOPENIANJ. R. DESJARLAIS: "Enhanced antibody half-life improves in vivo activity", NAT BIOTECHNOL, vol. 28, no. 2, 2010, pages 157 - 159, XP055308991, DOI: 10.1038/nbt.1601
ZHANG, T.X. SONGL. XUJ. MAY. ZHANGW. GONGY. ZHANGX. ZHOUZ. WANGY. WANG: "The binding of an anti-PD-1 antibody to FcyRI has a profound impact on its biological functions", CANCER IMMUNOLOGY, IMMUNOTHERAPY, vol. 67, no. 7, 2018, pages 1079 - 1090, XP036529047, DOI: 10.1007/s00262-018-2160-x

Cited By (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP3444271B1 (en) 2013-08-08 2021-10-06 Cytune Pharma Il-15 and il-15ralpha sushi domain based modulokines
EP3995507B1 (en) 2013-08-08 2023-10-04 Cytune Pharma Il-15 and il-15ralpha sushi domain based on modulokines
WO2025177263A1 (en) * 2024-02-25 2025-08-28 Biohaven Therapeutics Ltd. Myostatin-binding proteins

Also Published As

Publication number Publication date
JP2024524891A (ja) 2024-07-09
WO2022268983A3 (en) 2023-04-06
CA3221886A1 (en) 2022-12-29
KR20240024242A (ko) 2024-02-23
IL309533A (en) 2024-02-01
BR112023027312A2 (pt) 2024-03-12
EP4359428A2 (en) 2024-05-01
MX2023015444A (es) 2024-04-29
US20240294594A1 (en) 2024-09-05
AU2022296794A1 (en) 2023-12-14

Similar Documents

Publication Publication Date Title
US11377477B2 (en) PD-1 targeted IL-15/IL-15RALPHA fc fusion proteins and uses in combination therapies thereof
US20230227584A1 (en) Bispecific antibodies comprising a modified c-terminal crossfab fragment
JP2026048631A (ja) マスクされたil-12サイトカイン及びその切断産物
US12280120B2 (en) Tumor-specific cleavable linkers
JP7678005B2 (ja) Her2を標的とするアゴニストCD28抗原結合分子
CN110325209A (zh) 能够结合cd137和肿瘤抗原的双特异性结合分子及其用途
US20250002601A1 (en) Multispecific antibodies binding to cd20, nkp46, cd16 and conjugated to il-2
IL296225A (en) Immune activating fc domain binding molecules
TW201730212A (zh) Ror1-結合分子及其使用方法
US20240294594A1 (en) Interleukin-15 based immunocytokines
EP3497120A1 (en) Engineered antibodies and other fc-domain containing molecules with enhanced agonism and effector functions
CN116333138A (zh) Pd-1结合分子和其使用方法
WO2021055765A2 (en) Multimeric antibodies with enhanced selectivity for cells with high target density
TW202000231A (zh) 變體cd3-結合結構域及其在用於治療疾病的組合療法中的用途
CN116390933A (zh) 治疗b细胞恶性肿瘤的抗cd19剂和b细胞靶向剂组合疗法
CN111465618A (zh) 双特异性cd16-结合分子及其在疾病治疗中的用途
JP2024537096A (ja) がんの治療のための代替的なPD1-IL7vイムノコンジュゲート
US20260115255A1 (en) Interleukin 15 variants
CN120152989A (zh) 抗cd19/抗cd28双特异性抗体的组合疗法
CN117597356A (zh) 基于白细胞介素-15的免疫细胞因子
US20250376536A1 (en) Multispecific anti-cd40 / anti-fap antibodies and uses thereof
RU2805648C2 (ru) Биспецифические связывающие молекулы, способные связывать cd137 и опухолевые антигены, и варианты их применения
EA051364B1 (ru) Улучшенные антигенсвязывающие рецепторы

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 22736247

Country of ref document: EP

Kind code of ref document: A2

WWE Wipo information: entry into national phase

Ref document number: 805958

Country of ref document: NZ

Ref document number: 2022296794

Country of ref document: AU

Ref document number: AU2022296794

Country of ref document: AU

WWE Wipo information: entry into national phase

Ref document number: 3221886

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2023576235

Country of ref document: JP

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2022296794

Country of ref document: AU

Date of ref document: 20220623

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: MX/A/2023/015444

Country of ref document: MX

WWE Wipo information: entry into national phase

Ref document number: 309533

Country of ref document: IL

WWE Wipo information: entry into national phase

Ref document number: 202317088027

Country of ref document: IN

WWE Wipo information: entry into national phase

Ref document number: 202280045358.9

Country of ref document: CN

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112023027312

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 20247002543

Country of ref document: KR

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 2022736247

Country of ref document: EP

Ref document number: 1020247002543

Country of ref document: KR

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2022736247

Country of ref document: EP

Effective date: 20240123

ENP Entry into the national phase

Ref document number: 112023027312

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20231222