WO2022261257A1 - Stapled peptides and methods thereof - Google Patents
Stapled peptides and methods thereof Download PDFInfo
- Publication number
- WO2022261257A1 WO2022261257A1 PCT/US2022/032738 US2022032738W WO2022261257A1 WO 2022261257 A1 WO2022261257 A1 WO 2022261257A1 US 2022032738 W US2022032738 W US 2022032738W WO 2022261257 A1 WO2022261257 A1 WO 2022261257A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- agent
- amino acid
- independently
- group
- staple
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K7/00—Peptides having 5 to 20 amino acids in a fully defined sequence; Derivatives thereof
- C07K7/50—Cyclic peptides containing at least one abnormal peptide link
- C07K7/54—Cyclic peptides containing at least one abnormal peptide link with at least one abnormal peptide link in the ring
- C07K7/56—Cyclic peptides containing at least one abnormal peptide link with at least one abnormal peptide link in the ring the cyclisation not occurring through 2,4-diamino-butanoic acid
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K45/00—Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
- A61K45/06—Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K1/00—General methods for the preparation of peptides, i.e. processes for the organic chemical preparation of peptides or proteins of any length
- C07K1/107—General methods for the preparation of peptides, i.e. processes for the organic chemical preparation of peptides or proteins of any length by chemical modification of precursor peptides
- C07K1/1072—General methods for the preparation of peptides, i.e. processes for the organic chemical preparation of peptides or proteins of any length by chemical modification of precursor peptides by covalent attachment of residues or functional groups
- C07K1/1077—General methods for the preparation of peptides, i.e. processes for the organic chemical preparation of peptides or proteins of any length by chemical modification of precursor peptides by covalent attachment of residues or functional groups by covalent attachment of residues other than amino acids or peptide residues, e.g. sugars, polyols, fatty acids
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K7/00—Peptides having 5 to 20 amino acids in a fully defined sequence; Derivatives thereof
- C07K7/04—Linear peptides containing only normal peptide links
- C07K7/08—Linear peptides containing only normal peptide links having 12 to 20 amino acids
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
Definitions
- Stapled peptides are useful for various applications. For example, as biologically active agents, they can be utilized to modulate various biological functions.
- the present disclosure provides powerful technologies (e.g., agents (e.g., those that are or comprise peptides, in many embodiments, stapled peptides), compositions, methods, etc.) for modulating various biological functions.
- agents e.g., those that are or comprise peptides, in many embodiments, stapled peptides
- compositions, methods, etc. for modulating various biological functions.
- the present disclosure provides agents, e.g., stapled peptides that comprise multiple staples. In some embodiments, the present disclosure provides agents, e.g., stapled peptides that comprise three or more staples. In some embodiments, the present disclosure provides agents, e.g., stapled peptides that comprise three or more staples within 10-20 amino acid residues, e.g., 10-15, 11-15, 11-14, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20 consecutive amino acid residues. In some embodiments, the present disclosure provides agents, e.g., stapled peptides that comprise three or more staples within 11 consecutive amino acid residues.
- the present disclosure provides agents, e.g., stapled peptides that comprise three or more staples within 14 consecutive amino acid residues. In some embodiments, within such numbers of amino acid residues there are three staples. In some embodiments, within such numbers of consecutive amino acid residues there are four staples.
- provided agents, e.g., stapled peptides have increased rigidity than reference peptides (e.g., unstapled peptides, or stapled peptides having fewer staples (in some embodiments, fewer staples within certain numbers of amino acid residues as described herein), etc.).
- provided agents e.g., stapled peptides demonstrate various desired properties and/or activities.
- provided agents, e.g., stapled peptides provide improved desired properties and/or activities than reference peptides (e.g., unstapled peptides, or stapled peptides having fewer staples (in some embodiments, fewer staples within certain numbers of amino acid residues as described herein), etc.).
- provided technologies comprise designed structural features, e.g., novel amino acid residues, that can provide significantly improved properties and/or activities compared to comparable reference technologies that do not contain such designed structural features.
- the present disclosure provides designed amino acids as described herein, whose incorporation into peptide agents, including stapled peptides, can provide significantly improved properties and/or activities such as improved lipophilicity and/or delivery into cells compared to reference amino acids (e.g., Asp).
- the present disclosure provides technologies including peptides comprising such designed amino acid residues.
- the present disclosure provides stapled peptides comprise such designed amino acid residues.
- the present disclosure provides technologies for modulating one or more functions of beta-catenin.
- the present disclosure provides various agents, e.g., peptides, in many instances stapled peptides, that can bind to beta-catenin and modulate its functions.
- the present disclosure binds agents that can interact with beta-catenin at a unique set of residues.
- a binding site comprises one or more or all of the set of residues.
- provided agents interact with one or more of a set of residues that are or correspond to the following residues of SEQ ID NO: 1: A305, Y306, G307, N308, Q309, K312, R342, K345, V346, V349, Q375, R376, Q379, N380, L382, W383, R386, N387, D413, N415, V416, T418, and C419.
- provided agents interact with one or more of amino acid residue that are or correspond to A305, Y306, G307, N308, Q309, K312, R342, K345, V346, V349, Q375, Q379, N380, L382, W383, R386, N387, D413, N415, V416, T418, and C419 of SEQ ID NO: 1.
- provided agents interact with one or more of amino acid residues that are or correspond to A305, Y306, G307, N308, Q309, K312, K345, V346, V349, Q379, N380, L382, W383, R386, N387, D413, N415, V416, T418, and C419 of SEQ ID NO: 1.
- provided agents interact with one or more of amino acid residues that are or correspond to G307, K312, K345, W383, N387, D413, and N415 of SEQ ID NO: 1.
- provided agents interact with one or more of amino acid residues that are or correspond to K312, K345, R386 and W383 of SEQ ID NO: 1.
- provided agents interact with one or more of a set of residues that are or correspond to the following residues of SEQ ID NO: 1: G307, K312, K345, Q379, L382, W383, N387, N415, and V416. In some embodiments, provided agents interact with all of a set of residues that are or correspond to the following residues of SEQ ID NO: 1: Y306, G307, K312, K345, Q379, L382, W383, N387, N415, and V416.
- provided agents interact with all of a set of residues that are or correspond to the following residues of SEQ ID NO: 1: G307, K312, K345, Q379, L382, W383, N387, N415, and V416. In some embodiments, provided agents interact with all of a set of residues that are or correspond to the following residues of SEQ ID NO: 1: Y306, G307, K312, K345, Q379, L382, W383, N387, N415, and V416. In some embodiments, provided agents interact with one or more of amino acid residues that are or correspond to K312, K345 and W383 of SEQ ID NO: 1.
- provided agents interact with the amino acid residues that are or correspond to K312, K345 and W383 of SEQ ID NO: 1.
- provided technologies can modulate one or more biological processes associated with beta-catenin.
- provided agents e.g., stapled peptides, compete with a ligand (e.g., with a member of the T cell factor/lymphoid enhancer factor (TCF/LEF) family of transcription factors) for binding to beta-catenin.
- TCF/LEF T cell factor/lymphoid enhancer factor
- provided agents compete with a ligand for binding to beta-catenin at a particular binding site (e.g., with a member of the T cell factor/lymphoid enhancer factor (TCF/LEF) family of transcription factors at the TCF site on beta-catenin).
- TCF/LEF T cell factor/lymphoid enhancer factor
- provided technologies compete with TCF for interactions with beta-catenin.
- binding of provided agents to a beta-catenin site decreases, suppresses and/or blocks binding to beta-catenin by another binding partner (e.g., a kinase).
- binding of provided agents blocks binding of beta-catenin by a TCF/LEF family member.
- the present disclosure provides agents that can bind to a site of beta-catenin selectively over one of more other binding sites by other ligands (e.g., peptides, proteins, etc.; in some embodiments, a ligand is Axin; in some embodiments, a ligand is Bcl9).
- ligands e.g., peptides, proteins, etc.; in some embodiments, a ligand is Axin; in some embodiments, a ligand is Bcl9.
- provided technologies modulate one or more beta-catenin functions associated with its interactions with TCF.
- provided technologies selectively modulate beta-catenin functions, e.g., functions associated with TCF interactions.
- provided technologies selectively modulate beta-catenin functions and do not significantly impact functions that are not associated with beta-catenin (e.g., various functions and/or processes in the Wnt pathway that are not associated with beta-catenin).
- provided technologies are useful for inhibiting beta- catenin functions.
- provided technologies are usefully for promoting and/or enhancing immune activities, e.g., anti-tumor adaptive immunity. [0008] In some embodiments, provided technologies are useful for preventing or treating various conditions, disorders or diseases including cancer.
- the present disclosure provides methods for treating or preventing a condition, disorder or disease associated with beta-catenin, comprising administering to a subject suffered therefrom or susceptible thereto an effective amount of a provided agent or a pharmaceutically acceptable salt thereof.
- a condition, disorder or disease is associated with beta-catenin’s interactions with TCF.
- an agent e.g., a staple peptide
- the present disclosure provides pharmaceutical compositions which comprise or deliver a provided agent or a pharmaceutically acceptable salt thereof.
- a pharmaceutical composition further comprises a lipid.
- a suitable lipid can promote delivery/activities.
- an agent is or comprises a peptide. In some embodiments, an agent is or comprises a stapled peptides. In some embodiments, provided agents that can bind beta-catenin comprise one or more designed amino acid residues. [0009] In some embodiments, the present disclosure provides agents that bind to a polypeptide comprising or consisting of SEQ ID NO: 1 (Uniprot ID P35222), or residues 250-450 of SEQ ID NO: 1, or residues 305-419 of SEQ ID NO: 1: Uniprot No.
- provided agents specifically interact with one or more residues which are or correspond to residues 305-419 of SEQ ID NO: 1.
- provided agents bind to a motif (e.g., a portion of a polypeptide, a domain of a polypeptide, etc.) that comprise one or more residues corresponding to Ala305, Tyr306, Gly307, Asn 308, Gln309, Lys312, Arg342, Lys345, Val346, Val349, Gln375, Arg376, Gln379, Asn380, Leu382, Trp383, Arg386, Asn387, Asp413, Asn415, Val416, Thr418, and Cys419 of SEQ ID NO: 1.
- provided agents bind to a motif (e.g., a portion of a polypeptide, a domain of a polypeptide, etc.) that comprise one or more residues corresponding to Ala305, Tyr306, Gly307, Asn 308, Gln309, Lys312, Lys345, Val346, Val349, Gln375, Arg376, Gln379, Asn380, Leu382, Trp383, Arg386, Asn387, Asp413, Asn415, Val416, Thr418, and Cys419 of SEQ ID NO: 1.
- a motif e.g., a portion of a polypeptide, a domain of a polypeptide, etc.
- an agent binds to a motif comprising one or more of the following residues within SEQ ID NO: 1: Ala305, Tyr306, Gly307, Asn 308, Gln309, Lys312, Arg342, Lys345, Val346, Val349, Gln375, Arg376, Gln379, Asn380, Leu382, Trp383, Arg386, Asn387, Asp413, Asn415, Val416, Thr418, and Cys419.
- an agent binds to a motif comprising one or more of the following residues within SEQ ID NO: 1: Ala305, Tyr306, Gly307, Asn 308, Gln309, Lys312, Lys345, Val346, Val349, Gln375, Arg376, Gln379, Asn380, Leu382, Trp383, Arg386, Asn387, Asp413, Asn415, Val416, Thr418, and Cys419.
- an agent binds to a motif comprising one or more of the following residues within SEQ ID NO: 1: Ala305, Tyr306, Gly307, Asn 308, Gln309, Lys312, Arg342, Lys345, Val346, Val349, Gln 375, Gln379, Asn380, Leu382, Trp383, Arg386, Asn387, Asp413, Asn415, Val416, Thr418, and Cys419.
- an agent binds to a motif comprising one or more of the following residues within SEQ ID NO: 1: Ala305, Tyr306, Gly307, Asn 308, Gln309, Lys312, Lys345, Val346, Val349, Gln379, Asn380, Leu382, Trp383, Arg386, Asn387, Asp413, Asn415, Val416, Thr418, and Cys419.
- provided technologies bind to a motif comprising at least 2, 3, 4, 5, or 6 of G307, K312, K345, W383, N387, and N415.
- provided technologies bind to a motif comprising at least 2, 3, 4, 5, 6, or 7 of G307, K312, K345, W383, N387, D413, and N415.
- provided agents specifically bind to such motifs.
- a motif may be referred to as a binding site.
- provided technologies selectively bind to such a binding site over an Axin binding site.
- provided technologies selectively bind to such a binding site over a Bcl9 binding site.
- provided technologies selectively bind to such a binding site over a TCF binding site.
- provided technology binds to such a binding site in a reverse N to C direction compared to TCF.
- provided technologies do not bind to Axin binding site of beta-catenin. In some embodiments, provided technologies do not bind to Bcl9 binding site of beta-catenin. In some embodiments, provided technologies do not bind to ICAT binding site of beta-catenin.
- Various technologies e.g., crystallography, NMR, biochemical assays, etc., may be utilized to assess interactions with beta-catenin in accordance with the present disclosure.
- the provided technology provides an agent, e.g., a stapled peptide, that comprises three staples within 10-20, 10-15, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20 consecutive amino acids residues.
- a first staple in an agent e.g., a staple peptide
- a staple peptide are bonded to amino acid residues at positions i and i+3.
- i is an integer of 1-50 (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20). In some embodiments, i is 1.
- a fourth staple in an agent, e.g., a stapled peptide.
- an agent e.g., a stapled peptide.
- Such a staple may be referred to as a (i, i+3) staple.
- an agent e.g., a stapled peptide, comprises a (i, i+2) staple and a (i, i+7) staple.
- an agent e.g., a stapled peptide, comprises a (i, i+3) staple and a (i, i+7) staple.
- a (i, i+3) staple and (i, i+7) staple are bonded to the same amino acid residue.
- a (i, i+3) staple and (i, i+7) staple bond to the same atom.
- a (i, i+3) staple and (i, i+7) staple bond to the same alpha carbon atom.
- an agent further comprises a third staple.
- a third staple is (i, i+4).
- a third staple is (i, i+7).
- a third staple is not bonded to any of the amino acid residues that are bonded to the first two staples.
- an agent further comprises a fourth staple.
- a fourth staple is (i, i+4).
- a fourth staple is (i, i+7). In some embodiments, a fourth staple is not bonded to any of the amino acid residues that are bonded to the first two staples. In some embodiments, a fourth staple is not bonded to any of the amino acid residues that are bonded to the first third staples.
- a provided agent e.g., a peptide agent such as a stapled peptide agent, comprises one or more (e.g., 1, 2, 3, 4, 5, 6, or 7) of the following groups (in some embodiments, from the N to C direction): a first acidic group (e.g., of a first acidic amino acid residue); a second acidic group (e.g., of a second acidic amino acid residue); optionally a third acidic group (e.g., of a third acidic amino acid residue); optionally a hydrophobic group (e.g., of a hydrophobic amino acid residue) a first aromatic group (e.g., of a first aromatic amino acid residue); a second aromatic group (e.g., of a first aromatic amino acid residue); and a third aromatic group (e.g., of a third aromatic amino acid residue).
- a first acidic group e.g., of a first acidic amino acid residue
- a second acidic group e.g.,
- an agent comprises a first and second acidic group and a first, second and third aromatic group.
- such an agent additionally comprises a third acidic group (e.g., of a third acid amino acid residue) and/or a hydrophobic group (e.g., of a hydrophobic amino acid residue).
- such an agent additionally comprises a third acidic group (e.g., of a third acid amino acid residue) and a hydrophobic group (e.g., of a hydrophobic amino acid residue).
- the distance between a first acidic group and a second acidic group is about the distance between the acidic groups of two acidic amino acid residues of a peptide motif, wherein there are two amino acid residues between the two acidic amino acid residues (e.g., if the first acidic amino acid residue is at position N, the second is at position N+3), the distance between a first acidic group and a third acidic group (if present) is about the distance between the acidic groups of two acidic amino acid residues of a peptide motif, wherein there are three amino acid residues between the two acidic amino acid residues (e.g., if the first acidic amino acid residue is at position N, the third is at position N+4), the distance between a first acidic group and a hydrophobic group (if present) is about the distance between the acidic group of an acidic amino acid residue and the hydrophobic group of a hydrophobic amino acid residue of a peptide motif, wherein there are five amino acid residues between the
- a first acidic amino acid residue is at position N
- a second acidic amino acid residue is at position N+3
- a first, second and third aromatic amino acid residue are at positions N+7, N+10 and N+11, respectively.
- a first acidic amino acid residue is at position N
- a second acidic amino acid residue is at position N+3
- a third acidic amino acid residue is at position N+4
- a first, second and third aromatic amino acid residue are at positions N+7, N+10 and N+11, respectively.
- a first acidic amino acid residue is at position N
- a second acidic amino acid residue is at position N+3
- a hydrophobic amino acid residue is at position N+6, and a first, second and third aromatic amino acid residue are at positions N+7, N+10 and N+11, respectively.
- a first acidic amino acid residue is at position N
- a second acidic amino acid residue is at position N+3
- a third acidic amino acid residue is at position N+4
- a hydrophobic amino acid residue is at position N+6, and a first, second and third aromatic amino acid residue are at positions N+7, N+10 and N+11, respectively.
- M is N+7.
- N is 1-7.
- N is 1, 2, 3, 4, or 5. In some embodiments, N is 1. In some embodiments, N is 2. In some embodiments, N is 3. In some embodiments, N is 4. In some embodiments, N is 5. In some embodiments, M is 8-16. In some embodiments, M is 8. In some embodiments, M is 9. In some embodiments, M is 10. In some embodiments, M is 11. In some embodiments, M is 12. In some embodiments, M is 13. In some embodiments, a peptide motif is an alpha-helical motif wherein each amino acid residue is independently an alpha amino acid residue. In some embodiments, a peptide motif is stapled.
- a peptide motif is or comprises an agent described in a Table herein (e.g., I-xxxx wherein xxxx is a number (e.g., I-1, I-10, I-100, I-1000, etc.)).
- a first acidic group is of X 2 as described herein
- a second acidic group is of X 5 as described herein
- a third acidic group (if present) is of X 6 as described herein
- a hydrophobic group (if present) is of X 8 as described herein
- a first aromatic group is of X 9 as described herein
- a second aromatic group is of X 12 as described herein
- a third aromatic group is of X 13 as described herein.
- a provided agent is a stapled peptide comprising one or more staples.
- a provided agent is a stapled peptide comprising two or more staples.
- a provided agent is a stapled peptide comprising three or more staples.
- a first acidic group when contacted with a beta-catenin polypeptide, a first acidic group interacts with Lys312 and/or Gly307 or amino acid residues corresponding thereto, a second acidic group interacts with Asn387, Trp383 and/or Arg386 or amino acid residues corresponding thereto, a first aromatic group interacts with Lys345 and/or Trp383 or amino acid residues corresponding thereto, a second aromatic group interacts with Trp383 and/or Asn415 or amino acid residues corresponding thereto, and a third aromatic group interacts with Gln379, Leu383, Val416, Asn415 and/or Trp383 or amino acid residues corresponding thereto.
- a third acidic group interacts with Asn387, Trp383 and/or Arg386 or amino acid residues corresponding thereto.
- a hydrophobic group interacts with Trp383 or an amino acid residue corresponding thereto.
- the present disclosure provides an agent which is or comprises a peptide comprising: [X 0 ] p0 X 1 X 2 X 3 X 4 X 5 X 6 X 7 X 8 X 9 X 10 X 11 X 12 X 13 X 14 [X 15 ] p15 [X 16 ] p16 [X 17 ] p17 , wherein: each of p0, p15, p16 and p17 is independently 0 or 1; each of X 0 , X 1 , X 2 , X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , X 9 , X 10 , X 11 , X 12 , X 13 , X 14 , X 15 , X 16 , and X 17 is independently an amino acid residue.
- the present disclosure provides an agent which is or comprises a peptide comprising: [X] p X 1 X 2 X 3 X 4 X 5 X 6 X 7 X 8 X 9 X 10 X 11 X 12 X 13 X 14 [X 15 ] p15 [X 16 ] p16 [X 17 ] p17 [X] p’ , wherein: each of p15, p16 and p17 is independently 0 or 1; each of p and p’ is independently 0-10; each of X, X 1 , X 2 , X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , X 9 , X 10 , X 11 , X 12 , X 13 , X 14 , X 15 , X 16 , and X 17 is independently an amino acid residue.
- an agent is R N ⁇ [X]pX 1 X 2 X 3 X 4 X 5 X 6 X 7 X 8 X 9 X 10 X 11 X 12 X 13 [X 14 ] p14 [X 15 ] p15 [X 16 ] p16 [X 17 ] p17 [X]p’ ⁇ R C , wherein each variable is independently as described herein.
- an agent is or comprises X 1 X 2 X 3 X 4 X 5 X 6 X 7 X 8 X 9 X 10 X 11 X 12 X 13 [X 14 ] p14 [X 15 ] p15 [X 16 ] p16 [X 17 ] p17 [X 18 ] p18 [X 19 ] p19 [X 20 ] p20 [X 21 ] p21 [X 22 ] p22 [X 23 ] p 23 , wherein each of p14, p15, p16, p17, p18, p19, p20, p21, p22, and p23 is independently 0 or 1, and each of X 1 , X 2 , X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , X 9 , X 10 , X 11 , X 12 , X 13 , X
- such a peptide comprises three or more staples. In some embodiments, such a peptide comprises five or more residues suitable for stapling. [0022] In some embodiments, the present disclosure provides an agent, wherein the agent is or comprises a peptide comprising: [X 0 ] p0 X 1 X 2 X 3 X 4 X 5 X 6 X 7 X 8 X 9 X 10 X 11 X 12 X 13 X 14 [X 15 ] p15 [X 16 ] p16 [X 17 ] p17 , wherein: each of p0, p15, p16 and p17 is independently 0 or 1; each of X 0 , X 1 , X 2 , X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , X 9 , X 10 , X 11 , X 12 , X 13 ,
- the present disclosure provides an agent, wherein the agent is or comprises a peptide comprising: [X 0 ] p0 X 1 X 2 X 3 X 4 X 5 X 6 X 7 X 8 X 9 X 10 X 11 X 12 X 13 X 14 [X 15 ] p15 [X 16 ] p16 [X 17 ] p17 , wherein: each of p0, p15, p16 and p17 is independently 0 or 1; each of X 0 , X 1 , X 2 , X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , X 9 , X 10 , X 11 , X 12 , X 13 , X 14 , X 15 , X 16 , and X 17 is independently an amino acid residue, wherein: X 2 comprises a side chain comprising an acidic or a polar
- an agent is or comprises a peptide. In some embodiments, an agent is or comprises a stapled peptide. In some embodiments, an agent is a peptide. In some embodiments, an agent is a stapled peptide. In some embodiments, an agent, a peptide, or a stapled peptide has the structure of [X 0 ] p0 X 1 X 2 X 3 X 4 X 5 X 6 X 7 X 8 X 9 X 10 X 11 X 12 X 13 X 14 [X 15 ] p15 [X 16 ] p16 [X 17 ] p17 .
- X 1 and X 4 , and/or X 4 and X 11 are independently amino acid residues suitable for stapling, or are stapled, or X 3 and X 10 independently amino acid residues suitable for stapling, or are stapled.
- X 1 and X 4 are independently amino acid residues suitable for stapling.
- X 1 and X 4 are stapled.
- X 4 and X 11 are independently amino acid residues suitable for stapling.
- X 4 and X 11 are stapled.
- X 1 and X 4 , and X 4 and X 11 are independently amino acid residues suitable for stapling.
- a stapled peptide is a stitched peptide comprising two or more staples, some of which may bond to the same backbone atom.
- X 1 and X 4 are stapled, and X 4 and X 11 are stapled.
- a staple connecting X 1 and X 4 and a staple connecting X 4 and X 11 are bonded to a common backbone atom of X 4 .
- a common backbone atom is the alpha-carbon of X 4 .
- X 3 and X 10 are independently amino acid residues suitable for stapling. In some embodiments, X 3 and X 10 are stapled.
- X 1 and X 3 are independently amino acid residues suitable for stapling. In some embodiments, X 1 and X 3 are stapled. In some embodiments, X 10 and X 14 are independently amino acid residues suitable for stapling. In some embodiments, X 10 and X 14 are stapled. In some embodiments, X 7 and X 10 are independently amino acid residues suitable for stapling. In some embodiments, X 7 and X 10 are stapled. In some embodiments, X 7 and X 14 are independently amino acid residues suitable for stapling. In some embodiments, X 7 and X 14 are stapled. In some embodiments, X 3 and X 7 are independently amino acid residues suitable for stapling.
- X 3 and X 7 are stapled.
- the present disclosure provides agents that bind to a polypeptide comprising or consisting of residues 305-419 of SEQ ID NO: 1 as described herein.
- an agent e.g., a peptide
- the present disclosure provides various technologies, e.g., reagents methods, etc., for preparing, characterizing, assessing and using provided agents and compositions thereof. In some embodiments, the present disclosure provides, e.g., methods, reagents and/or systems for identifying, characterizing and/or assessing provided agents and use thereof (e.g., as therapeutic or diagnostic agents). [0027] In some embodiments, the present disclosure provides pharmaceutical compositions comprising or delivering a provided agent and a pharmaceutical acceptable carrier. In some embodiments, a provided agent is a pharmaceutically acceptable salt form.
- a provided composition comprises a pharmaceutically acceptable salt form an agent.
- agents are provided as pharmaceutically acceptable salt forms.
- the present disclosure provides methods for modulating a property, activity and/or function of beta-catenin, comprising contacting beta-catenin with a provided agent.
- the present disclosure provides methods for modulating a property, activity and/or function of beta-catenin in a system comprising beta-catenin, comprising administering to a system an effective amount of a provided agent.
- the present disclosure provides methods for modulating a property, activity and/or function of beta-catenin in a system expressing beta-catenin, comprising administering or delivering to a system an effective amount of a provided agent.
- an activity of beta-catenin is inhibited or reduced.
- a function of beta-catenin is inhibited or reduced.
- a property, activity and/or function is associated with beta-catenin/TCF interaction.
- the present disclosure provides methods for modulating beta-catenin/TCF interaction.
- the present disclosure provides methods for modulating beta-catenin/TCF interaction, comprising contacting beta-catenin with a provided agent. In some embodiments, the present disclosure provides methods for modulating beta-catenin/TCF interaction in a system comprising beta-catenin and TCF, comprising administering or delivering to the system an effective amount a provided agent. In some embodiments, the present disclosure provides methods for modulating beta-catenin/TCF interaction in a system expressing beta-catenin and TCF, comprising administering or delivering to the system an effective amount a provided agent. In some embodiments, interactions between beta-catenin and TCF is reduced. In some embodiments, interactions between beta-catenin and TCF is inhibited.
- the present disclosure provides methods for inhibiting cell proliferation, comprising administering or delivering to a population of cells an effective amount of a provided agent. In some embodiments, the present disclosure provides methods for inhibiting cell proliferation in a system, comprising administering or delivering to the system an effective amount of a provided agent. In some embodiments, the present disclosure provides methods for inhibiting cell growth, comprising administering or delivering to a population of cells an effective amount of a provided agent. In some embodiments, the present disclosure provides methods for inhibiting cell growth in a system, comprising administering or delivering to the system an effective amount of a provided agent. In some embodiments, such cell proliferation is beta-catenin dependent. In some embodiments, such cell growth is beta-catenin dependent.
- a system is in vitro. In some embodiments, a system is ex vivo. In some embodiments, a system is in vivo. In some embodiments, a system is or comprise a cell. In some embodiments, a system is or comprises a tissue. In some embodiments, a system is or comprises an organ.
- a system is or comprises an organism. In some embodiments, a system is an animal. In some embodiments, a system is human. In some embodiments, a system is or comprises cells, tissues or organs associated with a condition, disorder or disease. In some embodiments, a system is or comprises cancer cells. [0033] In some embodiments, the present disclosure provides methods for preventing conditions, disorders or diseases. In some embodiments, the present disclosure provides methods for reducing risks of conditions, disorders or diseases. In some embodiments, the present disclosure provides methods for preventing a condition, disorder or disease, comprising administering or delivering to a subject susceptible thereto an effective amount of an agent of the present disclosure.
- the present disclosure provides methods for reducing risk of a condition, disorder or disease, comprising administering or delivering to a subject susceptible thereto an effective amount of an agent of the present disclosure. In some embodiments, the present disclosure provides methods for reducing risks of a condition, disorder or disease in a population, comprising administering or delivering to a population of subjects susceptible thereto an effective amount of an agent of the present disclosure. In some embodiments, the present disclosure provides methods for treating conditions, disorders or diseases. In some embodiments, the present disclosure provides methods for treating a condition, disorder or disease, comprising administering or delivering to a subject suffering therefrom an effective amount of an agent of the present disclosure. In some embodiments, a symptom is reduced, removed or prevented.
- a condition, disorder or disease is cancer.
- a condition, disorder or disease is associated with beta-catenin.
- a condition, disorder or disease is associated with beta-catenin interaction with TCF.
- a condition, disorder or disease is bladder cancer.
- a condition, disorder or disease is endometrial cancer.
- a condition, disorder or disease is adrenocortical carcinoma.
- a condition, disorder or disease is gastric cancer. In some embodiments, a condition, disorder or disease is lung cancer. In some embodiments, a condition, disorder or disease is melanoma. In some embodiments, a condition, disorder or disease is esophageal cancer. In some embodiments, a condition, disorder or disease is colorectal cancer. In some embodiments, a cancer is liver cancer. In some embodiments, a cancer is prostate cancer. In some embodiments, a cancer is breast cancer. In some embodiments, a cancer is endometrial cancer. Mutations that lead to constitutive activation of Wnt/beta-catenin-mediated signaling are reported to be present in approximately 20% of all human cancers.
- a condition, disorder or disease is associated with WNT signaling. In some embodiments, a condition, disorder or disease is associated with beta-catenin dependent WNT signaling. In some embodiments, a condition, disorder or disease is associated with beta-catenin/TCF interaction. In some embodiments, it has been reported that beta-catenin/TCFs interactions may promote cell proliferation, epithelial-mesenchymal transition (EMT), a cancer stem cell phenotype, etc.
- EMT epithelial-mesenchymal transition
- agents are administered as pharmaceutically compositions that comprise or deliver such agents. In some embodiments, agents are provided and/or delivered in pharmaceutically acceptable salt forms.
- an agent in a composition (e.g., a liquid composition of certain pH) an agent may exist in various forms including various pharmaceutically acceptable salt forms.
- a provided agent is utilized in combination with a second therapy.
- a provided agent is utilized in combination with a second therapeutic agent.
- a second therapy or therapeutic agent is administered prior to an administration or delivery of a provided agent.
- a second therapy or therapeutic agent is administered at about the same time as an administration or delivery of a provided agent.
- a second therapy or therapeutic agent is administered subsequently to an administration or delivery of a provided agent.
- a subject is exposed to both a provided agent and a second therapeutic agent.
- a subject is exposed to a therapeutic effect of a provided agent and a therapeutic effect of a second therapeutic agent.
- a second therapy is or comprises surgery.
- a second therapy is or comprises radiation therapy.
- a second therapy is or comprises immunotherapy.
- a second therapeutic agent is or comprises a drug.
- a second therapeutic agent is or comprises a cancer drug.
- a second therapeutic agent is or comprises a chemotherapeutic agent.
- a second therapeutic agent is or comprises a hormone therapy agent.
- a second therapeutic agent is or comprises a kinase inhibitor.
- a second therapeutic agent is or comprises a checkpoint inhibitor (e.g., antibodies against PD-1, PD-L1, CTLA-4, etc.).
- a provide agent can be administered with lower unit dose and/or total dose compared to being used alone.
- a second agent can be administered with lower unit dose and/or total dose compared to being used alone.
- one or more side effects associated with administration of a provided agent and/or a second therapy or therapeutic agent are reduced.
- a combination therapy provides improved results, e.g., when compared to each agent utilized individually.
- a combination therapy achieves one or more better results, e.g., when compared to each agent utilized individually.
- FIG. 1 BRIEF DESCRIPTION OF THE DRAWING [0037] Figure 1. Provided technologies can inhibit beta-catenin driven gene transcription selectively in cells expressing beta-catenin. Stapled peptides inhibited endogenous gene expression in wild HAP1 isogenic cell but not in CTNNB1 knockout (KO) cells.
- A beta-catenin levels.
- CHIR CHIR99021, which can activate beta-catenin pathway and increase AXIN2 and SP5 expression.
- B SP5 expression (24h).
- FIG. 1 For each group, from left to right, DMSO (“0” and “0”), Peptide A (1 and 5 uM), I-66 (1 and 5 uM) and I-470 (1 and 5 uM). Expression assessed after 24 hour treatment.
- Figure 2. Provided technologies can reduce nuclear beta-catenin levels. Results for total beta- catenin in nuclear fraction (24 h) are shown as examples.
- Figure 3. Provided technologies can inhibit cell proliferation, modulate transcription and/or induce cell cycle arrest.
- A Provided technologies can reduce cell proliferation.
- FIG. 1 Provided technologies can reduce cell proliferation.
- FIG. 1 Provided technologies can reduce cell proliferation.
- FIG. 1 For each group, from left to right, DMSO (“0” and “0”), Peptide A (1 and 5 uM), I-66 (1 and 5 uM) and I-470 (1 and 5 uM). Expression assessed after 24 hour treatment.
- Figure 3. Provided technologies can reduce nuclear beta-catenin levels. Results for total beta- catenin in nuclear fraction (24
- FIG. 4 Provided technologies can provide robust, dose-dependent anti-tumor effects in vivo. Both dose levels assessed provided robust reduction of tumor sizes, and the higher dose levels provided greater reductions. COLO320DM cells (colon cancer, mutations: APC, TP53) were utilized for the presented data. Top line is for vehicle treatment, the middle line is for I-66, 30 mg/kg, Q4D, and the bottom line is for I-66, 75 mg/kg, Q4D. [0041] Figure 5. Provided technologies can provide sustained tumor exposure, suitable pharmacokinetic profiles and broad tissue distribution.
- Administration typically refers to the administration of a composition to a subject or system.
- routes may, in appropriate circumstances, be utilized for administration to a subject, for example a human.
- administration may be ocular, oral, parenteral, topical, etc.
- administration may be bronchial (e.g., by bronchial instillation), buccal, dermal (which may be or comprise, for example, one or more of topical to the dermis, intradermal, interdermal, transdermal, etc), enteral, intra-arterial, intradermal, intragastric, intramedullary, intramuscular, intranasal, intraperitoneal, intrathecal, intravenous, intraventricular, within a specific organ (e. g., intrahepatic), mucosal, nasal, oral, rectal, subcutaneous, sublingual, topical, tracheal (e.g., by intratracheal instillation), vaginal, vitreal, etc.
- bronchial e.g., by bronchial instillation
- buccal which may be or comprise, for example, one or more of topical to the dermis, intradermal, interdermal, transdermal, etc
- enteral intra-arterial, intradermal, intragastric
- administration may involve dosing that is intermittent (e.g., a plurality of doses separated in time) and/or periodic (e.g., individual doses separated by a common period of time) dosing. In some embodiments, administration may involve continuous dosing (e.g., perfusion) for at least a selected period of time.
- Affinity is a measure of the tightness with a particular ligand (e.g., an agent) binds to its partner (e.g., beta-catenin or a portion thereof). Affinities can be measured in different ways. In some embodiments, affinity is measured by a quantitative assay.
- binding partner concentration may be fixed to be in excess of ligand concentration so as to mimic physiological conditions.
- binding partner concentration and/or ligand concentration may be varied.
- affinity may be compared to a reference under comparable conditions (e.g., concentrations).
- the term may be utilized to refer to an entity that is or comprises a cell or organism, or a fraction, extract, or component thereof.
- the term may be used to refer to a natural product in that it is found in and/or is obtained from nature.
- the term may be used to refer to one or more entities that is man-made in that it is designed, engineered, and/or produced through action of the hand of man and/or is not found in nature.
- an agent may be utilized in isolated or pure form; in some embodiments, an agent may be utilized in crude form.
- potential agents may be provided as collections or libraries, for example that may be screened to identify or characterize active agents within them.
- the term “agent” may refer to a compound or entity that is or comprises a polymer; in some cases, the term may refer to a compound or entity that comprises one or more polymeric moieties.
- the term “agent” may refer to a compound or entity that is not a polymer and/or is substantially free of any polymer and/or of one or more particular polymeric moieties.
- the term may refer to a compound or entity that lacks or is substantially free of any polymeric moiety.
- an agent is a compound.
- an agent is a stapled peptide.
- Aliphatic means a straight-chain (i.e., unbranched) or branched, substituted or unsubstituted hydrocarbon chain that is completely saturated or that contains one or more units of unsaturation, or a substituted or unsubstituted monocyclic, bicyclic, or polycyclic hydrocarbon ring that is completely saturated or that contains one or more units of unsaturation (but not aromatic), or combinations thereof.
- aliphatic groups contain 1-50 aliphatic carbon atoms. In some embodiments, aliphatic groups contain 1-20 aliphatic carbon atoms. In other embodiments, aliphatic groups contain 1-10 aliphatic carbon atoms.
- aliphatic groups contain 1-9 aliphatic carbon atoms. In other embodiments, aliphatic groups contain 1-8 aliphatic carbon atoms. In other embodiments, aliphatic groups contain 1-7 aliphatic carbon atoms. In other embodiments, aliphatic groups contain 1-6 aliphatic carbon atoms. In still other embodiments, aliphatic groups contain 1-5 aliphatic carbon atoms, and in yet other embodiments, aliphatic groups contain 1, 2, 3, or 4 aliphatic carbon atoms.
- Suitable aliphatic groups include, but are not limited to, linear or branched, substituted or unsubstituted alkyl, alkenyl, alkynyl groups and hybrids thereof such as (cycloalkyl)alkyl, (cycloalkenyl)alkyl or (cycloalkyl)alkenyl.
- Alkenyl As used herein, the term “alkenyl” refers to an aliphatic group, as defined herein, having one or more double bonds.
- Alkyl As used herein, the term “alkyl” is given its ordinary meaning in the art and may include saturated aliphatic groups, including straight-chain alkyl groups, branched-chain alkyl groups, cycloalkyl (alicyclic) groups, alkyl substituted cycloalkyl groups, and cycloalkyl substituted alkyl groups. In some embodiments, alkyl has 1-100 carbon atoms. In certain embodiments, a straight chain or branched chain alkyl has about 1-20 carbon atoms in its backbone (e.g., C 1 -C 20 for straight chain, C 2 -C 20 for branched chain), and alternatively, about 1-10.
- cycloalkyl rings have from about 3-10 carbon atoms in their ring structure where such rings are monocyclic, bicyclic, or polycyclic, and alternatively about 5, 6 or 7 carbons in the ring structure.
- an alkyl group may be a lower alkyl group, wherein a lower alkyl group comprises 1-4 carbon atoms (e.g., C 1 -C 4 for straight chain lower alkyls).
- Amino acid In its broadest sense, as used herein, refers to any compound and/or substance that can be incorporated into a polypeptide chain, e.g., through formation of one or more peptide bonds.
- an amino acid comprising an amino group and an a carboxylic acid group.
- an amino acid has the structure of NH(R a1 ) ⁇ L a1 ⁇ C(R a2 )(R a3 ) ⁇ L a2 ⁇ COOH, wherein each variable is independently as described in the present disclosure.
- an amino acid has the general structure NH(R’)–C(R’) 2 –COOH, wherein each R’ is independently as described in the present disclosure.
- an amino acid has the general structure H 2 N–C(R’) 2 –COOH, wherein R’ is as described in the present disclosure.
- an amino acid has the general structure H 2 N– C(H)(R’)–COOH, wherein R’ is as described in the present disclosure.
- an amino acid is a naturally-occurring amino acid.
- an amino acid is a non-natural amino acid; in some embodiments, an amino acid is a D-amino acid; in some embodiments, an amino acid is an L-amino acid.
- Standard amino acid refers to any of the twenty standard L-amino acids commonly found in naturally occurring peptides.
- Nonstandard amino acid refers to any amino acid, other than the standard amino acids, regardless of whether it is prepared synthetically or obtained from a natural source.
- an amino acid including a carboxy- and/or amino-terminal amino acid in a polypeptide, can contain a structural modification as compared with the general structure above.
- an amino acid may be modified by methylation, amidation, acetylation, pegylation, glycosylation, phosphorylation, and/or substitution (e.g., of the amino group, the carboxylic acid group, one or more protons, one or more hydrogens, and/or the hydroxyl group) as compared with the general structure.
- such modification may, for example, alter the circulating half-life of a polypeptide containing the modified amino acid as compared with one containing an otherwise identical unmodified amino acid.
- such modification does not significantly alter a relevant activity of a polypeptide containing the modified amino acid, as compared with one containing an otherwise identical unmodified amino acid.
- amino acid may be used to refer to a free amino acid; in some embodiments it may be used to refer to an amino acid residue of a polypeptide.
- Analog refers to a substance that shares one or more particular structural features, elements, components, or moieties with a reference substance. Typically, an “analog” shows significant structural similarity with the reference substance, for example sharing a core or consensus structure, but also differs in certain discrete ways.
- an analog is a substance that can be generated from the reference substance, e.g., by chemical manipulation of the reference substance. In some embodiments, an analog is a substance that can be generated through performance of a synthetic process substantially similar to (e.g., sharing a plurality of steps with) one that generates the reference substance. In some embodiments, an analog is or can be generated through performance of a synthetic process different from that used to generate the reference substance.
- Animal As used herein refers to any member of the animal kingdom. In some embodiments, “animal” refers to humans, of either sex and at any stage of development. In some embodiments, “animal” refers to non-human animals, at any stage of development.
- the non-human animal is a mammal (e.g., a rodent, a mouse, a rat, a rabbit, a monkey, a dog, a cat, a sheep, cattle, a primate, and/or a pig).
- animals include, but are not limited to, mammals, birds, reptiles, amphibians, fish, insects, and/or worms.
- an animal may be a transgenic animal, genetically engineered animal, and/or a clone.
- the term “approximately” or “about” refers to a range of values that fall within 25%, 20%, 19%, 18%, 17%, 16%, 15%, 14%, 13%, 12%, 11%, 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, 1%, or less in either direction (greater than or less than) of the stated reference value unless otherwise stated or otherwise evident from the context (except where such number would exceed 100% of a possible value).
- Aryl The term “aryl” used alone or as part of a larger moiety as in “aralkyl,” “aralkoxy,” “aryloxyalkyl,” etc.
- an aryl group is a monocyclic, bicyclic or polycyclic ring system having a total of five to fourteen ring members, wherein at least one ring in the system is aromatic, and wherein each ring in the system contains 3 to 7 ring members.
- an aryl group is a biaryl group.
- aryl may be used interchangeably with the term “aryl ring.”
- aryl refers to an aromatic ring system which includes, but not limited to, phenyl, biphenyl, naphthyl, binaphthyl, anthracyl and the like, which may bear one or more substituents.
- aryl is a group in which an aromatic ring is fused to one or more non–aromatic rings, such as indanyl, phthalimidyl, naphthimidyl, phenanthridinyl, or tetrahydronaphthyl, and the like, where a radical or point of attachment is on an aryl ring.
- two events or entities are “associated” with one another, as that term is used herein, if the presence, level and/or form of one is correlated with that of the other.
- a particular entity e.g., nucleic acid (e.g., genomic DNA, transcripts, mRNA, etc.), polypeptide, genetic signature, metabolite, microbe, etc..
- a particular entity e.g., nucleic acid (e.g., genomic DNA, transcripts, mRNA, etc.), polypeptide, genetic signature, metabolite, microbe, etc..
- binding typically refers to a non- covalent association between or among agents. In many embodiments herein, binding is addressed with respect to particular agents and beta-catenin.
- binding is assessed with respect to beta-catenin. In some embodiments, binding is assessed with respect to one or more amino acid residues of beta-catenin. In some embodiments, binding is assessed with respect to one or more amino acid residues corresponding to (e.g., similarly positioned in three dimensional space and/or having certain similar properties and/or functions) those of beta-catenin.
- binding site refers to a region of a target polypeptide, formed in three-dimensional space, that includes one or more or all interaction residues of the target polypeptide.
- binding site may refer to one or more amino acid residues which comprise or are one or more or all interaction amino acid residues of a target polypeptide.
- a binding site may include residues that are adjacent to one another on a linear chain, and/or that are distal to one another on a linear chain but near to one another in three-dimensional space when a target polypeptide is folded.
- a binding site may comprise amino acid residues and/or saccharide residues.
- carriers can include sterile liquids, such as, for example, water and oils, including oils of petroleum, animal, vegetable or synthetic origin, such as, for example, peanut oil, soybean oil, mineral oil, sesame oil and the like.
- carriers are or include one or more solid components.
- Comparable refers to two or more agents, entities, situations, sets of conditions, etc., that may not be identical to one another but that are sufficiently similar to permit comparison there between so that one skilled in the art will appreciate that conclusions may reasonably be drawn based on differences or similarities observed.
- comparable sets of conditions, circumstances, individuals, or populations are characterized by a plurality of substantially identical features and one or a small number of varied features.
- Those of ordinary skill in the art will understand, in context, what degree of identity is required in any given circumstance for two or more such agents, entities, situations, sets of conditions, etc. to be considered comparable.
- sets of circumstances, individuals, or populations are comparable to one another when characterized by a sufficient number and type of substantially identical features to warrant a reasonable conclusion that differences in results obtained or phenomena observed under or with different sets of circumstances, individuals, or populations are caused by or indicative of the variation in those features that are varied.
- composition may be used to refer to a discrete physical entity that comprises one or more specified components. In general, unless otherwise specified, a composition may be of any form – e.g., gas, gel, liquid, solid, etc.
- Cycloaliphatic refers to saturated or partially unsaturated aliphatic monocyclic, bicyclic, or polycyclic ring systems having, e.g., from 3 to 30, members, wherein the aliphatic ring system is optionally substituted.
- Cycloaliphatic groups include, without limitation, cyclopropyl, cyclobutyl, cyclopentyl, cyclopentenyl, cyclohexyl, cyclohexenyl, cycloheptyl, cycloheptenyl, cyclooctyl, cyclooctenyl, norbornyl, adamantyl, and cyclooctadienyl.
- the cycloalkyl has 3–6 carbons.
- cycloaliphatic may also include aliphatic rings that are fused to one or more aromatic or nonaromatic rings, such as decahydronaphthyl or tetrahydronaphthyl, where a radical or point of attachment is on an aliphatic ring.
- a carbocyclic group is bicyclic.
- a carbocyclic group is tricyclic.
- a carbocyclic group is polycyclic.
- cycloaliphatic refers to a monocyclic C 3 -C 10 , or C 3 - C 6 hydrocarbon, or a C 4 -C 10 , or C 8 -C 10 bicyclic hydrocarbon that is completely saturated or that contains one or more units of unsaturation, but which is not aromatic, or a C 9 -C 16 tricyclic hydrocarbon that is completely saturated or that contains one or more units of unsaturation, but which is not aromatic.
- Derivative As used herein, the term “derivative” refers to a structural analogue of a reference substance.
- a “derivative” is a substance that shows significant structural similarity with the reference substance, for example sharing a core or consensus structure, but also differs in certain discrete ways.
- a derivative is a substance that can be generated from the reference substance by chemical manipulation.
- a derivative is a substance that can be generated through performance of a synthetic process substantially similar to (e.g., sharing a plurality of steps with) one that generates the reference substance.
- Dosage form or unit dosage form may be used to refer to a physically discrete unit of an active agent (e.g., a therapeutic or diagnostic agent) for administration to a subject.
- each such unit contains a predetermined quantity of active agent.
- such quantity is a unit dosage amount (or a whole fraction thereof) appropriate for administration in accordance with a dosing regimen that has been determined to correlate with a desired or beneficial outcome when administered to a relevant population (i.e., with a therapeutic dosing regimen).
- a dosing regimen that has been determined to correlate with a desired or beneficial outcome when administered to a relevant population (i.e., with a therapeutic dosing regimen).
- the total amount of a therapeutic composition or agent administered to a particular subject is determined by one or more attending physicians and may involve administration of multiple dosage forms.
- Dosing regimen may be used to refer to a set of unit doses (typically more than one) that are administered individually to a subject, typically separated by periods of time.
- a given therapeutic agent has a recommended dosing regimen, which may involve one or more doses.
- a dosing regimen comprises a plurality of doses each of which is separated in time from other doses.
- individual doses are separated from one another by a time period of the same length; in some embodiments, a dosing regimen comprises a plurality of doses and at least two different time periods separating individual doses.
- all doses within a dosing regimen are of the same unit dose amount. In some embodiments, different doses within a dosing regimen are of different amounts.
- a dosing regimen comprises a first dose in a first dose amount, followed by one or more additional doses in a second dose amount different from the first dose amount. In some embodiments, a dosing regimen comprises a first dose in a first dose amount, followed by one or more additional doses in a second dose amount same as the first dose amount. In some embodiments, a dosing regimen is correlated with a desired or beneficial outcome when administered across a relevant population (i.e., is a therapeutic dosing regimen). [0067] Engineered: In general, the term “engineered” refers to the aspect of having been manipulated by the hand of man.
- a peptide may be considered to be engineered if its amino acid sequence has been selected by man.
- an engineered agent has an amino acid sequence that was selected based on preferences for corresponding amino acids at particular sites of protein- protein interactions.
- an engineered sequence has an amino acid sequence that differs from the amino acid sequence of polypeptides included in the NCBI database that binds to a TCF site of beta- catenin.
- provided agents are engineered agents.
- engineered agents are peptide agents comprising non-natural amino acid residues, non-natural amino acid sequences, and/or peptide staples.
- provided agents comprise or are engineered peptide agents which comprise engineered sequences.
- Halogen means F, Cl, Br, or I.
- Heteroaliphatic The term “heteroaliphatic” is given its ordinary meaning in the art and refers to aliphatic groups as described herein in which one or more carbon atoms are replaced with one or more heteroatoms (e.g., oxygen, nitrogen, sulfur, silicon, phosphorus, and the like).
- Heteroalkyl The term “heteroalkyl” is given its ordinary meaning in the art and refers to alkyl groups as described herein in which one or more carbon atoms is replaced with a heteroatom (e.g., oxygen, nitrogen, sulfur, silicon, phosphorus, and the like).
- heteroalkyl groups include, but are not limited to, alkoxy, poly(ethylene glycol)-, alkyl-substituted amino, tetrahydrofuranyl, piperidinyl, morpholinyl, etc.
- Heteroaryl The terms “heteroaryl” and “heteroar—,” used alone or as part of a larger moiety, e.g., “heteroaralkyl,” or “heteroaralkoxy,” refer to monocyclic, bicyclic or polycyclic ring systems having, for example, a total of five to thirty, e.g., 5, 6, 9, 10, 14, etc., ring members, wherein at least one ring in the system is aromatic and at least one aromatic ring atom is a heteroatom.
- a heteroatom is nitrogen, oxygen or sulfur.
- a heteroaryl group is a group having 5 to 10 ring atoms (i.e., monocyclic, bicyclic or polycyclic), in some embodiments 5, 6, 9, or 10 ring atoms.
- a heteroaryl group has 6, 10, or 14 ⁇ electrons shared in a cyclic array; and having, in addition to carbon atoms, from one to five heteroatoms.
- Heteroaryl groups include, without limitation, thienyl, furanyl, pyrrolyl, imidazolyl, pyrazolyl, triazolyl, tetrazolyl, oxazolyl, isoxazolyl, oxadiazolyl, thiazolyl, isothiazolyl, thiadiazolyl, pyridyl, pyridazinyl, pyrimidinyl, pyrazinyl, indolizinyl, purinyl, naphthyridinyl, and pteridinyl.
- a heteroaryl is a heterobiaryl group, such as bipyridyl and the like.
- heteroaryl and “heteroar—”, as used herein, also include groups in which a heteroaromatic ring is fused to one or more aryl, cycloaliphatic, or heterocyclyl rings, where a radical or point of attachment is on a heteroaromatic ring.
- Non-limiting examples include indolyl, isoindolyl, benzothienyl, benzofuranyl, dibenzofuranyl, indazolyl, benzimidazolyl, benzthiazolyl, quinolyl, isoquinolyl, cinnolinyl, phthalazinyl, quinazolinyl, quinoxalinyl, 4H–quinolizinyl, carbazolyl, acridinyl, phenazinyl, phenothiazinyl, phenoxazinyl, tetrahydroquinolinyl, tetrahydroisoquinolinyl, and pyrido[2,3–b]–1,4–oxazin–3(4H)–one.
- heteroaryl group may be monocyclic, bicyclic or polycyclic.
- heteroaryl may be used interchangeably with the terms “heteroaryl ring,” “heteroaryl group,” or “heteroaromatic,” any of which terms include rings that are optionally substituted.
- heteroarylkyl refers to an alkyl group substituted by a heteroaryl group, wherein the alkyl and heteroaryl portions independently are optionally substituted.
- Heteroatom means an atom that is not carbon and is not hydrogen.
- a heteroatom is oxygen, sulfur, nitrogen, phosphorus, boron or silicon (including any oxidized form of nitrogen, sulfur, phosphorus, or silicon; the quaternized form of any basic nitrogen or a substitutable nitrogen of a heterocyclic ring (for example, N as in 3,4-dihydro-2H-pyrrolyl), NH (as in pyrrolidinyl) or NR + (as in N-substituted pyrrolidinyl); etc.).
- a heteroatom is boron, nitrogen, oxygen, silicon, sulfur, or phosphorus.
- a heteroatom is nitrogen, oxygen, silicon, sulfur, or phosphorus.
- a heteroatom is nitrogen, oxygen, sulfur, or phosphorus. In some embodiments, a heteroatom is nitrogen, oxygen or sulfur.
- Heterocyclyl As used herein, the terms “heterocycle,” “heterocyclyl,” “heterocyclic radical,” and “heterocyclic ring” are used interchangeably and refer to a monocyclic, bicyclic or polycyclic ring moiety (e.g., 3-30 membered) that is saturated or partially unsaturated and has one or more heteroatom ring atoms. In some embodiments, a heteroatom is boron, nitrogen, oxygen, silicon, sulfur, or phosphorus.
- a heteroatom is nitrogen, oxygen, silicon, sulfur, or phosphorus. In some embodiments, a heteroatom is nitrogen, oxygen, sulfur, or phosphorus. In some embodiments, a heteroatom is nitrogen, oxygen or sulfur.
- a heterocyclyl group is a stable 5– to 7–membered monocyclic or 7– to 10–membered bicyclic heterocyclic moiety that is either saturated or partially unsaturated, and having, in addition to carbon atoms, one or more, preferably one to four, heteroatoms, as defined above. When used in reference to a ring atom of a heterocycle, the term "nitrogen" includes substituted nitrogen.
- the nitrogen may be N (as in 3,4–dihydro–2H–pyrrolyl), NH (as in pyrrolidinyl), or + NR (as in N–substituted pyrrolidinyl).
- a heterocyclic ring can be attached to its pendant group at any heteroatom or carbon atom that results in a stable structure and any of the ring atoms can be optionally substituted.
- saturated or partially unsaturated heterocyclic radicals include, without limitation, tetrahydrofuranyl, tetrahydrothienyl, pyrrolidinyl, piperidinyl, pyrrolinyl, tetrahydroquinolinyl, tetrahydroisoquinolinyl, decahydroquinolinyl, oxazolidinyl, piperazinyl, dioxanyl, dioxolanyl, diazepinyl, oxazepinyl, thiazepinyl, morpholinyl, and quinuclidinyl.
- heterocycle used interchangeably herein, and also include groups in which a heterocyclyl ring is fused to one or more aryl, heteroaryl, or cycloaliphatic rings, such as indolinyl, 3H–indolyl, chromanyl, phenanthridinyl, or tetrahydroquinolinyl, where a radical or point of attachment is on a heteroaliphatic ring.
- a heterocyclyl group may be monocyclic, bicyclic or polycyclic.
- heterocyclylalkyl refers to an alkyl group substituted by a heterocyclyl, wherein the alkyl and heterocyclyl portions independently are optionally substituted.
- homology refers to the overall relatedness between polymeric molecules, e.g., between nucleic acid molecules (e.g., DNA molecules and/or RNA molecules) and/or between polypeptide molecules.
- polymeric molecules are considered to be “homologous” to one another if their sequences are at least 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical.
- polymeric molecules are considered to be “homologous” to one another if their sequences are at least 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% similar (e.g., containing residues with related chemical properties at corresponding positions).
- certain amino acids are typically classified as similar to one another as “hydrophobic” or “hydrophilic” amino acids, and/or as having “polar” or “non-polar” side chains. Substitution of one amino acid for another of the same type may often be considered a “homologous” substitution.
- Calculation of the percent homology between two nucleic acid sequences can be performed by aligning the two sequences for optimal comparison purposes (e.g., gaps can be introduced in one or both of a first and a second nucleic acid sequences for optimal alignment and non- corresponding sequences can be disregarded for comparison purposes).
- the length of a sequence aligned for comparison purposes is at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, or substantially 100% of the length of the reference sequence.
- the nucleotides at corresponding nucleotide positions are then compared.
- the percent homology between the two sequences is a function of the number of identical and similar positions shared by the sequences, taking into account the number of gaps, and the length of each gap, which needs to be introduced for optimal alignment of the two sequences.
- Representative algorithms and computer programs useful in determining the percent homology between two nucleotide sequences include, for example, the algorithm of Meyers and Miller (CABIOS, 1989, 4: 11-17), which has been incorporated into the ALIGN program (version 2.0) using a PAM120 weight residue table, a gap length penalty of 12 and a gap penalty of 4.
- the percent homology between two nucleotide sequences can, alternatively, be determined for example using the GAP program in the GCG software package using an NWSgapdna.CMP matrix.
- Interaction residues refers to, with respect to an agent, residues or motifs in an agent that are designed to interact with particular target residues in a target polypeptide, or with respect to a target polypeptide, residues in a target polypeptide that interact with particular motifs (e.g., aromatic groups, amino acid residues, etc.) of an agent.
- interaction residues and motifs of various agents are selected and arranged within the agents so that they will be displayed in three dimensional space within a predetermined distance (or volume) of identified target residues (e.g., upon binding, docking or other interaction assays).
- interaction residues are direct-binding residues.
- an assessed value achieved in a subject or system of interest may be “improved” relative to that obtained in the same subject or system under different conditions (e.g., prior to or after an event such as administration of an agent of interest), or in a different, comparable subject (e.g., in a comparable subject or system that differs from the subject or system of interest in presence of one or more indicators of a particular disease, disorder or condition of interest, or in prior exposure to a condition or agent, etc).
- comparative terms refer to statistically relevant differences (e.g., that are of a prevalence and/or magnitude sufficient to achieve statistical relevance).
- Partially unsaturated refers to a moiety that includes at least one double or triple bond.
- the term “partially unsaturated” is intended to encompass groups having multiple sites of unsaturation, but is not intended to include aryl or heteroaryl moieties.
- Peptide The term “peptide” as used herein refers to a polypeptide.
- a peptide is a polypeptide that is relatively short, for example having a length of less than about 100 amino acids, less than about 50 amino acids, less than about 40 amino acids less than about 30 amino acids, less than about 25 amino acids, less than about 20 amino acids, less than about 15 amino acids, or less than 10 amino acids.
- a length is about 5-20, 5-19, 5-18, 5-17, 5-16, 5-15, 10-20, 10-19, 10-18, 10- 17, 10-16, 10-15, 11-20, 11-19, 11-18, 11-17, 11-16, 11-15, 12-20, 12-19, 12-18, 12-17, 12-16, 12-15, 13-20, 13-19, 13-18, 13-17, 13-16, 13-15, 14-20, 14-19, 14-18, 14-17, 14-16, 14-15, or about 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20 amino acids.
- pharmaceutical composition refers to an active agent, formulated together with one or more pharmaceutically acceptable carriers.
- active agent is present in unit dose amount appropriate for administration in a therapeutic regimen that shows a statistically significant probability of achieving a predetermined therapeutic effect when administered to a relevant population.
- pharmaceutical compositions may be specially formulated for administration in solid or liquid form, including those adapted for the following: oral administration, for example, drenches (aqueous or non-aqueous solutions or suspensions), tablets, e.g., those targeted for buccal, sublingual, and systemic absorption, boluses, powders, granules, pastes for application to the tongue; parenteral administration, for example, by subcutaneous, intramuscular, intravenous or epidural injection as, for example, a sterile solution or suspension, or sustained-release formulation; topical application, for example, as a cream, ointment, or a controlled-release patch or spray applied to the skin, lungs, or oral cavity; intravaginally or intrarectally, for example, as a pessary, cream, or foam; sublingual
- oral administration for example,
- compositions or vehicles which are, within the scope of sound medical judgment, suitable for use in contact with the tissues of human beings and animals without excessive toxicity, irritation, allergic response, or other problem or complication, commensurate with a reasonable benefit/risk ratio.
- pharmaceutically acceptable carrier means a pharmaceutically-acceptable material, composition or vehicle, such as a liquid or solid filler, diluent, excipient, or solvent encapsulating material, involved in carrying or transporting the subject compound from one organ, or portion of the body, to another organ, or portion of the body.
- Each carrier must be “acceptable” in the sense of being compatible with the other ingredients of the formulation and not injurious to the patient.
- materials which can serve as pharmaceutically-acceptable carriers include: sugars, such as lactose, glucose and sucrose; starches, such as corn starch and potato starch; cellulose, and its derivatives, such as sodium carboxymethyl cellulose, ethyl cellulose and cellulose acetate; powdered tragacanth; malt; gelatin; talc; excipients, such as cocoa butter and suppository waxes; oils, such as peanut oil, cottonseed oil, safflower oil, sesame oil, olive oil, corn oil and soybean oil; glycols, such as propylene glycol; polyols, such as glycerin, sorbitol, mannitol and polyethylene glycol; esters, such as ethyl oleate and ethyl laurate; agar; buffering agents, such as magnesium hydrox
- compositions that are appropriate for use in pharmaceutical contexts, i.e., salts which are, within the scope of sound medical judgment, suitable for use in contact with the tissues of humans and lower animals without undue toxicity, irritation, allergic response and the like, and are commensurate with a reasonable benefit/risk ratio.
- Pharmaceutically acceptable salts are well known. For example, S. M. Berge, et al. describes pharmaceutically acceptable salts in detail in J. Pharmaceutical Sciences, 66: 1-19 (1977).
- pharmaceutically acceptable salts include, but are not limited to, nontoxic acid addition salts, which are salts of an amino group formed with inorganic acids such as hydrochloric acid, hydrobromic acid, phosphoric acid, sulfuric acid and perchloric acid or with organic acids such as acetic acid, maleic acid, tartaric acid, citric acid, succinic acid or malonic acid or by using other known methods such as ion exchange.
- nontoxic acid addition salts which are salts of an amino group formed with inorganic acids such as hydrochloric acid, hydrobromic acid, phosphoric acid, sulfuric acid and perchloric acid or with organic acids such as acetic acid, maleic acid, tartaric acid, citric acid, succinic acid or malonic acid or by using other known methods such as ion exchange.
- pharmaceutically acceptable salts include, but are not limited to, adipate, alginate, ascorbate, aspartate, benzenesulfonate, benzoate, bisulfate, borate, butyrate, camphorate, camphorsulfonate, citrate, cyclopentanepropionate, digluconate, dodecylsulfate, ethanesulfonate, formate, fumarate, glucoheptonate, glycerophosphate, gluconate, hemisulfate, heptanoate, hexanoate, hydroiodide, 2-hydroxy- ethanesulfonate, lactobionate, lactate, laurate, lauryl sulfate, malate, maleate, malonate, methanesulfonate, 2- naphthalenesulfonate, nicotinate, nitrate, oleate, oxalate,
- pharmaceutically acceptable salts include, but are not limited to, nontoxic base addition salts, such as those formed by acidic groups of provided compounds with bases.
- Representative alkali or alkaline earth metal salts include salts of sodium, lithium, potassium, calcium, magnesium, and the like.
- pharmaceutically acceptable salts are ammonium salts (e.g., ⁇ N(R) 3 + ).
- pharmaceutically acceptable salts are sodium salts.
- pharmaceutically acceptable salts include, when appropriate, nontoxic ammonium, quaternary ammonium, and amine cations formed using counterions such as halide, hydroxide, carboxylate, sulfate, phosphate, nitrate, alkyl having from 1 to 6 carbon atoms, sulfonate and aryl sulfonate.
- Polypeptide As used herein refers to any polymeric chain of amino acids. In some embodiments, a polypeptide has an amino acid sequence that occurs in nature. In some embodiments, a polypeptide has an amino acid sequence that does not occur in nature.
- a polypeptide has an amino acid sequence that is engineered in that it is designed and/or produced through action of the hand of man.
- a polypeptide may comprise or consist of natural amino acids, non- natural amino acids, or both.
- a polypeptide may comprise or consist of only natural amino acids or only non-natural amino acids.
- a polypeptide may comprise D-amino acids, L-amino acids, or both.
- a polypeptide may comprise only D-amino acids.
- a polypeptide may comprise only L-amino acids.
- a polypeptide may include one or more pendant groups or other modifications, e.g., modifying or attached to one or more amino acid side chains, at the polypeptide’s N-terminus, at the polypeptide’s C-terminus, or any combination thereof.
- such pendant groups or modifications may be selected from the group consisting of acetylation, amidation, lipidation, methylation, pegylation, etc., including combinations thereof.
- a polypeptide may be cyclic, and/or may comprise a cyclic portion.
- a polypeptide is not cyclic and/or does not comprise any cyclic portion.
- a polypeptide is linear.
- a polypeptide may be or comprise a stapled polypeptide.
- the term “polypeptide” may be appended to a name of a reference polypeptide, activity, or structure; in such instances it is used herein to refer to polypeptides that share the relevant activity or structure and thus can be considered to be members of the same class or family of polypeptides.
- the present specification provides and/or those skilled in the art will be aware of exemplary polypeptides within the class whose amino acid sequences and/or functions are known; in some embodiments, such exemplary polypeptides are reference polypeptides for the polypeptide class or family.
- a member of a polypeptide class or family shows significant sequence homology or identity with, shares a common sequence motif (e.g., a characteristic sequence element) with, and/or shares a common activity (in some embodiments at a comparable level or within a designated range) with a reference polypeptide of the class; in some embodiments with all polypeptides within the class).
- a common sequence motif e.g., a characteristic sequence element
- shares a common activity in some embodiments at a comparable level or within a designated range
- a member polypeptide shows an overall degree of sequence homology or identity with a reference polypeptide that is at least about 30-40%, and is often greater than about 50%, 60%, 70%, 80%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more and/or includes at least one region (e.g., a conserved region that may in some embodiments be or comprise a characteristic sequence element) that shows very high sequence identity, often greater than 90% or even 95%, 96%, 97%, 98%, or 99%.
- a conserved region that may in some embodiments be or comprise a characteristic sequence element
- Such a conserved region usually encompasses at least 3-4 and often up to 20 or more amino acids; in some embodiments, a conserved region encompasses at least one stretch of at least 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15 or more contiguous amino acids.
- a relevant polypeptide may comprise or consist of a fragment of a parent polypeptide.
- a useful polypeptide as may comprise or consist of a plurality of fragments, each of which is found in the same parent polypeptide in a different spatial arrangement relative to one another than is found in the polypeptide of interest (e.g., fragments that are directly linked in the parent may be spatially separated in the polypeptide of interest or vice versa, and/or fragments may be present in a different order in the polypeptide of interest than in the parent), so that the polypeptide of interest is a derivative of its parent polypeptide.
- Prevent or prevention refers to reducing the risk of developing the disease, disorder and/or condition and/or to delaying onset of one or more characteristics or symptoms of the disease, disorder or condition. Prevention may be considered complete when onset of a disease, disorder or condition has been delayed for a predefined period of time.
- Protecting group The term “protecting group,” as used herein, is well known in the art and includes those described in detail in Protecting Groups in Organic Synthesis, T. W. Greene and P. G. M. Wuts, 3 rd edition, John Wiley & Sons, 1999, the entirety of which is incorporated herein by reference.
- Suitable amino–protecting groups include methyl carbamate, ethyl carbamante, 9–fluorenylmethyl carbamate (Fmoc), 9–(2–sulfo)fluorenylmethyl carbamate, 9–(2,7– dibromo)fluoroenylmethyl carbamate, 2,7–di–t–butyl–[9–(10,10–dioxo–10,10,10,10– tetrahydrothioxanthyl)]methyl carbamate (DBD–Tmoc), 4–methoxyphenacyl carbamate (Phenoc), 2,2,2– trichloroethyl carbamate (Troc), 2–trimethylsilylethyl carbamate (Teoc), 2–phenylethyl carbamate (hZ), 1– (1–adamantyl)–1–methylethyl carbamate (Adpoc), 1,1–dimethyl–2–haloethy
- suitable mono-protected amines include, but are not limited to, aralkylamines, carbamates, allyl amines, amides, and the like.
- suitable mono-protected amino moieties include t-butyloxycarbonylamino (—NHBOC), ethyloxycarbonylamino, methyloxycarbonylamino, trichloroethyloxycarbonylamino, allyloxycarbonylamino (—NHAlloc), benzyloxocarbonylamino (–NHCBZ), allylamino, benzylamino (–NHBn), fluorenylmethylcarbonyl (–NHFmoc), formamido, acetamido, chloroacetamido, dichloroacetamido, trichloroacetamido, phenylacetamido, trifluoroacetamido, benzamido, t
- suitable di-protected amines include amines that are substituted with two substituents independently selected from those described above as mono-protected amines, and further include cyclic imides, such as phthalimide, maleimide, succinimide, and the like.
- suitable di-protected amines include pyrroles and the like, 2,2,5,5-tetramethyl- [1,2,5]azadisilolidine and the like, and azide.
- Suitably protected carboxylic acids further include, but are not limited to, silyl–, alkyl–, alkenyl–, aryl–, and arylalkyl–protected carboxylic acids.
- Examples of suitable silyl groups include trimethylsilyl, triethylsilyl, t–butyldimethylsilyl, t–butyldiphenylsilyl, triisopropylsilyl, and the like.
- Examples of suitable alkyl groups include methyl, benzyl, p–methoxybenzyl, 3,4–dimethoxybenzyl, trityl, t–butyl, tetrahydropyran–2–yl.
- Examples of suitable alkenyl groups include allyl.
- Examples of suitable aryl groups include optionally substituted phenyl, biphenyl, or naphthyl.
- Suitable arylalkyl groups include optionally substituted benzyl (e.g., p–methoxybenzyl (MPM), 3,4–dimethoxybenzyl, O–nitrobenzyl, p– nitrobenzyl, p–halobenzyl, 2,6–dichlorobenzyl, p–cyanobenzyl), and 2– and 4–picolyl.
- suitable protected carboxylic acids include, but are not limited to, optionally substituted C 1–6 aliphatic esters, optionally substituted aryl esters, silyl esters, activated esters, amides, hydrazides, and the like.
- ester groups include methyl, ethyl, propyl, isopropyl, butyl, isobutyl, benzyl, and phenyl ester, wherein each group is optionally substituted.
- Additional suitable protected carboxylic acids include oxazolines and ortho esters.
- Suitable hydroxyl protecting groups include methyl, methoxylmethyl (MOM), methylthiomethyl (MTM), t–butylthiomethyl, (phenyldimethylsilyl)methoxymethyl (SMOM), benzyloxymethyl (BOM), p– methoxybenzyloxymethyl (PMBM), (4–methoxyphenoxy)methyl (p–AOM), guaiacolmethyl (GUM), t– butoxymethyl, 4–pentenyloxymethyl (POM), siloxymethyl, 2–methoxyethoxymethyl (MEM), 2,2,2– trichloroethoxymethyl, bis(2–chloroethoxy)methyl, 2–(trimethylsilyl)ethoxymethyl (SEMOR), tetrahydropyranyl (THP), 3–bromotetrahydropyranyl, tetrahydrothiopyranyl, 1–methoxycyclohexyl, 4– methoxytetrahydropyr
- the protecting groups include methylene acetal, ethylidene acetal, 1–t– butylethylidene ketal, 1–phenylethylidene ketal, (4–methoxyphenyl)ethylidene acetal, 2,2,2– trichloroethylidene acetal, acetonide, cyclopentylidene ketal, cyclohexylidene ketal, cycloheptylidene ketal, benzylidene acetal, p–methoxybenzylidene acetal, 2,4–dimethoxybenzylidene ketal, 3,4– dimethoxybenzylidene acetal, 2–nitrobenzylidene acetal, methoxymethylene acetal, ethoxymethylene acetal, dimethoxymethylene ortho ester, 1–methoxyethy
- a hydroxyl protecting group is acetyl, t-butyl, tbutoxymethyl, methoxymethyl, tetrahydropyranyl, 1 -ethoxyethyl, 1 -(2-chloroethoxy)ethyl, 2- trimethylsilylethyl, p- chlorophenyl, 2,4-dinitrophenyl, benzyl, benzoyl, p-phenylbenzoyl, 2,6- dichlorobenzyl, diphenylmethyl, p- nitrobenzyl, triphenylmethyl (trityl), 4,4'-dimethoxytrityl, trimethylsilyl, triethylsilyl, t-butyldimethylsilyl, t- butyldiphenylsilyl, triphenylsilyl, triisopropylsilyl, benzoylformate, chloroacetyl, trich
- each of the hydroxyl protecting groups is, independently selected from acetyl, benzyl, t- butyldimethylsilyl, t- butyldiphenylsilyl and 4,4'-dimethoxytrityl.
- the hydroxyl protecting group is selected from the group consisting of trityl, monomethoxytrityl and 4,4'-dimethoxytrityl group.
- a phosphorous linkage protecting group is a group attached to the phosphorous linkage (e.g., an internucleotidic linkage) throughout oligonucleotide synthesis.
- a protecting group is attached to a sulfur atom of an phosphorothioate group. In some embodiments, a protecting group is attached to an oxygen atom of an internucleotide phosphorothioate linkage. In some embodiments, a protecting group is attached to an oxygen atom of the internucleotide phosphate linkage.
- a protecting group is 2-cyanoethyl (CE or Cne), 2-trimethylsilylethyl, 2-nitroethyl, 2-sulfonylethyl, methyl, benzyl, o- nitrobenzyl, 2-(p-nitrophenyl)ethyl (NPE or Npe), 2-phenylethyl, 3-(N-tert-butylcarboxamido)-1-propyl, 4- oxopentyl, 4-methylthio-l-butyl, 2-cyano-1,1-dimethylethyl, 4-N-methylaminobutyl, 3-(2-pyridyl)-1-propyl, 2-[N-methyl-N-(2-pyridyl)]aminoethyl, 2-(N-formyl,N-methyl)aminoethyl, or 4-[N-methyl-N-(2,2,2- trifluoroacetyl)amino]butyl.
- Protected thiols are well known in the art and include those described in detail in Greene (1999). Suitable protected thiols further include, but are not limited to, disulfides, thioethers, silyl thioethers, thioesters, thiocarbonates, and thiocarbamates, and the like. Examples of such groups include, but are not limited to, alkyl thioethers, benzyl and substituted benzyl thioethers, triphenylmethyl thioethers, and trichloroethoxycarbonyl thioester, to name but a few.
- Reference As used herein describes a standard or control relative to which a comparison is performed.
- an agent, animal, individual, population, sample, sequence or value of interest is compared with a reference or control agent, animal, individual, population, sample, sequence or value.
- a reference or control is tested and/or determined substantially simultaneously with the testing or determination of interest.
- a reference or control is a historical reference or control, optionally embodied in a tangible medium.
- a reference or control is determined or characterized under comparable conditions or circumstances to those under assessment.
- Specificity is a measure of the ability of a particular ligand (e.g., an agent) to distinguish its binding partner (e.g., beta-catenin) from other potential binding partners (e.g., another protein, another portion (e.g., domain) of beta-catenin.
- binding partner e.g., beta-catenin
- substitution As described herein, compounds of the disclosure may contain optionally substituted and/or substituted moieties. In general, the term “substituted,” whether preceded by the term “optionally” or not, means that one or more hydrogens of the designated moiety are replaced with a suitable substituent.
- an “optionally substituted” group may have a suitable substituent at each substitutable position of the group, and when more than one position in any given structure may be substituted with more than one substituent selected from a specified group, the substituent may be either the same or different at every position.
- Combinations of substituents envisioned by this disclosure are preferably those that result in the formation of stable or chemically feasible compounds.
- stable refers to compounds that are not substantially altered when subjected to conditions to allow for their production, detection, and, in certain embodiments, their recovery, purification, and use for one or more of the purposes disclosed herein. In some embodiments, example substituents are described below.
- Suitable monovalent substituents on R° are independently halogen, —(CH 2 ) 0–2 R ⁇ , –(haloR ⁇ ), –(CH 2 ) 0–2 OH, –(CH 2 ) 0–2 OR ⁇ , –(CH 2 ) 0–2 CH(OR ⁇ ) 2 ; –O(haloR ⁇ ), –CN, –N 3 , –(CH 2 ) 0–2 C(O)R ⁇ , –(CH 2 ) 0– 2 C(O)OH, –(CH 2 ) 0–2 C(O)OR ⁇ , –(CH 2 ) 0–2 SR ⁇ , –(CH 2 ) 0–2 SH, –(CH 2 ) 0–2 NH 2 , –(CH 2 ) 0
- Suitable divalent substituents that are bound to vicinal substitutable carbons of an “optionally substituted” group include: –O(CR * 2) 2–3 O–, wherein each independent occurrence of R * is selected from hydrogen, C 1–6 aliphatic which may be substituted as defined below, or an unsubstituted 5–6–membered saturated, partially unsaturated, or aryl ring having 0–4 heteroatoms independently selected from nitrogen, oxygen, and sulfur.
- Suitable substituents on the aliphatic group of R * are halogen, –R ⁇ , -(haloR ⁇ ), –OH, ⁇ OR ⁇ , – O(haloR ⁇ ), –CN, –C(O)OH, –C(O)OR ⁇ , –NH 2 , –NHR ⁇ , –NR ⁇ 2 , or –NO 2 , wherein each R ⁇ is unsubstituted or where preceded by “halo” is substituted only with one or more halogens, and is independently C 1–4 aliphatic, –CH 2 Ph, –O(CH 2 ) 0–1 Ph, or a 5–6–membered saturated, partially unsaturated, or aryl ring having 0– 4 heteroatoms independently selected from nitrogen, oxygen, and sulfur.
- suitable substituents on a substitutable nitrogen are –R ⁇ , ⁇ NR ⁇ 2, –C(O)R ⁇ , –C(O)OR ⁇ , –C(O)C(O)R ⁇ , –C(O)CH 2 C(O)R ⁇ , –S(O) 2 R ⁇ , –S(O) 2 NR ⁇ 2, ⁇ C(S)NR ⁇ 2, –C(NH)NR ⁇ 2, or – N(R ⁇ )S(O) 2 R ⁇ ; wherein each R ⁇ is independently hydrogen, C 1–6 aliphatic which may be substituted as defined below, unsubstituted –OPh, or an unsubstituted 5–6–membered saturated, partially unsaturated, or aryl ring having 0–4 heteroatoms independently selected from nitrogen, oxygen, and sulfur, or, notwithstanding the definition above, two independent occurrences of R ⁇ ,
- Suitable substituents on the aliphatic group of R ⁇ are independently halogen, ⁇ R ⁇ , -(haloR ⁇ ), – OH, –OR ⁇ , –O(haloR ⁇ ), –CN, –C(O)OH, –C(O)OR ⁇ , –NH 2 , –NHR ⁇ , –NR ⁇ 2 , or –NO 2 , wherein each R ⁇ is unsubstituted or where preceded by “halo” is substituted only with one or more halogens, and is independently C 1–4 aliphatic, –CH 2 Ph, –O(CH 2 ) 0–1 Ph, or a 5–6–membered saturated, partially unsaturated, or aryl ring having 0–4 heteroatoms independently selected from nitrogen, oxygen, and sulfur.
- Subject refers to any organism to which a provided compound or composition is administered in accordance with the present disclosure e.g., for experimental, diagnostic, prophylactic, and/or therapeutic purposes. Typical subjects include animals (e.g., mammals such as mice, rats, rabbits, non-human primates, and humans; insects; worms; etc.) and plants. In some embodiments, a subject may be suffering from, and/or susceptible to a disease, disorder, and/or condition. In some embodiments, a subject is a human.
- Susceptible to An individual who is “susceptible to” a disease, disorder, and/or condition is one who has a higher risk of developing the disease, disorder, and/or condition than does a member of the general public. In some embodiments, an individual who is susceptible to a disease, disorder and/or condition may not have been diagnosed with the disease, disorder, and/or condition. In some embodiments, an individual who is susceptible to a disease, disorder, and/or condition may exhibit symptoms of the disease, disorder, and/or condition. In some embodiments, an individual who is susceptible to a disease, disorder, and/or condition may not exhibit symptoms of the disease, disorder, and/or condition.
- Target polypeptide A “target polypeptide”, as that term is used herein, is a polypeptide with which an agent interacts.
- a target polypeptide is a beta-catenin polypeptide.
- a target polypeptide comprises, consists essentially of, or is a binding site of beta-catenin polypeptide.
- Target residue is a residue within a target polypeptide with which an agent is designed to interact.
- an agent may be characterized by particular interaction motifs (e.g., aromatic groups as described herein) and/or residues (e.g., amino acid residues comprising aromatic groups as described herein) selected and arranged (by virtue of being presented on the selected scaffold) to be within a certain predetermined distance (or volume) of a target residue.
- a target residue is or comprises an amino acid residue.
- Therapeutic agent refers to an agent that, when administered to a subject, has a therapeutic effect and/or elicits a desired biological and/or pharmacological effect.
- a therapeutic agent is any substance that can be used to alleviate, ameliorate, relieve, inhibit, prevent, delay onset of, reduce severity of, and/or reduce incidence of one or more symptoms or features of a disease, disorder, and/or condition.
- Therapeutic regimen A “therapeutic regimen”, as that term is used herein, refers to a dosing regimen whose administration across a relevant population may be correlated with a desired or beneficial therapeutic outcome.
- therapeutically effective amount means an amount of a substance (e.g., a therapeutic agent, composition, and/or formulation) that elicits a desired biological response when administered as part of a therapeutic regimen.
- a therapeutically effective amount of a substance is an amount that is sufficient, when administered to a subject suffering from or susceptible to a disease, disorder, and/or condition, to treat, diagnose, prevent, and/or delay the onset of the disease, disorder, and/or condition.
- the effective amount of a substance may vary depending on such factors as the desired biological endpoint, the substance to be delivered, the target cell or tissue, etc.
- the effective amount of compound in a formulation to treat a disease, disorder, and/or condition is the amount that alleviates, ameliorates, relieves, inhibits, prevents, delays onset of, reduces severity of and/or reduces incidence of one or more symptoms or features of the disease, disorder, and/or condition.
- a therapeutically effective amount is administered in a single dose; in some embodiments, multiple unit doses are required to deliver a therapeutically effective amount.
- Treat refers to any method used to partially or completely alleviate, ameliorate, relieve, inhibit, prevent, delay onset of, reduce severity of, and/or reduce incidence of one or more symptoms or features of a disease, disorder, and/or condition.
- Treatment may be administered to a subject who does not exhibit signs of a disease, disorder, and/or condition.
- treatment may be administered to a subject who exhibits only early signs of the disease, disorder, and/or condition, for example for the purpose of decreasing the risk of developing pathology associated with the disease, disorder, and/or condition.
- Unit dose refers to an amount administered as a single dose and/or in a physically discrete unit of a pharmaceutical composition.
- a unit dose contains a predetermined quantity of an active agent.
- a unit dose contains an entire single dose of the agent.
- more than one unit dose is administered to achieve a total single dose.
- administration of multiple unit doses is required, or expected to be required, in order to achieve an intended effect.
- a unit dose may be, for example, a volume of liquid (e.g., an acceptable carrier) containing a predetermined quantity of one or more therapeutic agents, a predetermined amount of one or more therapeutic agents in solid form, a sustained release formulation or drug delivery device containing a predetermined amount of one or more therapeutic agents, etc. It will be appreciated that a unit dose may be present in a formulation that includes any of a variety of components in addition to the therapeutic agent(s). For example, acceptable carriers (e.g., pharmaceutically acceptable carriers), diluents, stabilizers, buffers, preservatives, etc., may be included as described infra.
- acceptable carriers e.g., pharmaceutically acceptable carriers
- diluents e.g., diluents, stabilizers, buffers, preservatives, etc.
- a total appropriate daily dosage of a particular therapeutic agent may comprise a portion, or a plurality, of unit doses, and may be decided, for example, by the attending physician within the scope of sound medical judgment.
- the specific effective dose level for any particular subject or organism may depend upon a variety of factors including the disorder being treated and the severity of the disorder; activity of specific active compound employed; specific composition employed; age, body weight, general health, sex and diet of the subject; time of administration, and rate of excretion of the specific active compound employed; duration of the treatment; drugs and/or additional therapies used in combination or coincidental with specific compound(s) employed, and like factors well known in the medical arts.
- Unsaturated means that a moiety has one or more units of unsaturation.
- salts such as pharmaceutically acceptable acid or base addition salts, stereoisomeric forms, and tautomeric forms, of provided compound are included.
- the term “a” or “an” may be understood to mean “at least one”; (ii) the term “or” may be understood to mean “and/or”; (iii) the terms “comprising”, “comprise”, “including” (whether used with “not limited to” or not), and “include” (whether used with “not limited to” or not) may be understood to encompass itemized components or steps whether presented by themselves or together with one or more additional components or steps; (iv) the term “another” may be understood to mean at least an additional/second one or more; (v) the terms “about” and “approximately” may be understood to permit standard variation as would be understood by those of ordinary skill in the art; and (vi) where ranges are provided, endpoints are included.
- a provided agent is or comprises a peptide.
- a provided agent is a peptide.
- a peptide is a stapled peptide.
- a provided agent is a stapled peptide.
- a peptide is a stitched peptide.
- a provided agent is a stitched peptide.
- a stitched peptide comprises two or more staples, wherein two staples are bonded to the same peptide backbone atom.
- Stapled peptides as described herein are typically peptides in which two or more amino acids of a peptide chain are linked through connection of two peptide backbone atoms of the amino acid residues and, as is understood by those skilled in the art, the connection is not through the peptide backbone between the linked amino acid residues.
- a staple as described herein is a linker that link one amino acid residue to another amino acid residue, e.g., through bonding to a peptide backbone atom of each of the amino acid residues and, as is understood by those skilled in the art, the connection through a staple is not through the peptide backbone between the linked amino acid residues.
- a staple bonds to the peptide backbone by replacing one or more hydrogen and/or substituents (e.g., side chains, O, S, etc.) on peptide backbone atoms (e.g., C, N, etc.).
- substituents e.g., side chains, O, S, etc.
- side chains form portions of staples.
- a staple is bonded to two carbon backbone atoms, e.g., two alpha carbon atoms.
- a staple comprises C(R’) 2 or N(R’), either individually or as part of a large moiety, wherein R’ is R and is taken together with another group attached to a backbone atom which can be R (e.g., R a3 ) and their intervening atoms to form a ring as described herein (e.g., when PyrS2 is stapled in various peptides).
- a stapled peptide comprises one or more staples.
- a stapled peptide comprises two or more staples.
- a stapled peptide comprises three or more staples.
- a stapled peptide comprises four or more staples.
- a variety of peptide stapling technologies are available, including both hydrocarbon-stapling and non-hydrocarbon-stapling technologies, and can be utilized in accordance with the present disclosure.
- Various technologies for stapled and stitched peptides, including various staples and/or methods for manufacturing are available and may be utilized in accordance with the present disclosure, e.g., those described in WO 2019/051327 and WO 2020/041270, the staples of each of which are incorporated herein by reference.
- a peptide e.g., a stapled peptide
- a staple is a hydrocarbon staple.
- a staple as described herein is a non-hydrocarbon staple.
- a non-hydrocarbon staple comprises one or more chain heteroatoms wherein a chain of a staple is the shortest covalent connection within the staple from one end of the staple to the other end of the staple.
- a non-hydrocarbon staple is or comprises at least one sulfur atom derived from an amino acid residue of a polypeptide.
- a non-hydrocarbon staple comprises two sulfur atom derived from two different amino acid residues of a polypeptide. In some embodiments, a non-hydrocarbon staple comprises two sulfur atoms derived from two different cysteine residues of a polypeptide. In some embodiments, a staple is a cysteine staple. In some embodiments, a staple is a non-cysteine staple. In some embodiments, a non-hydrocarbon staple is a carbamate staple and comprises a carbamate moiety (e.g., ⁇ N(R’) ⁇ C(O) ⁇ O ⁇ ) in its chain.
- a non-hydrocarbon staple is an amino staple and comprises an amino group (e.g., ⁇ N(R’) ⁇ ) in its chain.
- an amino group in an amino staple e.g., ( ⁇ N(R’) ⁇
- a non-hydrocarbon staple is an ester staple and comprises an ester moiety ( ⁇ C(O) ⁇ O ⁇ ) in its chain.
- a non-hydrocarbon staple is an amide staple and comprises an amide moiety ( ⁇ C(O) ⁇ N(R’) ⁇ ) in its chain.
- a non-hydrocarbon staple is a sulfonamide staple and comprises a sulfonamide moiety ( ⁇ S(O) 2 ⁇ N(R’) ⁇ ) in its chain.
- a non-hydrocarbon staple is an ether staple and comprises an ether moiety ( ⁇ O ⁇ ) in its chain.
- R’ of a carbamate moiety, amino group, amide moiety, sulfonamide moiety, or ether moiety is R, and is taken together with an R group attached to a backbone (e.g., R a3 when it is R) and their intervening atoms to form a ring as described herein.
- R’ of a carbamate moiety or amino group is R, and is taken together with an R group attached to a backbone (e.g., R a3 when it is R) and their intervening atoms to form a ring as described herein.
- a staple comprises one or more amino groups, e.g., ⁇ N(R’) ⁇ , wherein each R’ is independently as described herein.
- ⁇ N(R’) ⁇ bonds to two carbon atoms.
- ⁇ N(R’) ⁇ bonds to two carbon atoms, wherein neither of the two carbon atoms are bond to any heteroatoms through a double bond.
- ⁇ N(R’) ⁇ bonds to two sp3 carbon atoms.
- a staple comprises one or more ⁇ C(O) ⁇ N(R’) ⁇ groups, wherein each R’ is independently as described herein.
- a staple comprises one or more carbamate groups, e.g., one or more ⁇ (O) ⁇ C(O) ⁇ N(R’) ⁇ , wherein each R’ is independently as described herein.
- R’ is ⁇ H.
- R’ is optionally substituted C 1-6 aliphatic.
- R’ is optionally substituted C 1-6 alkyl.
- R’ is C 1-6 aliphatic.
- R’ is C 1-6 alkyl.
- R’ is methyl.
- a stapled peptide comprise one or more staples.
- a stapled peptide comprises one and no more than one staple. In some embodiments, a stapled peptide comprises two and no more than two staples. In some embodiments, two staples of a stapled peptide bond to a common backbone atom. In some embodiments, two staples of a stapled peptide bond to a common backbone atom which is an alpha carbon atom of an amino acid residue. In some embodiments, a stapled peptide comprises three or more staples. In some embodiments, a stapled peptides comprise four or more staples. In some embodiments, a stapled peptide comprises three and no more than three staples. In some embodiments, a stapled peptide comprises four and no more than four staples.
- each staple independently has the structure of ⁇ L s1 ⁇ L s2 ⁇ L s3 ⁇ as described herein. In some embodiments, each staple is independently bonded to two amino acid residues. In some embodiments, each staple is independently bonded to two alpha carbon atoms. [0120] In some embodiments, two, three, four, or all staples of a stapled peptide are within a region that has a length of several amino acid residues. In some embodiments, two staples are within such a region. In some embodiments, three staples are within such a region. In some embodiments, four staples are within such a region. In some embodiments, all staples are within such a region.
- a region has a length of 5-20, 5-15, 5-14, 5-113, 5-12, 5-11, 5-10, 6-20, 6-15, 6-14, 6-113, 6-12, 6-11, 6-10, 7-20, 7- 15, 7-14, 7-113, 7-12, 7-11, 7-10, 10-16, 10-15, 10-14, 11-16, 11-15, 11-14, 12-16, 12-15, 12-14, 13-15 or 13-14 amino acid residues.
- a region has a length of 5 amino acid residues.
- a region has a length of 6 amino acid residues.
- a region has a length of 7 amino acid residues.
- a region has a length of 8 amino acid residues.
- a region has a length of 9 amino acid residues. In some embodiments, a region has a length of 10 amino acid residues. In some embodiments, a region has a length of 11 amino acid residues. In some embodiments, a region has a length of 12 amino acid residues. In some embodiments, a region has a length of 13 amino acid residues. In some embodiments, a region has a length of 14 amino acid residues. In some embodiments, a region has a length of 15 amino acid residues. In some embodiments, a region has a length of 16 amino acid residues. In some embodiments, a region has a length of 17 amino acid residues. In some embodiments, a region has a length of 18 amino acid residues.
- a region has a length of 19 amino acid residues. In some embodiments, a region has a length of 20 amino acid residues.
- stapled peptides comprise three staples within in a region of 14 amino acids (e.g., a staple bonded to aa1 and aa4, a staple bonded to aa4 and aa11, and a staple bonded to aa10 and aa14).
- peptides, e.g., staple peptides, of the present disclosure is or comprises a helix structure. As those skilled in the art will appreciate, helixes can have various lengths.
- lengths of helixes range from 5 to 30 amino acid residues. In some embodiments, a length of a helix is 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20, or more, amino acid residues. In some embodiments, a length of a helix is 6 amino acid residues. In some embodiments, a length of a helix is 8 amino acid residues. In some embodiments, a length of a helix is 10 amino acid residues. In some embodiments, a length of a helix is 12 amino acid residues. In some embodiments, a length of a helix is 14 amino acid residues. In some embodiments, a length of a helix is 16 amino acid residues.
- a length of a helix is 17 amino acid residues. In some embodiments, a length of a helix is 18 amino acid residues. In some embodiments, a length of a helix is 19 amino acid residues. In some embodiments, a length of a helix is 20 amino acid residues.
- Amino acids stapled together can have various number of amino acid residues in between, e.g., 1- 20, 1-15, 1-10, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10, etc.
- a staple is (i, i+4) which means there are three amino acid residues between the two amino acids (at positions i and i+4, respectively) that bond to the staple (at positions i+1, i+2, i+3, respectively).
- a staple is (i, i+2).
- a staple is (i, i+3).
- a staple is (i, i+5).
- a staple is (i, i+6).
- a staple is (i, i+7).
- a staple is (i, i+8).
- a stapled peptide comprises two staples, one is (i, i+2) and the other is (i, i+7). In some embodiments, a stapled peptide comprises two staples, one is (i, i+3) and the other is (i, i+7). In some embodiments, a stapled peptide comprises two staples, one is (i, i+3) and the other is (i, i+4). In some embodiments, a stapled peptide comprises two staples, one is (i, i+4) and the other is (i, i+7). In some embodiments, a stapled peptide comprises two staples, one is (i, i+3) and the other is (i, i+3).
- a stapled peptide comprises two staples, one is (i, i+4) and the other is (i, i+4). In some embodiments, a stapled peptide comprises two staples, one is (i, i+7) and the other is (i, i+7). In some embodiments, the two staples are bonded to a common backbone atom, e.g., an alpha carbon atom of an amino acid residue. In some embodiments, a stapled peptide further comprises a third staple. In some embodiments, a third staple is (i, i+3). In some embodiments, a third staple is (i, i+4). In some embodiments, a third staple is (i, i+7).
- a stapled peptide further comprises a fourth staple.
- a fourth staple is (i, i+3).
- a fourth staple is (i, i+4).
- a fourth staple is (i, i+7).
- a stapled peptide comprises a staple which staple is L s , wherein L s is ⁇ L s1 ⁇ L s2 ⁇ L s3 ⁇ , each of L s1 , L s2 , and L s3 is independently L, wherein each L is independently as described in the present disclosure.
- a provided staple is L s .
- L s1 comprises at least one ⁇ N(R’) ⁇ , wherein R’ is as described in the present disclosure.
- the ⁇ N(R’) ⁇ is bonded to two carbon atoms, wherein neither of the two carbon atoms forms a double bond with a heteroatom.
- the ⁇ N(R’) ⁇ is not bonded to ⁇ C(O) ⁇ .
- the ⁇ N(R’) ⁇ is not bonded to ⁇ C(S) ⁇ .
- L s1 is ⁇ L’ ⁇ N(R’) ⁇ , wherein L’ is optionally substituted bivalent C 1 -C 19 aliphatic. In some embodiments, L s1 is ⁇ L’ ⁇ N(CH 3 ) ⁇ , wherein L’ is optionally substituted bivalent C 1 -C 19 aliphatic. [0125] In some embodiments, R’ is optionally substituted C 1-6 alkyl. In some embodiments, R’ is C 1-6 alkyl. In some embodiments, R’ is methyl.
- the peptide backbone atom to which L s1 is bonded is also bonded to R 1 , and R’ and R 1 are both R and are taken together with their intervene atoms to form an optionally substituted ring as described in the present disclosure.
- a formed ring has no additional ring heteroatoms in addition to the nitrogen atom to which R’ is bonded.
- a formed ring is 3-membered.
- a formed ring is 4-membered.
- a formed ring is 5-membered.
- a formed ring is 6-membered.
- L’ is optionally substituted bivalent C 1 -C 20 aliphatic. In some embodiments, L’ is optionally substituted bivalent C 1 -C 19 aliphatic. In some embodiments, L’ is optionally substituted bivalent C 1 -C 15 aliphatic. In some embodiments, L’ is optionally substituted bivalent C 1 -C 10 aliphatic. In some embodiments, L’ is optionally substituted bivalent C 1 -C 9 aliphatic. In some embodiments, L’ is optionally substituted bivalent C 1 -C 8 aliphatic. In some embodiments, L’ is optionally substituted bivalent C 1 -C 7 aliphatic.
- L’ is optionally substituted bivalent C 1 -C 6 aliphatic. In some embodiments, L’ is optionally substituted bivalent C 1 -C 5 aliphatic. In some embodiments, L’ is optionally substituted bivalent C 1 -C 4 aliphatic. In some embodiments, L’ is optionally substituted alkylene. In some embodiments, L’ is optionally substituted alkenylene. In some embodiments, L’ is unsubstituted alkylene. In some embodiments, L’ is ⁇ CH 2 ⁇ . In some embodiments, L’ is ⁇ (CH 2 ) 2 ⁇ . In some embodiments, L’ is ⁇ (CH 2 ) 3 ⁇ .
- L’ is optionally substituted phenylene.
- L s1 comprises at least one ⁇ N(R’)C(O) ⁇ , wherein R’ is as described in the present disclosure.
- L s1 is ⁇ L’ ⁇ N(R’)C(O) ⁇ , wherein each of L’ and R’ is independently as described in the present disclosure.
- L s1 is ⁇ L’ ⁇ N(CH 3 )C(O) ⁇ , wherein L’ is independently as described in the present disclosure.
- L s1 comprises at least one ⁇ C(O)O ⁇ .
- L s1 comprises at least one ⁇ C(O)O ⁇ . In some embodiments, L s1 is ⁇ L’ ⁇ C(O)O ⁇ or ⁇ L’ ⁇ OC(O) ⁇ , wherein each L’ is independently as described in the present disclosure. In some embodiments, L s1 is ⁇ L’ ⁇ C(O)O ⁇ , wherein each L’ is independently as described in the present disclosure. In some embodiments, L s1 is ⁇ L’ ⁇ OC(O) ⁇ , wherein each L’ is independently as described in the present disclosure. [0130] In some embodiments, L s1 comprises at least one ⁇ S(O) 2 ⁇ N(R’) ⁇ , wherein R’ is as described in the present disclosure.
- L s1 comprises at least one ⁇ S(O) 2 ⁇ N(R’) ⁇ , wherein R’ is as described in the present disclosure. In some embodiments, L s1 is ⁇ L’ ⁇ N(R’) ⁇ S(O) 2 ⁇ or ⁇ L’ ⁇ S(O) 2 ⁇ N(R’) ⁇ , wherein each of L’ and R’ is independently as described in the present disclosure. In some embodiments, L s1 is ⁇ L’ ⁇ N(R’) ⁇ S(O) 2 ⁇ , wherein each of L’ and R’ is independently as described in the present disclosure.
- L s1 is ⁇ L’ ⁇ S(O) 2 ⁇ N(R’) ⁇ , wherein each of L’ and R’ is independently as described in the present disclosure. In some embodiments, L s1 is ⁇ L’ ⁇ N(CH 3 ) ⁇ S(O) 2 ⁇ or ⁇ L’ ⁇ S(O) 2 ⁇ N(CH 3 ) ⁇ , wherein each L’ is independently as described in the present disclosure. In some embodiments, L s1 is ⁇ L’ ⁇ N(CH 3 ) ⁇ S(O) 2 ⁇ , wherein L’ is as described in the present disclosure.
- L s1 is ⁇ L’ ⁇ S(O) 2 ⁇ N(CH 3 ) ⁇ , wherein L’ is as described in the present disclosure.
- L s1 comprises at least one ⁇ O ⁇ .
- L s1 is ⁇ L’ ⁇ O ⁇ , wherein L’ is independently as described in the present disclosure.
- L s1 is a covalent bond.
- L s1 is L’, wherein L’ is as described in the present disclosure.
- L s2 is L, wherein L is as described in the present disclosure.
- L s2 is L’, wherein L’ is as described in the present disclosure.
- L s2 comprises ⁇ (CH 2 ) 4 ⁇ .
- L s2 is ⁇ (CH 2 ) 4 ⁇ .
- L s3 comprises at least one ⁇ N(R’) ⁇ , wherein R’ is as described in the present disclosure.
- L s3 is ⁇ L’ ⁇ N(CH 3 ) ⁇ , wherein L’ is optionally substituted bivalent C 1 -C 19 aliphatic. [0136] In some embodiments, L s3 comprises at least one ⁇ N(R’)C(O) ⁇ , wherein R’ is as described in the present disclosure. In some embodiments, L s3 is ⁇ L’ ⁇ N(R’)C(O) ⁇ , wherein each of L’ and R’ is independently as described in the present disclosure. In some embodiments, L s3 is ⁇ L’ ⁇ N(CH 3 )C(O) ⁇ , wherein L’ is independently as described in the present disclosure.
- L s3 comprises at least one ⁇ C(O)O ⁇ . In some embodiments, L s3 comprises at least one ⁇ C(O)O ⁇ . In some embodiments, L s3 is ⁇ L’ ⁇ C(O)O ⁇ or ⁇ L’ ⁇ OC(O) ⁇ , wherein each L’ is independently as described in the present disclosure. In some embodiments, L s3 is ⁇ L’ ⁇ C(O)O ⁇ , wherein each L’ is independently as described in the present disclosure. In some embodiments, L s3 is ⁇ L’ ⁇ OC(O) ⁇ , wherein each L’ is independently as described in the present disclosure.
- L s3 comprises at least one ⁇ S(O) 2 ⁇ N(R’) ⁇ , wherein R’ is as described in the present disclosure. In some embodiments, L s3 comprises at least one ⁇ S(O) 2 ⁇ N(R’) ⁇ , wherein R’ is as described in the present disclosure. In some embodiments, L s3 is ⁇ L’ ⁇ N(R’) ⁇ S(O) 2 ⁇ or ⁇ L’ ⁇ S(O) 2 ⁇ N(R’) ⁇ , wherein each of L’ and R’ is independently as described in the present disclosure.
- L s3 is ⁇ L’ ⁇ N(R’) ⁇ S(O) 2 ⁇ , wherein each of L’ and R’ is independently as described in the present disclosure. In some embodiments, L s3 is ⁇ L’ ⁇ S(O) 2 ⁇ N(R’) ⁇ , wherein each of L’ and R’ is independently as described in the present disclosure. In some embodiments, L s3 is ⁇ L’ ⁇ N(CH 3 ) ⁇ S(O) 2 ⁇ or ⁇ L’ ⁇ S(O) 2 ⁇ N(CH 3 ) ⁇ , wherein each L’ is independently as described in the present disclosure.
- L s3 is ⁇ L’ ⁇ N(CH 3 ) ⁇ S(O) 2 ⁇ , wherein L’ is as described in the present disclosure. In some embodiments, L s3 is ⁇ L’ ⁇ S(O) 2 ⁇ N(CH 3 ) ⁇ , wherein L’ is as described in the present disclosure. [0139] In some embodiments, L s3 comprises at least one ⁇ O ⁇ . In some embodiments, L s3 is ⁇ L’ ⁇ O ⁇ , wherein L’ is independently as described in the present disclosure. [0140] In some embodiments, L s3 is L’, wherein L’ is as described in the present disclosure. In some embodiments, L s3 is optionally substituted alkylene.
- L s3 is unsubstituted alkylene.
- L s comprises at least one ⁇ N(R’) ⁇ , wherein R’ is as described in the present disclosure.
- the ⁇ N(R’) ⁇ is bonded to two carbon atoms, wherein neither of the two carbon atoms forms a double bond with a heteroatom.
- the ⁇ N(R’) ⁇ is not bonded to ⁇ C(O) ⁇ .
- the ⁇ N(R’) ⁇ is not bonded to ⁇ C(S) ⁇ .
- L s comprises at least one ⁇ N(R’)C(O) ⁇ , wherein R’ is as described in the present disclosure.
- L s , L s1 , L s2 , and L s3 each independently and optionally comprise a R’ group, e.g., a R’ group in ⁇ C(R’) 2 ⁇ , ⁇ N(R’) ⁇ , etc., and the R’ group is taken with a group (e.g., a group that can be R) attached to a backbone atom (e.g., R a1 , R a2 , R a3 , a R’ group of L a1 or L a2 (e.g., a R’ group in ⁇ C(R’) 2 ⁇ , ⁇ N(R’) ⁇ , etc.), etc.) to form a double bond or an optionally substituted ring as two R groups can.
- a R’ group e.g., a R’ group in ⁇
- a formed ring is an optionally substituted 3-10 membered ring. In some embodiments, a formed ring is an optionally substituted 3-membered ring. In some embodiments, a formed ring is an optionally substituted 4-membered ring. In some embodiments, a formed ring is an optionally substituted 5- membered ring. In some embodiments, a formed ring is an optionally substituted 6-membered ring. In some embodiments, a formed ring is monocyclic. In some embodiments, a formed ring is saturated. In some embodiments, a formed ring is partially unsaturated. In some embodiments, a formed ring is aromatic.
- a formed ring comprises one or more ring heteroatom (e.g., nitrogen).
- a staple, or L s , L s1 , L s2 , and/or L s3 comprises ⁇ N(R’) ⁇ , and the R’ is taken together with a group attached to a backbone atom to form an optionally substituted ring as described herein.
- a staple, or L s , L s1 , L s2 , and/or L s3 comprises ⁇ C(R’) 2 ⁇ , and the R’ is taken together with a group attached to a backbone atom to form an optionally substituted ring as described herein.
- L is used to refer to a linker moiety as described herein; each L superscript (e.g., L a , L s1 , L s2 , L s3 , L s , etc.) therefore is understood, in some embodiments, to be L, unless otherwise specified.
- L comprises at least one ⁇ N(R’) ⁇ , wherein R’ is as described in the present disclosure.
- the ⁇ N(R’) ⁇ is bonded to two carbon atoms, wherein neither of the two carbon atoms forms a double bond with a heteroatom.
- the ⁇ N(R’) ⁇ is not bonded to ⁇ C(O) ⁇ .
- the ⁇ N(R’) ⁇ is not bonded to ⁇ C(S) ⁇ .
- L is ⁇ L’ ⁇ N(R’) ⁇ , wherein L’ is optionally substituted bivalent C 1 -C 19 aliphatic. In some embodiments, L is ⁇ L’ ⁇ N(CH 3 ) ⁇ , wherein L’ is optionally substituted bivalent C 1 -C 19 aliphatic. [0146] In some embodiments, L comprises at least one ⁇ N(R’)C(O) ⁇ , wherein R’ is as described in the present disclosure. In some embodiments, L is ⁇ L’ ⁇ N(R’)C(O) ⁇ , wherein each of L’ and R’ is independently as described in the present disclosure.
- L is ⁇ L’ ⁇ N(CH 3 )C(O) ⁇ , wherein L’ is independently as described in the present disclosure.
- L comprises at least one ⁇ C(O)O ⁇ .
- L comprises at least one ⁇ C(O)O ⁇ .
- L is ⁇ L’ ⁇ C(O)O ⁇ or ⁇ L’ ⁇ OC(O) ⁇ , wherein each L’ is independently as described in the present disclosure.
- L is ⁇ L’ ⁇ C(O)O ⁇ , wherein each L’ is independently as described in the present disclosure.
- L is ⁇ L’ ⁇ OC(O) ⁇ , wherein each L’ is independently as described in the present disclosure.
- L comprises at least one ⁇ S(O) 2 ⁇ N(R’) ⁇ , wherein R’ is as described in the present disclosure. In some embodiments, L comprises at least one ⁇ S(O) 2 ⁇ N(R’) ⁇ , wherein R’ is as described in the present disclosure. In some embodiments, L is ⁇ L’ ⁇ N(R’) ⁇ S(O) 2 ⁇ or ⁇ L’ ⁇ S(O) 2 ⁇ N(R’) ⁇ , wherein each of L’ and R’ is independently as described in the present disclosure. In some embodiments, L is ⁇ L’ ⁇ N(R’) ⁇ S(O) 2 ⁇ , wherein each of L’ and R’ is independently as described in the present disclosure.
- L is ⁇ L’ ⁇ S(O) 2 ⁇ N(R’) ⁇ , wherein each of L’ and R’ is independently as described in the present disclosure.
- L is ⁇ L’ ⁇ N(CH 3 ) ⁇ S(O) 2 ⁇ or ⁇ L’ ⁇ S(O) 2 ⁇ N(CH 3 ) ⁇ , wherein each L’ is independently as described in the present disclosure.
- L is ⁇ L’ ⁇ N(CH 3 ) ⁇ S(O) 2 ⁇ , wherein L’ is as described in the present disclosure.
- L is ⁇ L’ ⁇ S(O) 2 ⁇ N(CH 3 ) ⁇ , wherein L’ is as described in the present disclosure.
- L comprises at least one ⁇ O ⁇ . In some embodiments, L is ⁇ L’ ⁇ O ⁇ , wherein L’ is independently as described in the present disclosure. [0150] In some embodiments, L is L’, wherein L’ is as described in the present disclosure. In some embodiments, L is optionally substituted alkylene. In some embodiments, L is unsubstituted alkylene. [0151] In some embodiments, L is optionally substituted bivalent C 1 -C 25 aliphatic. In some embodiments, L is optionally substituted bivalent C 1 -C 20 aliphatic. In some embodiments, L is optionally substituted bivalent C 1 -C 15 aliphatic.
- L is optionally substituted bivalent C 1 -C 10 aliphatic. In some embodiments, L is optionally substituted bivalent C 1 -C 9 aliphatic. In some embodiments, L is optionally substituted bivalent C 1 -C 8 aliphatic. In some embodiments, L is optionally substituted bivalent C 1 -C 7 aliphatic. In some embodiments, L is optionally substituted bivalent C 1 -C 6 aliphatic. In some embodiments, L is optionally substituted bivalent C 1 -C 5 aliphatic. In some embodiments, L is optionally substituted bivalent C 1 -C 4 aliphatic. In some embodiments, L is optionally substituted alkylene.
- L is optionally substituted alkenylene. In some embodiments, L is unsubstituted alkylene. In some embodiments, L is ⁇ CH 2 ⁇ . In some embodiments, L is ⁇ (CH 2 ) 2 ⁇ . In some embodiments, L is ⁇ (CH 2 ) 3 ⁇ . In some embodiments, L is ⁇ (CH 2 ) 4 ⁇ . In some embodiments, L is ⁇ (CH 2 ) 5 ⁇ . In some embodiments, L is ⁇ (CH 2 ) 6 ⁇ . In some embodiments, L is ⁇ (CH 2 ) 7 ⁇ . In some embodiments, L is ⁇ (CH 2 ) 8 ⁇ .
- L is bonded to a peptide backbone atom.
- L is optionally substituted alkenylene.
- L is unsubstituted alkenylene.
- m is 3. In some embodiments, m is 4. In some embodiments, m is 5. In some embodiments, m is 6. In some embodiments, m is 7. In some embodiments, m is 8. In some embodiments, m is 9. In some embodiments, m is 10. In some embodiments, m is 11. In some embodiments, a staple is referred to a (i, i+m) staple.
- a n1 is a carbon atom. In some embodiments, A n1 is achiral. In some embodiments, A n1 is chiral. In some embodiments, A n1 is R. In some embodiments, A n1 is S.
- a n2 is a carbon atom. In some embodiments, A n2 is achiral. In some embodiments, A n2 is chiral. In some embodiments, A n2 is R. In some embodiments, A n2 is S. [0156] In some embodiments, A n1 is achiral and A n2 is achiral. In some embodiments, A n1 is achiral and A n2 is R. In some embodiments, A n1 is achiral and A n2 is S. In some embodiments, A n1 is R and A n2 is achiral. In some embodiments, A n1 is R and A n2 is R.
- a n1 is R and A n2 is S. In some embodiments, A n1 is S and A n2 is achiral. In some embodiments, A n1 is S and A n2 is R. In some embodiments, A n1 is S and A n2 is S. [0157] In some embodiments, provided stereochemistry at staple-backbone connection points and/or combinations thereof, optionally together with one or more structural elements of provided peptide, e.g., staple chemistry (hydrocarbon, non-hydrocarbon), staple length, etc.
- staple chemistry hydrocarbon, non-hydrocarbon
- a staple can be of various lengths, in some embodiments, as represent by the number of chain atoms of a staple.
- a chain of a staple is the shortest covalent connection in the staple from a first end (connection point with a peptide backbone) of a staple to a second end of the staple, wherein the first end and the second end are connected to two different peptide backbone atoms.
- a staple comprises 5-30 chain atoms, e.g., 5-20, 5-15, 5, 6, 7, 8, 9, or 10 to 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, or 25 chain atoms.
- a staple comprises 5 chain atoms.
- a staple comprises 6 chain atoms.
- a staple comprises 7 chain atoms.
- a staple comprises 8 chain atoms.
- a staple comprises 9 chain atoms. In some embodiments, a staple comprises 10 chain atoms. In some embodiments, a staple comprises 11 chain atoms. In some embodiments, a staple comprises 12 chain atoms. In some embodiments, a staple comprises 13 chain atoms. In some embodiments, a staple comprises 14 chain atoms. In some embodiments, a staple comprises 15 chain atoms. In some embodiments, a staple comprises 16 chain atoms. In some embodiments, a staple comprises 17 chain atoms. In some embodiments, a staple comprises 18 chain atoms. In some embodiments, a staple comprises 19 chain atoms. In some embodiments, a staple comprises 20 chain atoms.
- a staple has a length of 5 chain atoms. In some embodiments, a staple has a length of 6 chain atoms. In some embodiments, a staple has a length of 7 chain atoms. In some embodiments, a staple has a length of 8 chain atoms. In some embodiments, a staple has a length of 9 chain atoms. In some embodiments, a staple has a length of 10 chain atoms. In some embodiments, a staple has a length of 11 chain atoms. In some embodiments, a staple has a length of 12 chain atoms. In some embodiments, a staple has a length of 13 chain atoms. In some embodiments, a staple has a length of 14 chain atoms.
- a staple has a length of 15 chain atoms. In some embodiments, a staple has a length of 16 chain atoms. In some embodiments, a staple has a length of 17 chain atoms. In some embodiments, a staple has a length of 18 chain atoms. In some embodiments, a staple has a length of 19 chain atoms. In some embodiments, a staple has a length of 20 chain atoms. In some embodiments, a staple has a length of 8-15 chain atoms. In some embodiments, a staple has 8-12 chain atoms. In some embodiments, a staple has 9-12 chain atoms. In some embodiments, a staple has 9-10 chain atoms.
- a staple has 8-10 chain atoms.
- length of a staple can be adjusted according to the distance of the amino acid residues it connects, for example, a longer staple may be utilized for a (i, i+7) staple than a (i, i+4) or (i, i+3) staple.
- a (i, i+2) staple has about 5-10, 5-8, e.g., about 5, 6, 7, 8, 9 or 10 chain atoms.
- a (i, i+2) staple has 5 chain atoms.
- a (i, i+2) staple has 6 chain atoms.
- a (i, i+2) staple has 7 chain atoms.
- a (i, i+2) staple has 8 chain atoms. In some embodiments, a (i, i+2) staple has 9 chain atoms. In some embodiments, a (i, i+2) staple has 10 chain atoms. In some embodiments, a (i, i+3) staple has about 5-10, 5-8, e.g., about 5, 6, 7, 8, 9 or 10 chain atoms. In some embodiments, a (i, i+3) staple has 5 chain atoms. In some embodiments, a (i, i+3) staple has 6 chain atoms. In some embodiments, a (i, i+3) staple has 7 chain atoms.
- a (i, i+3) staple has 8 chain atoms. In some embodiments, a (i, i+3) staple has 9 chain atoms. In some embodiments, a (i, i+3) staple has 10 chain atoms. In some embodiments, a (i, i+4) staple has about 5-12, 5- 10, 7-12, 5-8, e.g., about 5, 6, 7, 8, 9, 10, 11 or 12 chain atoms. In some embodiments, a (i, i+4) staple has 5 chain atoms. In some embodiments, a (i, i+4) staple has 6 chain atoms. In some embodiments, a (i, i+4) staple has 7 chain atoms.
- a (i, i+4) staple has 8 chain atoms. In some embodiments, a (i, i+4) staple has 9 chain atoms. In some embodiments, a (i, i+4) staple has 10 chain atoms. In some embodiments, a (i, i+4) staple has 11 chain atoms. In some embodiments, a (i, i+4) staple has 12 chain atoms. In some embodiments, a (i, i+7) staple has about 8-25, 10-25, 10-16, 12-15, e.g., about 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24 or 25 chain atoms. In some embodiments, a (i, i+7) staple has 8 chain atoms.
- a (i, i+7) staple has 9 chain atoms. In some embodiments, a (i, i+7) staple has 10 chain atoms. In some embodiments, a (i, i+7) staple has 11 chain atoms. In some embodiments, a (i, i+7) staple has 12 chain atoms. In some embodiments, a (i, i+7) staple has 13 chain atoms. In some embodiments, a (i, i+7) staple has 14 chain atoms. In some embodiments, a (i, i+7) staple has 15 chain atoms. In some embodiments, a (i, i+7) staple has 16 chain atoms.
- a (i, i+7) staple has 17 chain atoms. In some embodiments, a (i, i+7) staple has 18 chain atoms. In some embodiments, a (i, i+7) staple has 19 chain atoms. In some embodiments, a (i, i+7) staple has 20 chain atoms. In some embodiments, a (i, i+7) staple has 21 chain atoms. In some embodiments, a (i, i+7) staple has 22 chain atoms. In some embodiments, a stapled peptide comprises three or more staples, each of which is independently such a (I, i+2), (i, i+3), (i, i+4) or (i, i+7) staple.
- a stapled peptide comprises such a (i, i+2) staple, such a (i, i+4) staple and such a (i, i+7) staple.
- a stapled peptide comprises such a (i, i+3) staple, such a (i, i+4) staple and such a (i, i+7) staple.
- a stapled peptide comprises such a (i, i+3) staple, such a (i, i+7) staple and such a (i, i+7) staple.
- staple lengths may be described as the total number of chain atoms and non-chain ring atoms, where a non-chain ring atom is an atom of the staple which forms a ring with one or more chain atoms but is not a chain atom in that it is not within the shortest covalent connection from a first end of the staple to a second end of the staple.
- staples formed using Monomer A which comprises an azetidine moiety
- Monomer B which comprises a pyrrolidine moiety
- Monomer C which comprises a pyrrolidine moiety
- a staple has no heteroatoms in its chain. In some embodiments, a staple comprises at least one heteroatom in its chain. In some embodiments, a staple comprises at least one nitrogen atom in its chain. [0161] In some embodiments, a staple is L s , wherein L s is an optionally substituted, bivalent C 8-14 aliphatic group wherein one or more methylene units of the aliphatic group are optionally and independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ Cy ⁇ , ⁇ O ⁇ , ⁇ S ⁇ , ⁇ S ⁇ S ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ C(S) ⁇ , ⁇ C(NR’) ⁇ , ⁇ C(O)N(R’) ⁇ , ⁇ N(R’)C(O)N(R’) ⁇ , ⁇ N(R’)C(O)O ⁇ , ⁇ S(O) 2 ⁇ , ⁇ S s(O) 2 ⁇ , ⁇ S
- a staple is L s , wherein L s is an optionally substituted, bivalent C 9-13 aliphatic group wherein one or more methylene units of the aliphatic group are optionally and independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ Cy ⁇ , ⁇ O ⁇ , ⁇ S ⁇ , ⁇ S ⁇ S ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ C(S) ⁇ , ⁇ C(NR’) ⁇ , ⁇ C(O)N(R’) ⁇ , ⁇ N(R’)C(O)N(R’) ⁇ , ⁇ N(R’)C(O)O ⁇ , ⁇ S(O) ⁇ , ⁇ S(O) 2 ⁇ , ⁇ S(O) 2 N(R’) ⁇ , ⁇ C(O)S ⁇ , or ⁇ C(O)O ⁇ .
- a staple is L s , wherein L s is an optionally substituted, bivalent C 10-15 aliphatic group wherein one or more methylene units of the aliphatic group are optionally and independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ Cy ⁇ , ⁇ O ⁇ , ⁇ S ⁇ , ⁇ S ⁇ S ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ C(S) ⁇ , ⁇ C(NR’) ⁇ , ⁇ C(O)N(R’) ⁇ , ⁇ N(R’)C(O)N(R’) ⁇ , ⁇ N(R’)C(O)O ⁇ , ⁇ S(O) ⁇ , ⁇ S(O) 2 ⁇ , ⁇ S(O) 2 N(R’) ⁇ , ⁇ C(O)S ⁇ , or ⁇ C(O)O ⁇ .
- a staple is L s , wherein L s is an optionally substituted, bivalent C 11-14 aliphatic group wherein one or more methylene units of the aliphatic group are optionally and independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ Cy ⁇ , ⁇ O ⁇ , ⁇ S ⁇ , ⁇ S ⁇ S ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ C(S) ⁇ , ⁇ C(NR’) ⁇ , ⁇ C(O)N(R’) ⁇ , ⁇ N(R’)C(O)N(R’) ⁇ , ⁇ N(R’)C(O)O ⁇ , ⁇ S(O) ⁇ , ⁇ S(O) 2 ⁇ , ⁇ S(O) 2 N(R’) ⁇ , ⁇ C(O)S ⁇ , or ⁇ C(O)O ⁇ .
- a staple is a (i, i+2) staple in that not including the two amino acid residues that are directly connected to the staple, there are one amino acid residue between the two amino acid residues that are directly connected to the staple.
- a staple is a (i, i+3) staple in that not including the two amino acid residues that are directly connected to the staple, there are two amino acid residues between the two amino acid residues that are directly connected to the staple.
- a staple is a (i, i+4) staple in that not including the two amino acid residues that are directly connected to the staple, there are three amino acid residues between the two amino acid residues that are directly connected to the staple.
- a staple is a (i, i+7) staple in that not including the two amino acid residues that are directly connected to the staple, there are six amino acid residues between the two amino acid residues that are directly connected to the staple.
- any replacement of methylene units if any, is replaced with ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ N(R’) ⁇ , ⁇ N(R’)C(O)O ⁇ , ⁇ C(O)O ⁇ , ⁇ S(O) 2 N(R’) ⁇ , or ⁇ O ⁇ .
- any replacement of methylene units, if any, is replaced with ⁇ N(R’) ⁇ , ⁇ N(R’) ⁇ C(O) ⁇ , or ⁇ N(R’)C(O)O ⁇ .
- any replacement of methylene units, if any, is replaced with ⁇ N(R’) ⁇ or ⁇ N(R’)C(O)O ⁇ .
- a staple comprises a double bond.
- a staple comprises a double bond may be formed by olefin metathesis of two olefins.
- staples are formed by metathesis reactions, e.g., involving one or more double bonds in amino acid residues as described herein.
- an olefin e.g., in a staple, is converted into ⁇ CHR’ ⁇ CHR’ ⁇ , wherein each R’ is independently as described herein.
- R’ is R as described herein.
- R’ is ⁇ H.
- each R’ is ⁇ H.
- R’ is ⁇ OR, wherein R is as described herein.
- R’ is ⁇ OH.
- R’ is ⁇ N(R) 2 wherein each R is independently as described herein.
- R’ is ⁇ SR wherein R is as described herein.
- R’ is R wherein R is optionally substituted aliphatic, e.g., C 1-10 aliphatic. In some embodiments, R’ is R wherein R is optionally substituted aliphatic, e.g., C 1-10 alkenyl. In some embodiments, R’ is R wherein R is optionally substituted aliphatic, e.g., C 1-10 alkynyl. In some embodiments, ⁇ CHR’ ⁇ CHR’ ⁇ is ⁇ CH 2 ⁇ CH 2 ⁇ . In some embodiments, each of the two olefins is independently of a side chain of an amino acid residue. In some embodiments, each olefin is independently a terminal olefin.
- each olefin is independently a mono-substituted olefin.
- an amino acid suitable for stapling has the structure of formula A-II or a salt thereof, wherein each variable is independently as described in the present disclosure.
- an amino acid suitable for stapling has the structure of formula A-II-b or a salt thereof, wherein each variable is independently as described in the present disclosure.
- an amino acid suitable for stapling has the structure of formula A-II or a salt thereof, wherein each variable is independently as described in the present disclosure.
- an amino acid of formula A-I or a salt thereof has structure of formula A- IV: NH(R a1 ) ⁇ L a1 ⁇ C( ⁇ L a ⁇ COOH)(R a3 ) ⁇ L a2 ⁇ COOH, A-IV or a salt thereof, wherein each variable is independently as described in the present disclosure.
- an amino acid suitable for stapling has the structure of formula A-IV or a salt thereof, wherein each variable is independently as described in the present disclosure.
- an amino acid has structure of formula A-V: NH(R a1 ) ⁇ L a1 ⁇ C( ⁇ L a ⁇ R SP1 )(R a3 ) ⁇ L a2 ⁇ COOH, A-V or a salt thereof, wherein each variable is independently as described in the present disclosure.
- an amino acid suitable for stapling has the structure of formula A-V or a salt thereof, wherein each variable is independently as described in the present disclosure.
- an amino acid for stapling has structure of formula A-VI: NH(R a1 ) ⁇ L a1 ⁇ C( ⁇ L a ⁇ R SP1 )( ⁇ L a ⁇ R SP2 ) ⁇ L a2 ⁇ COOH, A-VI or a salt thereof, wherein each variable is independently as described in the present disclosure.
- an amino acid suitable for stapling has the structure of formula A-VI or a salt thereof, wherein each variable is independently as described in the present disclosure.
- each of R SP1 and R SP2 independently comprises a reactive group.
- each of R SP1 and R SP2 is independently a reactive group.
- a reactive group is for a cycloaddition reaction (e.g., [3+2], [4+2], etc.), e.g., an alkene, an alkyne, a diene, a 1,3-dipole (e.g., ⁇ N 3 ), etc.
- a reactive group is optionally substituted ⁇ C ⁇ CH.
- a reactive group is ⁇ C ⁇ CH.
- a reactive group is ⁇ N 3 .
- R SP1 or R SP2 of a first amino acid residue and R SP1 or R SP2 of a second amino acid residue can react with each other so that the two amino acid residues are connected with a staple.
- a reaction is amidation and one reactive group is an amino group, e.g., ⁇ NHR wherein R is as described herein (e.g., in some embodiments, R is ⁇ H; in some embodiments, R is optionally substituted C 1-6 aliphatic), and the other is an acid group (e.g., ⁇ COOH) or an activated form thereof.
- a reaction is a cycloaddition reaction, e.g., [4+2], [3+2], etc.
- a first and a second reactive groups are two reactive groups suitable for a cycloaddition reaction.
- a reaction is a click reaction.
- one reaction group is or comprises ⁇ N 3
- the other is or comprises an alkyne, e.g., a terminal alkyne or a activated/strained alkyne.
- the other is or comprises ⁇ C ⁇ CH.
- R SP1 or R SP2 of a first amino acid residue and R SP1 or R SP2 of a second amino acid residue can react with a reagent so that the two are connected to form a staple.
- a reagent comprises two reactive groups, one of which reacts with R SP1 or R SP2 of a first amino acid residue, and the other reacts with R SP1 or R SP2 of a first amino acid residue.
- R SP1 or R SP2 of both amino acid residues are the same or the same type, e.g., both are amino groups, and the two reactive groups of a linking reagent are also the same, e.g., both are acid groups such as ⁇ COOH or activated form thereof.
- R SP1 or R SP2 of both amino acid residues are both acid groups, e.g., ⁇ COOH or activated form thereof, and both reactive groups of a linking agent are amino groups.
- R SP1 or R SP2 of both amino acid residues are both nucleophilic groups, e.g., ⁇ SH, and both reactive groups of a linking reagent are electrophilic (e.g., carbon attached to leaving groups such as ⁇ Br, ⁇ I, etc.).
- R SP1 and R SP2 are the same.
- R SP1 and R SP2 are different.
- R SP1 is or comprises ⁇ COOH.
- R SP1 is or comprises an amino group.
- R SP1 is or comprises ⁇ NHR.
- R is hydrogen or optionally substituted C 1-6 aliphatic.
- R SP1 is or comprises ⁇ NH 2 .
- R SP1 is or comprises ⁇ N 3 .
- R SP2 is or comprises ⁇ COOH.
- R SP2 is or comprises an amino group.
- R SP2 is or comprises ⁇ NHR.
- R is hydrogen or optionally substituted C 1-6 aliphatic.
- R SP2 is or comprises ⁇ NH 2 .
- R SP2 is or comprises ⁇ N 3 .
- each amino acid residue of a pair of amino acid residues is independently a residue of an amino acid of formula A-II or A-III or a salt thereof.
- such a pair of amino acid residues is stapled, e.g., through olefin metathesis.
- olefin in a staple is reduced.
- a staple has the structure of ⁇ L a ⁇ CH 2 ⁇ CH 2 ⁇ L a ⁇ , wherein each variable is independently as described herein.
- one L a is L s1 as described herein, and one L a is L s3 as described herein.
- two amino acid residues, e.g., of amino acids independently of formula A- I or a salt of, connected by a staple have the structure of ⁇ N(R a1 ) ⁇ L a1 ⁇ C( ⁇ L s ⁇ R AA )(R a3 ) ⁇ L a2 ⁇ CO ⁇ , wherein each variable is independently as described herein, and R AA is an amino acid residue.
- two amino acid residues e.g., of amino acids independently of formula A-I or a salt of, connected by a staple have the structure of ⁇ N( ⁇ L s ⁇ R AA ) ⁇ L a1 ⁇ C(R a2 )(R a3 ) ⁇ L a2 ⁇ CO ⁇ , wherein each variable is independently as described herein, and R AA is an amino acid residue.
- two amino acid residues e.g., of amino acids independently of formula A-I or a salt of, connected by a staple have the structure of R a1 ⁇ N( ⁇ L s ⁇ R AA ) ⁇ L a1 ⁇ C(R a2 )(R a3 ) ⁇ L a2 ⁇ CO ⁇ , wherein each variable is independently as described herein, and R AA is an amino acid residue.
- three amino acid residues e.g., of amino acids independently of formula A-I or a salt of, connected by two staples have the structure of R a1 ⁇ N( ⁇ L s ⁇ R AA ) ⁇ L a1 ⁇ C( ⁇ L s ⁇ R AA )(R a3 ) ⁇ L a2 ⁇ CO ⁇ , wherein each variable is independently as described herein, and R AA is an amino acid residue.
- three amino acid residues e.g., of amino acids independently of formula A-I or a salt of, connected by two staples have the structure of ⁇ N( ⁇ L s ⁇ R AA ) ⁇ L a1 ⁇ C( ⁇ L s ⁇ R AA )(R a3 ) ⁇ L a2 ⁇ CO ⁇ , wherein each variable is independently as described herein, and R AA is an amino acid residue.
- three amino acid residues e.g., of amino acids independently of formula A-I or a salt of, connected by two staples (e.g., X 4 stapled with both X 1 and X 14 ) have the structure of ⁇ N(R a1 ) ⁇ L a1 ⁇ C( ⁇ L s ⁇ R AA )( ⁇ L s ⁇ R AA ) ⁇ L a2 ⁇ CO ⁇ , wherein each variable is independently as described herein, and R AA is an amino acid residue.
- each R AA is independently a residue of an amino acid of formula A-I, A-II, A-III, A-IV, A-V, A-VI, etc. or a salt thereof.
- R AA is ⁇ C(R a3 )[ ⁇ L a1 ⁇ N(R a1 ) ⁇ ]( ⁇ L a2 ⁇ CO ⁇ ), wherein each variable is independently as described herein. In some embodiments, R AA is ⁇ C(R a3 )[ ⁇ N(R a1 ) ⁇ ]( ⁇ CO ⁇ ), wherein each variable is independently as described herein. In some embodiments, each R AA is independently ⁇ N( ⁇ )[ ⁇ L a1 ⁇ C(R a2 )(R a3 ) ⁇ L a2 ⁇ CO ⁇ ], wherein each variable is independently as described herein, wherein ⁇ C( ⁇ )(R a3 ) ⁇ is bonded to a staple.
- each R AA is independently ⁇ N( ⁇ )[ ⁇ C(R a2 )(R a3 ) ⁇ CO ⁇ ], wherein each variable is independently as described herein, wherein ⁇ C( ⁇ )(R a3 ) ⁇ is bonded to a staple.
- each R AA is independently R a1 ⁇ N( ⁇ )[ ⁇ L a1 ⁇ C(R a2 )(R a3 ) ⁇ L a2 ⁇ CO ⁇ ], wherein each variable is independently as described herein, wherein ⁇ C( ⁇ )(R a3 ) ⁇ is bonded to a staple.
- each R AA is independently R a1 ⁇ N( ⁇ )[ ⁇ C(R a2 )(R a3 ) ⁇ CO ⁇ ], wherein each variable is independently as described herein, wherein ⁇ C( ⁇ )(R a3 ) ⁇ is bonded to a staple.
- Various staples e.g., L s , are as described herein.
- L s is ⁇ L s1 ⁇ L s2 ⁇ L s3 ⁇ as described herein.
- L s1 is L a as described herein.
- L s3 is L a as described herein.
- L s1 is L a of a first of two stapled amino acid residues.
- L s2 is L a of a second of two stapled amino acid residues.
- L s2 is or comprises a double bond.
- L s2 is or comprises optionally substituted ⁇ CH 2 ⁇ CH 2 ⁇ .
- L s2 is or comprises ⁇ CH 2 ⁇ CH 2 ⁇ .
- L s2 is or comprises ⁇ C(O)N(R’) ⁇ (e.g., a staple formed by two amino acid residues one of which has a R SP1 group that is or comprises an amino group and the other of which has a R SP2 group that is or comprises ⁇ COOH).
- L s2 is or comprises ⁇ C(O)NH ⁇ .
- each of L s1 and L s3 is independently optionally substituted linear or branched C 1-10 hydrocarbon chain.
- each of L s1 and L s3 is independently ⁇ (CH 2 )n ⁇ , wherein n is 1-10.
- L s1 is ⁇ CH 2 ⁇ .
- L s3 is ⁇ (CH 2 ) 3 ⁇ .
- L s is ⁇ (CH 2 ) 6 ⁇ .
- L s is ⁇ (CH 2 ) 2 ⁇ C(O)NH ⁇ (CH 2 ) 4 ⁇ .
- L s is bonded to two backbone carbon atoms. In some embodiments, L s is bonded to two alpha carbon atoms of two stapled amino acid residues.
- L s is bonded to a backbone nitrogen atom and a backbone carbon atom (e.g., an alpha carbon).
- L a comprises at least one ⁇ N(R’) ⁇ wherein R’ is independently as described in the present disclosure.
- L a comprises ⁇ L am1 ⁇ N(R’) ⁇ wherein R’ is independently as described in the present disclosure, and L am1 is as described herein.
- L a is or comprises ⁇ L am1 ⁇ N(R’) ⁇ L am2 ⁇ , wherein each of L am1 , R’, and L am2 is independently as described herein.
- R’ is optionally substituted C 1-6 aliphatic. In some embodiments, R’ is methyl. In some embodiments, R’ is taken together with R a3 to form an optionally substituted ring as described herein. In some embodiments, a formed ring is a 3-10 membered monocyclic saturated ring as described herein. In some embodiments, a formed ring has no additional heteroatom ring atom in addition to the nitrogen of ⁇ N(R’) ⁇ . In some embodiments, a formed ring is 3-membered. In some embodiments, a formed ring is 4-membered. In some embodiments, a formed ring is 5-membered. In some embodiments, a formed ring is 6-membered.
- L a comprises at least one ⁇ C(R’) 2 ⁇ wherein each R’ is independently as described in the present disclosure.
- L a comprises ⁇ L am1 ⁇ C(R’) 2 ⁇ wherein R’ is independently as described in the present disclosure, and L am1 is as described herein.
- L a is or comprises ⁇ L am1 ⁇ C(R’) 2 ⁇ L am2 ⁇ , wherein each of L am1 , R’, and L am2 is independently as described herein.
- R’ is ⁇ H.
- ⁇ C(R’) 2 ⁇ is optionally substituted ⁇ CH 2 ⁇ .
- ⁇ C(R’) 2 ⁇ is ⁇ CH 2 ⁇ .
- one R’ is taken together with R a3 to form an optionally substituted ring as described herein.
- a formed ring is a 3-10 membered monocyclic saturated ring as described herein.
- a formed ring has no additional heteroatom ring atom in addition to the nitrogen of ⁇ N(R’) ⁇ .
- a formed ring is 3- membered.
- a formed ring is 4-membered.
- a formed ring is 5- membered.
- a formed ring is 6-membered.
- each of L am1 and L am2 is independently L am as described herein.
- L am is a covalent bond, or an optionally substituted, bivalent C 1 -C 10 aliphatic group wherein one or more methylene units of the aliphatic group are optionally and independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ Cy ⁇ , ⁇ O ⁇ , ⁇ S ⁇ , ⁇ S ⁇ S ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ C(S) ⁇ , ⁇ C(NR’) ⁇ , ⁇ C(O)N(R’) ⁇ , ⁇ N(R’)C(O)N(R’) ⁇ , ⁇ N(R’)C(O)O ⁇ , ⁇ S(O) ⁇ , ⁇ S(O) 2 ⁇ , ⁇ S(O) 2 N(R’) ⁇ , ⁇ C(O)S ⁇ , or ⁇ C(O)O ⁇ .
- L am is a covalent bond. In some embodiments, L am is an optionally substituted bivalent C 1 -C 10 aliphatic group. In some embodiments, L am is an optionally substituted bivalent linear C 1 -C 10 aliphatic group. In some embodiments, L am is optionally substituted C 1-10 alkylene. In some embodiments, L am is C 1-10 alkylene. In some embodiments, L am is optionally substituted linear C 1-10 alkylene. In some embodiments, L am is optionally substituted ⁇ CH 2 ⁇ . In some embodiments, L am is ⁇ CH 2 ⁇ . [0183] In some embodiments, L am1 is a covalent bond.
- L am1 is an optionally substituted bivalent C 1 -C 10 aliphatic group. In some embodiments, L am1 is an optionally substituted bivalent linear C 1 -C 10 aliphatic group. In some embodiments, L am1 is optionally substituted C 1-10 alkylene. In some embodiments, L am1 is C 1-10 alkylene. In some embodiments, L am1 is optionally substituted linear C 1-10 alkylene. In some embodiments, L am1 is optionally substituted ⁇ CH 2 ⁇ . In some embodiments, L am1 is ⁇ CH 2 ⁇ . In some embodiments, L am1 is bonded to a backbone atom. In some embodiments, L am1 is bonded to an alpha-carbon of an amino acid.
- L am2 is a covalent bond. In some embodiments, L am2 is an optionally substituted bivalent C 1 -C 10 aliphatic group. In some embodiments, L am2 is an optionally substituted bivalent linear C 1 -C 10 aliphatic group. In some embodiments, L am2 is optionally substituted C 1-10 alkylene. In some embodiments, L am2 is C 1-10 alkylene. In some embodiments, L am2 is optionally substituted linear C 1-10 alkylene. In some embodiments, L am2 is optionally substituted ⁇ CH 2 ⁇ . In some embodiments, L am2 is ⁇ CH 2 ⁇ . In some embodiments, L am2 is or comprises ⁇ C(O) ⁇ .
- ⁇ C(O) ⁇ is bonded to a nitrogen atom.
- L am2 is or comprises ⁇ S(O) 2 ⁇ . In some embodiments, ⁇ S(O) 2 ⁇ is bonded to a nitrogen atom. In some embodiments, L am2 is or comprises ⁇ O ⁇ . In some embodiments, L am2 is or comprises ⁇ C(O) ⁇ O ⁇ . In some embodiments, ⁇ C(O) ⁇ O ⁇ is bonded to a nitrogen atom. In some embodiments, L am2 is bonded to a nitrogen atom, and it comprises a ⁇ C(O) ⁇ group which is bonded to the nitrogen atom.
- each of R a2 and R a3 independently comprises a double bond, e.g., a terminal olefin which can be optionally and independently stapled with another residue comprising an olefin.
- an amino acid are stapled with two amino acid residues independently through R a2 and R a3 .
- such an amino acid is B5.
- it is B3.
- it is B4.
- it is B6.
- an amino acid is selected from Tables A-I, A-II, A-III and A-IV (may be presented as Fmoc-protected).
- Fmoc-protected amino groups and carboxyl groups may independently form amide connections with other amino acid residues (or N- or C-terminus capping groups, or exist as N- or C- terminus amino or carboxyl groups).
- Olefins, including those in Alloc groups, may be utilized to form staples through olefin metathesis.
- Staples comprising olefins may be further modified, e.g., through hydrogenation to convert olefin double bonds into single bonds, and/or through CO 2 extrusion to convert carbamate moieties (e.g., ⁇ O ⁇ (CO) ⁇ N(R’) ⁇ ) into amine moieties (e.g., ⁇ N(R’) ⁇ ).
- an agent is or comprises a stapled peptide (e.g., a stapled peptide described according to Table E2 or Table E3) or a salt thereof, in which stapled peptide each double bond is converted into a single bond.
- a conversion is achieved through hydrogenation which adds a ⁇ H to each olefin carbon atom.
- an olefin double bond is replaced with ⁇ CHR’ ⁇ CHR’ ⁇ , wherein each R’ is independently as described herein.
- R’ is R as described herein.
- R’ is ⁇ H.
- each R’ is ⁇ H.
- R’ is ⁇ OR, wherein R is as described herein.
- R’ is ⁇ OH.
- R’ is ⁇ N(R) 2 wherein each R is independently as described herein.
- R’ is ⁇ SR wherein R is as described herein.
- R’ is R wherein R is optionally substituted aliphatic, e.g., C 1-10 aliphatic. In some embodiments, R’ is R wherein R is optionally substituted aliphatic, e.g., C 1-10 alkenyl. In some embodiments, R’ is R wherein R is optionally substituted aliphatic, e.g., C 1-10 alkynyl. In some embodiments, ⁇ CHR’ ⁇ CHR’ ⁇ is ⁇ CH 2 ⁇ CH 2 ⁇ . [0188] Table A-I. Exemplary amino acids (Fmoc-Protected).
- an amino acid is an alpha-amino acid.
- an amino acid is an L-amino acid.
- an amino acid is a D-amino acid.
- the alpha-carbon of an amino acid is achiral.
- an amino acid is a beta-amino acid.
- an amino acid is a gamma-amino acid.
- a provided amino acid sequence contains two or more amino acid residues whose side chains are linked together to form one or more staples.
- a provided amino acid sequence contains two or more amino acid residues, each of which independently has a side chain comprising an olefin. In some embodiments, a provided amino acid sequence contains two or more amino acid residues, each of which independently has a side chain comprising a terminal olefin. In some embodiments, a provided amino acid sequence contains two and no more than two amino acid residues, each of which independently has a side chain comprising an olefin. In some embodiments, a provided amino acid sequence contains two and no more than two amino acid residues, each of which independently has a side chain comprising a terminal olefin.
- a provided amino acid sequence comprises at least one residue of an amino acid that comprises an olefin and a nitrogen atom other than the nitrogen atom of its amino group. In some embodiments, a provided amino acid sequence comprises at least one residue of an amino acid that comprises a terminal olefin and a nitrogen atom other than the nitrogen atom of its amino group. In some embodiments, a provided amino acid sequence comprises at least one residue of an amino acid that has a side chain than comprises a terminal olefin and a nitrogen atom.
- a provided amino acid sequence comprises at least one residue of an amino acid of formula A-I, wherein R a2 comprising an olefin and a ⁇ N(R’) ⁇ moiety, wherein R’ is as described in the present disclosure (including, in some embodiments, optionally taken together with R a3 and their intervening atoms to form an optionally substituted ring as described in the present disclosure).
- R a2 comprising a terminal olefin and a ⁇ N(R’) ⁇ moiety wherein R’ is as described in the present disclosure.
- a provided amino acid sequence comprises at least one residue of an amino acid selected from Table A-I.
- a provided amino acid sequence comprises at least one residue of an amino acid selected from Table A-II. In some embodiments, a provided amino acid sequence comprises at least one residue of an amino acid selected from Table A-III. In some embodiments, two olefins from two side chains are linked together through olefin metathesis to form a staple. In some embodiments, a staple is preferably formed by side chains of amino acid residues that are not at the corresponding positions of a target of interest. In some embodiments, a formed staple does not disrupt interaction between the peptide and a target of interest. [0193] In some embodiments, a provided staple is a hydrocarbon staple.
- a hydrocarbon staple comprises no chain heteroatoms wherein a chain of a staple is the shortest covalent connection within the staple from one end of the staple to the other end of the staple.
- an olefin in a staple is a Z-olefin.
- an olefin in a staple in an E-olefin in some embodiments, a provided composition comprises stapled peptides comprising a staple that contains a Z-olefin and stapled peptides comprising a staple that contains an E-olefin.
- a provided composition comprises stapled peptides comprising a staple that contains a Z- olefin.
- a provided composition comprises stapled peptides comprising a staple that contains an E-olefin.
- otherwise identical stapled peptides that differ only in the E/Z configuration of staple olefin demonstrate different properties and/or activities as demonstrated herein.
- stapled peptides with E-olefin in a staple may provide certain desirable properties and/or activities given the context.
- stapled peptides with Z-olefin in a staple may provide certain desirable properties and/or activities given the context.
- the present disclosure provides compositions comprising stapled peptides.
- a composition comprises one and only one stereoisomer of a stapled peptide (e.g., E or Z isomer, and/or a single diastereomer/enantiomer with respect to a chiral center, etc.).
- a composition comprises two or more stereoisomers (e.g., both E and Z isomers of one or more double bonds, and/or one or more diastereomers/enantiomers with respect to a chiral center, etc.).
- a composition corresponds to a single peak in a chromatographic separation, e.g., HPLC.
- a peak comprises one and only one stereoisomers.
- a peak comprises two or more stereoisomers.
- two staples may be bonded to the same atom of the peptide backbone, forming a stitched peptide.
- a staple is pro-lock wherein one end of the staple is bonded to the alpha- carbon of a proline residue.
- a staple is a staple illustrated below in Tables S-1, S-2, S-3, S-4 and S-5 (with exemplary peptide backbone illustrated for clarity (can be applied to other peptide backbone), each X independently being an amino acid residue).
- a staple is a staple in Table S-6 (with amino acid residues bonded to staples illustrated).
- the olefin is Z.
- the olefin is E.
- an (i, i+3) staple is selected from Table S-1.
- an (i, i+3) staple is selected from Table S-2.
- “X 3 ” in those tables would be “X 2 ” (i.e., two amino acid residues instead of three amino acid residues).
- an (i, i+4) staple is selected from Table S-1.
- an (i, i+4) staple is selected from Table S-2. In some embodiments, an (i, i+7) staple is selected from Table S-3. In some embodiments, an (i, i+7) staple is selected from Table S-4. [0199] Table S-1. Exemplary staples.
- Table S-3 Exemplary staples.
- a staple may be one of the following, connecting the amino acids at the indicated position:
- a peptide comprises a staple or stitch (two staples) from Table S-6.
- the amino acid residues can either be from N to C or C to N. In some embodiments, it is N to C. In some embodiments, it is C to N.
- a double bond is E. In some embodiments, a double bond is Z.
- a staple is a (i, i+2) staple. In some embodiments, a staple is a (i, i+3) staple. In some embodiments, a staple is a (i, i+4) staple. In some embodiments, a staple is a (i, i+7) staple.
- each double is independently E or Z when a structure comprises more than one double bond.
- each staple is independently a (i, i+2) or a (i, i+3) or a (i, i+4) staple or a (i, i+7) staple.
- each staple is independently a (i, i+2) or a (i, i+4) staple or a (i, i+7) staple.
- each staple is independently a (i, i+3) or a (i, i+4) staple or a (i, i+7) staple.
- each staple is independently a (i, i+4) staple or a (i, i+7) staple in a structure comprising two staples.
- one staple is a (i, i+4) staple and the other is a (i, i+7) staple.
- one staple is a (i, i+3) staple, one staple is a (i, i+4) staple and one staple is a (i, i+7) staple.
- one staple is a (i, i+2) staple, one staple is a (i, i+4) staple and one staple is a (i, i+7) staple.
- a PL3 residue is bonded to a (i, i+3) staple. In some embodiments, a PL3 residue is bonded to a (i, i+4) staple.
- staples e.g., those in Table 6 are formed by metathesis of double bonds in side chains of amino acid residues, e.g., RdN and S7, R8 and PyrS, R5 and SeN, R6 and SeN, ReN and S5, ReN and S6, R7 and PyrS, Az and S7, R8 and SgN, Az and S8, R4 and SeN, R5 and SdN, R7 and Az, R8 and Az, RdN and S4, RgN and S8, RgN and S7, R8 and S5, PL3 and B5 and the same B5 and S8, PL3 and B5 and the same B5 and SeN, PL3 and B5 and the same B5 and SeN, PL3 and B5 and the same B5 and SdN, PL3 and
- the double bond in a (i, i+3) staple is Z. In some embodiments, the double bond in a (i, i+4) staple is Z. In some embodiments, the double bond in a (i, i+7) staple is Z. In some embodiments, the double bond in a (i, i+3) staple is E. In some embodiments, the double bond in a (i, i+4) staple is E. In some embodiments, the double bond in a (i, i+7) staple is E. [0207] In some embodiments, a staple comprises ⁇ S ⁇ . In some embodiments, stapling technologies comprise utilization of one or more, e.g., two or more, sulfur-containing moieties.
- a stapled peptide comprises cysteine stapling.
- two cysteine residues are stapled wherein the ⁇ S ⁇ moieties of the two cysteine residues are connected optionally through a linker.
- a stapled peptide comprises one and no more than one staples from cysteine stapling.
- a stapled peptide comprises one and no more than one staples having the structure of , , n some embodiments, a stapled peptide comprises one and no more than one staples having the structure of .
- a stapled peptide comprises one and no more than one staples having the structure of .
- a stapled peptide comprises one and no more than one staples having the structure of . In some embodiments, a stapled peptide comprises no staples having the structure of n some embodiments, a stapled peptide comprises no staples having the structure of . In some embodiments, a stapled peptide comprises no staples having the structure of In some embodiments, a stapled peptide comprises no staples having the structure of [0208] In some embodiments, the present disclosure provides useful technologies relating to cysteine stapling. Among other things, the present disclosure appreciates that peptides amenable to cysteine stapling and/or comprising one or more cysteine staples, can be produced and/or assessed in a biological system.
- cysteine stapled peptides having a range of different structures (e.g., different amino acid sequences), and in fact can provide a user with complete control over selection and implementation of amino acid sequences to be incorporated into stapled peptides.
- Cysteine stapling involves linking one cysteine residue to another cysteine residue, where the resulting bond is not through the peptide backbone between the linked cysteine residues.
- a stapled peptide as described herein comprises a staple which staple is L s , wherein: L s is ⁇ L s1 ⁇ S ⁇ L s2 ⁇ S ⁇ L s3 ⁇ ; L s1 and L s3 are each independently L; L s2 is L and comprises at least one ⁇ C(O) ⁇ ; and each L is independently a covalent bond, or an optionally substituted, bivalent C 1 -C 25 aliphatic group wherein one or more methylene units of the aliphatic group are optionally and independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ Cy ⁇ , ⁇ O ⁇ , ⁇ S ⁇ , ⁇ S ⁇ S ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ C(S) ⁇ , ⁇ C(NR’) ⁇ , ⁇ C(O)N(R’) ⁇ , ⁇ N(R’)C(O)N(R’) ⁇ , ⁇ N(R’) ⁇ , ⁇ N(
- L is independently a bivalent C 1 -C 25 aliphatic group. In some embodiments, L is independently a bivalent C 1 -C 20 aliphatic group. In some embodiments, L is independently a bivalent C 1 -C 10 aliphatic group. In some embodiments, L is independently a bivalent C 1 -C 5 aliphatic group. In some embodiments, L is independently a bivalent C 1 aliphatic group. In some embodiments, L is ⁇ CH 2 . [0212] In some embodiments, L s1 is ⁇ CH 2 ⁇ . In some embodiments, L s3 is ⁇ CH 2 ⁇ .
- L s1 and L s3 are both ⁇ CH 2 ⁇ .
- L s is ⁇ CH 2 ⁇ S ⁇ L s2 ⁇ S ⁇ CH 2 ⁇ .
- L s2 comprises ⁇ C(R’) 2 ⁇ L’ ⁇ C(R’) 2 ⁇ , wherein L’ is described in the present disclosure.
- L s2 is ⁇ L x1 ⁇ C(O)Q ⁇ L’ ⁇ QC(O) ⁇ L x1 ⁇ , wherein each variable is independently as described in the present disclosure.
- L s2 is ⁇ CH 2 C(O)Q ⁇ L’ ⁇ QC(O)CH 2 ⁇ , wherein each ⁇ CH 2 ⁇ is independently and optionally substituted. In some embodiments, L s2 is ⁇ CH 2 C(O)Q ⁇ L’ ⁇ QC(O)CH 2 ⁇ . [0214] In some embodiments, L s2 In some embodiments, L s2 is L and comprises at least one ⁇ C(O) ⁇ . In some embodiments, L s2 is L and comprises at least two ⁇ C(O) ⁇ .
- L s2 is L and comprises at least one ⁇ C(O)Q ⁇ , wherein Q is selected from the group consisting of: a covalent bond, ⁇ N(R’) ⁇ , ⁇ O ⁇ , and –S–. In some embodiments, L s2 is L and comprises at least one ⁇ C(O)Q ⁇ , wherein Q is selected between ⁇ N(R’) ⁇ and ⁇ O ⁇ . In some embodiments, L s2 is L and comprises at least two ⁇ C(O)Q ⁇ , wherein Q is selected from the group consisting of: ⁇ N(R’) ⁇ , ⁇ O ⁇ , and –S–.
- L s2 is L and comprises at least two ⁇ C(O)Q ⁇ , wherein Q is selected between ⁇ N(R’) ⁇ and ⁇ O ⁇ . In some embodiments, L s2 is L and comprises at least one ⁇ C(O)N(R’) ⁇ . In some embodiments, L s2 is L and comprises at least two ⁇ C(O)N(R’) ⁇ . In some embodiments, L s2 is L and comprises at least one ⁇ C(O)O ⁇ . In some embodiments, L s2 is L and comprises at least two ⁇ C(O)O ⁇ .
- L s2 comprises ⁇ Q ⁇ L’ ⁇ Q ⁇ , wherein Q is independently selected from the group consisting of: ⁇ N(R’) ⁇ , ⁇ O ⁇ , and ⁇ S, wherein L’ is described in the present disclosure.
- L s2 comprises ⁇ Q ⁇ L’ ⁇ Q ⁇ , wherein Q is independently selected between ⁇ N(R’) ⁇ and ⁇ O ⁇ , wherein L’ is described in the present disclosure.
- L s2 comprises – C(O)Q ⁇ L’ ⁇ QC(O) ⁇ , wherein Q is independently selected from the group consisting of: ⁇ N(R’) ⁇ , ⁇ O ⁇ , and ⁇ S, wherein L’ is described in the present disclosure.
- L s2 comprises – C(O)Q ⁇ L’ ⁇ QC(O) ⁇ , wherein Q is independently selected between ⁇ N(R’) ⁇ and ⁇ O, wherein L’ is described in the present disclosure.
- L s2 comprises –C(R’) 2 C(O)Q ⁇ L’ ⁇ QC(O)C(R’) 2 ⁇ , wherein Q is independently selected from the group consisting of: ⁇ N(R’) ⁇ , ⁇ O ⁇ , and ⁇ S, wherein L’ is described in the present disclosure.
- L s2 comprises –C(R’) 2 C(O)Q ⁇ L’ ⁇ QC(O)C(R’) 2 ⁇ , wherein Q is independently selected between ⁇ N(R’) ⁇ and ⁇ O, wherein L’ is described in the present disclosure.
- L s2 comprises ⁇ N(R’) ⁇ L’ ⁇ N(R’) ⁇ , wherein L’ is described in the present disclosure. In some embodiments, L s2 comprises ⁇ C(O)N(R’) ⁇ L’ ⁇ N(R’)C(O) ⁇ , wherein L’ is described in the present disclosure. In some embodiments, L s2 is ⁇ C(R’) 2 C(O)N(R’) ⁇ L’ ⁇ N(R’)C(O)C(R’) 2 ⁇ , wherein L’ is described in the present disclosure.
- L s2 comprises ⁇ O(R’) ⁇ L’ ⁇ O(R’) ⁇ , wherein L’ is described in the present disclosure. In some embodiments, L s2 comprises ⁇ C(O)O ⁇ L’ ⁇ OC(O) ⁇ , wherein L’ is described in the present disclosure. In some embodiments, L s2 is ⁇ C(R’) 2 C(O)O ⁇ L’ ⁇ OC(O)C(R’) 2 ⁇ , wherein L’ is described in the present disclosure. [0219] In some embodiments, R’ is an optionally substituted C 1-30 aliphatic. In some embodiments, R’ is an optionally substituted C 1-15 aliphatic.
- R’ is an optionally substituted C 1-10 aliphatic. In some embodiments, R’ is an optionally substituted C 1-5 aliphatic. In some embodiments, R’ is hydrogen. [0220] In some embodiments, L’ is optionally substituted bivalent C 1 -C 19 aliphatic. In some embodiments, L’ is optionally substituted bivalent C 1 -C 15 aliphatic. In some embodiments, L’ is optionally substituted bivalent C 1 -C 10 aliphatic. In some embodiments, L’ is optionally substituted bivalent C 1 -C 9 aliphatic. In some embodiments, L’ is optionally substituted bivalent C 1 -C 8 aliphatic.
- L’ is optionally substituted bivalent C 1 -C 7 aliphatic. In some embodiments, L’ is optionally substituted bivalent C 1 -C 6 aliphatic. In some embodiments, L’ is optionally substituted bivalent C 1 -C 5 aliphatic. In some embodiments, L’ is optionally substituted bivalent C 1 -C 3 aliphatic. In some embodiments, L’ is optionally substituted bivalent C 1 -C 2 aliphatic. In some embodiments, L’ is optionally substituted bivalent C 1 aliphatic. In some embodiments, L’ is ⁇ CH 2 ⁇ . In some embodiments, L’ is ⁇ (CH 2 ) 2 ⁇ .
- L’ is ⁇ (CH 2 ) 3 ⁇ . In some embodiments, L’ is ⁇ (CH 2 ) 4 ⁇ . In some embodiments, L’ is ⁇ (CH 2 ) 5 ⁇ . In some embodiments, L’ is ⁇ (CH 2 ) 6 ⁇ . In some embodiments, L’ is ⁇ (CH 2 ) 7 ⁇ . In some embodiments, L’ is ⁇ (CH 2 ) 8 ⁇ . [0221] In some embodiments, L’ is optionally substituted bivalent C 6-20 aryl ring. In some embodiments, L’ is optionally substituted bivalent C 6-14 aryl ring. In some embodiments, L’ is optionally substituted bivalent C 6-10 aryl ring.
- L’ is optionally substituted bivalent C 6 aryl ring. In some embodiments, L’ is bivalent C 6 aryl substituted with at least one halogen. In some embodiments, L’ is bivalent C 6 aryl substituted with at least two halogen. In some embodiments, L’ is bivalent C 6 aryl substituted with at least three halogen. In some embodiments, L’ is bivalent C 6 aryl substituted with four halogen. In some embodiments, L’ is bivalent C 6 aryl substituted with at least one fluorine. In some embodiments, L’ is bivalent C 6 aryl substituted with at least two fluorine.
- L’ is bivalent C 6 aryl substituted with at least three fluorine. In some embodiments, L’ is bivalent C 6 aryl substituted with four fluorine. In some embodiments, L’ is bivalent C 6 aryl substituted with at least one chlorine. In some embodiments, L’ is bivalent C 6 aryl substituted with at least two chlorine. In some embodiments, L’ is bivalent C 6 aryl substituted with at least three chlorine. In some embodiments, L’ is bivalent C 6 aryl substituted with four chlorine. In some embodiments, L’ is bivalent C 6 aryl substituted at with least one –O(CH2) 0-4 CH 3 .
- L’ is bivalent C 6 aryl substituted with at least two – O(CH2) 0-4 CH 3 . In some embodiments, L’ is bivalent C 6 aryl substituted with at least three –O(CH2) 0-4 CH 3 . In some embodiments, L’ is bivalent C 6 aryl substituted with four –O(CH2) 0-4 CH 3 . [0222] In some embodiments, L’ is bivalent 5-20 membered heteroaryl ring having 1-10 heteroatoms independently selected from oxygen, nitrogen, sulfur, phosphorus and silicon. In some embodiments, L’ is bivalent 5-6 membered heteroaryl ring having 1-4 heteroatoms independently selected from oxygen, nitrogen, sulfur, phosphorus and silicon.
- L’ is bivalent 5-6 membered heteroaryl ring having 1- 4 heteroatoms independently selected from oxygen, nitrogen, and sulfur. In some embodiments, L’ is bivalent 6 membered heteroaryl ring having 1-2 heteroatoms independently selected from oxygen, nitrogen, and sulfur. In some embodiments, L’ is bivalent 6 membered heteroaryl ring having 2 nitrogen. [0223] In some embodiments, L’ is optionally substituted bivalent C 3-20 cycloaliphatic ring. In some embodiments, L’ is optionally substituted bivalent C 3-15 cycloaliphatic ring. In some embodiments, L’ is optionally substituted bivalent C 3-10 cycloaliphatic ring.
- L’ is optionally substituted bivalent C 3-9 cycloaliphatic ring. In some embodiments, L’ is optionally substituted bivalent C 3-8 cycloaliphatic ring. In some embodiments, L’ is optionally substituted bivalent C 3-7 cycloaliphatic ring. In some embodiments, L’ is optionally substituted bivalent C 3-6 cycloaliphatic ring. In some embodiments, L’ is optionally substituted bivalent C 3-5 cycloaliphatic ring. In some embodiments, L’ is optionally substituted bivalent C 3-4 cycloaliphatic ring. In some embodiments, L’ is optionally substituted bivalent C 3 cycloaliphatic ring.
- L’ is optionally substituted bivalent C 4 cycloaliphatic ring. In some embodiments, L’ is optionally substituted bivalent C 5 cycloaliphatic ring. In some embodiments, L’ is optionally substituted bivalent C 5 cycloalkyl ring. In some embodiments, L’ is optionally substituted bivalent C 5 cycloalkenyl ring. In some embodiments, L’ is optionally substituted bivalent C 6 cycloaliphatic ring. In some embodiments, L’ is optionally substituted bivalent C 6 cycloalkyl ring. [0224] In some embodiments, L s2 comprises ⁇ N(R’) ⁇ L’ ⁇ N(R’) ⁇ and L’ is a covalent bond.
- L s2 comprises ⁇ N(R) ⁇ N(R) ⁇ , wherein: each R is independently ⁇ H, or an optionally substituted group selected from C 1-30 aliphatic, C 1-30 heteroaliphatic having 1-10 heteroatoms independently selected from oxygen, nitrogen, sulfur, phosphorus and silicon, C 6-30 aryl, C 6-30 arylaliphatic, C 6-30 arylheteroaliphatic having 1-10 heteroatoms independently selected from oxygen, nitrogen, sulfur, phosphorus and silicon, 5-30 membered heteroaryl having 1-10 heteroatoms independently selected from oxygen, nitrogen, sulfur, phosphorus and silicon, and 3-30 membered heterocyclyl having 1-10 heteroatoms independently selected from oxygen, nitrogen, sulfur, phosphorus and silicon, or two or more R groups on two or more atoms are optionally and independently taken together with their intervening atoms to form an optionally substituted, 3-30 membered, monocyclic, bicyclic or polycyclic ring having, in addition to the intervening atoms,
- L s2 comprises ⁇ N(R) ⁇ N(R) ⁇ , wherein: each R is independently optionally substituted C 1-30 aliphatic; or two or more R groups on two or more atoms are optionally and independently taken together with their intervening atoms to form an optionally substituted, 3-30 membered monocyclic ring.
- L s2 is a staple selected from the group consisting of: [0227]
- L s1 is optionally substituted bivalent C 1-6 aliphatic.
- L s1 is bivalent C 1-6 aliphatic.
- L s1 is bivalent C 1-4 aliphatic.
- L s1 is saturated. In some embodiments, L s1 is linear. In some embodiments, L s1 is branched. In some embodiments, L s1 is optionally substituted ⁇ CH 2 ⁇ . In some embodiments, L s1 is ⁇ CH 2 ⁇ . In some embodiments, L s1 is optionally substituted ⁇ CH 2 ⁇ CH 2 ⁇ . In some embodiments, L s1 is ⁇ CH 2 ⁇ CH 2 ⁇ . In some embodiments, L s1 is optionally substituted ⁇ C(CH 3 ) 2 ⁇ . In some embodiments, L s1 is ⁇ C(CH 3 ) 2 ⁇ .
- L s2 is optionally substituted bivalent C 1-6 , (e.g., C 3-6 , C 3 , C 4 , C 5 , C 6 , etc.) aliphatic wherein one or more methylene units are optionally and independently replaced with ⁇ Cy ⁇ or ⁇ C(R’) 2 ⁇ .
- L s2 is optionally substituted bivalent C 1-6 aliphatic.
- L s2 is optionally substituted bivalent C 3-6 aliphatic.
- L s2 is bivalent C 1-6 aliphatic.
- L s2 is bivalent C 1-4 aliphatic.
- L s2 is optionally substituted bivalent C 2 aliphatic. In some embodiments, L s2 is optionally substituted bivalent C 3 aliphatic. In some embodiments, L s2 is optionally substituted bivalent C 4 aliphatic. In some embodiments, L s2 is optionally substituted bivalent C 5 aliphatic. In some embodiments, L s2 is optionally substituted bivalent C 6 aliphatic. In some embodiments, L s2 is substituted. In some embodiments, L s2 is unsubstituted. In some embodiments, L s2 is saturated. In some embodiments, L s2 is linear. In some embodiments, L s2 is branched.
- L s2 is optionally substituted bivalent C 3-6 , (e.g., C 3-5 , C 3 , C 4 , C 5 , C 6 , etc.) aliphatic wherein one or two methylene units are independently replaced with ⁇ Cy ⁇ .
- L s2 is ⁇ CH 2 ⁇ Cy ⁇ CH 2 ⁇ .
- L s2 is ⁇ CH 2 ⁇ CH 2 ⁇ Cy ⁇ CH 2 ⁇ CH 2 ⁇ .
- L s2 is ⁇ CH 2 ⁇ Cy ⁇ Cy ⁇ CH 2 ⁇ .
- ⁇ Cy ⁇ are as described herein.
- ⁇ Cy ⁇ is an optionally substituted monocyclic 5-membered aromatic ring having 0-4 heteroatoms. In some embodiments, ⁇ Cy ⁇ is an optionally substituted monocyclic 6-membered aromatic ring having 0-4 heteroatoms. In some embodiments, ⁇ Cy ⁇ is optionally substituted phenylene. In some embodiments, ⁇ Cy ⁇ is optionally substituted 1,2-phenylene. In some embodiments, ⁇ Cy ⁇ is 1,2-phenylene. In some embodiments, ⁇ Cy ⁇ is optionally substituted 1,3-phenylene. In some embodiments, ⁇ Cy ⁇ is 1,3-phenylene. In some embodiments, ⁇ Cy ⁇ is optionally substituted 1,5-phenylene.
- ⁇ Cy ⁇ is 1,5- phenylene. In some embodiments, ⁇ Cy ⁇ is 3-methyl-1,5-phenylene. In some embodiments, ⁇ Cy ⁇ is 3- methoxy-1,5-phenylene. In some embodiments, ⁇ Cy ⁇ is an optionally substituted bivalent pyridyl ring. In some embodiments, ⁇ Cy ⁇ is optionally substituted . In some embodiments, ⁇ Cy ⁇ is . In some embodiments, ⁇ Cy ⁇ is optionally substituted . In some embodiments, ⁇ Cy ⁇ is . In some embodiments, ⁇ Cy ⁇ is an optionally substituted bicyclic 9-membered aromatic ring having 0-4 heteroatoms.
- ⁇ Cy ⁇ is an optionally substituted bicyclic 10-membered aromatic ring having 0-4 heteroatoms. In some embodiments, ⁇ Cy ⁇ is an optionally substituted bivalent naphthyl ring. In some embodiments, ⁇ Cy ⁇ is a bivalent naphthyl ring. In some embodiments, ⁇ Cy ⁇ is optionally substituted . In some embodiments, ⁇ Cy ⁇ is .
- ⁇ Cy ⁇ is optionally substituted
- ⁇ Cy ⁇ is n some embodiments, ⁇ Cy ⁇ is an optionally substituted 3-10 (e.g., 5-10, 5-6, 3, 4, 5, 6, 7, 8, 9, 10, etc.) membered bivalent cycloaliphatic ring. In some embodiments, it is saturated. In some embodiments, ⁇ Cy ⁇ is an optionally substituted 6-membered cycloalkyl ring.
- ⁇ Cy ⁇ is optionally substituted
- ⁇ Cy ⁇ is n some e s2 mbodiments
- L is optionally substituted bivalent C 3-6 , (e.g., C 3-5 , C 3 , C 4 , C 5 , C 6 , etc.) aliphatic wherein one or two methylene units are independently replaced with ⁇ C(R’) 2 ⁇ .
- L s2 is ⁇ CH 2 ⁇ C(R’) 2 ⁇ CH 2 ⁇ .
- the two R’ are taken together with the carbon atom to form an optionally substituted ring as described herein, e.g., an optionally substituted 3-10 (e.g., 5-10, 5-6, 3, 4, 5, 6, 7, 8, 9, 10, etc.) membered ring having 0-4 (e.g., 1-4, 0, 1, 2, 3, 4, etc.) heteroatoms.
- a ring is saturated.
- a ring has one or more heteroatoms.
- ⁇ C(R’) 2 ⁇ is [0229]
- L s2 is optionally substituted n some embodiments, L s2 is optionally substituted In some em s2 bodiments, L is optionally substituted . In some embodiments, L s2 is optionally substituted . n some embodiments, L s2 is optionally substituted . In some embodiments, L s2 is optionally substituted . In some embodiments, L s2 is optionally substituted . n some embodiments, L s2 is optionally substituted .
- L s3 is optionally substituted bivalent C 1-6 aliphatic. In some embodiments, L s3 is bivalent C 1-6 aliphatic. In some embodiments, L s3 is bivalent C 1-4 aliphatic. In some embodiments, L s3 is saturated. In some embodiments, L s3 is linear. In some embodiments, L s3 is branched. In some embodiments, L s3 is optionally substituted ⁇ CH 2 ⁇ . In some embodiments, L s3 is ⁇ CH 2 ⁇ . In some embodiments, L s3 is optionally substituted ⁇ CH 2 ⁇ CH 2 ⁇ . In some embodiments, L s3 is ⁇ CH 2 ⁇ CH 2 ⁇ . In some embodiments, L s3 is ⁇ CH 2 ⁇ CH 2 ⁇ . In some embodiments, L s3 is ⁇ CH 2 ⁇ CH 2 ⁇ .
- L s3 is optionally substituted ⁇ C(CH 3 ) 2 ⁇ . In some embodiments, L s3 is ⁇ C(CH 3 ) 2 ⁇ .
- an amino acid residue for forming a staple is selected from: In some embodiments, both amino acid residue for forming a staple are independently residues of these amino acids. In some embodiments, each of L s1 and L s3 is independently ⁇ CH 2 ⁇ , ⁇ CH 2 ⁇ CH 2 ⁇ , or ⁇ C(CH 3 ) 2 ⁇ . In some embodiments, a staple is formed by reacting the thiol groups with a thiol reactive linker compound.
- such a linker compound has the structure of LG ⁇ L s2 ⁇ LG or a salt thereof, wherein each LG is independently a leaving group, e.g., ⁇ Br, ⁇ I, etc.
- each LG is independently ⁇ Br or ⁇ I.
- each LG is ⁇ Br.
- each LG is ⁇ I.
- L s2 are of such structures that LG ⁇ L s2 ⁇ LG (each LG is independently ⁇ Br or ⁇ I) is a compound selected from:
- thioether staples Various technologies are available for constructing of thioether staples.
- a peptide and excess equivalents e.g., about 2-10, 5-10, 2, 3, 4, 5, 6, 7, 8, 9, 10, etc.; in some embodiments, 5
- a linker compound were added to a 1:1 DMF : 100 mM Na 2 CO 3 pH 8.0 solution and stirred at a suitable temperature, e.g., room temperature for a suitable period of time, in some embodiments, 1-2 hours.
- excess equivalents e.g., about 10- 30, 10-20, 10, 20, etc.; in some embodiments, 20
- a metal salt e.g., Zn(acac) 2
- an excess equivalents e.g., about 5-20, 10-15, 10, 15, 20, etc.; in some embodiments, 10-15
- a linker compound e.g., a linker compound
- a suitable period of time e.g., overnight
- a suitable temperature e.g., 37 °C.
- equivalents of Zn(acac) 2 and linker compounds were doubled, and/or the temperature was increased to 50 °C.
- a staple having the structure of ⁇ L s1 ⁇ S ⁇ L s2 ⁇ S ⁇ L s3 ⁇ is a (i, i+4) staple. In some embodiments, such a staple is in closer to a C-terminus. In some embodiments, such a staple is in closer to a N-terminus.
- such a staple is between X 10 and X 14 .
- certain staples provide better properties and/or activities.
- certain staples/scaffolds is ranked in the following order: [0235] As those skilled in the art will appreciate, provided technologies can be utilized to prepare collection of peptides using non-cysteine residues and suitable chemistry therefor.
- cysteine stapling is replaced with lysine stapling, wherein the cysteine residues for cysteine stapling are replaced with lysine residues for lysine stapling (e.g., using agents that can crosslink two lysine residues, for example, through reactions with side chain amino groups).
- R E in various formulae is or comprises an activated carboxylic acid group (e.g., NHS ester group), an imidoester group, etc. Suitable reagents are widely known in the art including many commercially available ones.
- cysteine stapling is replaced with methionine stapling.
- cysteine residues for cysteine stapling are replaced with methionine residues for methionine stapling. In some embodiments, cysteine stapling is replaced with tryptophan stapling. In some embodiments, cysteine residues for cysteine stapling are replaced with tryptophan residues for tryptophan stapling.
- various technologies e.g., reagents, reactions, etc. are described in the art and can be utilized in accordance with the present disclosure for, e.g., methionine stapling, tryptophan stapling, etc.
- such stapling can be performed using reagents having various formulae described herein, wherein R E is or comprises a group that are suitable for methionine and/or tryptophan stapling.
- stapling may be performed using one residue at a first position, and a different residue at a second position.
- Useful reagents for such stapling may comprise a first reactive group for stapling at a first position (e.g., through a first R E ), and a second reactive group for stapling at a second position (e.g., through a second R E ).
- stapling is between residues (e.g., cysteine residues for cysteine stapling) separated by two residues (i+3 stapling). In some embodiments, stapling is between residues separated by three residues (i+4 stapling). In some embodiments, stapling is between residues separated by six residues (i+7 stapling). [0237] As appreciated by those skilled in the art, in some embodiments, more than two residues can be stapled at the same time.
- cysteines are stapled using crosslinking reagents containing three or more reactive groups (e.g., R E groups).
- R E groups reactive groups
- the present disclosure provides useful technologies relating to non-cysteine stapling.
- peptides amenable to cysteine stapling and/or comprising one or more non-cysteine staples can have its cysteine residues and cysteine staple replaced with other amino acids and staples described herein (e.g. hydrocarbon and other non-hydrocarbon amino acid and staples).
- the resulting non-cysteine stapled peptide maintains the same or similar interaction with a target of interest when compared to a reference cysteine stapled peptide.
- Certain useful agents peptides prior to stapling and stapled peptides post stapling
- compositions thereof are presented in Table E2 or Table E3 as examples, which includes various amino acid residues and N- and C-terminus capping groups for various positions as examples; also illustrated are various stapling patterns, e.g., X 1 ⁇ X 4 ⁇ X 11 , X 1 ⁇ X 3 , X 3 ⁇ X 7 , X 3 ⁇ X 10 , X 4 ⁇ X 11 , X 7 ⁇ X 10 , X 7 ⁇ X 14 , X 10 ⁇ X 14 , etc.
- a provided agent, a peptide, or a stapled peptide is a compound as described herein.
- a provided agent has a structure selected from Table E2 or Table E3, or a salt thereof.
- a provided agent is a stereoisomer of a structure selected from Table E2 or Table E3, or a salt thereof.
- a provided agent is a stereoisomer, with respect to a chiral center bonded to two staples (e.g., in B4, B5, etc.), of a structure selected from Table E2 or Table E3, or a salt thereof.
- a provided agent is a stereoisomer, with respect to olefin double bond(s) in staple(s), of a structure selected from Table E2 or Table E3, or a salt thereof.
- a provided agent is a stereoisomer, with respect to olefin double bond(s) in staple(s) and/or a chiral center bonded to two staples (e.g., in B4, B5, etc.), of a structure selected from Table E2 or Table E3, or a salt thereof.
- a provided composition is a composition described in Table E2 or Table E3.
- a compound has the structure of (SP-1) or a salt thereof.
- a compound has the structure of (SP-2) or a salt thereof. In some embodiments, a compound has the structure of (SP-3) or a salt thereof. In some embodiments, a compound has the structure of
- SP-4 or a salt thereof.
- a compound has the structure of SP-5) or a salt thereof.
- a salt thereof in some embodiments, a
- a compound has the structure of (SP-6) or a salt thereof. In some embodiments, a compound has the structure of SP-7) or a salt thereof. In some
- a compound has the structure of (SP- 8) or a salt thereof. In some embodiments, a compound has the structure of SP-9) or a salt thereof. In some embodiments, a
- a compound has the structure of SP-10) or a salt thereof. In some embodiments, a compound has the structure of (SP-11) or a salt thereof. In some embodiments, a
- a compound has the structure of (SP-12) or a salt thereof. In some embodiments, a compound has the structure of SP-13) or a salt thereof. In some embodiments, a compound has the structure of
- a compound has the structure of SP-15) or a salt thereof.
- a double bond of a (i, i+2) staple is E.
- a double bond of a (i, i+2) staple is Z.
- a double bond of a (i, i+3) staple is E.
- a double bond of a (i, i+3) staple is Z.
- a double bond of a (i, i+7) staple is E.
- a double bond of a (i, i+7) staple is Z.
- both double bonds are E.
- both double bonds are Z.
- a (i, i+3) staple is E, and the other is Z.
- a (i, i+3) staple is Z, and the other is E.
- a (i, i+4) staple is E, and the other is Z.
- a (i, i+4) staple is Z, and the other is E.
- a double bond of a (i, i+7) staple is Z, and a double bond of a second staple (e.g., (i, i+2), (i, i+3), (i, i+4), etc.) is E.
- a double bond of a (i, i+7) staple is Z, and a double bond of a second staple (e.g., (i, i+2), (i, i+3), (i, i+4), etc.) is Z.
- a double bond of a (i, i+7) staple is E, and a double bond of a second staple (e.g., (i, i+2), (i, i+3), (i, i+4), etc.) is E.
- a double bond of a (i, i+7) staple is E
- a double bond of a second staple e.g., (i, i+2), (i, i+3), (i, i+4), etc.
- two staples are bonded to a chiral center (e.g., a carbon atom in B5), and the chiral center is R.
- two staples are bonded to a chiral center (e.g., a carbon atom in B5), and the chiral center is S.
- a compound has the structure selected from below or a salt thereof:
- an agent is SP-1-1 or a salt thereof. In some embodiments, an agent is SP-1-2 or a salt thereof. In some embodiments, an agent is SP-1-3 or a salt thereof. In some embodiments, an agent is SP-1- 4 or a salt thereof. In some embodiments, an agent is SP-1-5 or a salt thereof. In some embodiments, an agent is SP-1-6 or a salt thereof. In some embodiments, an agent is SP-1-7 or a salt thereof. In some embodiments, an agent is SP-1-8 or a salt thereof. In some embodiments, an agent is SP-2-1 or a salt thereof. In some embodiments, an agent is SP-2-2 or a salt thereof. In some embodiments, an agent is SP-2-3 or a salt thereof.
- an agent is SP-2-4 or a salt thereof. In some embodiments, an agent is SP-2- 5 or a salt thereof. In some embodiments, an agent is SP-2-6 or a salt thereof. In some embodiments, an agent is SP-2-7 or a salt thereof. In some embodiments, an agent is SP-2-8 or a salt thereof. In some embodiments, an agent is SP-3-1 or a salt thereof. In some embodiments, an agent is SP-3-2 or a salt thereof. In some embodiments, an agent is SP-4-1 or a salt thereof. In some embodiments, an agent is SP-4-2 or a salt thereof. In some embodiments, an agent is SP-4-3 or a salt thereof. In some embodiments, an agent is SP-4- 4 or a salt thereof.
- an agent is SP-4-5 or a salt thereof. In some embodiments, an agent is SP-4-6 or a salt thereof. In some embodiments, an agent is SP-4-7 or a salt thereof. In some embodiments, an agent is SP-4-8 or a salt thereof. In some embodiments, an agent is SP-5-1 or a salt thereof. In some embodiments, an agent is SP-5-2 or a salt thereof. In some embodiments, an agent is SP-5-3 or a salt thereof. In some embodiments, an agent is SP-5-4 or a salt thereof. In some embodiments, an agent is SP-5- 5 or a salt thereof. In some embodiments, an agent is SP-5-6 or a salt thereof. In some embodiments, an agent is SP-5-7 or a salt thereof.
- an agent is SP-5-8 or a salt thereof. In some embodiments, an agent is SP-6 or a salt thereof. In some embodiments, an agent is SP-7-1 or a salt thereof. In some embodiments, an agent is SP-7-2 or a salt thereof. In some embodiments, an agent is SP-7-3 or a salt thereof. In some embodiments, an agent is SP-7-4 or a salt thereof. In some embodiments, an agent is SP-7- 5 or a salt thereof. In some embodiments, an agent is SP-7-6 or a salt thereof. In some embodiments, an agent is SP-7-7 or a salt thereof. In some embodiments, an agent is SP-7-8 or a salt thereof. In some embodiments, an agent is SP-8-1 or a salt thereof.
- an agent is SP-8-2 or a salt thereof. In some embodiments, an agent is SP-8-3 or a salt thereof. In some embodiments, an agent is SP-8-4 or a salt thereof. In some embodiments, an agent is SP-8-5 or a salt thereof. In some embodiments, an agent is SP-8- 6 or a salt thereof. In some embodiments, an agent is SP-8-7 or a salt thereof. In some embodiments, an agent is SP-8-8 or a salt thereof. In some embodiments, an agent is SP-9-1 or a salt thereof. In some embodiments, an agent is SP-9-2 or a salt thereof. In some embodiments, an agent is SP-9-3 or a salt thereof. In some embodiments, an agent is SP-9-4 or a salt thereof.
- an agent is SP-9-5 or a salt thereof. In some embodiments, an agent is SP-9-6 or a salt thereof. In some embodiments, an agent is SP-9- 7 or a salt thereof. In some embodiments, an agent is SP-9-8 or a salt thereof. In some embodiments, an agent is SP-10-1 or a salt thereof. In some embodiments, an agent is SP-10-2 or a salt thereof. In some embodiments, an agent is SP-10-3 or a salt thereof. In some embodiments, an agent is SP-10-4 or a salt thereof. In some embodiments, an agent is SP-10-5 or a salt thereof. In some embodiments, an agent is SP- 10-6 or a salt thereof. In some embodiments, an agent is SP-10-7 or a salt thereof.
- an agent is SP-10-8 or a salt thereof.
- an agent is SP-11-1 or a salt thereof.
- an agent is SP-11-2 or a salt thereof.
- an agent is SP-11-3 or a salt thereof.
- an agent is SP-11-4 or a salt thereof.
- an agent is SP- 11-5 or a salt thereof.
- an agent is SP-11-6 or a salt thereof.
- an agent is SP-11-7 or a salt thereof.
- an agent is SP-11-8 or a salt thereof.
- an agent is SP-12-1 or a salt thereof.
- an agent is SP-12-2 or a salt thereof.
- an agent is SP-12-3 or a salt thereof. In some embodiments, an agent is SP- 12-4 or a salt thereof. In some embodiments, an agent is SP-12-5 or a salt thereof. In some embodiments, an agent is SP-12-6 or a salt thereof. In some embodiments, an agent is SP-12-7 or a salt thereof. In some embodiments, an agent is SP-12-8 or a salt thereof. In some embodiments, an agent is SP-13-1 or a salt thereof. In some embodiments, an agent is SP-13-2 or a salt thereof. In some embodiments, an agent is SP- 13-3 or a salt thereof. In some embodiments, an agent is SP-13-4 or a salt thereof. In some embodiments, an agent is SP-13-5 or a salt thereof.
- an agent is SP-13-6 or a salt thereof. In some embodiments, an agent is SP-13-7 or a salt thereof. In some embodiments, an agent is SP-13-8 or a salt thereof. In some embodiments, an agent is SP-14-1 or a salt thereof. In some embodiments, an agent is SP- 14-2 or a salt thereof. In some embodiments, an agent is SP-14-3 or a salt thereof. In some embodiments, an agent is SP-14-4 or a salt thereof. In some embodiments, an agent is SP-14-5 or a salt thereof. In some embodiments, an agent is SP-14-6 or a salt thereof. In some embodiments, an agent is SP-14-7 or a salt thereof. In some embodiments, an agent is SP-14-8 or a salt thereof.
- an agent is SP- 15-1 or a salt thereof. In some embodiments, an agent is SP-15-2 or a salt thereof. In some embodiments, an agent is SP-15-3 or a salt thereof. In some embodiments, an agent is SP-15-4 or a salt thereof. In some embodiments, an agent is SP-15-5 or a salt thereof. In some embodiments, an agent is SP-15-6 or a salt thereof. In some embodiments, an agent is SP-15-7 or a salt thereof. In some embodiments, an agent is SP- 15-8 or a salt thereof. [0242] Agents, e.g., peptides including stapled peptides, can contain various numbers of amino acid residues.
- a length of a peptide agent is about 5-20, 5-19, 5-18, 5-17, 5-16, 5-15, 10- 20, 10-19, 10-18, 10-17, 10-16, 10-15, 11-20, 11-19, 11-18, 11-17, 11-16, 11-15, 12-20, 12-19, 12-18, 12-17, 12-16, 12-15, 13-20, 13-19, 13-18, 13-17, 13-16, 13-15, 14-20, 14-19, 14-18, 14-17, 14-16, 14-15, or about 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20 amino acid residues.
- a length is about 10 amino acid residues. In some embodiments, a length is about 11 amino acid residues.
- a length is about 12 amino acid residues. In some embodiments, a length is about 13 amino acid residues. In some embodiments, a length is about 14 amino acid residues. In some embodiments, a length is about 15 amino acid residues. In some embodiments, a length is about 16 amino acid residues. In some embodiments, a length is about 17 amino acid residues. In some embodiments, a length is about 18 amino acid residues. In some embodiments, a length is about 19 amino acid residues. In some embodiments, a length is about 20 amino acid residues. [0243] In some embodiments, as described herein, one or more staples independently comprise an olefin double bond (e.g., formed through olefin metathesis).
- one or more staples independently comprise an amide group (e.g., formed through amidation). In some embodiments, at least one staple does not contain an olefin double bond. In some embodiments, there is at least one staple whose formation does not comprise reactions of olefins such as olefin metathesis and/or modification of olefin double bonds (e.g., hydrogenation, epoxidation, etc.).
- a residue of a staple (e.g., B5) is so positioned that if its position is P (e.g., X 4 ), a first acidic amino acid residue is at position P-2 (e.g., X 2 ), a second acidic amino acid residue is positioned at P+1 (e.g., X 5 ), a third acidic amino acid residue is positioned at P+2 (e.g., X 6 ), a hydrophobic amino acid residue is positioned at P+4 (e.g., X 8 ), a first aromatic amino acid residue is positioned at P+5 (e.g., X 9 ), a second aromatic amino acid residue is positioned at P+8 (e.g., X 12 ), and/or a third aromatic amino acid residue is positioned at P+9 (e.g., X 13 ).
- a staple is a (i, i+7) staple, and the other residue of the staple is positioned at P+7 (e.g., X 11 ).
- a first acidic amino acid residue is at position P-2 (e.g., X 2 ).
- a second acidic amino acid residue is positioned at P+1 (e.g., X 5 ).
- a third acidic amino acid residue is positioned at P+2 (e.g., X 6 ).
- a hydrophobic amino acid residue is positioned at P+4 (e.g., X 8 ).
- a first aromatic amino acid residue is positioned at P+5 (e.g., X 9 ).
- a second aromatic amino acid residue is positioned at P+8 (e.g., X 12 ).
- a third aromatic amino acid residue is positioned at P+9 (e.g., X 13 ).
- a first acidic amino acid residue is at position P-2 (e.g., X 2 ), a second acidic amino acid residue is positioned at P+1 (e.g., X 5 ), a first aromatic amino acid residue is positioned at P+5 (e.g., X 9 ), a second aromatic amino acid residue is positioned at P+8 (e.g., X 12 ), and a third aromatic amino acid residue is positioned at P+9 (e.g., X 13 ).
- a first acidic amino acid residue is at position P-2 (e.g., X 2 ), a second acidic amino acid residue is positioned at P+1 (e.g., X 5 ), a third acidic amino acid residue is positioned at P+2 (e.g., X 6 ), a hydrophobic amino acid residue is positioned at P+4 (e.g., X 8 ), a first aromatic amino acid residue is positioned at P+5 (e.g., X 9 ), a second aromatic amino acid residue is positioned at P+8 (e.g., X 12 ), and a third aromatic amino acid residue is positioned at P+9 (e.g., X 13 ).
- a stapled peptide agent comprises acidic amino acid residues at positions P-2 and P+1, and aromatic amino acid residues at positions P+5, P+8 and P+9. In some embodiments, a stapled peptide agent comprises acidic amino acid residues at positions P-2, P+1 and P+2, and aromatic amino acid residues at positions P+5, P+8 and P+9. In some embodiments, a stapled peptide agent comprises acidic amino acid residues at positions P-2 and P+1, a hydrophobic amino acid residue at position P+4, and aromatic amino acid residues at positions P+5, P+8 and P+9.
- a stapled peptide agent comprises acidic amino acid residues at positions P-2, P+1 and P+2, a hydrophobic amino acid residue at position P+4, and aromatic amino acid residues at positions P+5, P+8 and P+9.
- P is 3.
- P is 4.
- P is 5.
- P is 6.
- P is 7.
- an amino acid residue at position P comprises two groups for stapling, e.g., B4, B5, B6, etc. In some embodiments, it is B4. In some embodiments, it is B5. In some embodiments, it is B6.
- an agent comprises a staple and a first additional staple, e.g., a (i, i+3) or (i, i+4) staple.
- a staple and a first additional staple are bonded to the same residue (e.g., B5, B6, etc.).
- the other residue of a first additional residue is at position P-2 (e.g., when a moiety for stapling like a terminal olefin is in a P-terminal group which is considered a portion of X 1 ), P-3 or P-4.
- an agent comprises a second additional staple, e.g., a (i, i+4) staple (e.g., stapling residues at positions P+6 (e.g., X 10 ) and P+10 (e.g., X 14 ), a (i, i+3) staple (e.g., stapling residues at positions P+3 (e.g., X 7 ) and P+6 (e.g., X 10 ), a (i, i+7) staple (e.g., stapling residues at positions P+3 (e.g., X 7 ) and P+10 (e.g., X 14 ), etc.).
- a (i, i+4) staple e.g., stapling residues at positions P+6 (e.g., X 10 ) and P+10 (e.g., X 14
- a (i, i+4) staple e.g., stapling residues
- an agent comprises a second additional staple which is a (i, i+4) staple stapling residues at positions P+6 (e.g., X 10 ) and P+10 (e.g., X 14 ).
- an agent comprises a third additional staple, e.g., a (i, i+4) staple stapling residues at positions P-1 (e.g., X 3 ) and P+3 (e.g., X 7 ).
- stapled agents comprising so positioned staples and residues can provide various desired properties and activities.
- positioning of one or more staples may be shifted relevant to various acidic, hydrophobic and/or aromatic amino acid residues described herein, e.g., in some embodiments, stapled peptide agents comprise stapled residues at position P and P+7 (and optionally P-3 or P-4), acidic amino acid residues are at positions P-1, and P+2, and aromatic amino acid residues at positions P+6, P+9 and P+10, and optionally an acid amino acid residue at P+3 and/or a hydrophobic amino acid residue at positon P+5.
- Beta-catenin [0246] Among other things, the present disclosure provides technologies for modulating one or more beta-catenin functions. In some embodiments, the present disclosure provides useful technologies for inhibiting one or more beta-catenin functions that are associated with cancer or hyperplasia. In some embodiments, provided technologies are useful for preventing and treating conditions, disorders or diseases whose prevention and/or treatment will benefits from inhibition of beta-catenin. In some embodiments, a condition, disorder or disease is cancer. [0247] Beta-catenin is reported to have various functions.
- beta-catenin can regulate and coordinate transcription of various genes. It is reported that high beta-catenin activity and/or expression levels may contribute to the development various conditions, disorders or diseases including cancer. Mutations and overexpression of beta-catenin are reported to be associated with conditions, disorders or diseases including many cancers including colorectal cancer, lung cancer, and breast cancer. Dysregulation of the Wnt/ ⁇ - catenin signaling pathway has reportedly been linked to a number of conditions, disorders or diseases, including neurodegenerative diseases, psychiatric diseases, cancers, asthma, and even wound healing. An abundance of published research, both clinical and preclinical, has indicated that hyperactivated Wnt/beta- catenin activity drives tumorigenesis and is required for tumor maintenance in various cancers.
- Wnt inhibitors largely modulate this pathway at the extracellular ligand/receptor level, e.g., by preventing Wnt ligand secretion or by blocking Wnt ligand interaction with its receptors at the plasma membrane. It has been reported that many activating Wnt pathway mutations are found in APC and/or CTNNB1, which are downstream of membrane-proximal events. Among other things, the present disclosure encompasses the recognition that many agents at the extracellular ligand/receptor level are insufficient to treat many relevant patients, e.g., those with downstream mutations/abnormalities. In some embodiments, Wnt pathway- activating mutations converge on beta-catenin/TCF node.
- Beta-catenin may interact with various agents at various binding sites each independently comprising a set of amino acid residues that interact with binding agents. For example, certain binding sites are utilized for beta-catenin interactions with Axin, APC, C-cadherin, E-cadherin, TCF3, and Bcl9. For interactions with TCF3, it has been reported that two or more binding sites may be utilized simultaneously to interact with different portions of TCF3.
- provided agents bind to beta-catenin at a unique binding site.
- provided agents interact with beta-catenin at a set of amino acid residues that are different from previously reported binding sites, e.g., those for Axin, APC, C-cadherin, E-cadherin, TCF3 or Bcl9.
- provided agents interact with one or more or all (e.g., about 1-23, 1-20, 1-15, 1-10, 1-5, 5-23, 5-20, 5-15, 5-10, 6-23, 6-20, 6-15, 6-10, 7-23, 7-20, 7-15, 7-10, 8-23, 8-20, 8-15, 8-10, 9-23, 9-20, 9-15, 9-10, 10-23, 10-20, 10-15, 11-23, 11-20, 11-15, 12-23, 12-20, 12-15, 13-23, 13- 20, 13-15, 13-23, 14-20, 15-23, 15-20, 16-23, 16-20, 17-23, 17-20, 18-23, or 18-20, or about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, or 23, etc.) of a set of amino acid residues that are or correspond to amino acid residues in SEQ ID NO: 1, e.g., in some embodiments, the following amino acid residues of SEQ ID NO:
- a set of amino acid residues are or correspond to amino acid residues A305, Y306, G307, N308, Q309, K312, R342, K345, V346, V349, Q375, Q379, N380, L382, W383, R386, N387, D413, N415, V416, T418, and C419 of SEQ ID NO: 1.
- a set of amino acid residues are or correspond to amino acid residues A305, Y306, G307, N308, Q309, K312, K345, V346, V349, Q379, N380, L382, W383, R386, N387, D413, N415, V416, T418, and C419 of SEQ ID NO: 1.
- a set of amino acid residues are or correspond to amino acid residues G307, K312, K345, W383, N387, D413, and N415 of SEQ ID NO: 1.
- a set of amino acid residues are or correspond to amino acid residues G307, K312, K345, Q379, L382, W383, N387, N415 and V416 of SEQ ID NO: 1. In some embodiments, a set of amino acid residues are or correspond to amino acid residues Y306, G307, K312, K345, Q379, L382, W383, N387, N415 and V416 of SEQ ID NO: 1. In some embodiments, a set of amino acid residues are or correspond to amino acid residues G307, K312, K345, Q379, L382, W383, R386, N387, N415 and V416 of SEQ ID NO: 1.
- a set of amino acid residues are or correspond to amino acid residues Y306, G307, K312, K345, Q379, L382, W383, R386, N387, N415 and V416 of SEQ ID NO: 1.
- a set of amino acid residues are or correspond to amino acid residues Y306, G307, K312, K345, V349, Q379, L382, W383, N387, N415 and V416 of SEQ ID NO: 1.
- a set of amino acid residues are or correspond to amino acid residues Y306, G307, K312, K345, V349, Q379, L382, W383, R386, N387, N415 and V416 of SEQ ID NO: 1.
- a set of amino acid residues are or correspond to amino acid residues G307, K312, K345, W383, and N387 of SEQ ID NO: 1.
- a set of amino acid residues are or correspond to amino acid residues Y306, G307, K312, R386 and N387 of SEQ ID NO: 1.
- provided agents interact with Y306 or an amino acid residue corresponding thereto.
- provided agents interact with G307 or an amino acid residue corresponding thereto. In some embodiments, provided agents interact with K312 or an amino acid residue corresponding thereto. In some embodiments, provided agents interact with K345 or an amino acid residue corresponding thereto. In some embodiments, provided agents interact with V349 or an amino acid residue corresponding thereto. In some embodiments, provided agents interact with Q379 or an amino acid residue corresponding thereto. In some embodiments, provided agents interact with L382 or an amino acid residue corresponding thereto. In some embodiments, provided agents interact with W383 or an amino acid residue corresponding thereto. In some embodiments, provided agents interact with R386 or an amino acid residue corresponding thereto.
- provided agents interact with N387 or an amino acid residue corresponding thereto. In some embodiments, provided agents interact with N415 or an amino acid residue corresponding thereto. In some embodiments, provided agents interact with V416 or an amino acid residue corresponding thereto. [0251] In some embodiments, a present agent interacts with a polypeptide whose sequence corresponds to aa 146-aa665 of human beta-catenin.
- a present agent interacts with a polypeptide whose sequence comprises or is SEQ ID NO: 2: SVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQESKLIIL ASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLTDPSQRLVQNCL WTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEAL VRT (SEQ ID NO: 2). [0252] In some embodiments, all amino acid residues that interact with a provided agent is with SEQ ID NO: 2.
- amino acid residues that interact with a provided agent interacts with an agent through hydrogen bonding, hydrophobic interactions or salt bridge.
- a provided agent e.g., one or more amino acid residues in an agent
- they are typically within a certain range of distances when, e.g., assessed using crystallography, NMR, etc.
- certain amino acid residues reported to interact with one or more polypeptides are not significantly involved in interactions between provided and beta-catenin.
- provided agents do not interact with an Axin binding site.
- provided agents do not interact with a Bcl9 binding site.
- provided agents do not interact with one or more or all of amino acid residues that are or correspond to N426, C429, K435, R469, H470, S473, R474, K508 and N516 of SEQ ID NO: 1. In some embodiments, provided agents do not interact with N426 or an amino acid residue corresponding thereto. In some embodiments, provided agents do not interact with C429 or an amino acid residue corresponding thereto. In some embodiments, provided agents do not interact with K435 or an amino acid residue corresponding thereto. In some embodiments, provided agents do not interact with R469 or an amino acid residue corresponding thereto. In some embodiments, provided agents do not interact with H470 or an amino acid residue corresponding thereto.
- provided agents do not interact with S473 or an amino acid residue corresponding thereto. In some embodiments, provided agents do not interact with R474 or an amino acid residue corresponding thereto. In some embodiments, provided agents do not interact with K508 or an amino acid residue corresponding thereto. In some embodiments, provided agents do not interact with N516 or an amino acid residue corresponding thereto. [0254] In some embodiments, mutation of one or more amino acid residues outside of SEQ ID NO: 2 in beta-catenin does not significant/y (e.g., not exceeding 30%, 40%, 50%, 60%, 70%, 75%, 80%, 85%, 90% or more) reduce interactions of beta-catenin with a provided agent.
- mutation of one or more or all of amino acid residues that are or correspond to N426, C429, K435, R469, H470, S473, R474, K508 and N516 of SEQ ID NO: 1 does not significantly reduce interactions of beta-catenin with a provided agent.
- mutation of N426 or an amino acid residue corresponding thereto does not significantly reduce interaction of beta-catenin with an agent.
- mutation of Q379 or an amino acid residue corresponding thereto (e.g., to Ala, Glu, Phe, Trp, etc.) does not significantly reduce interaction of beta-catenin with an agent.
- an agent binds to a TCF site of beta-catenin.
- an agent interacts with one or more but not all amino acid residues that interact with TCF.
- an agent interacts with one or more but not all amino acid residues that interact with an extended region of XTcf3-CBD.
- an agent does not interact with beta-catenin amino acid residues that interact with a beta-hairpin module of XTcf3-CBD.
- an agent does not interact with beta-catenin amino acid residues that interact with a helix module of XTcf3-CBD.
- an agent competes with TCF for beta-catenin binding.
- an agent competes with an extended region of TCF (e.g., Ala14-Glu24, or Asp16-Glu24, as described in Graham et al. Cell, Vol.103, 885–896, 2000) for beta-catenin binding.
- an agent compared to an extended region of TCF, an agent does not compete, or competes at a less degree, with Axin for beta-catenin binding.
- an agent does not compete, or competes at a less degree, with Bcl9 for beta-catenin binding. In some embodiments, compared to an extended region of TCF, an agent does not compete, or competes at a less degree, with a beta-hairpin module of XTcf3-CBD for beta-catenin binding. In some embodiments, compared to an extended region of TCF, an agent does not compete, or competes at a less degree, with a helix module of XTcf3-CBD for beta- catenin binding. In some embodiments, an agent competes with E-cadherin for beta-catenin binding.
- the present disclosure provides complexes of peptides (e.g., polypeptides whose sequences are or comprises SEQ ID NO: 1 or 2) and provided agents.
- polypeptides and provided agents interact with one or more or all amino acid residues as described herein, and optionally do not interact with one or more or all amino acid residues as described herein.
- the present disclosure provides complexes comprising a provided agent and a beta-catenin polypeptide or a portion thereof. In some embodiments, a portion thereof comprises one or more or all of the interacting residues as described herein.
- an agent and a beta- catenin polypeptide or a portion thereof interact with other at one or more or all of the interacting residues.
- Certain Agents [0259]
- the present disclosure provides an agent having the structure of formula I: R N ⁇ L P1 ⁇ L AA1 ⁇ L P2 ⁇ L AA2 ⁇ L P3 ⁇ L AA3 ⁇ L P4 ⁇ L AA4 ⁇ L P5 ⁇ L AA5 ⁇ L P6 ⁇ L AA6 ⁇ L P7 ⁇ R C , I or a salt thereof, wherein: R N is a peptide, an amino protecting group or R’ ⁇ L RN ⁇ ; each of L P1 , L P2 , L P3 , L P4 , L P5 , L P6 , and L P7 is independently L, wherein L P1 , L P2 , L P3 , L P4 , L P5 , L P6 , and L P7 comprise:
- the present disclosure provides an agent having the structure of formula I: R N ⁇ L P1 ⁇ L AA1 ⁇ L P2 ⁇ L AA2 ⁇ L P3 ⁇ L AA3 ⁇ L P4 ⁇ L AA4 ⁇ L P5 ⁇ L AA5 ⁇ L P6 ⁇ L AA6 ⁇ L P7 ⁇ R C , I or a salt thereof, wherein: R N is a peptide, an amino protecting group or R’ ⁇ L RN ⁇ ; each of L P1 , L P2 , L P3 , L P4 , L P5 , L P6 , and L P7 is independently L, wherein L P1 , L P2 , L P3 , L P4 , L P5 , L P6 , and L P7 comprise: a first R’ group and a second R’ group which are taken together to form ⁇ L s ⁇ which is bonded to the atom to which a first R’ group is
- a second R’ group and a third R’ group are attached to the same atom. In some embodiments, none of the first, second and fourth R’ groups are attached to the same atom. In some embodiments, none of the first, second, fourth, fifth and sixth R’ groups are attached to the same atom. In some embodiments, none of the first, second, fourth, fifth, sixth, seventh and eighth R’ groups are attached to the same atom. In some embodiments, each of the first, second, third and fourth R’ groups is independently attached to a different atom. In some embodiments, each of the first, second, third, fourth, fifth and sixth R’ groups is independently attached to a different atom.
- each of the first, second, third, fourth, fifth, sixth, seventh and eighth R’ groups is independently attached to a different atom.
- a compound of formula I is a stapled peptide as described herein.
- each L s is independently a staple as described herein.
- L s e.g., L s formed by taking a first and a second R’ groups, has a length of 5-20 (e.g., 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20) atoms.
- a length between two connection sites is the shortest covalent connection from one site to the other.
- the length of ⁇ CH 2 ⁇ CH 2 ⁇ is 2 atoms ( ⁇ C ⁇ C ⁇ )
- the length of 1, 3-phenylene is 3 atoms.
- L s e.g., L s formed by taking a third and a fourth R’ groups, has a length of 5-20 (e.g., 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20) atoms.
- L s e.g., L s formed by taking a fifth and a sixth R’ groups
- L s has a length of 5-20 (e.g., 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20) atoms.
- L s e.g., L s formed by taking a seventh and an eighth R’ groups
- L s has a length of 5-20 (e.g., 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20) atoms.
- staples e.g., L s
- connecting two atoms having a longer distance typically has a longer length than staples connecting two atom having a shorter distance, e.g., (i, i+7) staples typically have longer lengths than (i, i+3) or (i, i+4) staples.
- a length is 5 atoms.
- a length is 6 atoms.
- a length is 7 atoms.
- a length is 8 atoms.
- a length is 9 atoms.
- a length is 10 atoms.
- a length is 11 atoms. In some embodiments, a length is 12 atoms. In some embodiments, a length is 13 atoms. In some embodiments, a length is 14 atoms. In some embodiments, a length is 15 atoms. In some embodiments, a length is 16 atoms. In some embodiments, a length is 17 atoms. In some embodiments, a length is 18 atoms. In some embodiments, a length is 19 atoms. In some embodiments, a length is 20 atoms.
- L P1 is a covalent bond, or an optionally substituted, bivalent C 2 -C 6 aliphatic group, wherein one or more methylene units of the group are optionally and independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ Cy ⁇ , ⁇ O ⁇ , ⁇ S ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ C(S) ⁇ , ⁇ C(NR’) ⁇ , ⁇ C(O)N(R’) ⁇ , ⁇ N(R’)C(O)N(R’) ⁇ , ⁇ N(R’)C(O)O ⁇ , ⁇ S(O) ⁇ , ⁇ S(O) 2 ⁇ , ⁇ S(O) 2 N(R’) ⁇ , ⁇ C(O)S ⁇ , or ⁇ C(O)O ⁇ .
- the length of L P1 is 2-10 atoms. In some embodiments, it is 2 atoms. In some embodiments, it is 3 atoms. In some embodiments, it is 4 atoms. In some embodiments, it is 5 atoms. In some embodiments, it is 6 atoms. In some embodiments, it is 7 atoms. In some embodiments, it is 8 atoms. In some embodiments, it is 9 atoms. In some embodiments, it is 10 atoms. In some embodiments, one or more methylene units are independently replaced with ⁇ N(R’) ⁇ , ⁇ C(R’) 2 ⁇ , ⁇ C(O) ⁇ or ⁇ C(O)N(R’) ⁇ .
- a methylene unit is replace with ⁇ N(R’) ⁇ . In some embodiments, a methylene unit is replace with ⁇ C(R’) 2 ⁇ . In some embodiments, a methylene unit is replace with ⁇ C(O) ⁇ . In some embodiments, a methylene unit is replace with ⁇ C(O)N(R’) ⁇ . In some embodiments, each methylene unit is independently replaced with ⁇ N(R’) ⁇ , ⁇ C(R’) 2 ⁇ or ⁇ C(O) ⁇ . In some embodiments, L P1 is or comprises an amino acid residue. In some embodiments, L P1 is or comprises a peptide.
- L P1 is or comprises ⁇ [X] p ⁇ X 1 ⁇ , wherein each of p, X and X 1 is independently as described herein, and X 1 is bonded to L AA1 . In some embodiments, L P1 is or comprises ⁇ X 1 ⁇ . [0267] In some embodiments, L P1 comprises a ⁇ C(R’) 2 ⁇ group, wherein one of the R’ groups is a first R’ group of the four. In some embodiments, such a ⁇ C(R’) 2 ⁇ group is of an amino acid residue. In some embodiments, such a ⁇ C(R’) 2 ⁇ group is of X 1 .
- such a carbon atom is an alpha carbon of an amino acid residue.
- L AA1 [0268] In some embodiments, L AA1 is or comprises amino acid residue. In some embodiments, L AA1 is or comprises an amino acid residue that comprises a side chain comprising an acidic or polar group. In some embodiments, L AA1 is an amino acid residue that comprises a side chain comprising an acidic group. [0269] In some embodiments, L AA1 is L AR , wherein a methylene unit is replaced with ⁇ C(R’)(R AS ) ⁇ , wherein each variable is independently as described herein.
- L AA1 is an optionally substituted, bivalent C 1 -C 6 (e.g., C 1 , C 2 , C 3 , C 4 , C 5 , or C 6 ) aliphatic group, wherein one or more methylene units of the group are optionally and independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ C(R’)(R AS ) ⁇ , ⁇ Cy ⁇ , ⁇ O ⁇ , ⁇ S ⁇ , ⁇ S ⁇ S ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ C(S) ⁇ , ⁇ C(NR’) ⁇ , ⁇ C(O)N(R’) ⁇ , ⁇ N(R’)C(O)N(R’) ⁇ , ⁇ N(R’)C(O)O ⁇ , ⁇ S(O) ⁇ , ⁇ S(O) 2 ⁇ , ⁇ S(O) 2 N(R’) ⁇ , ⁇ C(O)S ⁇ , or ⁇ C(O)O
- L AA1 is an optionally substituted, bivalent C 2 -C 4 aliphatic group, wherein one or more methylene units of the group are optionally and independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ C(R’)(R AS ) ⁇ , ⁇ Cy ⁇ , ⁇ O ⁇ , ⁇ S ⁇ , ⁇ S ⁇ S ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ C(S) ⁇ , ⁇ C(NR’) ⁇ , ⁇ C(O)N(R’) ⁇ , ⁇ N(R’)C(O)N(R’) ⁇ , ⁇ N(R’)C(O)O ⁇ , ⁇ S(O) ⁇ , ⁇ S(O) 2 ⁇ , ⁇ S(O) 2 N(R’) ⁇ , ⁇ C(O)S ⁇ , or ⁇ C(O)O ⁇ , wherein each variable is independently as described herein.
- L AA1 is ⁇ N(R’) ⁇ C(R’)(R AS ) ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, L AA1 is ⁇ NH ⁇ C(R’)(R AS ) ⁇ C(O) ⁇ , wherein each variable is independently as described herein. [0270] In some embodiments, L AS1 is L AS as described herein. In some embodiments, R AA1 is ⁇ CO 2 R, wherein R is as described herein. In some embodiments, R is H. In some embodiments, L AA1 is a residue of an acidic amino acid residue, e.g., Asp, Glu, etc.
- L AA1 is X 2 as described herein.
- L P2 is a covalent bond, or an optionally substituted, bivalent C 2 -C 6 aliphatic group, wherein one or more methylene units of the group are optionally and independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ Cy ⁇ , ⁇ O ⁇ , ⁇ S ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ C(S) ⁇ , ⁇ C(NR’) ⁇ , ⁇ C(O)N(R’) ⁇ , ⁇ N(R’)C(O)N(R’) ⁇ , ⁇ N(R’)C(O)O ⁇ , ⁇ S(O) ⁇ , ⁇ S(O) 2 ⁇ , ⁇ S(O) 2 N(R’) ⁇ , ⁇ C(O)S ⁇ , or ⁇ C(O)O ⁇ .
- the length of L P2 is 2-10 atoms. In some embodiments, it is 2 atoms. In some embodiments, it is 3 atoms. In some embodiments, it is 4 atoms. In some embodiments, it is 5 atoms. In some embodiments, it is 6 atoms. In some embodiments, it is 7 atoms. In some embodiments, it is 8 atoms. In some embodiments, it is 9 atoms. In some embodiments, it is 10 atoms. In some embodiments, one or more methylene units are independently replaced with ⁇ N(R’) ⁇ , ⁇ C(R’) 2 ⁇ , ⁇ C(O) ⁇ or ⁇ C(O)N(R’) ⁇ .
- a methylene unit is replace with ⁇ N(R’) ⁇ . In some embodiments, a methylene unit is replace with ⁇ C(R’) 2 ⁇ . In some embodiments, a methylene unit is replace with ⁇ C(O) ⁇ . In some embodiments, a methylene unit is replace with ⁇ C(O)N(R’) ⁇ . In some embodiments, each methylene unit is independently replaced with ⁇ N(R’) ⁇ , ⁇ C(R’) 2 ⁇ or ⁇ C(O) ⁇ . In some embodiments, L P2 is or comprises an amino acid residue. In some embodiments, L P2 is or comprises a peptide.
- L P2 is or comprises ⁇ [X]pX 4 [X]p’ ⁇ , wherein each of p, p’, X and X 4 is independently as described herein.
- L P2 is or comprises ⁇ [X]pX 3 X 4 [X]p’ ⁇ , wherein each X, X 3 and X 4 is independently an amino acid residue, and each of p and p’ is independently 0-10.
- L P2 is or comprises ⁇ X 3 X 4 ⁇ , wherein each X 3 and X 4 is independently as described herein, and X 4 is bonded to L AA2 .
- L P2 comprises a ⁇ C(R’) 2 ⁇ group, wherein one of the R’ groups is a second R’ group and the other is a third of the four.
- such a ⁇ C(R’) 2 ⁇ group is of an amino acid residue.
- such a ⁇ C(R’) 2 ⁇ group is of X 4 .
- such a carbon atom is an alpha carbon of an amino acid residue.
- such a carbon atom is an alpha carbon of X 4 .
- a methylene unit of L P2 is replaced with ⁇ C(R’) 2 ⁇ , wherein one of the R’ groups is a second or fifth or seventh R’ group.
- such a ⁇ C(R’) 2 ⁇ group is of an amino acid residue.
- such a ⁇ C(R’) 2 ⁇ group is of X 3 .
- such a carbon atom is an alpha carbon of an amino acid residue.
- such a carbon atom is an alpha carbon of X 3 .
- it is a second R’ group.
- it is a fifth R’ group.
- it is a seventh R’ group.
- a methylene unit of L P2 is replaced with ⁇ C(R’) 2 ⁇ , wherein one of the R’ groups is a first or third R’ group.
- such a ⁇ C(R’) 2 ⁇ group is of an amino acid residue.
- such a ⁇ C(R’) 2 ⁇ group is of X 4 .
- such a carbon atom is an alpha carbon of an amino acid residue.
- such a carbon atom is an alpha carbon of X 4 .
- it is a first R’ group.
- it is a third R’ group.
- L AA2 is or comprises amino acid residue. In some embodiments, L AA2 is or comprises an amino acid residue that comprises a side chain comprising an acidic or polar group. In some embodiments, L AA2 is an amino acid residue that comprises a side chain comprising an acidic group. [0277] In some embodiments, L AA2 is L AR , wherein a methylene unit is replaced with ⁇ C(R’)(R AS ) ⁇ , wherein each variable is independently as described herein.
- L AA2 is an optionally substituted, bivalent C 1 -C 6 (e.g., C 1 , C 2 , C 3 , C 4 , C 5 , or C 6 ) aliphatic group, wherein one or more methylene units of the group are optionally and independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ C(R’)(R AS ) ⁇ , ⁇ Cy ⁇ , ⁇ O ⁇ , ⁇ S ⁇ , ⁇ S ⁇ S ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ C(S) ⁇ , ⁇ C(NR’) ⁇ , ⁇ C(O)N(R’) ⁇ , ⁇ N(R’)C(O)N(R’) ⁇ , ⁇ N(R’)C(O)O ⁇ , ⁇ S(O) ⁇ , ⁇ S(O) 2 ⁇ , ⁇ S(O) 2 N(R’) ⁇ , ⁇ C(O)S ⁇ , or ⁇ C(O)O
- L AA2 is an optionally substituted, bivalent C 2 -C 4 aliphatic group, wherein one or more methylene units of the group are optionally and independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ C(R’)(R AS ) ⁇ , ⁇ Cy ⁇ , ⁇ O ⁇ , ⁇ S ⁇ , ⁇ S ⁇ S ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ C(S) ⁇ , ⁇ C(NR’) ⁇ , ⁇ C(O)N(R’) ⁇ , ⁇ N(R’)C(O)N(R’) ⁇ , ⁇ N(R’)C(O)O ⁇ , ⁇ S(O) ⁇ , ⁇ S(O) 2 ⁇ , ⁇ S(O) 2 N(R’) ⁇ , ⁇ C(O)S ⁇ , or ⁇ C(O)O ⁇ , wherein each variable is independently as described herein.
- L AA2 is ⁇ N(R’) ⁇ C(R’)(R AS ) ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, L AA2 is ⁇ NH ⁇ C(R’)(R AS ) ⁇ C(O) ⁇ , wherein each variable is independently as described herein. [0278] In some embodiments, L AS2 is L AS as described herein. In some embodiments, R AA2 is ⁇ CO 2 R, wherein R is as described herein. In some embodiments, R is H. In some embodiments, L AA2 is a residue of an acidic amino acid residue, e.g., Asp, Glu, etc.
- L AA2 is X 5 as described herein.
- L P3 is a covalent bond.
- L P3 is an optionally substituted, bivalent C 2 -C 6 aliphatic group, wherein one or more methylene units of the group are optionally and independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ Cy ⁇ , ⁇ O ⁇ , ⁇ S ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ C(S) ⁇ , ⁇ C(NR’) ⁇ , ⁇ C(O)N(R’) ⁇ , ⁇ N(R’)C(O)N(R’) ⁇ , ⁇ N(R’)C(O)O ⁇ , ⁇ S(O) ⁇ , ⁇ S(O) 2 ⁇ , ⁇ S(O) 2 N(R’) ⁇ , ⁇ C(O)S ⁇ , or ⁇ C(O)O ⁇ .
- the length of L P3 is 0-10 atoms. In some embodiments, the length of L P3 is 2-10 atoms. In some embodiments, it is 2 atoms. In some embodiments, it is 3 atoms. In some embodiments, it is 4 atoms. In some embodiments, it is 5 atoms. In some embodiments, it is 6 atoms. In some embodiments, it is 7 atoms. In some embodiments, it is 8 atoms. In some embodiments, it is 9 atoms. In some embodiments, it is 10 atoms.
- one or more methylene units are independently replaced with ⁇ N(R’) ⁇ , ⁇ C(R’) 2 ⁇ , ⁇ C(O) ⁇ or ⁇ C(O)N(R’) ⁇ .
- a methylene unit is replace with ⁇ N(R’) ⁇ .
- a methylene unit is replace with ⁇ C(R’) 2 ⁇ .
- a methylene unit is replace with ⁇ C(O) ⁇ .
- a methylene unit is replace with ⁇ C(O)N(R’) ⁇ .
- each methylene unit is independently replaced with ⁇ N(R’) ⁇ , ⁇ C(R’) 2 ⁇ or ⁇ C(O) ⁇ .
- L P3 is or comprises an amino acid residue.
- L P3 is or comprises a peptide.
- L P3 is or comprises ⁇ [X]pX 6 X 7 [X]p’ ⁇ , wherein each X, X 6 and X 7 is independently an amino acid residue, and each of p and p’ is independently 0- 10.
- L P3 is or comprises ⁇ X 6 X 7 ⁇ , wherein each X 6 and X 7 is independently an amino acid residue.
- X 7 is bonded to L AA3 .
- a methylene unit of L P3 is replaced with ⁇ C(R’) 2 ⁇ , wherein one of the R’ groups is the fifth, sixth, seventh or eighth R’ group.
- X 7 comprises ⁇ C(R’) 2 ⁇ , wherein one of the R’ groups is the fifth, sixth, seventh or eighth R’ group.
- L AA3 [0280]
- L AA3 is or comprises amino acid residue.
- L AA3 is or comprises an amino acid residue that comprises a side chain comprising an acidic or polar group.
- L AA3 is an amino acid residue that comprises a side chain comprising an acidic group.
- L AA3 is L AR , wherein a methylene unit is replaced with ⁇ C(R’)(R AS ) ⁇ , wherein each variable is independently as described herein.
- L AA3 is an optionally substituted, bivalent C 1 -C 6 (e.g., C 1 , C 2 , C 3 , C 4 , C 5 , or C 6 ) aliphatic group, wherein one or more methylene units of the group are optionally and independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ C(R’)(R AS ) ⁇ , ⁇ Cy ⁇ , ⁇ O ⁇ , ⁇ S ⁇ , ⁇ S ⁇ S ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ C(S) ⁇ , ⁇ C(NR’) ⁇ , ⁇ C(O)N(R’) ⁇ , ⁇ N(R’)C(O)N(R’) ⁇ , ⁇ N(R’)C(N(R’)C(N(R’
- L AA3 is an optionally substituted, bivalent C 2 -C 4 aliphatic group, wherein one or more methylene units of the group are optionally and independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ C(R’)(R AS ) ⁇ , ⁇ Cy ⁇ , ⁇ O ⁇ , ⁇ S ⁇ , ⁇ S ⁇ S ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ C(S) ⁇ , ⁇ C(NR’) ⁇ , ⁇ C(O)N(R’) ⁇ , ⁇ N(R’)C(O)N(R’) ⁇ , ⁇ N(R’)C(O)O ⁇ , ⁇ S(O) ⁇ , ⁇ S(O) 2 ⁇ , ⁇ S(O) 2 N(R’) ⁇ , ⁇ C(O)S ⁇ , or ⁇ C(O)O ⁇ , wherein each variable is independently as described herein.
- L AA3 is ⁇ N(R’) ⁇ C(R’)(R AS ) ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, L AA3 is ⁇ NH ⁇ C(R’)(R AS ) ⁇ C(O) ⁇ , wherein each variable is independently as described herein. [0282] In some embodiments, L AS3 is L AS as described herein. In some embodiments, R AA3 is ⁇ CO 2 R, wherein R is as described herein. In some embodiments, R is H. In some embodiments, L AA3 is a residue of an acidic amino acid residue, e.g., Asp, Glu, etc.
- L AA3 is X 6 as described herein. [0283] In some embodiments, L AA3 comprises a hydrophobic group. In some embodiments, L AA3 is or comprises a hydrophobic amino acid residue. In some embodiments, L AA3 is X 8 as described herein.
- L P4 is a covalent bond, or an optionally substituted, bivalent C 2 -C 6 aliphatic group, wherein one or more methylene units of the group are optionally and independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ Cy ⁇ , ⁇ O ⁇ , ⁇ S ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ C(S) ⁇ , ⁇ C(NR’) ⁇ , ⁇ C(O)N(R’) ⁇ , ⁇ N(R’)C(O)N(R’) ⁇ , ⁇ N(R’)C(O)O ⁇ , ⁇ S(O) ⁇ , ⁇ S(O) 2 ⁇ , ⁇ S(O) 2 N(R’) ⁇ , ⁇ C(O)S ⁇ , or ⁇ C(O)O ⁇ .
- the length of L P4 is 0-10 atoms. In some embodiments, the length of L P4 is 2-10 atoms. In some embodiments, it is 2 atoms. In some embodiments, it is 3 atoms. In some embodiments, it is 4 atoms. In some embodiments, it is 5 atoms. In some embodiments, it is 6 atoms. In some embodiments, it is 7 atoms. In some embodiments, it is 8 atoms. In some embodiments, it is 9 atoms. In some embodiments, it is 10 atoms.
- one or more methylene units are independently replaced with ⁇ N(R’) ⁇ , ⁇ C(R’) 2 ⁇ , ⁇ C(O) ⁇ or ⁇ C(O)N(R’) ⁇ .
- a methylene unit is replace with ⁇ N(R’) ⁇ .
- a methylene unit is replace with ⁇ C(R’) 2 ⁇ .
- a methylene unit is replace with ⁇ C(O) ⁇ .
- a methylene unit is replace with ⁇ C(O)N(R’) ⁇ .
- each methylene unit is independently replaced with ⁇ N(R’) ⁇ , ⁇ C(R’) 2 ⁇ or ⁇ C(O) ⁇ .
- L P4 is or comprises an amino acid residue.
- L P4 is or comprises a peptide. [0285] In some embodiments, L P4 is or comprises ⁇ [X]pX 7 X 8 [X]p’ ⁇ , wherein each X, X 7 and X 8 is independently an amino acid residue, and each of p and p’ is independently 0-10.
- L P4 is or comprises ⁇ X 7 X 8 ⁇ , wherein each X 7 and X 8 is independently as described herein, and X 8 is bonded to L AA4 .
- a methylene unit of L P4 is replaced with ⁇ C(R’) 2 ⁇ , wherein one of the R’ groups is a fifth, sixth, seventh or eighth R’ group.
- such a ⁇ C(R’) 2 ⁇ group is of an amino acid residue.
- such a ⁇ C(R’) 2 ⁇ group is of X 7 .
- such a carbon atom is an alpha carbon of an amino acid residue.
- such a carbon atom is an alpha carbon of X 7 . In some embodiments, it is a fifth R’ group. In some embodiments, it is a sixth R’ group. In some embodiments, it is a seventh R’ group. In some embodiments, it is an eighth R’ group.
- L AA4 [0287] In some embodiments, L AA4 is or comprises amino acid residue. In some embodiments, L AA4 is or comprises an amino acid residue that comprises a side chain comprising an aromatic group. [0288] In some embodiments, L AA4 is L AR , wherein a methylene unit is replaced with ⁇ C(R’)(R AS ) ⁇ , wherein each variable is independently as described herein.
- L AA4 is an optionally substituted, bivalent C 1 -C 6 (e.g., C 1 , C 2 , C 3 , C 4 , C 5 , or C 6 ) aliphatic group, wherein one or more methylene units of the group are optionally and independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ C(R’)(R AS ) ⁇ , ⁇ Cy ⁇ , ⁇ O ⁇ , ⁇ S ⁇ , ⁇ S ⁇ S ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ C(S) ⁇ , ⁇ C(NR’) ⁇ , ⁇ C(O)N(R’) ⁇ , ⁇ N(R’)C(O)N(R’) ⁇ , ⁇ N(R’)C(O)O ⁇ , ⁇ S(O) ⁇ , ⁇ S(O) 2 ⁇ , ⁇ S(O) 2 N(R’) ⁇ , ⁇ C(O)S ⁇ , or ⁇ C(O)O
- L AA4 is an optionally substituted, bivalent C 2 -C 4 aliphatic group, wherein one or more methylene units of the group are optionally and independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ C(R’)(R AS ) ⁇ , ⁇ Cy ⁇ , ⁇ O ⁇ , ⁇ S ⁇ , ⁇ S ⁇ S ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ C(S) ⁇ , ⁇ C(NR’) ⁇ , ⁇ C(O)N(R’) ⁇ , ⁇ N(R’)C(O)N(R’) ⁇ , ⁇ N(R’)C(O)O ⁇ , ⁇ S(O) ⁇ , ⁇ S(O) 2 ⁇ , ⁇ S(O) 2 N(R’) ⁇ , ⁇ C(O)S ⁇ , or ⁇ C(O)O ⁇ , wherein each variable is independently as described herein.
- L AA4 is ⁇ N(R’) ⁇ C(R’)(R AS ) ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, L AA4 is ⁇ NH ⁇ C(R’)(R AS ) ⁇ C(O) ⁇ , wherein each variable is independently as described herein. [0289] In some embodiments, L AS4 is L AS as described herein. In some embodiments, R AA4 is optionally substituted C 6-14 aryl. In some embodiments, R AA4 is optionally substituted phenyl. In some embodiments, R AA4 is phenyl. In some embodiments, R AA4 is optionally substituted 10-membered C 10 bicyclic aryl.
- R AA4 is optionally substituted 5-membered monocyclic heteroaryl having 1-4 heteroatoms. In some embodiments, R AA4 is optionally substituted 6-membered monocyclic heteroaryl having 1-4 heteroatoms. In some embodiments, R AA4 is optionally substituted 9-membered bicyclic heteroaryl having 1-4 heteroatoms. In some embodiments, R AA4 is optionally substituted 10-membered bicyclic heteroaryl having 1-4 heteroatoms. In some embodiments, a heteroaryl has no more than one heteroatom. In some embodiments, a heteroaryl has two or more heteroatoms. In some embodiments, a heteroatom is oxygen. In some embodiments, a heteroatom is nitrogen.
- a heteroatom is sulfur.
- R AA4 is optionally substituted .
- R AA4 is optionally substituted .
- R AA4 is optionally substituted n
- L AA4 is an aromatic amino acid residue as described herein.
- L AA4 is X 9 as described herein.
- L P5 is a covalent bond, or an optionally substituted, bivalent C 2 -C 6 aliphatic group, wherein one or more methylene units of the group are optionally and independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ Cy ⁇ , ⁇ O ⁇ , ⁇ S ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ C(S) ⁇ , ⁇ C(NR’) ⁇ , ⁇ C(O)N(R’) ⁇ , ⁇ N(R’)C(O)N(R’) ⁇ , ⁇ N(R’)C(O)O ⁇ , ⁇ S(O) ⁇ , ⁇ S(O) 2 ⁇ , ⁇ S(O) 2 N(R’) ⁇ , ⁇ C(O)S ⁇ , or ⁇ C(O)O ⁇ .
- the length of L P5 is 2-10 atoms. In some embodiments, it is 2 atoms. In some embodiments, it is 3 atoms. In some embodiments, it is 4 atoms. In some embodiments, it is 5 atoms. In some embodiments, it is 6 atoms. In some embodiments, it is 7 atoms. In some embodiments, it is 8 atoms. In some embodiments, it is 9 atoms. In some embodiments, it is 10 atoms. In some embodiments, one or more methylene units are independently replaced with ⁇ N(R’) ⁇ , ⁇ C(R’) 2 ⁇ , ⁇ C(O) ⁇ or ⁇ C(O)N(R’) ⁇ .
- a methylene unit is replace with ⁇ N(R’) ⁇ . In some embodiments, a methylene unit is replace with ⁇ C(R’) 2 ⁇ . In some embodiments, a methylene unit is replace with ⁇ C(O) ⁇ . In some embodiments, a methylene unit is replace with ⁇ C(O)N(R’) ⁇ . In some embodiments, each methylene unit is independently replaced with ⁇ N(R’) ⁇ , ⁇ C(R’) 2 ⁇ or ⁇ C(O) ⁇ . In some embodiments, L P5 is or comprises an amino acid residue. In some embodiments, L P5 is or comprises a peptide.
- L P5 is or comprises ⁇ [X]pX 11 [X]p’ ⁇ , wherein each variable is independently as described herein. In some embodiments, L P5 is or comprises ⁇ X 10 X 11 ⁇ , wherein each X 10 and X 11 is independently as described herein, and X 11 is bonded to L AA5 . [0292] In some embodiments, L P5 comprises a ⁇ C(R’) 2 ⁇ group, wherein one of the R’ groups is a fourth R’ group. In some embodiments, L P5 comprises a ⁇ C(R’) 2 ⁇ group, wherein one of the R’ groups is a second R’ group.
- such a ⁇ C(R’) 2 ⁇ group is of an amino acid residue. In some embodiments, such a ⁇ C(R’) 2 ⁇ group is of X 11 . In some embodiments, such a carbon atom is an alpha carbon of an amino acid residue. In some embodiments, such a carbon atom is an alpha carbon of X 11 . [0293] In some embodiments, L P5 comprises a ⁇ C(R’) 2 ⁇ group, wherein one of the R’ groups is a fifth, sixth, seventh or eighth R’ group. In some embodiments, such a ⁇ C(R’) 2 ⁇ group is of an amino acid residue.
- such a ⁇ C(R’) 2 ⁇ group is of X 10 .
- such a carbon atom is an alpha carbon of an amino acid residue.
- such a carbon atom is an alpha carbon of X 10 .
- it is a fifth R’ group.
- it is a sixth R’ group.
- it is a seventh R’ group.
- it is an eighth R’ group.
- L AA5 [0294]
- L AA5 is or comprises amino acid residue.
- L AA5 is or comprises an amino acid residue that comprises a side chain comprising an aromatic group.
- L AA5 is L AR , wherein a methylene unit is replaced with ⁇ C(R’)(R AS ) ⁇ , wherein each variable is independently as described herein.
- L AA5 is an optionally substituted, bivalent C 1 -C 6 (e.g., C 1 , C 2 , C 3 , C 4 , C 5 , or C 6 ) aliphatic group, wherein one or more methylene units of the group are optionally and independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ C(R’)(R AS ) ⁇ , ⁇ Cy ⁇ , ⁇ O ⁇ , ⁇ S ⁇ , ⁇ S ⁇ S ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ C(S) ⁇ , ⁇ C(NR’) ⁇ , ⁇ C(O)N(R’) ⁇ , ⁇ N(R’)C(O)N(R’) ⁇ , ⁇ N(R’)C(N(R’)C(N(R’
- L AA5 is an optionally substituted, bivalent C 2 -C 4 aliphatic group, wherein one or more methylene units of the group are optionally and independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ C(R’)(R AS ) ⁇ , ⁇ Cy ⁇ , ⁇ O ⁇ , ⁇ S ⁇ , ⁇ S ⁇ S ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ C(S) ⁇ , ⁇ C(NR’) ⁇ , ⁇ C(O)N(R’) ⁇ , ⁇ N(R’)C(O)N(R’) ⁇ , ⁇ N(R’)C(O)O ⁇ , ⁇ S(O) ⁇ , ⁇ S(O) 2 ⁇ , ⁇ S(O) 2 N(R’) ⁇ , ⁇ C(O)S ⁇ , or ⁇ C(O)O ⁇ , wherein each variable is independently as described herein.
- L AA5 is ⁇ N(R’) ⁇ C(R’)(R AS ) ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, L AA5 is ⁇ NH ⁇ C(R’)(R AS ) ⁇ C(O) ⁇ , wherein each variable is independently as described herein. [0296] In some embodiments, L AS5 is L AS as described herein. In some embodiments, R AA5 is optionally substituted C 6-14 aryl. In some embodiments, R AA5 is optionally substituted phenyl. In some embodiments, R AA5 is phenyl. In some embodiments, R AA5 is optionally substituted 10-membered C 10 bicyclic aryl.
- R AA5 is optionally substituted 5-membered monocyclic heteroaryl having 1-4 heteroatoms. In some embodiments, R AA5 is optionally substituted 6-membered monocyclic heteroaryl having 1-4 heteroatoms. In some embodiments, R AA5 is optionally substituted 9-membered bicyclic heteroaryl having 1-4 heteroatoms. In some embodiments, R AA5 is optionally substituted 10-membered bicyclic heteroaryl having 1-4 heteroatoms. In some embodiments, a heteroaryl has no more than one heteroatom. In some embodiments, a heteroaryl has two or more heteroatoms. In some embodiments, a heteroatom is oxygen. In some embodiments, a heteroatom is nitrogen.
- a heteroatom is sulfur.
- R AA5 is optionally substituted .
- R AA5 is optionally substituted
- R AA5 is optionally substituted
- L AA5 is an aromatic amino acid residue as described herein.
- L AA5 is X 12 as described herein.
- L P6 [0297] In some embodiments, L P6 is a covalent bond.
- L P6 is an optionally substituted, bivalent C 2 -C 6 aliphatic group, wherein one or more methylene units of the group are optionally and independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ Cy ⁇ , ⁇ O ⁇ , ⁇ S ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ C(S) ⁇ , ⁇ C(NR’) ⁇ , ⁇ C(O)N(R’) ⁇ , ⁇ N(R’)C(O)N(R’) ⁇ , ⁇ N(R’)C(O)O ⁇ , ⁇ S(O) ⁇ , ⁇ S(O) 2 ⁇ , ⁇ S(O) 2 N(R’) ⁇ , ⁇ C(O)S ⁇ , or ⁇ C(O)O ⁇ .
- the length of L P6 is 0-10 atoms (e.g., 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10, etc.). In some embodiments, the length of L P6 is 2-10 atoms. In some embodiments, it is 2 atoms. In some embodiments, it is 3 atoms. In some embodiments, it is 4 atoms. In some embodiments, it is 5 atoms. In some embodiments, it is 6 atoms. In some embodiments, it is 7 atoms. In some embodiments, it is 8 atoms. In some embodiments, it is 9 atoms. In some embodiments, it is 10 atoms.
- one or more methylene units are independently replaced with ⁇ N(R’) ⁇ , ⁇ C(R’) 2 ⁇ , ⁇ C(O) ⁇ or ⁇ C(O)N(R’) ⁇ .
- a methylene unit is replace with ⁇ N(R’) ⁇ .
- a methylene unit is replace with ⁇ C(R’) 2 ⁇ .
- a methylene unit is replace with ⁇ C(O) ⁇ .
- a methylene unit is replace with ⁇ C(O)N(R’) ⁇ .
- each methylene unit is independently replaced with ⁇ N(R’) ⁇ , ⁇ C(R’) 2 ⁇ or ⁇ C(O) ⁇ .
- L P6 is or comprises an amino acid residue.
- L P6 is or comprises a peptide.
- L AA6 [0298] In some embodiments, L AA6 is or comprises amino acid residue. In some embodiments, L AA6 is or comprises an amino acid residue that comprises a side chain comprising an aromatic group. [0299] In some embodiments, L AA6 is L AR , wherein a methylene unit is replaced with ⁇ C(R’)(R AS ) ⁇ , wherein each variable is independently as described herein.
- L AA6 is an optionally substituted, bivalent C 1 -C 6 (e.g., C 1 , C 2 , C 3 , C 4 , C 5 , or C 6 ) aliphatic group, wherein one or more methylene units of the group are optionally and independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ C(R’)(R AS ) ⁇ , ⁇ Cy ⁇ , ⁇ O ⁇ , ⁇ S ⁇ , ⁇ S ⁇ S ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ C(S) ⁇ , ⁇ C(NR’) ⁇ , ⁇ C(O)N(R’) ⁇ , ⁇ N(R’)C(O)N(R’) ⁇ , ⁇ N(R’)C(O)O ⁇ , ⁇ S(O) ⁇ , ⁇ S(O) 2 ⁇ , ⁇ S(O) 2 N(R’) ⁇ , ⁇ C(O)S ⁇ , or ⁇ C(O)O
- L AA6 is an optionally substituted, bivalent C 2 -C 4 aliphatic group, wherein one or more methylene units of the group are optionally and independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ C(R’)(R AS ) ⁇ , ⁇ Cy ⁇ , ⁇ O ⁇ , ⁇ S ⁇ , ⁇ S ⁇ S ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ C(S) ⁇ , ⁇ C(NR’) ⁇ , ⁇ C(O)N(R’) ⁇ , ⁇ N(R’)C(O)N(R’) ⁇ , ⁇ N(R’)C(O)O ⁇ , ⁇ S(O) ⁇ , ⁇ S(O) 2 ⁇ , ⁇ S(O) 2 N(R’) ⁇ , ⁇ C(O)S ⁇ , or ⁇ C(O)O ⁇ , wherein each variable is independently as described herein.
- L AA6 is ⁇ N(R’) ⁇ C(R’)(R AS ) ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, L AA6 is ⁇ NH ⁇ C(R’)(R AS ) ⁇ C(O) ⁇ , wherein each variable is independently as described herein. [0300] In some embodiments, L AS6 is L AS as described herein. In some embodiments, R AA6 is optionally substituted C 6-14 aryl. In some embodiments, R AA6 is optionally substituted phenyl. In some embodiments, R AA6 is phenyl. In some embodiments, R AA6 is optionally substituted 10-membered C 10 bicyclic aryl.
- R AA6 is optionally substituted 5-membered monocyclic heteroaryl having 1-4 heteroatoms. In some embodiments, R AA6 is optionally substituted 6-membered monocyclic heteroaryl having 1-4 heteroatoms. In some embodiments, R AA6 is optionally substituted 9-membered bicyclic heteroaryl having 1-4 heteroatoms. In some embodiments, R AA6 is optionally substituted 10-membered bicyclic heteroaryl having 1-4 heteroatoms. In some embodiments, a heteroaryl has no more than one heteroatom. In some embodiments, a heteroaryl has two or more heteroatoms. In some embodiments, a heteroatom is oxygen. In some embodiments, a heteroatom is nitrogen.
- a heteroatom is sulfur.
- R AA6 is optionally substituted In some embodiments, R AA6 is optionally substituted In some embodiments, R AA6 is optiona lly substituted n some embodiments, L AA6 is an aromatic amino acid residue as described herein. In some embodiments, L AA6 is X 13 as described herein.
- L P7 [0301] In some embodiments, L P7 is a covalent bond.
- L P7 is an optionally substituted, bivalent C 1 -C 25 (e.g., C 1-20 , C 1-15 , C 1-10 , C 1-5 , C 1 , C 2 , C 3 , C 4 , C 5 , C 6 , C 7 , C 8 , C 9 , C 10 , C 11 , C 12 , C 13 , C 14 , C 15 , C 16 , C 17 , C 18 , C 19 , or C 20 ) aliphatic or heteroaliphatic group having 1-10 heteroatoms, wherein one or more methylene units of the group are optionally and independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ Cy ⁇ , ⁇ O ⁇ , ⁇ S ⁇ , ⁇ S ⁇ S ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ C(S) ⁇ , ⁇ C(NR’) ⁇ , ⁇ C(O)N(R’) ⁇ , ⁇ N(R’)C
- L P7 is an optionally substituted, bivalent C 1 -C 25 (e.g., C 1-20 , C 1-15 , C 1-10 , C 1-5 , C 1 , C 2 , C 3 , C 4 , C 5 , C 6 , C 7 , C 8 , C 9 , C 10 , C 11 , C 12 , C 13 , C 14 , C 15 , C 16 , C 17 , C 18 , C 19 , or C 20 ) aliphatic group, wherein one or more methylene units of the group are optionally and independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ Cy ⁇ , ⁇ O ⁇ , ⁇ S ⁇ , ⁇ S ⁇ S ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ C(S) ⁇ , ⁇ C(NR’) ⁇ , ⁇ C(O)N(R’) ⁇ , ⁇ N(R’)C(O)N(R’) ⁇ , ⁇ N(R
- L P7 is an optionally substituted, bivalent C 1 -C 20 aliphatic or heteroaliphatic group having 1-10 heteroatoms, wherein one or more methylene units of the group are optionally and independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ Cy ⁇ , ⁇ O ⁇ , ⁇ S ⁇ , ⁇ S ⁇ S ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ C(S) ⁇ , ⁇ C(NR’) ⁇ , ⁇ C(O)N(R’) ⁇ , ⁇ N(R’)C(O)N(R’) ⁇ , ⁇ N(R’)C(O)O ⁇ , ⁇ S(O) ⁇ , ⁇ S(O) 2 ⁇ , ⁇ S(O) 2 N(R’) ⁇ , ⁇ C(O)S ⁇ , or ⁇ C(O)O ⁇ .
- L P7 is an optionally substituted, bivalent C 1 -C 15 aliphatic or heteroaliphatic group having 1-10 heteroatoms, wherein one or more methylene units of the group are optionally and independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ Cy ⁇ , ⁇ O ⁇ , ⁇ S ⁇ , ⁇ S ⁇ S ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ C(S) ⁇ , ⁇ C(NR’) ⁇ , ⁇ C(O)N(R’) ⁇ , ⁇ N(R’)C(O)N(R’) ⁇ , ⁇ N(R’)C(O)O ⁇ , ⁇ S(O) ⁇ , ⁇ S(O) 2 ⁇ , ⁇ S(O) 2 N(R’) ⁇ , ⁇ C(O)S ⁇ , or ⁇ C(O)O ⁇ .
- L P7 is an optionally substituted, bivalent C 1 -C 10 aliphatic or heteroaliphatic group having 1-10 heteroatoms, wherein one or more methylene units of the group are optionally and independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ Cy ⁇ , ⁇ O ⁇ , ⁇ S ⁇ , ⁇ S ⁇ S ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ C(S) ⁇ , ⁇ C(NR’) ⁇ , ⁇ C(O)N(R’) ⁇ , ⁇ N(R’)C(O)N(R’) ⁇ , ⁇ N(R’)C(O)O ⁇ , ⁇ S(O) ⁇ , ⁇ S(O) 2 ⁇ , ⁇ S(O) 2 N(R’) ⁇ , ⁇ C(O)S ⁇ , or ⁇ C(O)O ⁇ .
- X 14 is or comprises ⁇ X 14 ⁇ [X]p’ ⁇ , wherein p’ is 0-10.
- X 14 is bonded to L AA6 .
- L P7 comprises a ⁇ C(R’) 2 ⁇ group, wherein one of the R’ groups is a sixth or eighth R’ group.
- such a ⁇ C(R’) 2 ⁇ group is of an amino acid residue.
- such a ⁇ C(R’) 2 ⁇ group is of X 14 .
- such a carbon atom is an alpha carbon of an amino acid residue.
- such a carbon atom is an alpha carbon of X 14 .
- L AS is a covalent bond.
- L AS is an optionally substituted, bivalent C 1 -C 10 (e.g., C 1-5 , C 1 , C 2 , C 3 , C 4 , C 5 , C 6 , C 7 , C 8 , C 9 , or C 10 ) aliphatic group, wherein one or more methylene units of the group are optionally and independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ Cy ⁇ , ⁇ O ⁇ , ⁇ S ⁇ , ⁇ S ⁇ S ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ C(S) ⁇ , ⁇ C(NR’) ⁇ , ⁇ C(O)N(R’) ⁇ , ⁇ N(R’)C(O)N(R’) ⁇ , ⁇ N(R’)C(O)C(O)C(O)C(O) ⁇ , ⁇ N(R’)C(O)C(O)C(O) ⁇ , ⁇ N(
- L AS is an optionally substituted, bivalent C 1 -C 10 aliphatic group, wherein one or more methylene units of the group are optionally and independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ Cy ⁇ , ⁇ O ⁇ , ⁇ S ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ S(O) ⁇ , or ⁇ S(O) 2 ⁇ .
- L AS is an optionally substituted, bivalent C 1 -C 10 aliphatic group, wherein one or more methylene units of the group are optionally and independently replaced with ⁇ O ⁇ , ⁇ S ⁇ , or ⁇ N(R’) ⁇ .
- L AS is an optionally substituted, bivalent C 1 -C 10 alkylene group. In some embodiments, L AS is optionally substituted ⁇ CH 2 ⁇ . In some embodiments, L AS is ⁇ CH 2 ⁇ . In some embodiments, the length of L AS is 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 atoms. In some embodiments, it is 1 atom. In some embodiments, it is 2 atoms. In some embodiments, it is 3 atoms. In some embodiments, it is 4 atoms. In some embodiments, it is 5 atoms. In some embodiments, it is 6 atoms. In some embodiments, it is 7 atoms. In some embodiments, it is 8 atoms.
- an agent of formula I is a stapled peptide as described herein. In some embodiments, an agent of formula I is an agent selected from Table E2 or a pharmaceutically acceptable salt thereof. In some embodiments, an agent of formula I is an agent selected from Table E3 or a pharmaceutically acceptable salt thereof. [0305] Among other things, the present disclosure provides agents, e.g. peptides, that can bind to beta- catenin.
- an agent is or comprises X 1 X 2 X 3 X 4 X 5 X 6 X 7 X 8 X 9 X 10 X 11 X 12 X 13 X 14 wherein each of X 1 , X 2 , X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , X 9 , X 10 , X 11 , X 12 , X 13 and X 14 is independently an amino acid residue.
- an agent is or comprises [X 0 ] p0 X 1 X 2 X 3 X 4 X 5 X 6 X 7 X 8 X 9 X 10 X 11 X 12 X 13 X 14 [X 15 ] p15 [X 16 ] p16 [X 17 ] p17 , wherein each of p0, p15, p16 and p17 is independently 0 or 1, and each of X 0 , X 1 , X 2 , X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , X 9 , X 10 , X 11 , X 12 , X 13 , X 14 , X 15 , X 16 , and X 17 is independently an amino acid residue.
- each of X 2 and X 5 is independently an acidic residue as described herein.
- each of X 2 , X 5 and X 6 is independently an acidic residue as described herein.
- each of X 9 , X 12 and X 13 are independently an amino acid residue comprising a side chain that comprises an aromatic group.
- X 2 is an acidic residue.
- X 2 comprises a side chain that comprises ⁇ COOH or a derivative thereof. In some embodiments, X 2 comprises a side chain that comprises ⁇ COOH. In some embodiments, X 2 is Asp. Various other amino acid residues for X 2 are described else in the present disclosure.
- X 5 is an acidic residue. In some embodiments, X 5 comprises a side chain that comprises ⁇ COOH or a derivative thereof. In some embodiments, X 5 comprises a side chain that comprises ⁇ COOH. In some embodiments, X 5 is Asp. Various other amino acid residues for X 5 are described else in the present disclosure. [0310] In some embodiments, X 6 is an acidic residue.
- X 6 comprises a side chain that comprises ⁇ COOH or a derivative thereof. In some embodiments, X 6 comprises a side chain that comprises ⁇ COOH. In some embodiments, X 6 is Asp. Various other amino acid residues for X 6 are described else in the present disclosure. [0311] In some embodiments, X 9 comprises a side chain that comprises an aromatic group. In some embodiments, X 9 comprises a side chain that comprises ⁇ R, wherein R is an optionally substituted group selected from phenyl, 10-membered bicyclic aryl, 5-membered heteroaryl having 1-3 hetereoatoms, and 9-10 membered bicyclic heteroaryl having 1-5 heteroatoms.
- each heteroatom is independently sleeved from nitrogen, oxygen and sulfur.
- X 9 is Phe. Various other amino acid residues for X 9 are described else in the present disclosure.
- X 12 comprises a side chain that comprises an aromatic group.
- X 12 comprises a side chain that comprises ⁇ R, wherein R is an optionally substituted group selected from phenyl, 10-membered bicyclic aryl, 5-membered heteroaryl having 1-3 hetereoatoms, and 9-10 membered bicyclic heteroaryl having 1-5 heteroatoms.
- each heteroatom is independently sleeved from nitrogen, oxygen and sulfur.
- X 12 is 3Thi. In some embodiments, X 12 is 2F3MeF. In some embodiments, X 12 is Phe. Various other amino acid residues for X 12 are described else in the present disclosure. [0313] In some embodiments, X 13 comprises a side chain that comprises an aromatic group. In some embodiments, X 13 comprises a side chain that comprises ⁇ R, wherein R is an optionally substituted group selected from phenyl, 10-membered bicyclic aryl, 5-membered heteroaryl having 1-3 hetereoatoms, and 9-10 membered bicyclic heteroaryl having 1-5 heteroatoms. In some embodiments, each heteroatom is independently sleeved from nitrogen, oxygen and sulfur.
- X 13 is BtzA. In some embodiments, X 13 is 34ClF. In some embodiments, X 13 is 2NapA. Various other amino acid residues for X 13 are described else in the present disclosure.
- a peptide is a stapled peptide.
- an agent is or comprises a peptide, wherein a peptide is a stapled peptide. In some embodiments, a peptide is a stitched peptide. In some embodiments, a peptide comprises three or more staples as described herein.
- a peptide comprises three or more staples within a region having a length of, e.g., 11-15, such as 11, 14, etc., amino acid residues as described herein.
- such a peptide provides improved rigidity, activity, delivery, solubility, and/or other desired properties comprising a reference peptide that is not stapled or that comprises fewer staples.
- the present disclosure provides an agent, e.g., a peptide, comprising X 1 X 2 X 3 X 4 X 5 X 6 X 7 X 8 X 9 X 10 X 11 X 12 X 13 X 14 , wherein X 1 , X 2 , X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , X 9 , X 10 , X 11 , X 12 , X 13 , and X 14 are each independently an amino acid residue and comprises two or more pairs of amino acid residues, wherein each pair of amino acid residues are independently two amino acid residues suitable for stapling or stapled.
- an agent e.g., a peptide, comprising X 1 X 2 X 3 X 4 X 5 X 6 X 7 X 8 X 9 X 10 X 11 X 12 X 13 , wherein X 1 , X 2 , X
- the present disclosure provides an agent, e.g., a peptide, comprising X 1 X 2 X 3 X 4 X 5 X 6 X 7 X 8 X 9 X 10 X 11 X 12 X 13 X 14 , wherein X 1 , X 2 , X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , X 9 , X 10 , X 11 , X 12 , X 13 , and X 14 are each independently an amino acid residue and comprises two or more pairs of amino acid residues, wherein each pair of amino acid residues are independently three amino acid residues suitable for stapling or stapled.
- an agent e.g., a peptide, comprising X 1 X 2 X 3 X 4 X 5 X 6 X 7 X 8 X 9 X 10 X 11 X 12 X 13 , wherein X 1 , X 2 , X
- the present disclosure provides an agent, e.g., a peptide, comprising [X 0 ] p0 X 1 X 2 X 3 X 4 X 5 X 6 X 7 X 8 X 9 X 10 X 11 X 12 X 13 X 14 [X 15 ] p15 [X 16 ] p16 [X 17 ] p17 , wherein each of p0, p15, p16 and p17 is independently 0 or 1, and X 0 , X 1 , X 2 , X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , X 9 , X 10 , X 11 , X 12 , X 13 , X 14 , X 15 , X 16 , and X 17 are each independently an amino acid residue and comprises two or more pairs of amino acid residues, wherein each pair of amino acid residues are independently two amino
- the present disclosure provides an agent, e.g., a peptide, comprising [X 0 ] p0 X 1 X 2 X 3 X 4 X 5 X 6 X 7 X 8 X 9 X 10 X 11 X 12 X 13 X 14 [X 15 ] p15 [X 16 ] p16 [X 17 ] p17 , wherein each of p0, p15, p16 and p17 is independently 0 or 1, and X 0 , X 1 , X 2 , X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , X 9 , X 10 , X 11 , X 12 , X 13 , X 14 , X 15 , X 16 , and X 17 are each independently an amino acid residue and comprises three or more pairs of amino acid residues, wherein each pair of amino acid residues are independently two amino acid residues suitable
- each amino acid residue in such pairs of amino acid residues are independently selected from X 1 , X 2 , X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , X 9 , X 10 , X 11 , X 12 , X 13 , and X 14 .
- each pair is independently not stapled.
- one or more pairs are independently stapled.
- two or more pairs are independently stapled.
- a pair is X 1 and X 4 . In some embodiments, a pair is X 4 and X 11 . In some embodiments, a pair is X 1 and X 3 . In some embodiments, a pair is X 4 and X 11 . In some embodiments, a pair is X 10 and X 14 . In some embodiments, a pair is X 7 and X 10 .
- a pair is X 7 and X 14 . In some embodiments, a pair is X 3 and X 7 . [0319] In some embodiments, a pair is X 1 and X 14 and a pair is X 4 and X 11 . In some embodiments, a pair is X 1 and X 14 , a pair is X 4 and X 11 and a pair is X 10 and X 14 . In some embodiments, a pair is X 1 and X 14 , a pair is X 4 and X 11 and a pair is X 7 and X 10 .
- a pair is X 1 and X 14 , a pair is X 4 and X 11 and a pair is X 7 and X 14 .
- a pair is X 1 and X 14 , a pair is X 4 and X 11 , a pair is X 3 and X 7 , and a pair is X 7 and X 14 .
- each pair is independently a pair of amino acid residues suitable for stapling.
- each pair is independently stapled.
- a pair is X 1 and X 3 , a pair is X 4 and X 11 , and a pair is X 10 and X 14 .
- each pair is independently a pair of amino acid residues suitable for stapling. In some embodiments, each pair is independently stapled.
- the present disclosure provides an agent, which is or comprises a peptide comprising: [X 0 ] p0 X 1 X 2 X 3 X 4 X 5 X 6 X 7 X 8 X 9 X 10 X 11 X 12 X 13 X 14 [X 15 ] p15 [X 16 ] p16 [X 17 ] p17 , wherein: each of p0, p15, p16 and p17 is independently 0 or 1; each of X 0 , X 1 , X 2 , X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , X 9 , X 10 , X 11 , X 12 , X 13 , X 14 , X 15 , X 16
- X 2 comprises a side chain comprising an acidic or a polar group. In some embodiments, X 2 comprises a side chain comprising an acidic group. In some embodiments, X 2 comprises a side chain comprising a polar group. In some embodiments, X 5 comprises a side chain comprising an acidic or a polar group. In some embodiments, X 5 comprises a side chain comprising an acidic group. In some embodiments, X 5 comprises a side chain comprising a polar group. In some embodiments, X 13 comprises a side chain comprising an optionally substituted aromatic group.
- two or more of X 1 , X 3 , X 4 , X 7 , X 10 , X 11 and X 14 are each independently an amino acid residue suitable for stapling, or are each independently stapled.
- the present disclosure provides an agent, which is or comprises a peptide comprising: [X 0 ] p0 X 1 X 2 X 3 X 4 X 5 X 6 X 7 X 8 X 9 X 10 X 11 X 12 X 13 X 14 [X 15 ] p15 [X 16 ] p16 [X 17 ] p17 , wherein: each of p0, p15, p16 and p17 is independently 0 or 1; each of X 0 , X 1 , X 2 , X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , X 9 , X 10 , X 11
- three or more of X 1 , X 3 , X 4 , X 7 , X 10 , X 11 and X 14 are each independently an amino acid residue suitable for stapling, or are each independently stapled. In some embodiments, four or more of X 1 , X 3 , X 4 , X 7 , X 10 , X 11 and X 14 are each independently an amino acid residue suitable for stapling, or are each independently stapled. In some embodiments, five of X 1 , X 3 , X 4 , X 7 , X 10 , X 11 and X 14 are each independently an amino acid residue suitable for stapling, or are each independently stapled.
- X 1 and X 4 are each independently an amino acid residue suitable for stapling.
- X 1 and X 3 are each independently an amino acid residue suitable for stapling.
- X 4 and X 11 are each independently an amino acid suitable for stapling.
- X 1 , X 4 , and X 11 are each independently an amino acid residue suitable for stapling.
- X 10 and X 14 are each independently an amino acid residue suitable for stapling.
- X 7 and X 10 are each independently an amino acid residue suitable for stapling.
- X 7 and X 14 are each independently an amino acid residue suitable for stapling.
- X 3 and X 7 are each independently an amino acid residue suitable for stapling.
- X 1 and X 4 are connected by a staple.
- X 1 and X 3 are connected by a staple.
- X 4 and X 11 are connected by a staple.
- X 1 and X 4 connected by a staple, and X 4 and X 11 are connected by a staple.
- X 10 and X 14 are connected by a staple.
- X 7 and X 10 are connected by a staple.
- X 7 and X 14 are connected by a staple.
- X 3 and X 7 are connected by a staple.
- the present disclosure provides an agent, which is or comprises a peptide comprising: [X 0 ] p0 X 1 X 2 X 3 X 4 X 5 X 6 X 7 X 8 X 9 X 10 X 11 X 12 X 13 X 14 [X 15 ] p15 [X 16 ] p16 [X 17 ] p17 , wherein: each of p0, p15, p16 and p17 is independently 0 or 1; each of X 0 , X 1 , X 2 , X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , X 9 , X 10 , X 11 , X 12 , X 13 , X 14 , X 15 , X 16 , and X 17 is independently an amino acid residue, wherein: X 2 comprises a side chain comprising an acidic or a polar group;
- the present disclosure provides an agent, which is or comprises a peptide comprising: [X 0 ] p0 X 1 X 2 X 3 X 4 X 5 X 6 X 7 X 8 X 9 X 10 X 11 X 12 X 13 X 14 [X 15 ] p15 [X 16 ] p16 [X 17 ] p17 , wherein: each of p0, p15, p16 and p17 is independently 0 or 1; each of X 0 , X 1 , X 2 , X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , X 9 , X 10 , X 11 , X 12 , X 13 , X 14 , X 15 , X 16 , and X 17 is independently an amino acid residue, wherein: X 2 comprises a side chain comprising an acidic or a polar group;
- the present disclosure provides an agent, which is or comprises a peptide comprising: [X 0 ] p0 X 1 X 2 X 3 X 4 X 5 X 6 X 7 X 8 X 9 X 10 X 11 X 12 X 13 X 14 [X 15 ] p15 [X 16 ] p16 [X 17 ] p17 , wherein: each of p0, p15, p16 and p17 is independently 0 or 1; each of X 0 , X 1 , X 2 , X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , X 9 , X 10 , X 11 , X 12 , X 13 , X 14 , X 15 , X 16 , and X 17 is independently an amino acid residue, wherein: X 2 comprises a side chain comprising an acidic or a polar group;
- the present disclosure provides an agent, which is or comprises a peptide comprising: [X 0 ] p0 X 1 X 2 X 3 X 4 X 5 X 6 X 7 X 8 X 9 X 10 X 11 X 12 X 13 X 14 [X 15 ] p15 [X 16 ] p16 [X 17 ] p17 , wherein: each of p0, p15, p16 and p17 is independently 0 or 1; each of X 0 , X 1 , X 2 , X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , X 9 , X 10 , X 11 , X 12 , X 13 , X 14 , X 15 , X 16 , and X 17 is independently an amino acid residue, wherein: X 2 comprises a side chain comprising an acidic or a polar group;
- the present disclosure provides an agent, which is or comprises a peptide comprising: [X 0 ] p0 X 1 X 2 X 3 X 4 X 5 X 6 X 7 X 8 X 9 X 10 X 11 X 12 X 13 X 14 [X 15 ] p15 [X 16 ] p16 [X 17 ] p17 , wherein: each of p0, p15, p16 and p17 is independently 0 or 1; each of X 0 , X 1 , X 2 , X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , X 9 , X 10 , X 11 , X 12 , X 13 , X 14 , X 15 , X 16 , and X 17 is independently an amino acid residue, wherein: X 2 comprises a side chain comprising an acidic or a polar group;
- X 2 comprises a side chain comprising an acidic (e.g., ⁇ COOH) or a polar group. In some embodiments, X 2 comprises a side chain comprising an acid group. In some embodiments, X 5 comprises a side chain comprising an acidic or a polar group. In some embodiments, X 5 comprises a side chain comprising an acid group. In some embodiments, X 6 comprises a side chain comprising an acidic or a polar group. In some embodiments, X 6 comprises a side chain comprising an acid group. In some embodiments, X 9 comprises a side chain comprising an optionally substituted aromatic group.
- an acidic e.g., ⁇ COOH
- X 2 comprises a side chain comprising an acid group.
- X 5 comprises a side chain comprising an acidic or a polar group. In some embodiments, X 5 comprises a side chain comprising an acid group. In some embodiments, X 6 comprises a side chain comprising an acidic or a
- X 12 comprises a side chain comprising an optionally substituted aromatic group.
- X 13 comprises a side chain comprising an optionally substituted aromatic group.
- X 2 and X 5 each independently comprise a side chain comprising an acidic or a polar group.
- X 2 and X 6 each independently comprise a side chain comprising an acidic or a polar group.
- X 5 and X 6 each independently comprise a side chain comprising an acidic or a polar group.
- X 2 and X 5 each independently comprise a side chain comprising an acidic group.
- X 2 and X 6 each independently comprise a side chain comprising an acidic group.
- X 5 and X 6 each independently comprise a side chain comprising an acidic group.
- X 2 , X 5 and X 6 each independently comprise a side chain comprising an acidic or a polar group.
- X 2 , X 5 and X 6 each independently comprise a side chain comprising an acidic group.
- each of X 9 and X 12 independently comprises a side chain comprising an optionally substituted aromatic group.
- each of X 9 and X 13 independently comprises a side chain comprising an optionally substituted aromatic group.
- each of X 9 , X 12 and X 13 independently comprises a side chain comprising an optionally substituted aromatic group.
- each of X 2 and X 5 independently comprises a side chain comprising an acidic group (e.g., ⁇ COOH), and each of X 9 , X 12 and X 13 independently comprises a side chain comprising an optionally substituted aromatic group.
- each of X 2 , X 5 and X 6 independently comprises a side chain comprising an acidic group (e.g., ⁇ COOH), and each of X 9 , X 12 and X 13 independently comprises a side chain comprising an optionally substituted aromatic group.
- amino acid residues e.g., those of amino acids having the structure of formula A-I, A-II, A-III, A-IV, A-V, A-VI, etc.
- Certain examples are described herein for X 0 , X 1 , X 2 , X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , X 9 , X 10 , X 11 , X 12 , X 13 , X 14 , X 15 , X 16 , X 17 , etc.
- p0 is 0.
- p0 is 1.
- X 0 is selected from Gly, Sar, and NMebAla.
- X 0 is Gly.
- X 0 is Sar.
- X 0 is NMebAla.
- X 0 is present in various peptides (e.g., in some embodiments, p0 is 1).
- X 0 is absent from various peptides (e.g., in some embodiments, p0 is 0).
- X 0 is a N-terminus residue.
- X 0 is an amino acid reside suitable for stapling.
- X 0 is S5.
- X 0 is S6.
- X 0 is stapled.
- Various types of staples may be utilized as described herein.
- X 0 is stapled with X 4 .
- X 4 is stapled with X 11 .
- a stapled peptide comprises X 0 -X 4 -X 11 stapling.
- a stapled peptide comprises another staple, e.g., X 10 -X 14 .
- X 0 is X 1 as described herein.
- Various types of amino acid residues can be used for X 1 , e.g., a residue of an amino acid of formula A-I, A-II, A-III, A-IV, A-V, A-VI, etc. or a salt thereof in accordance with the present disclosure.
- X 1 is ⁇ N(R a1 ) ⁇ L a1 ⁇ C(R a2 )(R a3 ) ⁇ L a2 ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, X 1 is ⁇ N(R a1 ) ⁇ C(R a2 )(R a3 ) ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, X 1 is ⁇ N(R a1 ) ⁇ C(R a2 )H ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, R a1 is ⁇ H.
- R a3 is ⁇ H.
- L a is L as described herein.
- L is an optionally substituted bivalent linear or branched C 1-10 hydrocarbon chain.
- L is an optionally substituted bivalent linear C 1-10 hydrocarbon chain.
- L is ⁇ (CH 2 )n ⁇ , wherein n is 1-10.
- L is ⁇ CH 2 ⁇ .
- L is ⁇ (CH 2 ) 2 ⁇ .
- L is ⁇ (CH 2 ) 3 ⁇ .
- L is ⁇ (CH 2 ) 4 ⁇ .
- one or more methylene units of L are independently replaced with ⁇ C(O) ⁇ , ⁇ N(R’) ⁇ , ⁇ Cy ⁇ or ⁇ O ⁇ .
- a methylene unit is replaced with ⁇ C(O) ⁇ .
- a methylene unit is replaced with ⁇ N(R’) ⁇ .
- a methylene unit is replaced with ⁇ Cy ⁇ .
- ⁇ Cy ⁇ is optionally substituted phenylene.
- ⁇ Cy ⁇ is 1,2-phenylene.
- a methylene unit is replaced with ⁇ O ⁇ .
- L is ⁇ C(O) ⁇ (CH 2 )n ⁇ . In some embodiments, L is ⁇ C(O) ⁇ (CH 2 ) 2 ⁇ . In some embodiments, L is ⁇ C(O) ⁇ (CH 2 ) 3 ⁇ . In some embodiments, L is ⁇ C(O) ⁇ 1,2-phenylene ⁇ O ⁇ CH 2 ⁇ .
- L is applicable to all groups that can be such a group or moiety (e.g., L a , L s1 , L s2 , L s3 , etc.), no matter where such embodiments are described.
- X 1 is a residue of amino acid that comprises an optionally substituted ring.
- the amino group of X 1 is part of an optionally substituted ring.
- X 1 is an amino acid as described herein, e.g., of formula A-I, A-II, A-III, etc.
- R a1 and R a3 are taken together to form an optionally substituted ring, e.g., an optionally substituted 3-10 membered ring.
- R a1 and R a3 are taken together with their intervening atoms to form an optionally substituted 3-10 membered saturated or partially saturated ring having, in addition to the intervening atoms, 0-5 heteroatoms.
- a formed ring is saturated.
- a formed ring is monocyclic.
- a formed ring has no heteroatoms in addition to the intervening atoms.
- L a1 and L a2 are covalent bonds.
- a formed ring is unsubstituted.
- a formed ring is substituted.
- a substituent comprises a double bond which is suitable for metathesis with another double bond to form a staple.
- X 1 is MePro.
- X 1 is an amino acid reside suitable for stapling.
- X 1 is Asp. In some embodiments, X 1 is S6. In some embodiments, X 1 is Pro. In some embodiments, X 1 is Ala. In some embodiments, X 1 is Ser. In some embodiments, X 1 is ThioPro. In some embodiments, X 1 is Gly. In some embodiments, X 1 is NMebAla. In some embodiments, X 1 is Asn. In some embodiments, X 1 is TfeGA. In some embodiments, X 1 is Glu. In some embodiments, X 1 is an acidic amino acid residue. In some embodiments, X 1 is a polar amino acid residue. In some embodiments, X 1 comprises a hydrophobic side chain.
- an agent comprises a N-terminal group.
- X 1 is bonded to a N-terminal group.
- X 1 comprises a N-terminal group.
- a N-terminal group is Ac, 4pentenyl, 5hexenyl, BzAm2OAllyl, Hex, Bua, 2PyzCO, 3Phc3, MeOPr, lithocholate, 2FPhc, PhC, MeSO2, Ts, Isobutyryl, Isovaleryl, EtHNCO, TzPyr, 15PyraPy, 8IAP, 3PydCO, 2PyBu, 2PymCO, 5PymCO, or 4PymCO.
- a N-terminal group is Ac, 2PyBu, 1Imidac, 2F2PyAc, 2IAPAc, 124TriPr, 6QuiAc, 3PyAc, 123TriAc, 1PyrazoleAc, 4PyPrpc, 3PyPrpc, 5PymAc, 1PydoneAc, 124TriAc, 3IAPAc, Me2NAc, 4MePipzPrpC, MePipAc, MeImid4SO2, 8QuiSO2, mPEG4, mPEG8, mPEG16, mPEG24, NPyroR3, C3a, Bua, isobutyryl, Cpc, Bnc, CF3CO, 2PyCypCO, Cbc, CypCO, 4THPCO, 2PyzCO, 3Phc3, MeOPr, lithocholate, 2FPhc, PhC, MeOPr,
- a N-terminal group contains a moiety, e.g., a terminal olefin, for stapling.
- a N-terminal group is Ac.
- a N-terminal group is NPyroR3.
- a N-terminal group is 5hexenyl.
- a N-terminal group is 4pentenyl.
- X 1 is Ac-PL3, Ac-S5, NPyroR3-Asp, Ac-MePro, 5hexenyl-MePro, Ac- S6, 4pentenyl-MePro, Ac-Pro, Ac-Ala, Bua-PL3, C3a-PL3, Cpc-PL3, Cbc-PL3, CypCO-PL3, 4THPCO-PL3, Isobutyryl-PL3, Ac-Asp, Ac-Ser, Ts-PL3, 15PyraPy-PL3, 2PyBu-PL3, 4PymCO-PL3, 4pentenyl-ThioPro, 4PyPrpc-PL3, 3IAPAc-PL3, 4MePipzPrpC-PL3, MePipAc-PL3, MeImid4SO2-PL3, BzAm2OAllyl-MePro, Ac-Gly, Ac-Sar, Ac-NMebAla, Hex-PL3, 2P
- X 1 is Ac-PL3. In some embodiments, X 1 is Ac-S5. In some embodiments, X 1 is NPyroR3-Asp. In some embodiments, X 1 is Ac-MePro. In some embodiments, X 1 is Ac-S6. In some embodiments, X 1 is 4pentenyl-MePro. In some embodiments, X 1 is Ac-Pro. In some embodiments, X 1 is Ac-Ala. In some embodiments, X 1 is Bua-PL3. In some embodiments, X 1 is C3a-PL3. In some embodiments, X 1 is Cpc-PL3. In some embodiments, X 1 is Cbc-PL3.
- X 1 is CypCO-PL3. In some embodiments, X 1 is 4THPCO-PL3. In some embodiments, X 1 is Isobutyryl-PL3. In some embodiments, X 1 is Bnc-PL3. In some embodiments, X 1 is CF3CO-PL3. [0349] In some embodiments, X 1 is or comprises a residue of an amino acid or a moiety selected from Table A-I, Table A-II, Table A-III and Table A-IV. [0350] In some embodiments, X 1 is stapled (a staple bonds to X 1 ). In some embodiments, X 1 is a residue of PL3 and stapled. In some embodiments, X 1 is stapled with X 4 .
- a staple connecting a pair of amino acid residues has the structure of L s , ⁇ L s1 ⁇ L s2 ⁇ L s3 ⁇ , wherein L s1 is L a of one amino acid residue, e.g., X 1 , and L s3 is L a of the other amino acid residue, e.g., X 4 .
- a staple is L s .
- L s1 is L a of one amino acid residue of a pair of stapled amino acid residues
- L s3 is L a of the other amino acid residue of a pair of stapled amino acid residues.
- L s is ⁇ L a ⁇ L s2 ⁇ L a ⁇ , wherein each variable is independently as described herein.
- L a are described herein.
- L s1 is an optionally substituted bivalent linear or branched C 1-10 hydrocarbon chain.
- L s3 is an optionally substituted bivalent linear or branched C 1-10 hydrocarbon chain.
- a staple e.g., L s
- L s is bonded to two backbone atoms. In some embodiments, it is bonded to two carbon backbone atoms. In some embodiments, it is independently bonded to an alpha carbon atom of an amino acid residue at each end.
- X 1 is [4pentyenyl]MePro, [5pentenyl]MePro or [BzAm2OAllyl]MePro.
- X 1 is stapled with X 3 .
- a staple connecting X 1 and X 3 has the structure of L s as described herein.
- a staple is L s .
- L s1 is L a of an amino acid residue as described herein.
- L s1 is L as described herein.
- one or more methylene units of L are independently replaced with ⁇ C(O) ⁇ , ⁇ N(R’) ⁇ , ⁇ Cy ⁇ or ⁇ O ⁇ .
- L is ⁇ N(R’) ⁇ C(O) ⁇ (CH 2 ) n ⁇ O ⁇ CH 2 ⁇ , wherein n is 1-10.
- L is ⁇ C(O) ⁇ (CH 2 ) n ⁇ O ⁇ CH 2 ⁇ , wherein n is 1-10. In some embodiments, L is ⁇ N(R’) ⁇ C(O) ⁇ (CH 2 ) 2 ⁇ O ⁇ CH 2 ⁇ . In some embodiments, L is ⁇ C(O) ⁇ (CH 2 ) 2 ⁇ O ⁇ CH 2 ⁇ . In some embodiments, L is ⁇ N(R’) ⁇ C(O) ⁇ (CH 2 ) 3 ⁇ O ⁇ CH 2 ⁇ . In some embodiments, L is ⁇ C(O) ⁇ (CH 2 ) 3 ⁇ O ⁇ CH 2 ⁇ .
- L is ⁇ N(R’) ⁇ C(O) ⁇ (1,2-phenylene) ⁇ O ⁇ CH 2 ⁇ . In some embodiments, L is ⁇ C(O) ⁇ (1,2-phenylene) ⁇ O ⁇ CH 2 ⁇ . In some embodiments, one or more methylene units of L are replaced with ⁇ C(R’) 2 ⁇ . In some embodiments, one or more methylene units of L are replaced with ⁇ CHR’ ⁇ . In some embodiments, R’ (e.g., of ⁇ N(R’) ⁇ , ⁇ C(R’) 2 ⁇ , etc.) and another group that can be R, e.g., R a1 , R a2 , R a3 , etc.
- R e.g., of ⁇ N(R’) ⁇ , ⁇ C(R’) 2 ⁇ , etc.
- R a1 , R a2 , R a3 , etc. of an amino acid residue to which the staple is bonded to are taken together with their intervening atoms to form an optionally substituted 3-10 membered ring having 0-5 heteroatoms as described herein.
- R’ e.g., of ⁇ N(R’) ⁇ , ⁇ C(R’) 2 ⁇ , etc.
- R a1 of an amino acid residue to which the staple is bonded to e.g., X 1
- R a1 of an amino acid residue to which the staple is bonded to e.g., X 1
- R’ e.g., of ⁇ N(R’) ⁇ , ⁇ C(R’) 2 ⁇ , etc.
- R a2 of an amino acid residue to which the staple is bonded to e.g., X 1
- R a2 of an amino acid residue to which the staple is bonded to e.g., X 1
- R’ e.g., of ⁇ N(R’) ⁇ , ⁇ C(R’) 2 ⁇ , etc.
- R a3 of an amino acid residue to which the staple is bonded to e.g., X 1
- a formed ring is a ring existed in an amino acid residue, e.g., X 1 .
- L s3 is L as described herein. In some embodiments, L s3 is L a of an amino acid residue as described herein.
- L is an optionally substituted bivalent linear or branched C 1-10 hydrocarbon chain wherein one or more methylene units of L are independently replaced with ⁇ C(O) ⁇ , ⁇ N(R’) ⁇ , ⁇ Cy ⁇ or ⁇ O ⁇ .
- L is an optionally substituted bivalent linear C 1-10 hydrocarbon chain wherein one or more methylene units of L are independently replaced with ⁇ C(O) ⁇ , ⁇ N(R’) ⁇ , ⁇ Cy ⁇ or ⁇ O ⁇ .
- L is an optionally substituted bivalent linear or branched C 1- 10 hydrocarbon chain.
- L is an optionally substituted bivalent linear C 1-10 hydrocarbon chain.
- L s2 is ⁇ CH 2 ⁇ CH 2 ⁇ .
- a staple is bonded to two carbon backbone atoms. In some embodiments, it is independently bonded to an alpha carbon atom of an amino acid residue at each end. In some embodiments, it is bonded to a nitrogen backbone atom (e.g., of an alpha-amino group) and a carbon backbone atom (e.g., an alpha-carbon atom). In some embodiments, it is bonded to two nitrogen backbone atoms (e.g., in some embodiments, each independently of an alpha-amino group).
- X 1 is the 1 st amino acid from the N-terminus.
- an amino group of X 1 is a tertiary amine.
- an amino group of X 1 is a primary or secondary amine.
- an amino group of X 1 is capped.
- a capping group is R’ as described herein.
- a capping group is ⁇ C(O)R wherein R is as described herein.
- R is optionally substituted C 1-6 aliphatic.
- R is optionally substituted C 1-6 alkyl.
- R is methyl.
- X 1 interacts with Val349 of beta-catenin or an amino acid residue corresponding thereto.
- X 1 is or comprises a residue of an amino acid or a moiety selected from Table A-IV.
- Various types of amino acid residues can be used for X 2 , e.g., a residue of an amino acid of formula A-I, A-II, A-III, A-IV, A-V, A-VI, etc. or a salt thereof in accordance with the present disclosure.
- X 2 is ⁇ N(R a1 ) ⁇ L a1 ⁇ C(R a2 )(R a3 ) ⁇ L a2 ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, X 2 is ⁇ N(R a1 ) ⁇ C(R a2 )(R a3 ) ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, X 2 is ⁇ N(R a1 ) ⁇ C(R a2 )H ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, R a1 is ⁇ H.
- R a3 is ⁇ H.
- X 2 is a residue of amino acid (e.g., of formula A-I, A-II, A-III, A-IV, A- V, A-VI, etc. or a salt thereof) that comprises an acidic or polar group.
- X 2 is a residue of amino acid whose side chain comprises an acidic group (in some embodiments, may be referred to as an “acidic amino acid residue”).
- an amino acid residue whose side chain comprises an acidic group comprises ⁇ COOH in its side chain. In some embodiments, it is a residue of an amino acid having the structure of formula A-IV or a salt thereof.
- R PA is ⁇ H and R PS and R PC are ⁇ OH.
- it is ⁇ N(R a1 ) ⁇ L a1 ⁇ C( ⁇ L a ⁇ COOH)(R a3 ) ⁇ L a2 ⁇ C(O) ⁇ .
- it is ⁇ NH ⁇ L a1 ⁇ C( ⁇ L a ⁇ COOH)(R a3 ) ⁇ L a2 ⁇ C(O) ⁇ .
- it is ⁇ NH ⁇ CH( ⁇ L a ⁇ COOH) ⁇ C(O) ⁇ .
- L a is L as described herein.
- L is an optionally substituted bivalent linear or branched C 1-10 hydrocarbon chain wherein one or more methylene units of L are independently replaced with ⁇ C(O) ⁇ , ⁇ N(R’) ⁇ , ⁇ Cy ⁇ or ⁇ O ⁇ .
- L is an optionally substituted bivalent linear C 1-10 hydrocarbon chain wherein one or more methylene units of L are independently replaced with ⁇ C(O) ⁇ , ⁇ N(R’) ⁇ , ⁇ Cy ⁇ or ⁇ O ⁇ .
- L is an optionally substituted bivalent linear or branched C 1-10 hydrocarbon chain.
- L is an optionally substituted bivalent linear C 1-10 hydrocarbon chain. In some embodiments, L is a bivalent linear or branched C 1-10 hydrocarbon chain. In some embodiments, L is a bivalent linear C 1-10 hydrocarbon chain. In some embodiments, L is optionally substituted ⁇ (CH 2 )n ⁇ wherein n is 1-10. In some embodiments, L is ⁇ (CH 2 )n ⁇ . In some embodiments, L is ⁇ CH 2 ⁇ . In some embodiments, L is ⁇ (CH 2 ) 2 ⁇ . In some embodiments, L is ⁇ (CH 2 ) 3 ⁇ . In some embodiments, L is ⁇ (CH 2 ) 4 ⁇ .
- an acidic amino acid residue is Asp. In some embodiments, it is Glu. Other acidic amino acid residues are described herein and can be utilized at various amino acid residue positions.
- X 2 is a residue of Asp, Glu, Aad, SbMeAsp, RbMeAsp, aMeDAsp, or OAsp. In some embodiments, X 2 is a residue of Asp, Glu, or Aad. In some embodiments, X 2 is a residue of Asp. In some embodiments, X 2 is a residue of Glu. In some embodiments, X 2 is a residue of Aad.
- X 2 is a residue of SbMeAsp. In some embodiments, X 2 is a residue of RbMeAsp. In some embodiments, X 2 is a residue of aMeDAsp. In some embodiments, X 2 is a residue of OAsp. [0369] In some embodiments, X 2 is a residue of amino acid (e.g., of formula A-I, A-II, A-III, A-IV, A- V, A-VI, etc.
- an amino acid residue whose side chain comprises a polar group is ⁇ N(R a1 ) ⁇ L a1 ⁇ C(R a2 )(R a3 ) ⁇ L a2 ⁇ C(O) ⁇ .
- an amino acid residue whose side chain comprises a polar group is ⁇ N(R a1 ) ⁇ C(R a2 )(R a3 ) ⁇ C(O) ⁇ .
- an amino acid residue whose side chain comprises an amide group e.g., ⁇ C(O)N(R’) 2 such as ⁇ CONH 2 .
- R a2 is ⁇ L a ⁇ C(O)N(R’) 2 wherein each variable is independently as described herein.
- R a2 is ⁇ L a ⁇ C(O)NH 2 wherein L is independently as described herein.
- L a is L’ as described herein.
- R a3 is H.
- such a polar amino acid residue is Asn. In some embodiments, it is MeAsn.
- an amino acid residue whose side chain comprises a polar group is an amino acid residue whose side chain comprises ⁇ OH.
- R a2 is ⁇ L a ⁇ OH wherein each variable is independently as described herein.
- R a2 is ⁇ L a ⁇ OH wherein L is independently as described herein.
- L a is L’ as described herein.
- such an amino acid residue is a residue of Hse, Ser, aThr, or Thr.
- it is a residue of Hse, Ser, or aThr.
- it is a residue of Hse.
- it is a residue of Ser.
- X 2 is a residue of Asn. In some embodiments, X 2 is a residue of MeAsn. In some embodiments, X 2 is a residue of Hse, Ser, aThr, or Thr. In some embodiments, X 2 is a residue of Hse, Ser, or aThr. In some embodiments, X 2 is a residue of Hse. In some embodiments, X 2 is a residue of Ser. In some embodiments, X 2 is a residue of aThr.
- X 2 is a residue of Thr.
- X 2 is Asp, Ala, Asn, Glu, Npg, Ser, Hse, Val, S5, S6, AcLys, TfeGA, aThr, Aad, Pro, Thr, Phe, Leu, PL3, Gln, isoGlu, MeAsn, isoDAsp, RbGlu, SbGlu, AspSH, Ile, SbMeAsp, RbMeAsp, aMeDAsp, OAsp, 3COOHF, NAsp, 3Thi, NGlu, isoDGlu, BztA, Tle, Aib, MePro, Chg, Cha, or DipA.
- X 2 is or comprises a residue of an amino acid or a moiety selected from Table A-IV. [0374] In some embodiments, X 2 interacts with Gly307 of beta-catenin or an amino acid residue corresponding thereto. In some embodiments, X 2 interacts with Lys312 of beta-catenin or an amino acid residue corresponding thereto. In some embodiments, X 2 interacts with each of Gly307 and Lys312 of beta- catenin or an amino acid residue corresponding thereto.
- X 3 Various types of amino acid residues can be used for X 3 , e.g., a residue of an amino acid of formula A-I, A-II, A-III, A-IV, A-V, A-VI, etc. or a salt thereof in accordance with the present disclosure.
- X 3 is ⁇ N(R a1 ) ⁇ L a1 ⁇ C(R a2 )(R a3 ) ⁇ L a2 ⁇ C(O) ⁇ , wherein each variable is independently as described herein.
- X 3 is ⁇ N(R a1 ) ⁇ C(R a2 )(R a3 ) ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, X 3 is ⁇ N(R a1 ) ⁇ C(R a2 )H ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, R a1 is ⁇ H. In some embodiments, R a3 is ⁇ H. [0376] In some embodiments, L a is L as described herein. In some embodiments, L is an optionally substituted bivalent linear or branched C 1-10 hydrocarbon chain.
- L is an optionally substituted bivalent linear C 1-10 hydrocarbon chain.
- L is ⁇ (CH 2 )n ⁇ , wherein n is 1-10.
- L is ⁇ CH 2 ⁇ .
- L is ⁇ (CH 2 ) 2 ⁇ .
- L is ⁇ (CH 2 ) 3 ⁇ .
- L is ⁇ (CH 2 ) 4 ⁇ .
- L is an optionally substituted bivalent linear or branched C 1-10 hydrocarbon chain wherein one or more methylene units of L are independently replaced with ⁇ C(O) ⁇ , ⁇ N(R’) ⁇ , ⁇ Cy ⁇ or ⁇ O ⁇ .
- L is an optionally substituted bivalent linear C 1-10 hydrocarbon chain wherein one or more methylene units of L are independently replaced with ⁇ C(O) ⁇ , ⁇ N(R’) ⁇ , ⁇ Cy ⁇ or ⁇ O ⁇ .
- L is an optionally substituted bivalent linear or branched C 1-10 hydrocarbon chain.
- L is an optionally substituted bivalent linear C 1-10 hydrocarbon chain.
- L is a bivalent linear or branched C 1-10 hydrocarbon chain.
- L is ⁇ CH 2 ⁇ .
- L is ⁇ CH 2 ⁇ N(R’) ⁇ CH 2 ⁇ .
- R’ is Bn.
- R’ is ⁇ C(O)R. In some embodiments, R is phenyl. In some embodiments, R is t-butyl. In some embodiments, R is cyclohexyl.
- X 3 is a hydrophobic amino acid residue.
- a hydrophobic amino acid residue is an amino acid residue whose side chain is an optionally substituted aliphatic group. In some embodiments, it is a residue of an amino acid whose side chain is optionally substituted C 1-10 alkyl. In some embodiments, it is a residue of an amino acid whose side chain is C 1-10 alkyl.
- it is a residue of an amino acid whose side chain is C 1- 10 aliphatic optionally substituted with one or more non-polar and non-charged groups. In some embodiments, it is a residue of an amino acid whose side chain is C 1-10 alkyl optionally substituted with one or more non- polar and non-charged groups. In some embodiments, it is a residue of an amino acid whose side chain is C 1- 10 aliphatic optionally substituted with one or more hydrophobic substituents. In some embodiments, it is a residue of an amino acid whose side chain is C 1-10 aliphatic. In some embodiments, it is a residue of an amino acid whose side chain is C 1-10 alkyl.
- a hydrophobic amino acid residue e.g., X 3
- a hydrophobic amino acid residue has the structure of ⁇ NH 2 ⁇ C(R a2 )(R a3 ) ⁇ C(O) ⁇ or ⁇ NH ⁇ C(R a2 )H ⁇ C(O) ⁇ wherein each variable is independently as described herein.
- R a2 is ⁇ L a ⁇ R’.
- R’ is R as described herein.
- R is optionally substituted group selected from C 1-10 aliphatic, phenyl, 10-membered aryl, and 5-10 membered heteroaryl having 1-5 heteroatoms.
- each substituent, if any, is independently a non-polar group.
- R is optionally substituted C 1-10 aliphatic.
- R is optionally substituted C 1-10 alkyl.
- R is C 1-10 aliphatic.
- R is C 1-10 alkyl.
- R is methyl.
- R is isopropyl.
- R is 1-methylpropyl.
- R is 2-methylpropyl.
- R is optionally substituted aryl. In some embodiments, R is aryl. In some embodiments, R is optionally substituted phenyl. In some embodiments, R is phenyl. In some embodiments, R is optionally substituted 5-6 membered heteroaryl having 1-4 heteroatoms. In some embodiments, R is optionally substituted 5-6 membered heteroaryl having 1 heteroatom. In some embodiments, R is 5-6 membered heteroaryl having 1-4 heteroatoms. In some embodiments, R is 5-6 membered heteroaryl having 1 heteroatom. In some embodiments, R is optionally substituted 9-10 membered heteroaryl having 1-5 heteroatoms.
- R is optionally substituted 9-10 membered heteroaryl having 1 heteroatom. In some embodiments, R is 9-10 membered heteroaryl having 1-4 heteroatoms. In some embodiments, R is 9-10 membered heteroaryl having 1 heteroatom. In some embodiments, a heteroatom is nitrogen. In some embodiments, a heteroatom is oxygen. In some embodiments, L is an optionally substituted bivalent linear or branched C 1-10 hydrocarbon chain. In some embodiments, L is an optionally substituted bivalent linear C 1-10 hydrocarbon chain. In some embodiments, L is a bivalent linear or branched C 1-10 hydrocarbon chain. In some embodiments, L is a bivalent linear C 1-10 hydrocarbon chain.
- L is optionally substituted ⁇ (CH 2 )n ⁇ , wherein n is 1-10. In some embodiments, L is ⁇ (CH 2 )n ⁇ , wherein n is 1-10. In some embodiments, L is ⁇ CH 2 ⁇ . In some embodiments, L is ⁇ (CH 2 ) 2 ⁇ . In some embodiments, L is ⁇ (CH 2 ) 3 ⁇ . In some embodiments, L is ⁇ (CH 2 ) 4 ⁇ . In some embodiments, L is an optionally substituted bivalent linear or branched C 1-10 hydrocarbon chain wherein one or more methylene units of L are independently replaced with ⁇ C(O) ⁇ , ⁇ N(R’) ⁇ , ⁇ Cy ⁇ or ⁇ O ⁇ .
- L is an optionally substituted bivalent linear C 1-10 hydrocarbon chain wherein one or more methylene units of L are independently replaced with ⁇ C(O) ⁇ , ⁇ N(R’) ⁇ , ⁇ Cy ⁇ or ⁇ O ⁇ .
- a hydrophobic amino acid residue is a residue of Ala, Val, Ile, Leu, Met, Phe, Tyr, Trp, etc. Other hydrophobic amino acid residues are described herein and can be utilized at various amino acid residue positions.
- X 3 comprises a side chain comprising a cycloaliphatic group (e.g., a 4-, 5- , or 6-membered cycloalkyl group).
- X 3 is a residue of Npg, Leu, Cha, Val, nLeu, Ile, CypA, CyLeu, Chg, DiethA, Ala, Aib, OctG, or Cba. In some embodiments, X 3 is a residue of Npg, Leu, or Cha. In some embodiments, X 3 is a residue of Npg. In some embodiments, X 3 is a residue of Leu. In some embodiments, X 3 is a residue of Cha. In some embodiments, X 3 is a residue of Val. In some embodiments, X 3 is a residue of nLeu. In some embodiments, X 3 is a residue of Ile.
- X 3 is a residue of CypA. In some embodiments, X 3 is a residue of CyLeu. In some embodiments, X 3 is a residue of Chg. In some embodiments, X 3 is a residue of DiethA. In some embodiments, X 3 is a residue of Ala. In some embodiments, X 3 is a residue of Aib. In some embodiments, X 3 is a residue of OctG. In some embodiments, X 3 is a residue of Cba. [0381] In some embodiments, X 3 comprises a side chain which is or comprises an optionally substituted aromatic group (in some embodiments, may be referred to as an “aromatic amino acid residue”).
- an aromatic amino acid residue has a side chain which is or comprises an optionally substituted aromatic group.
- an aromatic amino acid residue e.g., X 3
- an aromatic amino acid residue has a side chain which is or comprises an optionally substituted aromatic group, wherein each substituent of the aromatic group is independently halogen.
- it comprises a side chain which is or comprises two optionally substituted aromatic groups. In some embodiments, it comprises a side chain which is or comprises an optionally substituted aromatic group, wherein each substituent of the aromatic group is independently selected from halogen or ⁇ OH. In some embodiments, an aromatic group is phenyl. In some embodiments, an aromatic group is optionally substituted 8-10 membered bicyclic aryl or heteroaryl having 0-5 heteroatoms. In some embodiments, an aromatic group is optionally substituted 9-10 membered bicyclic aryl or heteroaryl having one heteroatom. In some embodiments, it is a residue of an amino acid of formula A-I or a salt thereof.
- an amino acid residue has the structure of ⁇ NH ⁇ C(R a2 )(R a3 ) ⁇ C(O) ⁇ or ⁇ NH ⁇ CH(R a3 ) ⁇ C)O) ⁇ .
- R a3 is ⁇ L a ⁇ R’ wherein each variable is independently as described herein.
- R’ is an optionally substituted group selected from phenyl, 10- membered bicyclic aryl, 5-6 membered heteroaryl having 1-4 heteroatoms, and 9-10 membered bicyclic heteroaryl having 1-5 heteroatoms.
- each substituent is independently halogen or ⁇ OH.
- R’ is optionally substituted phenyl.
- R’ is phenyl. In some embodiments, R’ is optionally substituted aryl. In some embodiments, R’ is aryl. In some embodiments, R’ is optionally substituted 5-membered heteroaryl having 1-4 heteroatoms. In some embodiments, R’ is optionally substituted 5-membered heteroaryl having 1 heteroatom. In some embodiments, R’ is 5-6 membered heteroaryl having 1-4 heteroatoms. In some embodiments, R’ is 5-6 membered heteroaryl having 1 heteroatom. In some embodiments, R’ is optionally substituted 9-10 membered heteroaryl having 1-5 heteroatoms. In some embodiments, R’ is optionally substituted 9-10 membered heteroaryl having 1 heteroatom.
- R’ is 9-10 membered heteroaryl having 1- 4 heteroatoms. In some embodiments, R’ is 9-10 membered heteroaryl having 1 heteroatom. In some embodiments, a heteroatom is nitrogen. In some embodiments, a heteroatom is oxygen. In some embodiments, a heteroatom is sulfur. In some embodiments, L a is a covalent bond. In some embodiments, L a is optionally substituted ⁇ (CH 2 )n ⁇ wherein n is 1-10. In some embodiments, L a is ⁇ (CH 2 )n ⁇ . In some embodiments, n is 1. In some embodiments, n is 2. In some embodiments, n is 3. In some embodiments, L a is ⁇ CH(Ph) ⁇ .
- an aromatic amino acid residue is Phe. In some embodiments, an aromatic amino acid residue is Tyr. In some embodiments, an aromatic amino acid residue is Trp. Other aromatic amino acid residues are described herein and can be utilized at various amino acid residue positions. [0384] In some embodiments, X 3 is a residue of Phe. In some embodiments, X 3 is a residue of Pff. In some embodiments, X 3 is a residue of Tyr. In some embodiments, X 3 is a residue of Trp. In some embodiments, X 3 is a residue of Phg. In some embodiments, X 3 is a residue of DipA.
- X 3 is or comprises a residue of an amino acid or a moiety selected from Table A-I, Table A-II, Table A-III and Table A-IV. [0386] In some embodiments, X 3 is a residue of an amino acid suitable for stapling. In some embodiments, X 3 is a residue of an amino acid comprising a double bond, e.g., a terminal olefin, suitable for stapling. In some embodiments, X 3 is a residue of an amino acid having the structure of A-II, A-III, etc. or a salt thereof.
- a staple has the structure of ⁇ L s1 ⁇ L s2 ⁇ L s3 ⁇ , wherein each variable is as described herein.
- L s1 is L a of one stapled amino acid residue (e.g., X 1 ) and L s3 is L a of the other stapled amino acid residue (e.g., X 3 ).
- L s is ⁇ C(O) ⁇ (CH 2 )n ⁇ L s2 ⁇ (CH 2 )n ⁇ , wherein each variable is independently as described herein.
- L s is ⁇ C(O) ⁇ (CH 2 )n ⁇ L s2 ⁇ CH 2 ⁇ N(R’) ⁇ CH 2 ⁇ , wherein each variable is independently as described herein.
- n is 1.
- n is 2.
- n is 3.
- L s is ⁇ C(O) ⁇ Cy ⁇ O ⁇ CH 2 ⁇ L s2 ⁇ CH 2 ⁇ , each variable is independently as described herein.
- L s is ⁇ C(O) ⁇ Cy ⁇ O ⁇ CH 2 ⁇ L s2 ⁇ CH 2 ⁇ N(R’) ⁇ CH 2 ⁇ , each variable is independently as described herein.
- one end of a staple e.g., L s
- a backbone nitrogen atom e.g., of an alpha amino group, at ⁇ C(O) ⁇ of a staple
- a backbone carbon atom e.g., an alpha carbon atom, at ⁇ CH 2 ⁇ of a staple
- an amino acid residue suitable for stapling e.g., X 3
- such an amino acid residue is ⁇ N(R a1 ) ⁇ L a1 ⁇ C( ⁇ L a ⁇ R SP1 )(R a3 ) ⁇ L a2 ⁇ C(O) ⁇ , wherein each variable is independently as described herein.
- such an amino acid residue is ⁇ N(R a1 ) ⁇ C( ⁇ L a ⁇ R SP1 )(R a3 ) ⁇ C(O) ⁇ , wherein each variable is independently as described herein.
- a reactive group R SP1 is ⁇ COOH.
- an amino acid suitable for stapling is an amino acid of formula IV or a salt thereof. In some embodiments, such an amino acid is GlnR.
- such an amino acid residue can be stapled with another amino acid residue suitable for stapling, e.g., that comprises a R SP1 group that is ⁇ NH 2 (e.g., in Lys).
- X 3 is GlnR.
- X 3 is stapled with X 7 .
- a side chain of X 3 comprises ⁇ COOH that forms a staple with, e.g., a side chain of another amino acid comprising an amino group (e.g., Lys).
- a staple e.g., L s
- a staple comprises ⁇ C(O)N(R’) ⁇ wherein R’ is as described herein.
- R’ is ⁇ H.
- a staple, e.g., L s has the structure of ⁇ L s1 ⁇ C(O)N(R’) ⁇ L s3 ⁇ , wherein each variable is independently as described herein.
- L s1 is L as described herein.
- L s3 is L as described herein.
- L s1 is L a as described herein of one amino acid residue of a stapled pair.
- L s1 is L a as described herein of the other amino acid residue of a stapled pair.
- L s1 is independently an optionally substituted bivalent linear or branched C 1-10 hydrocarbon chain.
- L s3 is independently an optionally substituted bivalent linear or branched C 1-10 hydrocarbon chain.
- each of L s1 and L s3 is independently an optionally substituted bivalent linear or branched C 1-10 hydrocarbon chain.
- each of L s1 and L s3 is independently ⁇ (CH 2 )n ⁇ , wherein n is 1-10.
- L s1 is ⁇ CH 2 ⁇ .
- L s3 is ⁇ (CH 2 ) 3 ⁇ .
- L s2 is L as described herein.
- L is or comprises ⁇ C(O)N(R’) ⁇ wherein R’ is as described herein.
- L is or comprises ⁇ C(O)NH ⁇ .
- L s is ⁇ (CH 2 ) n1 ⁇ C(O)NH ⁇ (CH 2 ) n2 ⁇ , wherein each of n1 and n2 is independently n as described herein.
- L s is ⁇ (CH 2 ) 2 ⁇ C(O)NH ⁇ (CH 2 ) 4 ⁇ .
- such a staple connects X 3 and X 7 .
- such a staple may connect other pairs of stapled amino acid residues.
- X 3 is a residue of amino acid that comprises an acidic or polar group.
- X 3 is a residue of amino acid whose side chain comprises an acidic group, e.g., a ⁇ COOH group or a salt form thereof (e.g., a compound of formula A-IV, PA, PA-a, PA-b, PA-c, etc.).
- X 3 is ⁇ N(R a1 ) ⁇ L a1 ⁇ C( ⁇ L a ⁇ COOH)(R a3 ) ⁇ L a2 ⁇ C(O) ⁇ wherein each variable is independently as described herein. In some embodiments, X 3 is ⁇ N(R a1 ) ⁇ C( ⁇ L a ⁇ COOH)(R a3 ) ⁇ C(O) ⁇ wherein each variable is independently as described herein. In some embodiments, X 3 is a residue of Asp. In some embodiments, X 3 is a residue of amino acid whose side chain comprises ⁇ OH. For example, in some embodiments, X 3 is a residue of Tyr.
- X 3 is a residue of Ser. [0395] In some embodiments, X 3 is a residue selected from Npg, Leu, Cha, AllylGly, GlnR, Val, nLeu, Asp, [Bn][Allyl]Dap, [Phc][Allyl]Dap, Ile, Phe, CypA, CyLeu, Chg, Pff, DiethA, Ala, Tyr, Trp, Ser, Aib, Phg, OctG, Cba, MorphNva, F2PipNva, [Piv][Allyl]Dap, and [CyCO][Allyl]Dap.
- X 3 is a residue of Npg, Ile, Asp, Cha, DipA, Chg, Leu, B5, Cba, S5, Ala, Glu, AllylGly, nLeu, Ser, B6, Asn, B4, GlnR, Val, [Phc][Allyl]Dap, Hse, [Bn][Allyl]Dap, 1MeK, R5, Phe, CypA, CyLeu, Pff, DiethA, Tyr, Trp, Aib, Phg, OctG, MorphNva, F2PipNva, [Piv][Allyl]Dap, [CyCO][Allyl]Dap, Lys, or S3.
- X 3 is Npg. In some embodiments, X 3 is Leu. In some embodiments, Npg provides better properties and/or activities than, e.g., Ala. [0397] In some embodiments, X 3 interacts with Tyr306 of beta-catenin or an amino acid residue corresponding thereto. [0398] In some embodiments, X 3 is or comprises a residue of an amino acid or a moiety selected from Table A-IV. [0399] Various types of amino acid residues can be used for X 4 , e.g., a residue of an amino acid of formula A-I, A-II, A-III, A-IV, A-V, A-VI, etc.
- X 4 is a residue of an amino acid of formula A-I, A-II, A-III, A-IV, A-V, A-VI, etc. or a salt thereof. In some embodiments, X 4 is a residue of an amino acid of formula A-II or salt thereof. In some embodiments, X 4 is a residue of an amino acid of formula A-III or salt thereof. In some embodiments, X 4 is a residue of an amino acid of formula A-IV or salt thereof. In some embodiments, X 4 is a residue of an amino acid of formula A-V or salt thereof. In some embodiments, X 4 is a residue of an amino acid of formula A-VI or salt thereof.
- X 4 is ⁇ N(R a1 ) ⁇ L a1 ⁇ C(R a2 )(R a3 ) ⁇ L a2 ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, X 4 is ⁇ N(R a1 ) ⁇ C(R a2 )(R a3 ) ⁇ C(O) ⁇ wherein each variable is independently as described herein. In some embodiments, X 4 is ⁇ N(R a1 ) ⁇ C(R a2 )H ⁇ C(O) ⁇ wherein each variable is independently as described herein.
- X 4 is ⁇ N(R a1 ) ⁇ L a1 ⁇ C( ⁇ L a ⁇ R SP1 )( ⁇ L a ⁇ R SP2 ) ⁇ L a2 ⁇ C(O) ⁇ wherein each variable is independently as described herein.
- X 4 is ⁇ N(R a1 ) ⁇ C( ⁇ L a ⁇ R SP1 )( ⁇ L a ⁇ R SP2 ) ⁇ C(O) ⁇ wherein each variable is independently as described herein.
- R a1 is ⁇ H.
- R a3 is ⁇ H.
- each of ⁇ L a ⁇ connected R SP1 or R SP2 is independent L as described herein.
- L is an optionally substituted bivalent linear or branched C 1-10 hydrocarbon chain. In some embodiments, L is an optionally substituted bivalent linear C 1-10 hydrocarbon chain. In some embodiments, L is a bivalent linear or branched C 1-10 hydrocarbon chain. In some embodiments, L is a bivalent linear C 1-10 hydrocarbon chain. In some embodiments, L is optionally substituted ⁇ (CH 2 )n ⁇ , wherein n is 1-10. In some embodiments, L is ⁇ (CH 2 )n ⁇ , wherein n is 1-10. In some embodiments, L is ⁇ CH 2 ⁇ . In some embodiments, L is ⁇ (CH 2 ) 2 ⁇ .
- L is ⁇ (CH 2 ) 3 ⁇ . In some embodiments, L is ⁇ (CH 2 ) 4 ⁇ . In some embodiments, L is an optionally substituted bivalent linear or branched C 1-10 hydrocarbon chain wherein one or more methylene units of L are independently replaced with ⁇ C(O) ⁇ , ⁇ N(R’) ⁇ , ⁇ Cy ⁇ or ⁇ O ⁇ . In some embodiments, L is an optionally substituted bivalent linear C 1-10 hydrocarbon chain wherein one or more methylene units of L are independently replaced with ⁇ C(O) ⁇ , ⁇ N(R’) ⁇ , ⁇ Cy ⁇ or ⁇ O ⁇ .
- X 4 is or comprises a residue of an amino acid or a moiety selected from Table A-I, Table A-II, Table A-III and Table A-IV. [0402] In some embodiments, X 4 is residue of an amino acid suitable for stapling. In some embodiments, X 4 is a residue of an amino acid which comprises two functional groups suitable for stapling. In some embodiments, X 4 is a residue of an amino acid which comprises one and only one functional group suitable for stapling. In some embodiments, X 4 is a residue of an amino acid which comprises two olefins, e.g., two terminal olefins.
- each L a is independently optionally substituted bivalent C 1-10 alkylene or heteroalkylene.
- each L a is independently optionally substituted ⁇ (CH 2 )n ⁇ wherein n is 1-10.
- n is 1.
- n is 2.
- n is 3.
- n is 4.
- n is 5.
- n is 6. In some embodiments, n is 7. In some embodiments, n is 8. In some embodiments, n is 9. In some embodiments, n is 10. In some embodiments, X 4 is a residue of B5, R5, R4, or R6. In some embodiments, X 4 is a residue of B5 or R5. In some embodiments, X 4 is a residue of B5. In some embodiments, X 4 is residue of R5. In some embodiments, X 4 is a residue of R4. In some embodiments, X 4 is a residue of R6. [0403] In some embodiments, X 4 is stapled.
- X 4 is connected to two residues independently through two staples (e.g., when X 4 is B5).
- X 4 is staple with X 1
- X 4 is stapled with X 11 .
- various staples may be utilized for connecting stapled amino acid residues.
- a staple is L s as described herein.
- each staple connected to X 4 is independently L s as described herein.
- L s is ⁇ L s1 ⁇ L s2 ⁇ L s3 ⁇ , wherein each variable is independently as described herein.
- one of L s1 and L s3 is L a of one of two stapled amino acid residues, and the other is L a of the other of two stapled amino acid residues.
- L s3 is L a of X 4 , e.g., when X 4 is stapled with an amino acid residue to its N-terminus side (e.g., X 1 ).
- L s1 is L a of X 4 , e.g., when X 4 is stapled with an amino acid residue to its C-terminus side (e.g., X 11 ).
- L s1 is L a of X 1
- L s3 is L a of X 4
- L s1 is L a of X 4
- L s3 is L a of X 11 .
- two staples are bonded to X 4 , wherein a first staple staples X 4 with an amino acid residue to the N-terminus side of X 4 (an amino acid residue to a N-terminus side of a reference amino acid residue may be referred to as “N-direction amino acid residue” of the reference amino acid residue, e.g., X 1 is a N-direction amino acid residue of X 4 ), wherein the first staple is L s having the structure of ⁇ L s1 ⁇ L s2 ⁇ L s3 ⁇ , wherein L s1 is L a of the N-direction amino acid residue, and L s3 is L a of X 4 , and wherein a second staple staples X 4 with an amino acid residue to the C-terminus side of X 4 (an amino acid residue to a C-terminus side of a reference amino acid residue may be referred to as “C-direction amino acid residue” of the reference amino acid residue, e.g.
- L a is described herein and can be utilized for various amino acid residues including X 4 and N-direction (e.g., X 1 ) and C-direction (e.g., X 11 ) amino acid residues.
- each L a is ⁇ (CH 2 ) 3 ⁇ .
- L s2 is optionally substituted ⁇ CH 2 ⁇ CH 2 ⁇ .
- L s2 is ⁇ CH 2 ⁇ CH 2 ⁇ .
- each staple is independently bonded to two alpha carbon atoms of two stapled amino acid residues.
- X 4 is stapled with two amino acid residues, e.g., X 1 and X 11 .
- X 4 is stapled with only one residue, e.g., X 11 (e.g., when X 4 is a residue of R5, R4, or R6).
- X 4 is a residue of R4.
- X 4 is a residue of R5.
- X 4 is a residue of R6.
- a staple is L s as described herein.
- L s1 is L a of a first amino acid residue of two stapled amino acid residues, e.g., X 4
- L s3 is L a of a second amino acid residue of two stapled amino acid residues, e.g., X 11
- a second amino acid residue e.g., X 11
- X 4 is not stapled (e.g., when other residues are optionally stapled, in pre- stapling agents, etc.).
- X 4 is B5, Npg, Asp, R5, Ile, Ala, Cha, Chg, Ser, Leu, R4, R6, Phe, or S5.
- Various types of amino acid residues can be used for X 5 , e.g., a residue of an amino acid of formula A-I, A-II, A-III, A-IV, A-V, A-VI, etc. or a salt thereof in accordance with the present disclosure.
- X 5 is ⁇ N(R a1 ) ⁇ L a1 ⁇ C(R a2 )(R a3 ) ⁇ L a2 ⁇ C(O) ⁇ , wherein each variable is independently as described herein.
- X 5 is ⁇ N(R a1 ) ⁇ C(R a2 )(R a3 ) ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, X 5 is ⁇ N(R a1 ) ⁇ C(R a2 )H ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, R a1 is ⁇ H. In some embodiments, R a3 is ⁇ H. [0413] In some embodiments, X 5 is a residue of amino acid that comprises an acidic or polar group.
- X 5 is a residue of amino acid whose side chain comprises an acidic group, e.g., a ⁇ COOH group or a salt form thereof. In some embodiments, X 5 is a residue of an amino acid of formula A- IV or a salt thereof. In some embodiments, X 5 is a residue of an amino acid of formula PA, PA-a, PA-b, PA- c, or a salt thereof. In some embodiments, R PA is ⁇ H and R PS and R PC are ⁇ OH.
- X 5 is ⁇ N(R a1 ) ⁇ L a1 ⁇ C( ⁇ L a ⁇ COOH)(R a3 ) ⁇ L a2 ⁇ C(O) ⁇ wherein each variable is independently as described herein. In some embodiments, X 5 is ⁇ N(R a1 ) ⁇ C( ⁇ L a ⁇ COOH)(R a3 ) ⁇ C(O) ⁇ wherein each variable is independently as described herein. In some embodiments, L a is L as described herein. For example, in some embodiments, L is an optionally substituted bivalent linear or branched C 1-10 hydrocarbon chain. In some embodiments, L is an optionally substituted bivalent linear C 1-10 hydrocarbon chain.
- L is a bivalent linear or branched C 1-10 hydrocarbon chain. In some embodiments, L is a bivalent linear C 1-10 hydrocarbon chain. In some embodiments, L is optionally substituted ⁇ (CH 2 )n ⁇ , wherein n is 1-10. In some embodiments, L is ⁇ (CH 2 )n ⁇ , wherein n is 1-10. In some embodiments, L is ⁇ CH 2 ⁇ . In some embodiments, L is ⁇ (CH 2 ) 2 ⁇ . In some embodiments, L is ⁇ (CH 2 ) 3 ⁇ . In some embodiments, L is ⁇ (CH 2 ) 4 ⁇ . In some embodiments, L is ⁇ CH(CH 3 ) ⁇ .
- L is an optionally substituted bivalent linear or branched C 1-10 hydrocarbon chain wherein one or more methylene units of L are independently replaced with ⁇ C(O) ⁇ , ⁇ N(R’) ⁇ , ⁇ Cy ⁇ or ⁇ O ⁇ .
- X 5 is a residue of Asp, Glu, Aad, SbMeAsp, or RbMeAsp.
- X 5 is a residue of Asp or Glu.
- X 5 is a residue of Asp.
- X 5 is a residue of Glu.
- X 5 is a residue of Aad.
- X 5 is a residue of SbMeAsp. In some embodiments, X 5 is a residue of RbMeAsp. [0415] In some embodiments, X 5 is a residue of amino acid whose side chain comprises a polar group. In some embodiments, X 5 is a residue of amino acid whose side chain comprises an amide group, e.g., ⁇ C(O)N(R’) 2 such as ⁇ CONH 2 . In some embodiments, R a2 is ⁇ L a ⁇ C(O)N(R’) 2 wherein each variable is independently as described herein.
- R a2 is ⁇ L a ⁇ C(O)NH 2 wherein L is independently as described herein.
- L a is L’ as described herein.
- X 5 is a residue of Asn.
- X 5 is a residue of MeAsn.
- X 5 is a residue of amino acid whose side chain comprises ⁇ OH.
- X 5 is a residue of Hse, aThr, Ser, or Thr.
- X 5 is a residue of Hse or aThr.
- X 5 is a residue of Hse.
- X 5 is a residue of aThr. In some embodiments, X 5 is a residue of Ser. In some embodiments, X 5 is a residue of Thr. [0416] In some embodiments, X 5 is Asp, B5, 3COOHF, Glu, Asn, Npg, Hse, aThr, Aad, Ser, Thr, MeAsn, AspSH, SbMeAsp, RbMeAsp. In some embodiments, X 5 is Asp. In some embodiments, X 5 is 3COOHF. In some embodiments, X 5 is Glu. In some embodiments, X 5 is B5. In some embodiments, X 5 is DipA.
- X 5 is Chg. [0417] In some embodiments, X 5 is or comprises a residue of an amino acid or a moiety selected from Table A-IV. [0418] In some embodiments, X 5 interacts with Trp383 of beta-catenin or an amino acid residue corresponding thereto. In some embodiments, X 5 interacts with Arg386 of beta-catenin or an amino acid residue corresponding thereto. In some embodiments, X 5 interacts with Asn387 of beta-catenin or an amino acid residue corresponding thereto. In some embodiments, X 5 interacts with Asn387 and Trp383 of beta- catenin or amino acid residues corresponding thereto.
- X 6 Various types of amino acid residues can be used for X 6 , e.g., a residue of an amino acid of formula A-I, A-II, A-III, A-IV, A-V, A-VI, etc. or a salt thereof in accordance with the present disclosure.
- X 6 is a residue of an amino acid of formula A-I, A-II, A-III, A-IV, A-V, A-VI, etc. or a salt thereof.
- X 6 is ⁇ N(R a1 ) ⁇ L a1 ⁇ C(R a2 )(R a3 ) ⁇ L a2 ⁇ C(O) ⁇ , wherein each variable is independently as described herein.
- X 6 is ⁇ N(R a1 ) ⁇ C(R a2 )(R a3 ) ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, X 6 is ⁇ N(R a1 ) ⁇ C(R a2 )H ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, X 6 is a residue of an amino acid of formula A-IV or a salt thereof. In some embodiments, X 6 is a residue of an amino acid of formula PA, PA-a, PA-b, PA-c, or a salt thereof. In some embodiments, R PA is ⁇ H and R PS and R PC are ⁇ OH.
- R a1 is ⁇ H. In some embodiments, R a3 is ⁇ H.
- X 6 is a residue of amino acid that comprises an acidic or polar group. In some embodiments, X 6 is a residue of amino acid whose side chain comprises an acidic group, e.g., a ⁇ COOH group or a salt form thereof. In some embodiments, X 6 is a residue of an amino acid having the structure of formula A-IV or a salt thereof. In some embodiments, X 6 is a residue of amino acid having the structure of formula PA, PA-a, PA-b, PA-c, etc. In some embodiments, R PA is ⁇ H and R PS and R PC are ⁇ OH.
- X 6 is ⁇ N(R a1 ) ⁇ L a1 ⁇ C ( ⁇ L a ⁇ COOH)(R a3 ) ⁇ L a2 ⁇ C(O) ⁇ . In some embodiments, X 6 is ⁇ NH ⁇ L a1 ⁇ C( ⁇ L a ⁇ COOH)(R a3 ) ⁇ L a2 ⁇ C(O) ⁇ . In some embodiments, X 6 is ⁇ NH ⁇ CH( ⁇ L a ⁇ COOH) ⁇ C(O) ⁇ . [0421] As described herein, L a is L as described herein.
- L is an optionally substituted bivalent linear or branched C 1-10 hydrocarbon chain wherein one or more methylene units of L are independently replaced with ⁇ C(O) ⁇ , ⁇ N(R’) ⁇ , ⁇ Cy ⁇ or ⁇ O ⁇ .
- L is an optionally substituted bivalent linear C 1-10 hydrocarbon chain wherein one or more methylene units of L are independently replaced with ⁇ C(O) ⁇ , ⁇ N(R’) ⁇ , ⁇ Cy ⁇ or ⁇ O ⁇ .
- L is an optionally substituted bivalent linear or branched C 1-10 hydrocarbon chain.
- L is an optionally substituted bivalent linear C 1-10 hydrocarbon chain.
- L is a bivalent linear or branched C 1-10 hydrocarbon chain. In some embodiments, L is a bivalent linear C 1-10 hydrocarbon chain. In some embodiments, L is optionally substituted ⁇ (CH 2 )n ⁇ wherein n is 1-10. In some embodiments, L is ⁇ (CH 2 )n ⁇ . In some embodiments, L is ⁇ CH 2 ⁇ . In some embodiments, L is ⁇ (CH 2 ) 2 ⁇ . In some embodiments, L is ⁇ (CH 2 ) 3 ⁇ . In some embodiments, L is ⁇ (CH 2 ) 4 ⁇ . In some embodiments, a methylene unit is replaced with ⁇ Cy ⁇ .
- L is ⁇ CH 2 ⁇ Cy ⁇ CH 2 ⁇ . In some embodiments, L is ⁇ CH 2 ⁇ Cy ⁇ . In some embodiments, L is ⁇ (CH 2 ) 4 ⁇ Cy ⁇ CH 2 ⁇ C(CH 3 ) 2 ⁇ . In some embodiments, ⁇ Cy ⁇ is optionally substituted phenylene. In some embodiments, ⁇ Cy ⁇ is phenylene. In some embodiments, ⁇ Cy ⁇ is substituted phenylene. In some embodiments, ⁇ Cy ⁇ is mono-substituted phenylene. In some embodiments, a substituent is ⁇ F. In some embodiments, a substituent is optionally substituted C 1-6 alkyl.
- a substituent is ⁇ CF 3 . In some embodiments, a substituent is ⁇ OH. In some embodiments, phenylene is 1,2-phenylene. In some embodiments, phenylene is 1,3-phenylene. In some embodiments, phenylene is 1,4-phenylene. In some embodiments, a substituent is ortho to the carbon atom closed to ⁇ COOH. In some embodiments, it is meta. In some embodiments, it is para. In some embodiments, ⁇ Cy ⁇ is 1,3-phenylene (e.g., in 3COOHF). In some embodiments, ⁇ Cy ⁇ is an optionally substituted bivalent 5-10 membered heteroaryl group having 1-5 heteroatoms.
- ⁇ Cy ⁇ is an optionally substituted bivalent 5-membered heteroaryl group having 1-4 heteroatoms. In some embodiments, ⁇ Cy ⁇ is an optionally substituted bivalent 6-membered heteroaryl group having 1-4 heteroatoms. In some embodiments, ⁇ Cy ⁇ is optionally substituted In some embodiments, ⁇ Cy ⁇ is n some embodiments, ⁇ Cy ⁇ is optionally substituted In some embodiments, ⁇ Cy ⁇ is n some embodiments, L is bonded to a backbone atom, e.g., an alpha carbon atom, at ⁇ CH 2 ⁇ . In some embodiments, a methylene unit is replaced with ⁇ N(R’) ⁇ wherein R’ is as described herein.
- L is ⁇ CH 2 ⁇ N(R’) ⁇ CH 2 ⁇ wherein R’ is as described herein.
- R’ is R as described herein.
- R is optionally substituted C 1-6 alkyl.
- R is ⁇ CH 2 CF 3 .
- X 6 is a residue of an amino acid of formula PA, PA-a, PA-b, PA-c, or a salt thereof, wherein R PA is ⁇ H and R PS and R PC are ⁇ OH.
- X 6 is a residue of 3COOHF, TfeGA, Asp, [CH2CMe2CO2H]TriAzDap, Glu, 2OH3COOHF, 4OH3COOHF, 4COOHF, 2COOHF, 5F3Me2COOHF, 4F3Me2COOHF, 5F3Me3COOHF, 4F3Me3COOHF, 3F2COOHF, or dGlu.
- X 6 is a residue of 3COOHF, TfeGA, Asp, or [CH2CMe2CO2H]TriAzDap.
- X 6 is a residue of 3COOHF.
- X 6 is a residue of TfeGA. In some embodiments, X 6 is a residue of Asp. In some embodiments, X 6 is a residue of [CH2CMe2CO2H]TriAzDap. In some embodiments, X 6 is a residue of Glu. In some embodiments, X 6 is a residue of 2OH3COOHF. In some embodiments, X 6 is a residue of 4OH3COOHF. In some embodiments, X 6 is a residue of 4COOHF. In some embodiments, X 6 is a residue of 2COOHF. In some embodiments, X 6 is a residue of 5F3Me2COOHF.
- X 6 is a residue of 4F3Me2COOHF. In some embodiments, X 6 is a residue of 5F3Me3COOHF. In some embodiments, X 6 is a residue of 4F3Me3COOHF. In some embodiments, X 6 is a residue of 3F2COOHF. In some embodiments, X 6 is a residue of dGlu. [0423] In some embodiments, X 6 is a residue of amino acid whose side chain comprises a polar group. Certain such amino acid residues useful for X 6 include those described for, e.g., X 2 , X 5 , etc., whose side chain comprise a polar group.
- X 6 is a residue of amino acid whose side chain comprises ⁇ OH.
- X 6 is a residue of Thr, Tyr, Ser, aThr, or hTyr.
- X 6 is a residue of Thr.
- X 6 is a residue of Tyr.
- X 6 is a residue of Ser.
- X 6 is a residue of aThr.
- X 6 is a residue of hTyr.
- X 6 is a residue of amino acid whose side chain comprises an amide group, e.g., ⁇ C(O)N(R’) 2 such as ⁇ CONH 2 .
- X 6 is a residue of Asn. In some embodiments, X 6 is Me2Gln. [0424] In some embodiments, X 6 is a residue of an amino acid whose side chain is hydrophobic. Certain such amino acid residues include those hydrophobic amino acid residues described for, e.g., X 3 . In some embodiments, X 6 is a residue of an amino acid whose side chain is an optionally substituted aliphatic group. In some embodiments, X 6 is a residue of Val. In some embodiments, X 6 is a residue of Ala. In some embodiments, X 6 is a residue of Leu. In some embodiments, X 6 is a residue of Ile.
- amino acid residues of certain properties, structures, etc. described for one position may also be utilized at other positions where amino acid residues of the same properties, structures, etc. can be utilized.
- hydrophobic amino acid residues can be utilized at both positions X 3 and X 6
- hydrophobic amino acid residues described for X 3 can be utilized for X 6 and vice versa.
- acidic amino acid residues can be utilized at positions X 2 , X 5 and X 6
- acidic amino acid residues described for one of them may be utilized at the other two positions as well.
- X 6 comprises a side chain comprising an optionally substituted aromatic group.
- amino acid residues include those amino acid residues whose side chains comprise aromatic groups described for, e.g., X 3 .
- an aromatic group is optionally substituted 5- membered heteroaryl having 1-3 nitrogen atoms.
- an aromatic group is optionally substituted 8-10 membered bicyclic aryl or heteroaryl having 1-5 heteroatoms.
- an aromatic group is phenyl.
- an aromatic group is optionally substituted phenyl.
- X 6 is a residue of His.
- X 6 is a residue of Trp.
- X 6 is a reside of Phe.
- X 6 is a residue of 3cbmf. [0427] In some embodiments, X 6 is a residue selected from 3COOHF, TfeGA, Asp, [CH2CMe2CO2H]TriAzDap, Glu, 2OH3COOHF, 4OH3COOHF, 4COOHF, 2COOHF, 5F3Me2COOHF, 4F3Me2COOHF, 5F3Me3COOHF, 4F3Me3COOHF, 3F2COOHF, dGlu, Thr, Tyr, Ser, aThr, hTyr, Glyn, Lys, Arg, Val, Ala, Leu, Phe, Ile, His, Trp, or 3cbmf.
- X 6 is a residue of Gln. In some embodiments, X 6 is a residue of Lys. In some embodiments, X 6 is a residue of Arg. [0428] In some embodiments, X 6 is 3COOHF, Asp, TfeGA, Aib, Glu, Npg, Gln, [CH2CMe2CO2H]TriAzDap, B5, Thr, Ser, Asn, Ala, Hse, 4BOH2F, 2OH3COOHF, 4OH3COOHF, 4COOHF, 2COOHF, His, Tyr, 5F3Me2COOHF, 4F3Me2COOHF, 5F3Me3COOHF, 4F3Me3COOHF, 3F2COOHF, Val, Trp, Arg, dGlu, aThr, hTyr, 3cbmf, Leu, Phe, Lys, Ile, SbMeAsp, b
- X 6 is 3COOHF. In some embodiments, X 6 is Asp. In some embodiments, X 6 is TfeGA. In some embodiments, X 6 is Glu. In some embodiments, 3COOHF provides better properties and/or activities than, e.g., Asp. [0429] In some embodiments, X 6 is an amino acid residue for stapling as described herein. In some embodiments, X 6 is stapled. In some embodiments, X 6 is a reside of B5 [0430] In some embodiments, X 6 is or comprises a residue of an amino acid or a moiety selected from Table A-IV.
- X 6 interacts with Tyr306 of beta-catenin or an amino acid residue corresponding thereto. In some embodiments, X 6 interacts with Lys345 of beta-catenin or an amino acid residue corresponding thereto.
- Various types of amino acid residues can be used for X 7 , e.g., a residue of an amino acid of formula A-I, A-II, A-III, A-IV, A-V, A-VI, etc. or a salt thereof in accordance with the present disclosure.
- X 7 is ⁇ N(R a1 ) ⁇ L a1 ⁇ C(R a2 )(R a3 ) ⁇ L a2 ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, X 7 is ⁇ N(R a1 ) ⁇ C(R a2 )(R a3 ) ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, X 7 is ⁇ N(R a1 ) ⁇ C(R a2 )H ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, R a1 is ⁇ H.
- R a3 is ⁇ H.
- R a2 is R, wherein R is C 1-10 aliphatic.
- R a3 is R, wherein R is C 1-10 aliphatic.
- each of R a2 and R a3 is independently R as described herein.
- R a2 and R a3 are the same.
- R is C 1-10 alkyl.
- R is methyl.
- X 7 is a residue of an amino acid whose side chain is hydrophobic.
- X 7 is a hydrophobic amino acid residue described herein, e.g., those described for X 3 .
- X 7 is a residue of an amino acid whose side chain is optionally substituted C 1-10 alkyl.
- X 7 is a residue of an amino acid whose side chain is C 1-10 alkyl.
- X 7 is a residue of an amino acid whose side chain is C 1-10 alkyl optionally substituted with one or more non-polar and non-charged groups.
- X 7 comprises a side chain comprising a cycloaliphatic group (e.g., a 3-, 4-, 5-, or 6-membered cycloalkyl group).
- X 7 is a residue of Aib, Ala, nLeu, Cha, Npg, sAla, Val, CyLeu, Leu, aMeL, DaMeL, or aMeV. In some embodiments, X 7 is a residue of Aib, Ala, nLeu, or Cha. In some embodiments, X 7 is a residue of Aib. In some embodiments, X 7 is a residue of Ala. In some embodiments, X 7 is a residue of nLeu. In some embodiments, X 7 is a residue of Cha. In some embodiments, X 7 is a residue of Npg. In some embodiments, X 7 is a residue of sAla.
- X 7 is a residue of Val. In some embodiments, X 7 is a residue of CyLeu.. In some embodiments, X 7 is a residue of Leu. In some embodiments, X 7 is a residue of Cpg. In some embodiments, X 7 is a residue of Cbg. In some embodiments, X 7 is a residue of aMeL. In some embodiments, X 7 is a residue of DaMeL. In some embodiments, X 7 is a residue of aMeV. [0435] In some embodiments, X 7 is a residue of amino acid whose side chain comprises a polar group. Various polar amino acid residues described herein may be utilized for X 7 .
- X 7 is a residue of amino acid whose side chain comprises ⁇ OH.
- X 7 is a residue of Ser.
- X 7 is a residue of Hse.
- X 7 is a residue of Thr.
- X 7 is a residue of DaMeS.
- X 7 is a residue of aMeS.
- X 7 is a residue of amino acid that comprises an acidic or polar group.
- X 7 is a residue of amino acid whose side chain comprises an acidic group, e.g., a ⁇ COOH group or a salt form thereof (e.g., a compound of formula A-IV, etc.). Various acidic amino acid residues described herein may be utilized for X 7 .
- X 7 is a residue of 3COOHF.
- X 7 is a residue of amino acid whose side chain comprises an amide group, e.g., ⁇ C(O)N(R’) 2 such as ⁇ CONH 2 .
- X 7 is a residue of Asn.
- X 7 is a residue of Gln.
- X 7 is a residue of Me2Gln. In some embodiments, X 7 is a residue of AcLys. [0437] In some embodiments, X 7 comprises a side chain comprising an optionally substituted aromatic group. Various aromatic amino acid residues described herein may be utilized for X 7 . In some embodiments, an aromatic group is optionally substituted 5-membered heteroaryl having 1-3 nitrogen atoms. In some embodiments, X 7 is a residue of Phe. In some embodiments, X 7 is a residue of aMeDF. In some embodiments, X 7 is a residue of aMeF. In some embodiments, X 7 is a residue of His.
- X 7 is selected from Aib, Ala, MorphGln, Gln, GlnR, Ser, iPrLys, nLeu, Cha, Hse, Lys, Npg, sAla, TriAzLys, Val, CyLeu, 3COOHF, Thr, Phe, [29N2spiroundecane]GlnR, Acp, Asn, DaMeS, aMeDF, [4aminopiperidine]GlnR, Leu, Cpg, Cbg, Me2Gln, Met2O, AcLys, His, aMeL, DaMeL, aMeV, aMeS, aMeF, [isophthalate]Lys, [succinate]Lys, [Me2Mal]Lys, [diphenate]Lys, or [Biphen33COOH]Lys.
- X 7 is selected from GlnR, Lys, [29N2spiroundecane]GlnR, [4aminopiperidine]GlnR, sAla, TriAzLys, [isophthalate]Lys, [succinate]Lys, [Me2Mal]Lys, [diphenate]Lys, or [Biphen33COOH]Lys. [0439] In some embodiments, X 7 is an amino acid residue suitable for stapling as described herein.
- an amino acid residue suitable for stapling is ⁇ N(R a1 ) ⁇ L a1 ⁇ C( ⁇ L a ⁇ R SP1 )(R a3 ) ⁇ L a2 ⁇ C(O) ⁇ wherein each variable is independently as described herein. In some embodiments, it is ⁇ N(R a1 ) ⁇ C( ⁇ L a ⁇ R SP1 )(R a3 ) ⁇ C(O) ⁇ wherein each variable is independently as described herein.
- each amino acid residue in a pair of amino acid residues suitable for stapling, is independently ⁇ N(R a1 ) ⁇ L a1 ⁇ C( ⁇ L a ⁇ R SP1 )(R a3 ) ⁇ L a2 ⁇ C(O) ⁇ or ⁇ N(R a1 ) ⁇ C( ⁇ L a ⁇ R SP1 )(R a3 ) ⁇ C(O) ⁇ , wherein each variable is independently as described herein.
- R a1 is ⁇ H.
- R a3 is ⁇ H.
- both R a1 and R a3 are ⁇ H.
- R SP1 of a one amino acid residue in a pair is ⁇ NHR wherein R is as described herein. In some embodiments, R is ⁇ H. In some embodiments, R is optionally substituted C 1-6 aliphatic. In some embodiments, R is optionally substituted C 1-6 alkyl. In some embodiments, R is C 1-6 aliphatic. In some embodiments, R is C 1-6 alkyl. In some embodiments, R SP1 is ⁇ NH 2 .
- such an amino acid residue can be stapled with another amino acid residue comprising ⁇ COOH through amidation to form a staple comprising ⁇ C(O)N(R’) ⁇ , e.g., L s wherein L s2 is or comprising ⁇ C(O)N(R’) ⁇ .
- R SP1 in the other amino acid residue of a pair R SP1 is ⁇ COOH or an active derivative thereof.
- in the other amino acid residue of a pair R SP1 is ⁇ COOH.
- R’ is R.
- R’ is ⁇ H.
- L s1 is L a of a first amino acid residue, e.g., X 7 .
- L s3 is L a of a second amino acid residue, e.g., a C-direction amino acid residue of a first amino acid residue.
- a first amino acid residue is X 7
- a second amino acid residue is a C-direction amino acid residue of X 7 , e.g., X 10 .
- each of L s1 and L s3 is independently L.
- L is an optionally substituted bivalent linear or branched C 1-10 hydrocarbon chain.
- L is an optionally substituted bivalent linear C 1-10 hydrocarbon chain.
- L is a bivalent linear or branched C 1-10 hydrocarbon chain.
- L is a bivalent linear C 1-10 hydrocarbon chain. In some embodiments, L is optionally substituted ⁇ (CH 2 )n ⁇ , wherein n is 1-10. In some embodiments, L is ⁇ (CH 2 )n ⁇ , wherein n is 1-10. In some embodiments, L is ⁇ CH 2 ⁇ . In some embodiments, L is ⁇ (CH 2 ) 2 ⁇ . In some embodiments, L is ⁇ (CH 2 ) 3 ⁇ . In some embodiments, L is ⁇ (CH 2 ) 4 ⁇ .
- L is an optionally substituted bivalent linear or branched C 1-10 hydrocarbon chain wherein one or more methylene units of L are independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ C(O) ⁇ , ⁇ N(R’) ⁇ , ⁇ Cy ⁇ or ⁇ O ⁇ .
- L is an optionally substituted bivalent linear C 1-10 hydrocarbon chain wherein one or more methylene units of L are independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ C(O) ⁇ , ⁇ N(R’) ⁇ , ⁇ Cy ⁇ or ⁇ O ⁇ .
- each of L s1 and L s3 is independently L, wherein L is an optionally substituted bivalent linear or branched C 1-10 hydrocarbon chain. In some embodiments, each of L s1 and L s3 is independently L, wherein L is optionally substituted ⁇ (CH 2 )n ⁇ , wherein n is 1-10. In some embodiments, L s ⁇ (CH 2 )n1 ⁇ C(O)N(R’) ⁇ (CH 2 )n2 ⁇ wherein each variable is independently as described herein. In some embodiments, each of n1 and n2 is independently 1-10.
- a first amino acid residue has R SP1 which is an amino group
- a second amino acid residue has R SP1 which is ⁇ COOH or an activated form thereof.
- a second amino acid residue has R SP1 which is an amino group
- a first amino acid residue has R SP1 which is ⁇ COOH or an activated form thereof.
- a first amino acid residue is X 7 and a second amino acid residue is one of its C-direction amino acid residue, e.g., X 10 .
- a second amino acid residue is X 7 and a first amino acid residue is one of its N-direction amino acid residue, e.g., X 3 .
- a first amino acid residue is X 7 . In some embodiments, X 7 is Lys. In some embodiments, a second amino acid residue is X 10 . In some embodiments, X 10 is GlnR. In some embodiments, n1 is 4 as in Lys. In some embodiments, n2 is 2 as in GlnR. In some embodiments, a first amino acid residue is X 7 , e.g., GlnR. In some embodiments, n1 is 2. In some embodiments, a second amino acid residue is X 10 , e.g., Lys. In some embodiments, n2 is 4.
- a second amino acid residue is n some embodiments, L s3 is ⁇ (CH 2 ) 2 ⁇ C(O)NH ⁇ (CH 2 ) 4 ⁇ . In some embodiments, a second amino acid residue is In some em s3 bodiments, L is ⁇ (CH 2 ) 2 ⁇ C(O) ⁇ Cy ⁇ . In some embodiments, ⁇ Cy ⁇ is optionally substituted herein the nitrogen is bonded to ⁇ C(O) ⁇ .
- L s3 is ⁇ (CH 2 ) 2 ⁇ C(O) ⁇ N(R’) ⁇ (CH 2 )n ⁇ CHR’ ⁇ , wherein the two R’ are taken together with their intervening atoms to form an optionally substituted ring as described herein.
- a formed ring is optionally substituted
- a second amino acid residue is In som s3 e embodiments, L is ⁇ (CH 2 ) 2 ⁇ C(O) ⁇ N(R’) ⁇ (CH 2 )n ⁇ Cy ⁇ .
- R’ is R as described herein.
- R is ⁇ H.
- R optionally substituted C 1-6 aliphatic.
- R optionally substituted C 1-6 alkyl. In some embodiments, R is methyl. In some embodiments, n is 1. In some embodiments, ⁇ Cy ⁇ is optionally substituted wherein the nitrogen is bonded to L s2 which is or comprises ⁇ C(O) ⁇ . In some embodiments, L s3 is ⁇ (CH 2 ) 2 ⁇ C(O) ⁇ N(R’) ⁇ CH 2 ⁇ CHR’ ⁇ (CH 2 )n ⁇ . In some embodiments, n is 2. In some embodiments, ⁇ (CH 2 )n ⁇ is bonded to ⁇ N(R’) ⁇ of L s2 which is ⁇ C(O) ⁇ N(R’) ⁇ .
- R’ of ⁇ CHR’ ⁇ of L s3 is taken together with R’ of ⁇ N(R’) ⁇ of L s2 and their intervening atoms to form an optionally substituted ring as described herein.
- a formed ring is optionally substituted .
- a second amino acid residue is In some embodiments, a second amino acid residue is In some embodi s3 ments, L ⁇ (CH 2 ) 2 ⁇ C(O) ⁇ N(R’) ⁇ (CH 2 ) n1 ⁇ C(R’) 2 ⁇ (CH 2 ) n2 ⁇ .
- each of n1 and n2 is independently 1-10. In some embodiments, n1 is 1.
- n1 is 2. In some embodiments, n2 is 2. In some embodiments, R’ of ⁇ N(R’) ⁇ and one R’ of ⁇ C(R’) 2 ⁇ are taken together with their intervening atoms to form an optionally substituted ring as described herein. In some embodiments, a formed ring is an optionally substituted 6-membered monocyclic saturated ring having no heteroatoms in addition to the nitrogen atom of ⁇ N(R’) ⁇ . In some embodiments, L s2 is ⁇ C(O)N(R’) ⁇ . In some embodiments, ⁇ N(R’) ⁇ is bonded to ⁇ (CH 2 ) n2 ⁇ .
- one R’ of ⁇ C(R’) 2 ⁇ of L s3 is taken together with R’ of ⁇ N(R’) ⁇ of L s2 and their intervening atoms to form an optionally substituted ring as described herein.
- a formed ring is an optionally substituted 6-membered monocyclic saturated ring having no heteroatoms in addition to the nitrogen atom of ⁇ N(R’) ⁇ .
- a first amino acid residue is n some embodiments, L s1 is ⁇ (CH 2 ) 2 ⁇ C(O) ⁇ N(R’) ⁇ (CH 2 )n ⁇ CHR’ ⁇ , wherein the two R’ are taken together with their intervening atoms to form an optionally substituted ring as described herein. In some embodiments, a formed ring is optionally substituted.
- a second amino acid residue is GlnR (e.g., X 14 ).
- L s3 is ⁇ (CH 2 ) 2 ⁇ .
- a first amino acid residue is in some embodiments, L s1 is ⁇ (CH 2 ) 2 ⁇ C(O) ⁇ N(R’) ⁇ (CH 2 )n ⁇ Cy ⁇ .
- R’ is R as described herein.
- R is ⁇ H.
- R optionally substituted C 1-6 aliphatic.
- R optionally substituted C 1-6 alkyl.
- R is methyl.
- n is 1.
- ⁇ Cy ⁇ is optionally substituted herein the nitrogen is bonded to L s2 which is or comprises ⁇ C(O) ⁇ .
- L s1 is ⁇ (CH 2 ) 2 ⁇ C(O) ⁇ N(R’) ⁇ CH 2 ⁇ CHR’ ⁇ (CH 2 )n ⁇ .
- n is 2.
- ⁇ (CH 2 )n ⁇ is bonded to ⁇ N(R’) ⁇ of L s2 which is ⁇ C(O) ⁇ N(R’) ⁇ .
- R’ of ⁇ CHR’ ⁇ of L s1 is taken together with R’ of ⁇ N(R’) ⁇ of L s2 and their intervening atoms to form an optionally substituted ring as described herein.
- a formed ring is optionally substituted .
- a first amino acid residue is In some embodiments, a first amino acid residue is In some embodiments, L s1 ⁇ (CH 2 ) 2 ⁇ C(O) ⁇ N(R’) ⁇ (CH 2 ) n1 ⁇ C(R’) 2 ⁇ (CH 2 ) n2 ⁇ . In some embodiments, each of n1 and n2 is independently 1-10. In some embodiments, n1 is 1. In some embodiments, n1 is 2. In some embodiments, n2 is 2. In some embodiments, R’ of ⁇ N(R’) ⁇ and one R’ of ⁇ C(R’) 2 ⁇ are taken together with their intervening atoms to form an optionally substituted ring as described herein.
- a formed ring is an optionally substituted 6-membered monocyclic saturated ring having no heteroatoms in addition to the nitrogen atom of ⁇ N(R’) ⁇ .
- L s2 is ⁇ C(O)N(R’) ⁇ .
- ⁇ N(R’) ⁇ is bonded to ⁇ (CH 2 ) n2 ⁇ .
- one R’ of ⁇ C(R’) 2 ⁇ of L s1 is taken together with R’ of ⁇ N(R’) ⁇ of L s2 and their intervening atoms to form an optionally substituted ring as described herein.
- a formed ring is an optionally substituted 6-membered monocyclic saturated ring having no heteroatoms in addition to the nitrogen atom of ⁇ N(R’) ⁇ .
- a second amino acid residue is GlnR (e.g., X 14 ).
- a first residue is (e.g., X 7 ).
- a first residue is (e.g., X 7 ).
- a first residue is (e.g., X 7 ).
- L s1 is ⁇ (CH 2 )n ⁇ N(R’) ⁇ C(O) ⁇ Cy ⁇ Cy ⁇ , wherein each variable is independently as described herein.
- L s1 is ⁇ (CH 2 )n ⁇ N(R’) ⁇ C(O) ⁇ Cy ⁇ , wherein each variable is independently as described herein.
- a first residue is (e.g., X 7 ).
- L s1 is ⁇ (CH 2 )n ⁇ N(R’) ⁇ C(O) ⁇ CH 2 ⁇ , wherein R is as described herein, and the ⁇ CH 2 ⁇ bonded to C(O) ⁇ is optionally substituted.
- L s1 is ⁇ (CH 2 )n ⁇ N(R’) ⁇ C(O) ⁇ C(R’) 2 ⁇ , wherein each R is independently as described herein.
- L s1 is ⁇ (CH 2 )n ⁇ N(R’) ⁇ C(O) ⁇ C(CH 3 ) 2 ⁇ , wherein R is as described herein.
- a first residue is g., X 7 ).
- L s1 is ⁇ (CH 2 ) n1 ⁇ N(R’) ⁇ C(O) ⁇ (CH 2 ) n2 ⁇ , wherein each variable is independently as described herein.
- each of n1 and n2 is independently n as described herein.
- L s1 is ⁇ (CH 2 ) 4 ⁇ N(R’) ⁇ C(O) ⁇ (CH 2 ) 2 ⁇ , wherein each R is independently as described herein.
- n is 1-10.
- n is 1.
- n is 2.
- n is 3.
- n is 4.
- R’ is R as described herein.
- R is ⁇ H.
- ⁇ Cy ⁇ is optionally substituted phenylene.
- ⁇ Cy ⁇ is optionally substituted 1,2-phenylene.
- ⁇ Cy ⁇ is optionally substituted 1,3-phenylene.
- each ⁇ Cy ⁇ is independently optionally substituted 1,2- phenylene. In some embodiments, each ⁇ Cy ⁇ is independently optionally substituted 1,3-phenylene.
- L s2 is or comprises ⁇ C(O) ⁇ N(R’) ⁇ as described herein. In some embodiments, R’ is R as described herein. In some embodiments, R is ⁇ H. In some embodiments, L s2 is ⁇ C(O)NH ⁇ . In some embodiments, ⁇ C(O) ⁇ is bonded to ⁇ Cy ⁇ of L s1 . In some embodiments, a second residue is X 14 , e.g., Lys.
- L s3 is as described herein, e.g., optionally substituted ⁇ (CH 2 )n ⁇ . In some embodiments, L s3 is ⁇ (CH 2 )n ⁇ . In some embodiments, n is 1. In some embodiments, n is 2. In some embodiments, n is 3. In some embodiments, n is 4 (e.g., as in Lys). [0445] In some embodiments, R SP1 of a first amino acid residue is or comprises ⁇ COOH or a protected or activated form thereof. In some embodiments, a first amino acid residue is X 3 , e.g., GlnR.
- R SP1 of a second amino acid residue is or comprises an amino group, e.g., ⁇ NHR as described herein. In some embodiments, R SP1 of a second amino acid residue is or comprises ⁇ NH 2 . In some embodiments, a second amino acid residue is X 7 , e.g., Lys. In some embodiments, each of L s1 and L s3 is independently optionally substituted ⁇ (CH 2 )n ⁇ , wherein n is 1-10. In some embodiments, L s1 is ⁇ (CH 2 ) 2 ⁇ . In some embodiments, L s1 is ⁇ (CH 2 ) 4 ⁇ .
- R SP1 of a one amino acid residue in a pair is a first reaction group of a cycloaddition reaction.
- such an amino acid residue can be stapled with another amino acid residue comprising a second reactive group of a cycloaddition reaction through a cycloaddition reaction.
- R SP1 in the other amino acid residue of a pair R SP1 is a second reactive group of a cycloaddition reaction.
- a cycloaddition reaction is [3+2].
- a cycloaddition reaction is a click chemistry reaction.
- a cycloaddition reaction is [4+2].
- one of the first and the second reactive groups is or comprises ⁇ N 3 , and the other is or comprises an alkyne (e.g., a terminal alkyne or activated/strained alkyne).
- R SP1 of a first amino acid residue is ⁇ N 3 .
- L a of a first amino acid residue is L as described herein.
- L is an optionally substituted bivalent linear or branched C 1-10 hydrocarbon chain.
- L is an optionally substituted bivalent linear C 1-10 hydrocarbon chain.
- L is a bivalent linear or branched C 1-10 hydrocarbon chain.
- L is a bivalent linear C 1-10 hydrocarbon chain. In some embodiments, L is optionally substituted ⁇ (CH 2 )n ⁇ , wherein n is 1-10. In some embodiments, L is ⁇ (CH 2 )n ⁇ , wherein n is 1-10. In some embodiments, L is ⁇ CH 2 ⁇ . In some embodiments, L is ⁇ (CH 2 ) 2 ⁇ . In some embodiments, L is ⁇ (CH 2 ) 3 ⁇ . In some embodiments, L is ⁇ (CH 2 ) 4 ⁇ .
- L is an optionally substituted bivalent linear or branched C 1-10 hydrocarbon chain wherein one or more methylene units of L are independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ C(O) ⁇ , ⁇ N(R’) ⁇ , ⁇ Cy ⁇ or ⁇ O ⁇ .
- L is an optionally substituted bivalent linear C 1-10 hydrocarbon chain wherein one or more methylene units of L are independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ C(O) ⁇ , ⁇ N(R’) ⁇ , ⁇ Cy ⁇ or ⁇ O ⁇ .
- R SP1 of a second amino acid residue is or comprises ⁇ C ⁇ C ⁇ .
- R SP1 of a second amino acid residue is ⁇ H. In some embodiments, R SP1 of a second amino acid residue comprises a strained alkyne, e.g., in a ring.
- L a of a first amino acid residue is L as described herein. In some embodiments, L is an optionally substituted bivalent linear or branched C 1-10 hydrocarbon chain. In some embodiments, L is an optionally substituted bivalent linear C 1-10 hydrocarbon chain. In some embodiments, L is a bivalent linear or branched C 1-10 hydrocarbon chain. In some embodiments, L is a bivalent linear C 1-10 hydrocarbon chain.
- L is optionally substituted ⁇ (CH 2 )n ⁇ , wherein n is 1-10. In some embodiments, L is ⁇ (CH 2 )n ⁇ , wherein n is 1-10. In some embodiments, L is ⁇ CH 2 ⁇ . In some embodiments, L is ⁇ (CH 2 ) 2 ⁇ . In some embodiments, L is ⁇ (CH 2 ) 3 ⁇ . In some embodiments, L is ⁇ (CH 2 ) 4 ⁇ .
- L is an optionally substituted bivalent linear or branched C 1-10 hydrocarbon chain wherein one or more methylene units of L are independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ C(O) ⁇ , ⁇ N(R’) ⁇ , ⁇ Cy ⁇ or ⁇ O ⁇ .
- L is an optionally substituted bivalent linear C 1-10 hydrocarbon chain wherein one or more methylene units of L are independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ C(O) ⁇ , ⁇ N(R’) ⁇ , ⁇ Cy ⁇ or ⁇ O ⁇ .
- L s is ⁇ L s1 ⁇ L s2 ⁇ L s3 ⁇ , wherein L s2 is or comprises ⁇ Cy ⁇ .
- L s2 is ⁇ Cy ⁇ .
- ⁇ Cy ⁇ is formed by a cycloaddition reaction.
- ⁇ Cy ⁇ is optionally substituted
- ⁇ Cy ⁇ is n some embodiments, ⁇ Cy ⁇ is formed by a cycloaddition reaction.
- ⁇ Cy ⁇ is optionally substituted
- ⁇ Cy ⁇ is In some embodiments, L s1 a is L of a first amino acid residue, and L s3 is L a of a second amino acid residue. In some embodiments, L s1 is L a of a second amino acid residue, and L s3 is L a of a first amino acid residue. In some embodiments, each of L s1 and L s3 is independently L as described herein. In some embodiments, L is an optionally substituted bivalent linear or branched C 1-10 hydrocarbon chain. In some embodiments, L is an optionally substituted bivalent linear C 1-10 hydrocarbon chain.
- L is a bivalent linear or branched C 1-10 hydrocarbon chain. In some embodiments, L is a bivalent linear C 1-10 hydrocarbon chain. In some embodiments, L is optionally substituted ⁇ (CH 2 )n ⁇ , wherein n is 1-10. In some embodiments, L is ⁇ (CH 2 )n ⁇ , wherein n is 1-10. In some embodiments, L is ⁇ CH 2 ⁇ . In some embodiments, L is ⁇ (CH 2 ) 2 ⁇ . In some embodiments, L is ⁇ (CH 2 ) 3 ⁇ . In some embodiments, L is ⁇ (CH 2 ) 4 ⁇ .
- L is an optionally substituted bivalent linear or branched C 1-10 hydrocarbon chain wherein one or more methylene units of L are independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ C(O) ⁇ , ⁇ N(R’) ⁇ , ⁇ Cy ⁇ or ⁇ O ⁇ .
- L is an optionally substituted bivalent linear C 1-10 hydrocarbon chain wherein one or more methylene units of L are independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ C(O) ⁇ , ⁇ N(R’) ⁇ , ⁇ Cy ⁇ or ⁇ O ⁇ .
- L s1 is optionally substituted ⁇ (CH 2 ) n ⁇ , wherein n is 1-10.
- L s1 is ⁇ (CH 2 ) n ⁇ , wherein n is 1-10. In some embodiments, n is 1. In some embodiments, n is 2. In some embodiments, n is 3. In some embodiments, n is 4. In some embodiments, L s3 is optionally substituted ⁇ (CH 2 ) n ⁇ , wherein n is 1-10. In some embodiments, L s3 is ⁇ (CH 2 ) n ⁇ , wherein n is 1-10. In some embodiments, n is 1. In some embodiments, n is 2. In some embodiments, n is 3. In some embodiments, n is 4. [0450] In some embodiments, a first amino acid residue is X 7 .
- R SP1 of X 7 is ⁇ N 3 .
- L a of X 7 is optionally substituted ⁇ (CH 2 )n ⁇ wherein n is 1-10.
- L a of X 7 is ⁇ (CH 2 ) 4 ⁇ .
- L a of X 7 is ⁇ (CH 2 ) 3 ⁇ .
- L a of X 7 is ⁇ (CH 2 ) 2 ⁇ .
- L a of X 7 is ⁇ CH 2 ⁇ .
- a second amino acid residue is X 10 .
- R SP1 of X 10 is or comprises an alkyne, e.g., a strained/activated alkyne. In some embodiments, R SP1 of X 10 is ⁇ C ⁇ CH. In some embodiments, L a of X 10 is optionally substituted ⁇ (CH 2 )n ⁇ wherein n is 1-10. In some embodiments, L a of X 10 is ⁇ (CH 2 ) 4 ⁇ . In some embodiments, L a of X 10 is ⁇ (CH 2 ) 3 ⁇ . In some embodiments, L a of X 10 is ⁇ (CH 2 ) 2 ⁇ . In some embodiments, L a of X 10 is ⁇ CH 2 ⁇ .
- L s3 is L a of X 10 . In some embodiments, L s3 is bonded to a carbon atom of L s2 .
- a first amino acid residue is X 7 .
- R SP1 of X 7 is or comprises an alkyne, e.g., a strained/activated alkyne. In some embodiments, R SP1 of X 7 is ⁇ C ⁇ CH. In some embodiments, L a of X 7 is optionally substituted ⁇ (CH 2 )n ⁇ wherein n is 1-10. In some embodiments, L a of X 7 is ⁇ (CH 2 ) 4 ⁇ .
- L a of X 7 is ⁇ (CH 2 ) 3 ⁇ . In some embodiments, L a of X 7 is ⁇ (CH 2 ) 2 ⁇ . In some embodiments, L a of X 7 is ⁇ CH 2 ⁇ . In some embodiments, L s1 is L a of X 7 . In some embodiments, L s1 is bonded to a carbon atom of L s2 .In some embodiments, a second amino acid residue is X 10 . In some embodiments, R SP1 of X 10 is ⁇ N 3 . In some embodiments, L a of X 10 is optionally substituted ⁇ (CH 2 )n ⁇ wherein n is 1-10.
- L a of X 10 is ⁇ (CH 2 ) 4 ⁇ . In some embodiments, L a of X 10 is ⁇ (CH 2 ) 3 ⁇ . In some embodiments, L a of X 10 is ⁇ (CH 2 ) 2 ⁇ . In some embodiments, L a of X 10 is ⁇ CH 2 ⁇ .
- R SP1 of two amino acid residues of a pair of amino acid residues suitable for stapling can each independently react with a linking reagent to form a staple. In some embodiments, a suitable linking reagent comprises two reactive groups, each can independently react with R SP1 of each amino acid residue.
- a linking reagent has the structure of H ⁇ L” ⁇ H or a salt thereof, wherein the reagent comprises two amino groups, and L” is a covalent bond, or an optionally substituted, bivalent C 1 - C 20 aliphatic group wherein one or more methylene units of the aliphatic group are optionally and independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ Cy ⁇ , ⁇ O ⁇ , ⁇ S ⁇ , ⁇ S ⁇ S ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ C(S) ⁇ , ⁇ C(NR’) ⁇ , ⁇ C(O)N(R’) ⁇ , ⁇ N(R’)C(O)N(R’) ⁇ , ⁇ N(R’)C(O)O ⁇ , ⁇ S(O) ⁇ , ⁇ S(O) 2 ⁇ , ⁇ S(O) 2 N(R’) ⁇ , ⁇ C(O)S ⁇ , or ⁇ C(O)O ⁇ .
- such a linking agent can react with two amino acid residues each independently having a R SP1 group that is ⁇ COOH or an activated form thereof.
- Suitable embodiments for L including those described for L herein that fall within the scope of L”.
- L is L wherein L is an optionally substituted bivalent linear or branched C 1-10 hydrocarbon chain wherein one or more methylene units of L are independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ C(O) ⁇ , ⁇ N(R’) ⁇ , ⁇ Cy ⁇ or ⁇ O ⁇ .
- L is an optionally substituted bivalent linear or branched C 1-10 hydrocarbon chain.
- L is an optionally substituted bivalent linear C 1-10 hydrocarbon chain. In some embodiments, L is a bivalent linear or branched C 1-10 hydrocarbon chain. In some embodiments, L is a bivalent linear C 1-10 hydrocarbon chain. In some embodiments, L is optionally substituted ⁇ (CH 2 )n ⁇ , wherein n is 1-10. In some embodiments, L is ⁇ (CH 2 )n ⁇ , wherein n is 1-10. In some embodiments, L is ⁇ CH 2 ⁇ . In some embodiments, L is ⁇ (CH 2 ) 2 ⁇ . In some embodiments, L is ⁇ (CH 2 ) 3 ⁇ . In some embodiments, L is ⁇ (CH 2 ) 4 ⁇ .
- L is an optionally substituted bivalent linear C 1-10 hydrocarbon chain wherein one or more methylene units of L are independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ C(O) ⁇ , ⁇ N(R’) ⁇ , ⁇ Cy ⁇ or ⁇ O ⁇ .
- a linking reagent is a diamine or a salt thereof.
- a reagent has the structure of NHR ⁇ L” ⁇ NHR or a salt thereof, wherein each variable is independently as described herein.
- each R is independently ⁇ H or optionally substituted C 1-6 aliphatic.
- each R is independently ⁇ H or C 1-6 aliphatic.
- each R is independently ⁇ H or optionally substituted C 1-6 alkyl. In some embodiments, each R is independently ⁇ H or C 1-6 alkyl. In some embodiments, a reagent has the structure of NH 2 ⁇ L” ⁇ NH 2 or a salt thereof. In some embodiments, L” is optionally substituted ⁇ (CH 2 )n ⁇ wherein n is 1-10. In some embodiments, L” is ⁇ (CH 2 ) 4 ⁇ .
- a staple, L s is ⁇ L s1 ⁇ L s2 ⁇ L s3 ⁇ , wherein L s1 is L a of a first amino acid residue of a stapled pair, L s3 is L a of a second amino acid residue of a stapled pair, and L s2 is ⁇ C(O) ⁇ N(R’) ⁇ L” ⁇ N(R’) ⁇ C(O) ⁇ , wherein each variable is independently as described herein.
- L” is optionally substituted ⁇ (CH 2 )n ⁇ wherein n is 1-10.
- L” is ⁇ (CH 2 ) 4 ⁇ .
- each of L s1 and L s3 is independently optionally substituted ⁇ (CH 2 )n ⁇ wherein n is 1-10. In some embodiments, n is 2. In some embodiments, a first amino acid residue is Gln (e.g., X 7 ). In some embodiments, a second amino acid residue is GlnR (e.g., X 14 ). In some embodiments, two GlnR can form such a staple through [diaminobutane]. [0456] In some embodiments, a linking reagent has the structure of H ⁇ Cy ⁇ L” ⁇ NHR or a salt thereof, wherein ⁇ Cy ⁇ comprises a second amino group.
- R is ⁇ H or optionally substituted C 1- 6 aliphatic. In some embodiments, R is ⁇ H or C 1-6 aliphatic. In some embodiments, R is ⁇ H or optionally substituted C 1-6 alkyl. In some embodiments, R is ⁇ H or C 1-6 alkyl. In some embodiments, R is methyl.
- a linking reagent has the structure of H ⁇ Cy ⁇ L” ⁇ NH 2 or a salt thereof, wherein ⁇ Cy ⁇ comprises a second amino group. In some embodiments, ⁇ Cy ⁇ is optionally substituted . n some embodiments, ⁇ Cy ⁇ is . In some embodiments, L” is a covalent bond.
- L is optionally substituted ⁇ (CH 2 )n ⁇ wherein n is 1-10. In some embodiments, L” is ⁇ (CH 2 ) ⁇ . In some embodiments, a linking reagent is r a salt thereof. In some embodiments, a linking reagent is r a salt thereof. [0457] In some embodiments, L s2 is ⁇ C(O) ⁇ Cy ⁇ N(R’) ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, R’ is ⁇ H.
- ⁇ Cy ⁇ is n some embodiments, each of L s1 and L s3 is independently optionally substituted ⁇ (CH 2 )n ⁇ wherein n is 1-10. In some embodiments, n is 2. In some embodiments, ⁇ Cy ⁇ is closer to a N-terminus than ⁇ N(R’) ⁇ . In some embodiments, ⁇ Cy ⁇ is closer to a C-terminus than ⁇ N(R’) ⁇ . In some embodiments, a first amino acid residue is Gln (e.g., X 7 ). In some embodiments, a second amino acid residue is GlnR (e.g., X 14 ).
- L s2 is ⁇ C(O) ⁇ Cy ⁇ (CH 2 )n ⁇ N(R’) ⁇ C(O) ⁇ , wherein each variable is independently as described herein.
- R’ is ⁇ H.
- R’ is R as described herein, e.g., optionally substituted C 1-6 aliphatic, C 1-6 alkyl, etc.
- R is methyl.
- n is 1.
- ⁇ Cy ⁇ is .
- ⁇ Cy ⁇ is closer to a N-terminus than ⁇ N(R’) ⁇ . In some embodiments, ⁇ Cy ⁇ is closer to a C-terminus than ⁇ N(R’) ⁇ .
- each of L s1 and L s3 is independently optionally substituted ⁇ (CH 2 )n ⁇ wherein n is 1- 10. In some embodiments, n is 2.
- a first amino acid residue is Gln (e.g., X 7 ).
- a second amino acid residue is GlnR (e.g., X 14 ). In some embodiments, two GlnR can form such a staple through [4mampiperidine].
- a methylene unit is replaced with ⁇ Cy ⁇ .
- a linking reagent has the structure of H ⁇ Cy ⁇ H, wherein Cy comprises two secondary amino groups.
- ⁇ Cy ⁇ is optionally substituted 8-20 membered bicyclic ring.
- H ⁇ Cy ⁇ H comprises two ⁇ NH ⁇ .
- ⁇ Cy ⁇ is optionally substituted .
- ⁇ Cy ⁇ is optionally substituted .
- the meta connection site (relative to the spiro carbon atom) is closer to a N-terminus than the para connection site (relative to the spiro carbon atom).
- the meta connection site (relative to the spiro carbon atom) is closer to a C-terminus than the para connection site (relative to the spiro carbon atom).
- L s2 is ⁇ C(O) ⁇ Cy ⁇ C(O) ⁇ wherein ⁇ Cy ⁇ is as described herein.
- each of L s1 and L s3 is independently optionally substituted ⁇ (CH 2 )n ⁇ wherein n is 1-10.
- n is 2.
- a first amino acid residue is Gln (e.g., X 7 ).
- a second amino acid residue is GlnR (e.g., X 14 ).
- GlnR e.g., X 14
- two GlnR can form such a staple through [29N2spiroundecane].
- two GlnR can form such a staple through [39N2spiroundecane].
- a pair of amino acid residue suitable for stapling both independently has the structure of ⁇ N(R a1 ) ⁇ L a1 ⁇ C( ⁇ L a ⁇ R SP1 )(R a3 ) ⁇ L a2 ⁇ C(O) ⁇ or ⁇ N(R a1 ) ⁇ C( ⁇ L a ⁇ R SP1 )(R a3 ) ⁇ C(O) ⁇ , wherein each variable is independently as described herein, and R SP1 is an amino group.
- R SP1 is ⁇ NHR wherein R is as described herein.
- R is ⁇ H.
- R is optionally substituted C 1-6 aliphatic.
- R is optionally substituted C 1-6 alkyl. In some embodiments, R is C 1-6 aliphatic. In some embodiments, R is C 1-6 alkyl. In some embodiments, R SP1 is ⁇ NH 2 . In some embodiments, such two amino acid residue may be linked by a di-acid linking reagent.
- a linking reagent has the structure of HOOC ⁇ L” ⁇ COOH, or a salt thereof, or an activated form thereof, wherein L” is as described herein. In some embodiments, L” is ⁇ Cy ⁇ Cy ⁇ . In some embodiments, L” is ⁇ Cy ⁇ . In some embodiments, ⁇ Cy ⁇ is optionally substituted phenylene.
- ⁇ Cy ⁇ is optionally substituted 1,2-phenylene. In some embodiments, ⁇ Cy ⁇ is optionally substituted 1,3-phenylene. In some embodiments, each ⁇ Cy ⁇ is independently optionally substituted 1,2- phenylene. In some embodiments, each ⁇ Cy ⁇ is independently optionally substituted 1,3-phenylene. In some embodiments, L” is optionally substituted . In some embodiments, a linking agent is or a salt or an activated form thereof. In some embodiments, L” is optionally substituted In some embodiments, a linking agent is or a salt or an activated form thereof. In some embodiments, L” is 1,3-phenylene.
- a linking agent is or a salt or an activated form thereof.
- L is optionally substituted ⁇ (CH 2 )n ⁇ , wherein n is 1-10.
- L is optionally substituted ⁇ CH 2 ⁇ .
- L is ⁇ C(R’) 2 ⁇ .
- L is ⁇ C(CH 3 ) 2 ⁇ .
- a linking agent is (CH 3 ) 2 C(COOH) 2 or a salt or an activated form thereof.
- L” is ⁇ CH 2 CH 2 ⁇ .
- a linking agent is HOOCCH 2 CH 2 COOH or a salt or an activated form thereof.
- a staple is L s , wherein L s2 is ⁇ N(R’) ⁇ L” ⁇ N(R’) ⁇ , and each of L s1 and L s3 is independently as described herein.
- L is ⁇ Cy ⁇ Cy ⁇ , wherein each ⁇ Cy ⁇ is independently as described herein.
- L” is ⁇ Cy ⁇ as described herein.
- ⁇ Cy ⁇ is optionally substituted phenylene.
- ⁇ Cy ⁇ is optionally substituted 1,2-phenylene.
- ⁇ Cy ⁇ is optionally substituted 1,3-phenylene.
- each ⁇ Cy ⁇ is independently optionally substituted 1,2-phenylene. In some embodiments, each ⁇ Cy ⁇ is independently optionally substituted 1,3-phenylene. In some embodiments, L” is optionally substituted ⁇ (CH 2 )n ⁇ , wherein n is 1-10. In some embodiments, L” is optionally substituted ⁇ CH 2 ⁇ . In some embodiments, L” is ⁇ C(R’) 2 ⁇ . In some embodiments, L” is ⁇ C(CH 3 ) 2 ⁇ . In some embodiments, L” is ⁇ CH 2 CH 2 ⁇ . In some embodiments, each of L s1 and L s3 is independently optionally substituted ⁇ (CH 2 )n ⁇ wherein n is 1-10.
- n is 2. In some embodiments, n is 4. In some embodiments, a first amino acid residue is Lys (e.g., X 7 ). In some embodiments, a second amino acid residue is Lys (e.g., X 14 ). In some embodiments, two Lys can form such a staple through [Biphen33COOH]. In some embodiments, two Lys can form such a staple through [diphenate]. In some embodiments, two Lys can form such a staple through [isophthalate]. In some embodiments, two Lys can form such a staple through [Me2Mal]. In some embodiments, two Lys can form such a staple through [succinate]. [0464] In some embodiments, X 7 is stapled.
- X 7 is stapled with X 14 . In some embodiments, X 7 is stapled with X 10 . In some embodiments, X 10 is stapled with X 7 . In some embodiments, X 7 is stapled with X 3 .
- X 7 is Aib, Ala, 3COOHF, CyLeu, Phe, Asp, nLeu, B5, Val, Gln, MorphGln, GlnR, Cha, Ser, Leu, Cbg, CyhLeu, iPrLys, Aic, Lys, Lys*, Hse, GlnR, Npg, GlnR*, Dpg, Gly, sAla, TriAzLys, Thr, Asn, dAla, [isophthalate]-Lys, [succinate]-Lys, [29N2spiroundecane]GlnR, Acp, DaMeS, aMeDF, DGlnR, [Ac]Acp, [Phc]Acp, [isovaleryl]Acp, [Me2Mal]-Lys, [diphenate]-Lys, [Biphen33COOH
- X 7 is Aib. In some embodiments, X 7 is Ala. In some embodiments, X 7 is 3COOHF. In some embodiments, X 7 is CyLeu. In some embodiments, X 7 is Phe. In some embodiments, X 7 is nLeu. In some embodiments, X 7 is Val. In some embodiments, X 7 is Cha. In some embodiments, X 7 is Leu. In some embodiments, X 7 is Cbg. In some embodiments, X 7 is CyhLeu. In some embodiments, Aib provides better properties and/or activities than, e.g., Ala. In some embodiments, X 7 is GlnPDA*3.
- X 7 is GlnBDA*3. In some embodiments, X 7 is GlnR*3. In some embodiments, X 7 is GlnMeBDA*3. In some embodiments, X 7 is GlnT4CyMe*3. In some embodiments, X 7 is GlnC4CyMe*3. In some embodiments, X 7 is Gln3ACPip*3. In some embodiments, X 7 is GlnPipAz*3. In some embodiments, X 7 is Gln4Pippip*3. In some embodiments, X 7 is GlnPip4AE*3.
- X 7 is or comprises a residue of an amino acid or a moiety selected from Table A-I, Table A-II, Table A-III and Table A-IV.
- Various types of amino acid residues can be used for X 8 , e.g., a residue of an amino acid of formula A-I, A-II, A-III, A-IV, A-V, A-VI, etc. or a salt thereof in accordance with the present disclosure.
- X 8 is ⁇ N(R a1 ) ⁇ L a1 ⁇ C(R a2 )(R a3 ) ⁇ L a2 ⁇ C(O) ⁇ , wherein each variable is independently as described herein.
- X 8 is ⁇ N(R a1 ) ⁇ C(R a2 )(R a3 ) ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, X 8 is ⁇ N(R a1 ) ⁇ C(R a2 )H ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, R a1 is ⁇ H. In some embodiments, R a3 is ⁇ H. [0468] In some embodiments, X 8 is a residue of an amino acid whose side chain is hydrophobic.
- X 8 is a hydrophobic amino acid residue as described herein, e.g., those described for X 3 .
- X 8 is a residue of Ala.
- X 8 is a residue of Aib.
- X 8 is a residue of Cpg.
- X 8 is a residue of Val.
- X 8 is a residue of Leu.
- X 8 is a residue of nLeu.
- X 8 is a residue of Cba. [0469]
- X 8 is a residue of amino acid that comprises an acidic or polar group.
- X 8 is a residue of amino acid whose side chain comprises a polar group. In some embodiments, X 8 is a polar amino acid residue as described herein. In some embodiments, X 8 is a residue of amino acid whose side chain comprises ⁇ OH. In some embodiments, X 8 comprises a side chain comprising an optionally substituted aromatic group. For example, in some embodiments, X 8 is a residue of Ser. In some embodiments, X 8 is a residue of Thr. In some embodiments, X 8 is a residue of aThr. In some embodiments, X 8 is a residue of hTyr.
- X 8 is a residue of amino acid whose side chain comprises an amide group, e.g., ⁇ C(O)N(R’) 2 such as ⁇ CONH 2 .
- X 8 is a residue of Gln.
- X 8 is a residue of AcLys.
- X 8 is a residue of amino acid whose side chain comprises an acidic group, e.g., a ⁇ COOH group or a salt form thereof (e.g., a compound of formula A-IV, etc.).
- X 8 is an acidic amino acid residue as described herein, e.g., those descried for X 2 , X 5 , X 6 , etc. In some embodiments, X 8 is a residue of Asp. In some embodiments, X 8 is a residue of Glu. In some embodiments, X 8 is a residue of Aad. [0471] In some embodiments, X 8 comprises a side chain comprising an optionally substituted aromatic group. In some embodiments, X 8 is an aromatic amino acid residue as described herein. In some embodiments, an aromatic group is phenyl. In some embodiments, X 8 is a residue of Phe. In some embodiments, X 8 is a residue of hPhe.
- X 8 is a residue of hTyr. [0472] In some embodiments, X 8 is selected from Ala, Aib, Cpg, Val, Leu, Gln, Lys, Asp, Glu, Aad, nLeu, Cba, Ser, Thr, aThr, MorphGln, Phe, hPhe, hTyr, and AcLys.
- X 8 is Ala, Aib, Phe, Asp, 3COOHF, aThr, Gly, Ser, nLeu, Thr, Cpg, Val, Leu, Gln, Lys, Glu, Aad, Cba, MorphGln, hPhe, hTyr, or AcLys.
- X 8 is Ala.
- X 8 is Aib.
- X 8 is Phe.
- X 8 is Asp.
- X 8 is 3COOHF.
- X 8 is or comprises a residue of an amino acid or a moiety selected from Table A-IV. [0475] In some embodiments, X 8 interacts with Trp383 of beta-catenin or an amino acid residue corresponding thereto. [0476] Various types of amino acid residues can be used for X 9 , e.g., a residue of an amino acid of formula A-I, A-II, A-III, A-IV, A-V, A-VI, etc. or a salt thereof in accordance with the present disclosure.
- X 9 is ⁇ N(R a1 ) ⁇ L a1 ⁇ C(R a2 )(R a3 ) ⁇ L a2 ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, X 9 is ⁇ N(R a1 ) ⁇ C(R a2 )(R a3 ) ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, X 9 is ⁇ N(R a1 ) ⁇ C(R a2 )H ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, R a1 is ⁇ H.
- R a3 is ⁇ H.
- X 9 comprises a side chain comprising an optionally substituted aromatic group.
- X 9 is an aromatic amino acid residue as described herein.
- an aromatic group is optionally substituted 5-membered heteroaryl having 1-3 heteroatoms.
- an aromatic group is optionally substituted 5-membered heteroaryl having 1-3 nitrogen atoms.
- an aromatic group is optionally substituted 5-membered heteroaryl having one sulfur atom.
- an aromatic group is optionally substituted phenyl.
- X 9 comprises a side chain which is or comprises an optionally substituted aromatic group, wherein each substituent of the aromatic group is independently selected from halogen, ⁇ OR, ⁇ R, -C(O)OH, or ⁇ CN, wherein each R is independently hydrogen or C 1-4 alkyl or haloalkyl.
- an aromatic group is phenyl.
- an aromatic group is optionally substituted 8-10 membered bicyclic aryl or heteroaryl having 1-5 heteroatoms.
- X 9 comprises a side chain which is or comprises an optionally substituted aromatic group, wherein each substituent of the aromatic group is independently halogen.
- X 9 comprises a side chain which is or comprises two optionally substituted aromatic groups. In some embodiments, X 9 comprises a side chain which is or comprises an optionally substituted aromatic group, wherein each substituent of the aromatic group is independently selected from halogen or ⁇ OH. In some embodiments, an aromatic group is phenyl. In some embodiments, an aromatic group is optionally substituted 8-10 membered bicyclic aryl or heteroaryl having 0-5 heteroatoms. In some embodiments, an aromatic group is optionally substituted 9-10 membered bicyclic aryl or heteroaryl having one heteroatom. In some embodiments, X 9 is a residue of an amino acid of formula A-I or a salt thereof.
- an amino acid residue has the structure of ⁇ NH ⁇ C(R a2 )(R a3 ) ⁇ C(O) ⁇ or a salt thereof. In some embodiments, an amino acid residue has the structure of ⁇ NH ⁇ CH(R a3 ) ⁇ C)O) ⁇ or a salt thereof.
- R a3 is ⁇ L a ⁇ R’ wherein each variable is independently as described herein. In some embodiments, R’ is R as described herein. In some embodiments, R is an optionally substituted group selected from phenyl, 10-membered bicyclic aryl, 5-6 membered heteroaryl having 1-4 heteroatoms, and 9-10 membered bicyclic heteroaryl having 1-5 heteroatoms.
- each substituent is independently halogen or ⁇ OH or C 1-6 haloaliphatic. In some embodiments, each substituent is independently halogen or ⁇ OH. In some embodiments, R is optionally substituted phenyl. In some embodiments, R is phenyl. In some embodiments, R is optionally substituted aryl. In some embodiments, R is aryl. In some embodiments, R is optionally substituted 5- membered heteroaryl having 1-4 heteroatoms. In some embodiments, R is optionally substituted 5- membered heteroaryl having 1 heteroatom. In some embodiments, optionally substituted R is 6-membered heteroaryl having 1-4 heteroatoms.
- optionally substituted R is 6-membered heteroaryl having 1 heteroatom. In some embodiments, R is optionally substituted 9-membered heteroaryl having 1-5 heteroatoms. In some embodiments, R is optionally substituted 9-membered heteroaryl having 1 heteroatom. In some embodiments, R is optionally substituted 10-membered heteroaryl having 1-5 heteroatoms. In some embodiments, R is optionally substituted 10-membered heteroaryl having 1 heteroatom. In some embodiments, a heteroatom is nitrogen. In some embodiments, a heteroatom is oxygen. In some embodiments, a heteroatom is sulfur. As described herein, L a is L. In some embodiments, L is a covalent bond.
- L is an optionally substituted bivalent linear or branched C 1-10 hydrocarbon chain. In some embodiments, L is an optionally substituted bivalent linear C 1-10 hydrocarbon chain. In some embodiments, L is a bivalent linear or branched C 1-10 hydrocarbon chain. In some embodiments, L is a bivalent linear C 1-10 hydrocarbon chain. In some embodiments, L is optionally substituted ⁇ (CH 2 )n ⁇ , wherein n is 1-10. In some embodiments, L is ⁇ (CH 2 )n ⁇ , wherein n is 1-10. In some embodiments, L is ⁇ CH 2 ⁇ . In some embodiments, L is ⁇ (CH 2 ) 2 ⁇ .
- L is ⁇ (CH 2 ) 3 ⁇ . In some embodiments, L is ⁇ (CH 2 ) 4 ⁇ . In some embodiments, L is an optionally substituted bivalent linear or branched C 1-10 hydrocarbon chain wherein one or more methylene units of L are independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ C(O) ⁇ , ⁇ N(R’) ⁇ , ⁇ Cy ⁇ or ⁇ O ⁇ . In some embodiments, L is an optionally substituted bivalent linear C 1-10 hydrocarbon chain wherein one or more methylene units of L are independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ C(O) ⁇ , ⁇ N(R’) ⁇ , ⁇ Cy ⁇ or ⁇ O ⁇ .
- X 9 is a residue of an amino acid selected from Phe, 3COOHF, 2NapA, Tyr, 3Thi, 4FF, 4ClF, 4BrF, 3FF, 3ClF, 3BrF, 2FF, 3OMeF, 4CNF, 3CNF, 4MeF, 3MeF, Aic, RbiPrF, SbiPrF, RbiPrDF, RbMeXylA, RbMeXylDA, BztA, 1NapA, Trp, 2Thi, 4TriA, 3F3MeF, His, SbMeXylA, and SbMeXylDA.
- X 9 is Phe. In some embodiments, X 9 is 3COOHF. In some embodiments, X 9 is 2NapA. In some embodiments, X 9 is Tyr. In some embodiments, X 9 is 3Thi. In some embodiments, X 9 is 4FF. In some embodiments, X 9 is 4ClF. In some embodiments, X 9 is 4BrF. In some embodiments, X 9 is 3FF. In some embodiments, X 9 is 3ClF. In some embodiments, X 9 is 3BrF. In some embodiments, X 9 is 2FF. In some embodiments, X 9 is 3OMeF. In some embodiments, X 9 is 4CNF.
- X 9 is 3CNF. In some embodiments, X 9 is 4MeF. In some embodiments, X 9 is 3MeF. In some embodiments, X 9 is Aic. In some embodiments, X 9 is RbiPrF. In some embodiments, X 9 is SbiPrF. In some embodiments, X 9 is RbiPrDF. In some embodiments, X 9 is RbMeXylA. In some embodiments, X 9 is RbMeXylDA. In some embodiments, X 9 is BztA. In some embodiments, X 9 is 1NapA. In some embodiments, X 9 is Trp. In some embodiments, X 9 is 2Thi.
- X 9 is 4TriA. In some embodiments, X 9 is 3F3MeF. In some embodiments, X 9 is His. In some embodiments, X 9 is SbMeXylA. In some embodiments, X 9 is SbMeXylDA. [0479] In some embodiments, X 9 is a residue of an amino acid whose side chain is hydrophobic. In some embodiments, X 9 is a hydrophobic amino acid residue as described herein. In some embodiments, X 9 is selected from nLeu, Ala, Cba, CypA, Leu, Ile, Chg, Val, and 2Cpg.
- X 9 is a residue of amino acid that comprises an acidic or polar group.
- X 9 is a residue of amino acid whose side chain comprises a polar group.
- X 9 is a polar amino acid residue as described herein.
- X 9 is a residue of amino acid whose side chain comprises ⁇ OH.
- X 9 is a residue of Ser.
- X 9 is a residue of Hse.
- X 9 is a residue of amino acid whose side chain comprises an amide group, e.g., ⁇ C(O)N(R’) 2 such as ⁇ CONH 2 .
- X 9 is a residue of Asn.
- X 9 is Gln.
- X 9 is Phe, Ala, Lys, 3COOHF, Aib, 2NapA, nLeu, 2Thi, Tyr, 3Thi, 4FF, 4ClF, 4BrF, 3FF, 3ClF, 3BrF, 2FF, 3OMeF, 4CNF, 3CNF, 4MeF, 3MeF, Aic, RbiPrF, SbiPrF, RbiPrDF, RbMeXylA, RbMeXylDA, Cba, CypA, BztA, 1NapA, Trp, Leu, Ile, Ser, Chg, Hse, 4TriA, 3F3MeF, Thr, His, Val, Asn, Gln, 2Cpg, SbMeXylA, or
- X 9 is Phe. In some embodiments, X 9 is Ala. [0482] In some embodiments, X 9 is or comprises a residue of an amino acid or a moiety selected from Table A-IV. [0483] In some embodiments, X 9 interacts with Lys345 of beta-catenin or an amino acid residue corresponding thereto. In some embodiments, X 9 interacts with Trp383 of beta-catenin or an amino acid residue corresponding thereto. In some embodiments, X 9 interacts with Lys345 and Trp383 of beta-catenin or amino acid residues corresponding thereto.
- X 10 Various types of amino acid residues can be used for X 10 , e.g., a residue of an amino acid of formula A-I, A-II, A-III, A-IV, A-V, A-VI, etc. or a salt thereof in accordance with the present disclosure.
- X 10 is ⁇ N(R a1 ) ⁇ L a1 ⁇ C(R a2 )(R a3 ) ⁇ L a2 ⁇ C(O) ⁇ , wherein each variable is independently as described herein.
- X 10 is ⁇ N(R a1 ) ⁇ C(R a2 )(R a3 ) ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, X 10 is ⁇ N(R a1 ) ⁇ C(R a2 )H ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, R a1 is ⁇ H. In some embodiments, R a3 is ⁇ H.
- X 10 is Lys, GlnR, TriAzLys, sAla, dLys, AsnR, hGlnR, iPrLys, TriAzOrn, DGlnR, Orn, 4PipA, sCH2S, [8FBB]Cys, [mXyl]Cys, [oXyl]Cys, [pXyl]Cys, dOrn, dDab, NMeOrn, [2_6- naph]Cys, or [3_3-biph]Cys.
- X 10 is Lys, GlnR, or TriAzLys. In some embodiments, X 10 is Lys. In some embodiments, X 10 is Gln. In some embodiments, X 10 is TriAzLys. In some embodiments, X 10 is sAla. In some embodiments, X 10 is dLys. In some embodiments, X 10 isAsnR. In some embodiments, X 10 is hGlnR. In some embodiments, X 10 is iPrLys. In some embodiments, X 10 is TriAzOrn. In some embodiments, X 10 is DGlnR. In some embodiments, X 10 is Orn.
- X 10 is 4PipA. In some embodiments, X 10 is sCH2S. In some embodiments, X 10 is [8FBB]Cys. In some embodiments, X 10 is [4FB]Cys. In some embodiments, X 10 is [mXyl]Cys. In some embodiments, X 10 is [oXyl]Cys. In some embodiments, X 10 is [pXyl]Cys. In some embodiments, X 10 is dOrn. In some embodiments, X 10 is dDab. In some embodiments, X 10 is NMeOrn. In some embodiments, X 10 is [2_6-naph]Cys.
- X 10 is [3_3-biph]Cys. [0486] In some embodiments, X 10 is not stapled (e.g., when other residues are optionally stapled). In some embodiments, X 10 is a residue of Leu or Phe. In some embodiments, X 10 is a residue of Leu. In some embodiments, X 10 is a residue of Phe. [0487] In some embodiments, X 10 is an amino acid residue suitable for stapling as described herein.
- an amino acid residue suitable for stapling is ⁇ N(R a1 ) ⁇ L a1 ⁇ C( ⁇ L a ⁇ R SP1 )(R a3 ) ⁇ L a2 ⁇ C(O) ⁇ wherein each variable is independently as described herein. In some embodiments, it is ⁇ N(R a1 ) ⁇ C( ⁇ L a ⁇ R SP1 )(R a3 ) ⁇ C(O) ⁇ wherein each variable is independently as described herein.
- each amino acid residue in a pair of amino acid residues suitable for stapling, is independently ⁇ N(R a1 ) ⁇ L a1 ⁇ C( ⁇ L a ⁇ R SP1 )(R a3 ) ⁇ L a2 ⁇ C(O) ⁇ or ⁇ N(R a1 ) ⁇ C( ⁇ L a ⁇ R SP1 )(R a3 ) ⁇ C(O) ⁇ , wherein each variable is independently as described herein.
- R a1 is ⁇ H.
- R a3 is ⁇ H.
- both R a1 and R a3 are ⁇ H.
- R SP1 of a one amino acid residue in a pair is ⁇ NHR wherein R is as described herein. In some embodiments, R is ⁇ H. In some embodiments, R is optionally substituted C 1-6 aliphatic. In some embodiments, R is optionally substituted C 1-6 alkyl. In some embodiments, R is C 1-6 aliphatic. In some embodiments, R is C 1-6 alkyl. In some embodiments, R SP1 is ⁇ NH 2 .
- such an amino acid residue can be stapled with another amino acid residue comprising ⁇ COOH through amidation to form a staple comprising ⁇ C(O)N(R’) ⁇ , e.g., L s wherein L s2 is or comprising ⁇ C(O)N(R’) ⁇ .
- L s2 is ⁇ C(O)N(R’) ⁇ wherein R’ is as described herein.
- R’ is R as described herein.
- R is ⁇ H.
- R is optionally substituted C 1-6 aliphatic.
- R is optionally substituted C 1-6 alkyl.
- R is methyl.
- R is ethyl. In some embodiments, R is isopropyl. In some embodiments, ⁇ N(R’) ⁇ is from an amino acid residue which before stapling comprises an amino group. In some embodiments, ⁇ C(O) ⁇ is from an amino acid residue which before stapling comprises ⁇ COOH or an activated form thereof. In some embodiments, in the other amino acid residue of a pair R SP1 is ⁇ COOH or an active derivative thereof. In some embodiments, in the other amino acid residue of a pair R SP1 is ⁇ COOH. In some embodiments, R’ is R. In some embodiments, R’ is ⁇ H.
- L s1 is L a of a first amino acid residue, e.g., X 10 .
- L s3 is L a of a second amino acid residue, e.g., a C-direction amino acid residue of a first amino acid residue.
- a first amino acid residue is X 10
- a second amino acid residue is a C-direction amino acid residue of X 10 , e.g., X 14 .
- each of L s1 and L s3 is independently L.
- L is an optionally substituted bivalent linear or branched C 1-10 hydrocarbon chain.
- L is an optionally substituted bivalent linear C 1-10 hydrocarbon chain. In some embodiments, L is a bivalent linear or branched C 1-10 hydrocarbon chain. In some embodiments, L is a bivalent linear C 1-10 hydrocarbon chain. In some embodiments, L is optionally substituted ⁇ (CH 2 )n ⁇ , wherein n is 1-10. In some embodiments, L is ⁇ (CH 2 )n ⁇ , wherein n is 1-10. In some embodiments, L is ⁇ CH 2 ⁇ . In some embodiments, L is ⁇ (CH 2 ) 2 ⁇ . In some embodiments, L is ⁇ (CH 2 ) 3 ⁇ . In some embodiments, L is ⁇ (CH 2 ) 4 ⁇ .
- L is an optionally substituted bivalent linear or branched C 1-10 hydrocarbon chain wherein one or more methylene units of L are independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ C(O) ⁇ , ⁇ N(R’) ⁇ , ⁇ Cy ⁇ or ⁇ O ⁇ .
- L is an optionally substituted bivalent linear C 1-10 hydrocarbon chain wherein one or more methylene units of L are independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ C(O) ⁇ , ⁇ N(R’) ⁇ , ⁇ Cy ⁇ or ⁇ O ⁇ .
- each of L s1 and L s3 is independently L, wherein L is an optionally substituted bivalent linear or branched C 1-10 hydrocarbon chain. In some embodiments, each of L s1 and L s3 is independently L, wherein L is optionally substituted ⁇ (CH 2 )n ⁇ , wherein n is 1-10. In some embodiments, L s ⁇ (CH 2 )n1 ⁇ C(O)N(R’) ⁇ L s3 ⁇ wherein each variable is independently as described herein. In some embodiments, L s ⁇ L s1 ⁇ C(O)N(R’) ⁇ (CH 2 )n2 ⁇ wherein each variable is independently as described herein.
- each of n1 and n2 is independently 1- 10.
- a first amino acid residue has R SP1 which is an amino group
- a second amino acid residue has R SP1 which is ⁇ COOH or an activated form thereof.
- a second amino acid residue has R SP1 which is an amino group
- a first amino acid residue has R SP1 which is ⁇ COOH or an activated form thereof.
- a first amino acid residue is X 10 and a second amino acid residue is one of its C-direction amino acid residue, e.g., X 14 .
- a second amino acid residue is X 10 and a first amino acid residue is one of its N-direction amino acid residue, e.g., X 7 .
- a first amino acid residue is X 10 .
- X 10 is Lys.
- X 10 is dLys.
- X 10 is iPrLys.
- X 10 is NMeOrn.
- R’ of ⁇ N(R’) ⁇ of L s2 is optionally substituted C 1-6 alkyl. In some embodiments, it is methyl. In some embodiments, it is isopropyl. In some embodiments, n1 is 4. In some embodiments, n1 is 3. In some embodiments, X 10 is Orn. In some embodiments, X 10 is dOrn. In some embodiments, n1 is 3. In some embodiments, X 10 is dDab. In some embodiments, n1 is 2. In some embodiments, ⁇ N(R’) ⁇ of L s2 is bonded L s1 . In some embodiments, a second amino acid residue is X 14 .
- X 14 is GlnR. In some embodiments, X 14 is hGlnR. In some embodiments, n1 is 4 as in Lys. In some embodiments, n2 is 2 as in GlnR. In some embodiments, n2 is 3. [0492] In some embodiments, a first amino acid residue is X 10 which is 4PipA. In some embodiments, L s1 is ⁇ (CH 2 ) n1 ⁇ C(R’) 2 ⁇ (CH 2 ) n3 ⁇ , wherein each of n1 and n3 is independently n as described herein (e.g., 1- 10, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10), and each R’ is independently as described herein.
- one R’ is ⁇ H.
- n1 is 1.
- n3 is 2.
- ⁇ (CH 2 )n3 ⁇ is connected to ⁇ N(R’) ⁇ of L s2 .
- one R’ of ⁇ C(R’) 2 ⁇ of L s1 and R’ of ⁇ N(R’) ⁇ of L s2 are taken together with their intervening atoms to form an optionally substituted as described herein.
- a formed ring is an optionally substituted 3-10 membered saturated ring.
- a formed ring is 3-membered. In some embodiments, it is 4-membered.
- a formed ring has no additional ring heteroatoms in addition to the nitrogen to which R’ is attached.
- L s is ⁇ L s1 ⁇ Cy ⁇ C(O) ⁇ L s3 ⁇ wherein each variable is independently as described herein.
- ⁇ Cy ⁇ is optionally substituted , wherein the nitrogen atom is bonded to ⁇ C(O) ⁇ .
- each L s1 and L s3 is independently L as described herein.
- L is an optionally substituted bivalent linear or branched C 1-10 hydrocarbon chain. In some embodiments, L is an optionally substituted bivalent linear C 1-10 hydrocarbon chain. In some embodiments, L is a bivalent linear or branched C 1-10 hydrocarbon chain. In some embodiments, L is a bivalent linear C 1-10 hydrocarbon chain. In some embodiments, L is optionally substituted ⁇ (CH 2 )n ⁇ , wherein n is 1-10. In some embodiments, L is ⁇ (CH 2 )n ⁇ , wherein n is 1-10. In some embodiments, L is ⁇ CH 2 ⁇ . In some embodiments, L is ⁇ (CH 2 ) 2 ⁇ .
- L is ⁇ (CH 2 ) 3 ⁇ . In some embodiments, L is ⁇ (CH 2 ) 4 ⁇ . In some embodiments, L is an optionally substituted bivalent linear or branched C 1-10 hydrocarbon chain wherein one or more methylene units of L are independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ C(O) ⁇ , ⁇ N(R’) ⁇ , ⁇ Cy ⁇ or ⁇ O ⁇ . In some embodiments, L is an optionally substituted bivalent linear C 1-10 hydrocarbon chain wherein one or more methylene units of L are independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ C(O) ⁇ , ⁇ N(R’) ⁇ , ⁇ Cy ⁇ or ⁇ O ⁇ .
- ⁇ Cy ⁇ is optionally substituted wherein the nitrogen atom is bonded to ⁇ C(O) ⁇ .
- n1 is 1.
- a second amino acid residue is X 14 .
- X 14 is GlnR.
- n2 is 2.
- a first amino acid residue is X 7 , e.g., GlnR.
- n1 is 2.
- a second amino acid residue is X 10 , e.g., Lys. In some embodiments, n2 is 4. In some embodiments, a first amino acid residue is X 7 , e.g., Lys. In some embodiments, n1 is 4. In some embodiments, a second amino acid residue is X 10 , e.g., GlnR. In some embodiments, n2 is 2. [0494] In some embodiments, a first amino acid residue is X 10 . In some embodiments, X 10 is GlnR. In some embodiments, X 10 is DGlnR. In some embodiments, n1 is 2. In some embodiments, X 10 is AsnR.
- n1 is 1. In some embodiments, ⁇ C(O) ⁇ of L s2 is bonded to L s1 . In some embodiments, a first amino acid residue is X 10 , e.g., hGlnR. In some embodiments, n1 is 3. In some embodiments, a second amino acid residue is X 14 , e.g., iPrLys. In some embodiments, R’ of ⁇ N(R’) ⁇ of L s2 is optionally substituted C 1-6 alkyl. In some embodiments, it is isopropyl. In some embodiments, n2 is 4. In some embodiments, a second amino acid residue is X 14 , e.g., Lys.
- a second amino acid residue is X 14 , e.g., Orn. In some embodiments, n2 is 3. [0495] In some embodiments, a second amino acid residue is X 14 which is 4PipA.
- L s3 is ⁇ (CH 2 ) n2 ⁇ C(R’) 2 ⁇ (CH 2 ) n3 ⁇ , wherein each of n2 and n3 is independently n as described herein (e.g., 1-10, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10), and each R’ is independently as described herein. In some embodiments, one R’ is ⁇ H. In some embodiments, n2 is 1. In some embodiments, n3 is 2.
- ⁇ (CH 2 )n3 ⁇ is connected to ⁇ N(R’) ⁇ of L s2 .
- one R’ of ⁇ C(R’) 2 ⁇ of L s3 and R’ of ⁇ N(R’) ⁇ of L s2 are taken together with their intervening atoms to form an optionally substituted as described herein.
- a formed ring is an optionally substituted 3-10 membered saturated ring.
- a formed ring is 3-membered. In some embodiments, it is 4-membered. In some embodiments, it is 5-membered. In some embodiments, it is 6-membered. In some embodiments, it is 7-membered.
- L s is ⁇ L s1 ⁇ C(O) ⁇ Cy ⁇ L s3 ⁇ wherein each variable is independently as described herein.
- ⁇ Cy ⁇ is optionally substituted , wherein the nitrogen atom is bonded to ⁇ C(O) ⁇ .
- each L s1 and L s3 is independently L as described herein.
- L is an optionally substituted bivalent linear or branched C 1-10 hydrocarbon chain. In some embodiments, L is an optionally substituted bivalent linear C 1-10 hydrocarbon chain.
- L is a bivalent linear or branched C 1-10 hydrocarbon chain. In some embodiments, L is a bivalent linear C 1-10 hydrocarbon chain. In some embodiments, L is optionally substituted ⁇ (CH 2 )n ⁇ , wherein n is 1-10. In some embodiments, L is ⁇ (CH 2 )n ⁇ , wherein n is 1-10. In some embodiments, L is ⁇ CH 2 ⁇ . In some embodiments, L is ⁇ (CH 2 ) 2 ⁇ . In some embodiments, L is ⁇ (CH 2 ) 3 ⁇ . In some embodiments, L is ⁇ (CH 2 ) 4 ⁇ .
- L is an optionally substituted bivalent linear or branched C 1-10 hydrocarbon chain wherein one or more methylene units of L are independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ C(O) ⁇ , ⁇ N(R’) ⁇ , ⁇ Cy ⁇ or ⁇ O ⁇ .
- L is an optionally substituted bivalent linear C 1-10 hydrocarbon chain wherein one or more methylene units of L are independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ C(O) ⁇ , ⁇ N(R’) ⁇ , ⁇ Cy ⁇ or ⁇ O ⁇ .
- L s ⁇ (CH 2 )n1 ⁇ C(O) ⁇ Cy ⁇ (CH 2 )n2 ⁇ wherein each variable is independently as described herein.
- ⁇ Cy ⁇ is optionally substituted wherein the nitrogen atom is bonded to ⁇ C(O) ⁇ .
- n1 is 2.
- n2 is 1.
- a second amino acid residue is .g., X 14 ).
- L s3 is ⁇ (CH 2 ) 2 ⁇ C(O)NH ⁇ (CH 2 ) 4 ⁇ .
- a second amino acid residue is in some embodiments, L s3 is ⁇ (CH 2 ) 2 ⁇ C(O) ⁇ Cy ⁇ . In some embodiments, ⁇ Cy ⁇ is optionally substituted herein the nitrogen is bonded to ⁇ C(O) ⁇ . In some embodiments, L s3 is ⁇ (CH 2 ) 2 ⁇ C(O) ⁇ N(R’) ⁇ (CH 2 )n ⁇ CHR’ ⁇ , wherein the two R’ are taken together with their intervening atoms to form an optionally substituted ring as described herein. In some embodiments, a formed ring is optionally substituted .
- a second amino acid residue is s3
- L is ⁇ (CH 2 ) 2 ⁇ C(O) ⁇ N(R’) ⁇ (CH 2 )n ⁇ Cy ⁇ .
- R’ is R as described herein.
- R is ⁇ H.
- R optionally substituted C 1-6 aliphatic.
- R optionally substituted C 1-6 alkyl.
- R is methyl.
- n is 1.
- ⁇ Cy ⁇ is optionally substituted wherein the nitrogen is bonded to L s2 which is or comprises ⁇ C(O) ⁇ .
- L s3 is ⁇ (CH 2 ) 2 ⁇ C(O) ⁇ N(R’) ⁇ CH 2 ⁇ CHR’ ⁇ (CH 2 )n ⁇ .
- n is 2.
- ⁇ (CH 2 )n ⁇ is bonded to ⁇ N(R’) ⁇ of L s2 which is ⁇ C(O) ⁇ N(R’) ⁇ .
- R’ of ⁇ CHR’ ⁇ of L s3 is taken together with R’ of ⁇ N(R’) ⁇ of L s2 and their intervening atoms to form an optionally substituted ring as described herein.
- a formed ring is optionally substituted .
- a second amino acid residue is In some embodiments, a second amino acid residue is In some embodiments, L s3 ⁇ (CH 2 ) 2 ⁇ C(O) ⁇ N(R’) ⁇ (CH 2 ) n1 ⁇ C(R’) 2 ⁇ (CH 2 ) n2 ⁇ . In some embodiments, each of n1 and n2 is independently 1-10. In some embodiments, n1 is 1. In some embodiments, n1 is 2. In some embodiments, n2 is 2. In some embodiments, R’ of ⁇ N(R’) ⁇ and one R’ of ⁇ C(R’) 2 ⁇ are taken together with their intervening atoms to form an optionally substituted ring as described herein.
- a formed ring is an optionally substituted 6-membered monocyclic saturated ring having no heteroatoms in addition to the nitrogen atom of ⁇ N(R’) ⁇ .
- L s2 is ⁇ C(O)N(R’) ⁇ .
- ⁇ N(R’) ⁇ is bonded to ⁇ (CH 2 ) n2 ⁇ .
- one R’ of ⁇ C(R’) 2 ⁇ of L s3 is taken together with R’ of ⁇ N(R’) ⁇ of L s2 and their intervening atoms to form an optionally substituted ring as described herein.
- a formed ring is an optionally substituted 6-membered monocyclic saturated ring having no heteroatoms in addition to the nitrogen atom of ⁇ N(R’) ⁇ .
- a first amino acid residue is n some embodiments, L s1 is ⁇ (CH 2 ) 2 ⁇ C(O) ⁇ N(R’) ⁇ (CH 2 )n ⁇ CHR’ ⁇ , wherein the two R’ are taken together with their intervening atoms to form an optionally substituted ring as described herein.
- a formed ring is optionally substituted .
- a second amino acid residue is GlnR (e.g., X 14 ).
- L s3 is ⁇ (CH 2 ) 2 ⁇ .
- a first amino acid residue is In some embodiments, L s1 is ⁇ (CH 2 ) 2 ⁇ C(O) ⁇ N(R’) ⁇ (CH 2 )n ⁇ Cy ⁇ .
- R’ is R as described herein. In some embodiments, R is ⁇ H. In some embodiments, R optionally substituted C 1-6 aliphatic. In some embodiments, R optionally substituted C 1-6 alkyl. In some embodiments, R is methyl. In some embodiments, n is 1.
- ⁇ Cy ⁇ is optionally substituted wherein the nitrogen is bonded to L s2 which is or comprises ⁇ C(O) ⁇ .
- L s1 is ⁇ (CH 2 ) 2 ⁇ C(O) ⁇ N(R’) ⁇ CH 2 ⁇ CHR’ ⁇ (CH 2 )n ⁇ .
- n is 2.
- ⁇ (CH 2 )n ⁇ is bonded to ⁇ N(R’) ⁇ of L s2 which is ⁇ C(O) ⁇ N(R’) ⁇ .
- R’ of ⁇ CHR’ ⁇ of L s1 is taken together with R’ of ⁇ N(R’) ⁇ of L s2 and their intervening atoms to form an optionally substituted ring as described herein.
- a formed ring is optionally substituted .
- a first amino acid residue is n some embodiments, a first amino acid residue is s1 n some embodiments, L ⁇ (CH 2 ) 2 ⁇ C(O) ⁇ N(R’) ⁇ (CH 2 ) n1 ⁇ C(R’) 2 ⁇ (CH 2 ) n2 ⁇ .
- each of n1 and n2 is independently 1-10.
- n1 is 1.
- n1 is 2. In some embodiments, n2 is 2. In some embodiments, R’ of ⁇ N(R’) ⁇ and one R’ of ⁇ C(R’) 2 ⁇ are taken together with their intervening atoms to form an optionally substituted ring as described herein. In some embodiments, a formed ring is an optionally substituted 6-membered monocyclic saturated ring having no heteroatoms in addition to the nitrogen atom of ⁇ N(R’) ⁇ . In some embodiments, L s2 is ⁇ C(O)N(R’) ⁇ . In some embodiments, ⁇ N(R’) ⁇ is bonded to ⁇ (CH 2 ) n2 ⁇ .
- one R’ of ⁇ C(R’) 2 ⁇ of L s1 is taken together with R’ of ⁇ N(R’) ⁇ of L s2 and their intervening atoms to form an optionally substituted ring as described herein.
- a formed ring is an optionally substituted 6-membered monocyclic saturated ring having no heteroatoms in addition to the nitrogen atom of ⁇ N(R’) ⁇ .
- a second amino acid residue is GlnR (e.g., X 14 ). [0499] In some embodiments, a first residue is .
- a first residue is n some embodiments, a first residue is In some embodiments, L s1 is ⁇ (CH 2 )n ⁇ N(R’) ⁇ C(O) ⁇ Cy ⁇ Cy ⁇ , wherein each variable is independently as described herein. In some embodiments, L s1 is ⁇ (CH 2 )n ⁇ N(R’) ⁇ C(O) ⁇ Cy ⁇ , wherein each variable is independently as described herein. In some embodiments, a first residue is n some embodiments, L s1 is ⁇ (CH 2 )n ⁇ N(R’) ⁇ C(O) ⁇ CH 2 ⁇ , wherein R is as described herein, and the ⁇ CH 2 ⁇ bonded to C(O) ⁇ is optionally substituted.
- L s1 is ⁇ (CH 2 )n ⁇ N(R’) ⁇ C(O) ⁇ C(R’) 2 ⁇ , wherein each R is independently as described herein. In some embodiments, L s1 is ⁇ (CH 2 )n ⁇ N(R’) ⁇ C(O) ⁇ C(CH 3 ) 2 ⁇ , wherein R is as described herein. In some embodiments, a first residue is In some embodiments, L s1 is ⁇ (CH 2 ) n1 ⁇ N(R’) ⁇ C(O) ⁇ (CH 2 ) n2 ⁇ , wherein each variable is independently as described herein. In some embodiments, each of n1 and n2 is independently n as described herein.
- L s1 is ⁇ (CH 2 ) 4 ⁇ N(R’) ⁇ C(O) ⁇ (CH 2 ) 2 ⁇ , wherein each R is independently as described herein.
- n is 1-10.
- n is 1.
- n is 2.
- n is 3.
- n is 4.
- R’ is R as described herein.
- R is ⁇ H.
- ⁇ Cy ⁇ is optionally substituted phenylene.
- ⁇ Cy ⁇ is optionally substituted 1,2-phenylene.
- ⁇ Cy ⁇ is optionally substituted 1,3-phenylene.
- each ⁇ Cy ⁇ is independently optionally substituted 1,2- phenylene. In some embodiments, each ⁇ Cy ⁇ is independently optionally substituted 1,3-phenylene.
- L s2 is or comprises ⁇ C(O) ⁇ N(R’) ⁇ as described herein. In some embodiments, R’ is R as described herein. In some embodiments, R is ⁇ H. In some embodiments, L s2 is ⁇ C(O)NH ⁇ . In some embodiments, ⁇ C(O) ⁇ is bonded to ⁇ Cy ⁇ of L s1 . In some embodiments, a second residue is X 14 , e.g., Lys.
- L s3 is as described herein, e.g., optionally substituted ⁇ (CH 2 )n ⁇ . In some embodiments, L s3 is ⁇ (CH 2 )n ⁇ . In some embodiments, n is 1. In some embodiments, n is 2. In some embodiments, n is 3. In some embodiments, n is 4 (e.g., as in Lys). [0500] In some embodiments, R SP1 of a one amino acid residue in a pair is a first reaction group of a cycloaddition reaction. In some embodiments, such an amino acid residue can be stapled with another amino acid residue comprising a second reactive group of a cycloaddition reaction through a cycloaddition reaction.
- R SP1 is a second reactive group of a cycloaddition reaction.
- a cycloaddition reaction is [3+2].
- a cycloaddition reaction is a click chemistry reaction.
- a cycloaddition reaction is [4+2].
- one of the first and the second reactive groups is or comprises ⁇ N 3
- the other is or comprises an alkyne (e.g., a terminal alkyne or activated/strained alkyne).
- R SP1 of a first amino acid residue is ⁇ N 3 .
- L a of a first amino acid residue is L as described herein.
- L is an optionally substituted bivalent linear or branched C 1-10 hydrocarbon chain.
- L is an optionally substituted bivalent linear C 1-10 hydrocarbon chain.
- L is a bivalent linear or branched C 1-10 hydrocarbon chain.
- L is a bivalent linear C 1-10 hydrocarbon chain.
- L is optionally substituted ⁇ (CH 2 )n ⁇ , wherein n is 1-10.
- L is ⁇ (CH 2 )n ⁇ , wherein n is 1-10.
- L is ⁇ CH 2 ⁇ .
- L is ⁇ (CH 2 ) 2 ⁇ . In some embodiments, L is ⁇ (CH 2 ) 3 ⁇ . In some embodiments, L is ⁇ (CH 2 ) 4 ⁇ . In some embodiments, L is an optionally substituted bivalent linear or branched C 1-10 hydrocarbon chain wherein one or more methylene units of L are independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ C(O) ⁇ , ⁇ N(R’) ⁇ , ⁇ Cy ⁇ or ⁇ O ⁇ .
- L is an optionally substituted bivalent linear C 1-10 hydrocarbon chain wherein one or more methylene units of L are independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ C(O) ⁇ , ⁇ N(R’) ⁇ , ⁇ Cy ⁇ or ⁇ O ⁇ .
- R SP1 of a second amino acid residue is or comprises ⁇ C ⁇ C ⁇ .
- R SP1 of a second amino acid residue is ⁇ H.
- R SP1 of a second amino acid residue comprises a strained alkyne, e.g., in a ring.
- L a of a first amino acid residue is L as described herein.
- L is an optionally substituted bivalent linear or branched C 1-10 hydrocarbon chain. In some embodiments, L is an optionally substituted bivalent linear C 1-10 hydrocarbon chain. In some embodiments, L is a bivalent linear or branched C 1-10 hydrocarbon chain. In some embodiments, L is a bivalent linear C 1-10 hydrocarbon chain. In some embodiments, L is optionally substituted ⁇ (CH 2 )n ⁇ , wherein n is 1-10. In some embodiments, L is ⁇ (CH 2 )n ⁇ , wherein n is 1-10. In some embodiments, L is ⁇ CH 2 ⁇ . In some embodiments, L is ⁇ (CH 2 ) 2 ⁇ .
- L is ⁇ (CH 2 ) 3 ⁇ . In some embodiments, L is ⁇ (CH 2 ) 4 ⁇ . In some embodiments, L is an optionally substituted bivalent linear or branched C 1-10 hydrocarbon chain wherein one or more methylene units of L are independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ C(O) ⁇ , ⁇ N(R’) ⁇ , ⁇ Cy ⁇ or ⁇ O ⁇ . In some embodiments, L is an optionally substituted bivalent linear C 1-10 hydrocarbon chain wherein one or more methylene units of L are independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ C(O) ⁇ , ⁇ N(R’) ⁇ , ⁇ Cy ⁇ or ⁇ O ⁇ .
- L s is ⁇ L s1 ⁇ L s2 ⁇ L s3 ⁇ , wherein L s2 is or comprises ⁇ Cy ⁇ . In some embodiments, L s2 is ⁇ Cy ⁇ . In some embodiments, ⁇ Cy ⁇ is formed by a cycloaddition reaction. In some embodiments, ⁇ Cy ⁇ is optionally substituted n some embodiments, ⁇ Cy ⁇ is n some embodiments, ⁇ Cy ⁇ is optionally substituted n some embodiments, ⁇ Cy ⁇ is some embodiments, L s1 is L a of a first amino acid residue, and L s3 is L a of a second amino acid residue.
- L s1 is L a of a second amino acid residue
- L s3 is L a of a first amino acid residue.
- each of L s1 and L s3 is independently L as described herein.
- L is an optionally substituted bivalent linear or branched C 1-10 hydrocarbon chain.
- L is an optionally substituted bivalent linear C 1-10 hydrocarbon chain.
- L is a bivalent linear or branched C 1-10 hydrocarbon chain.
- L is a bivalent linear C 1-10 hydrocarbon chain.
- L is optionally substituted ⁇ (CH 2 )n ⁇ , wherein n is 1-10.
- L is ⁇ (CH 2 )n ⁇ , wherein n is 1-10. In some embodiments, L is ⁇ CH 2 ⁇ . In some embodiments, L is ⁇ (CH 2 ) 2 ⁇ . In some embodiments, L is ⁇ (CH 2 ) 3 ⁇ . In some embodiments, L is ⁇ (CH 2 ) 4 ⁇ . In some embodiments, L is an optionally substituted bivalent linear or branched C 1-10 hydrocarbon chain wherein one or more methylene units of L are independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ C(O) ⁇ , ⁇ N(R’) ⁇ , ⁇ Cy ⁇ or ⁇ O ⁇ .
- L is an optionally substituted bivalent linear C 1-10 hydrocarbon chain wherein one or more methylene units of L are independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ C(O) ⁇ , ⁇ N(R’) ⁇ , ⁇ Cy ⁇ or ⁇ O ⁇ .
- L s1 is optionally substituted ⁇ (CH 2 ) n ⁇ , wherein n is 1-10.
- L s1 is ⁇ (CH 2 ) n ⁇ , wherein n is 1-10.
- n is 1.
- n is 2.
- n is 3.
- n is 4.
- L s3 is optionally substituted ⁇ (CH 2 ) n ⁇ , wherein n is 1-10. In some embodiments, L s3 is ⁇ (CH 2 ) n ⁇ , wherein n is 1-10. In some embodiments, n is 1. In some embodiments, n is 2. In some embodiments, n is 3. In some embodiments, n is 4. [0504] In some embodiments, a first amino acid residue is X 10 . In some embodiments, R SP1 of X 10 is ⁇ N 3 . In some embodiments, L a of X 10 is optionally substituted ⁇ (CH 2 )n ⁇ wherein n is 1-10.
- L a of X 10 is ⁇ (CH 2 ) 4 ⁇ . In some embodiments, L a of X 10 is ⁇ (CH 2 ) 3 ⁇ . In some embodiments, L a of X 10 is ⁇ (CH 2 ) 2 ⁇ . In some embodiments, L a of X 10 is ⁇ CH 2 ⁇ . In some embodiments, a second amino acid residue is X 14 . In some embodiments, R SP1 of X 14 is or comprises an alkyne, e.g., a strained/activated alkyne. In some embodiments, R SP1 of X 14 is ⁇ C ⁇ CH.
- L a of X 14 is optionally substituted ⁇ (CH 2 )n ⁇ wherein n is 1-10. In some embodiments, L a of X 14 is ⁇ (CH 2 ) 4 ⁇ . In some embodiments, L a of X 14 is ⁇ (CH 2 ) 3 ⁇ . In some embodiments, L a of X 14 is ⁇ (CH 2 ) 2 ⁇ . In some embodiments, L a of X 14 is ⁇ CH 2 ⁇ . In some embodiments, a methylene unit is replaced with ⁇ O ⁇ . In some embodiments, L a of X 14 is ⁇ CH 2 ⁇ O ⁇ CH 2 ⁇ . In some embodiments, L s3 is L a of X 14 .
- L s3 is bonded to a carbon atom of L s2 .
- a first amino acid residue is X 10 .
- R SP1 of X 10 is or comprises an alkyne, e.g., a strained/activated alkyne.
- R SP1 of X 10 is ⁇ C ⁇ CH.
- L a of X 10 is optionally substituted ⁇ (CH 2 )n ⁇ wherein n is 1-10.
- L a of X 10 is ⁇ (CH 2 ) 4 ⁇ .
- L a of X 10 is ⁇ (CH 2 ) 3 ⁇ .
- L a of X 10 is ⁇ (CH 2 ) 2 ⁇ . In some embodiments, L a of X 10 is ⁇ CH 2 ⁇ . In some embodiments, a methylene unit is replaced with ⁇ O ⁇ . In some embodiments, L a of X 10 is ⁇ CH 2 ⁇ O ⁇ CH 2 ⁇ . In some embodiments, L s1 is L a of X 10 . In some embodiments, L s1 is bonded to a carbon atom of L s2 .In some embodiments, a second amino acid residue is X 14 . In some embodiments, R SP1 of X 14 is ⁇ N 3 .
- L a of X 14 is optionally substituted ⁇ (CH 2 )n ⁇ wherein n is 1-10. In some embodiments, L a of X 14 is ⁇ (CH 2 ) 4 ⁇ . In some embodiments, L a of X 14 is ⁇ (CH 2 ) 3 ⁇ . In some embodiments, L a of X 14 is ⁇ (CH 2 ) 2 ⁇ . In some embodiments, L a of X 14 is ⁇ CH 2 ⁇ . [0506] In some embodiments, R SP1 is a nucleophile. In some embodiments, R SP1 is ⁇ SH, e.g., as in Cys. In some embodiments, L s2 is L” as described herein.
- L s2 is ⁇ S ⁇ CH 2 ⁇ L” ⁇ CH 2 ⁇ S ⁇ wherein L” is as described herein.
- a staple has the structure of ⁇ L s1 ⁇ S ⁇ CH 2 ⁇ L” ⁇ CH 2 ⁇ S ⁇ L s3 ⁇ , wherein each variable is independently as described herein, and each ⁇ CH 2 ⁇ is optionally substituted.
- L s2 is ⁇ S ⁇ C(R’) 2 ⁇ L” ⁇ C(R’) 2 ⁇ S ⁇ , wherein each variable is independently as described herein.
- a staple has the structure of ⁇ L s1 ⁇ S ⁇ C(R’) 2 ⁇ L” ⁇ C(R’) 2 ⁇ S ⁇ L s3 ⁇ , wherein each variable is independently as described herein.
- each R’ is independently R as described herein.
- each R’ is ⁇ H.
- L s2 is ⁇ S ⁇ Cy ⁇ S ⁇ wherein ⁇ Cy ⁇ is as described herein.
- a staple has the structure of ⁇ L s1 ⁇ S ⁇ Cy ⁇ S ⁇ L s3 ⁇ , wherein each variable is independently as described herein.
- L s2 is ⁇ S ⁇ Cy ⁇ Cy ⁇ S ⁇ wherein ⁇ Cy ⁇ is as described herein.
- a staple has the structure of ⁇ L s1 ⁇ S ⁇ Cy ⁇ Cy ⁇ S ⁇ L s3 ⁇ , wherein each variable is independently as described herein.
- L s1 is L a of a first amino acid residue.
- L s3 is L a of a second amino acid residue.
- each of L s1 and L s3 is L as described herein.
- L is an optionally substituted bivalent linear or branched C 1-10 hydrocarbon chain.
- L is an optionally substituted bivalent linear C 1-10 hydrocarbon chain. In some embodiments, L is a bivalent linear or branched C 1-10 hydrocarbon chain. In some embodiments, L is a bivalent linear C 1-10 hydrocarbon chain. In some embodiments, L is optionally substituted ⁇ (CH 2 )n ⁇ , wherein n is 1-10. In some embodiments, L is ⁇ (CH 2 )n ⁇ , wherein n is 1-10. In some embodiments, L is ⁇ CH 2 ⁇ . In some embodiments, L is ⁇ (CH 2 ) 2 ⁇ . In some embodiments, L is ⁇ (CH 2 ) 3 ⁇ . In some embodiments, L is ⁇ (CH 2 ) 4 ⁇ .
- L is an optionally substituted bivalent linear or branched C 1-10 hydrocarbon chain wherein one or more methylene units of L are independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ C(O) ⁇ , ⁇ N(R’) ⁇ , ⁇ Cy ⁇ or ⁇ O ⁇ .
- L is an optionally substituted bivalent linear C 1-10 hydrocarbon chain wherein one or more methylene units of L are independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ C(O) ⁇ , ⁇ N(R’) ⁇ , ⁇ Cy ⁇ or ⁇ O ⁇ .
- each of a pair of amino acid residues is Cys.
- L s1 is ⁇ CH 2 ⁇ .
- L s3 is ⁇ CH 2 ⁇ .
- L is ⁇ Cy ⁇ as described herein.
- ⁇ Cy ⁇ is optionally substituted phenylene.
- ⁇ Cy ⁇ is phenylene.
- ⁇ Cy ⁇ is optionally substituted 1,2-phenylene.
- ⁇ Cy ⁇ is 1,2-phenylene.
- ⁇ Cy ⁇ is optionally substituted 1,3-phenylene.
- ⁇ Cy ⁇ is 1,3-phenylene.
- ⁇ Cy ⁇ is optionally substituted 1,4-phenylene.
- ⁇ Cy ⁇ is tetrafluoro-1,4-phenylene. In some embodiments, ⁇ Cy ⁇ is 1,4-phenylene. In some embodiments, ⁇ Cy ⁇ is optionally substituted naphthylene. In some embodiments, ⁇ Cy ⁇ is optionally substituted . In some embodiments, L” is ⁇ Cy ⁇ Cy ⁇ , wherein each ⁇ Cy ⁇ is independently as described herein. In some embodiments, each ⁇ Cy ⁇ is independently optionally substituted phenylene. In some embodiments, each ⁇ Cy ⁇ is independently phenylene. In some embodiments, each ⁇ Cy ⁇ is independently optionally substituted 1,2-phenylene.
- each ⁇ Cy ⁇ is independently 1,2- phenylene. In some embodiments, each ⁇ Cy ⁇ is independently optionally substituted 1,3-phenylene. In some embodiments, each ⁇ Cy ⁇ is independently 1,3-phenylene. In some embodiments, each ⁇ Cy ⁇ is independently optionally substituted 1,4-phenylene. In some embodiments, each ⁇ Cy ⁇ is independently 1,4- phenylene. In some embodiments, each ⁇ Cy ⁇ is independently tetrafluoro-1,4-phenylene.
- such staples may be formed by linking Cys residues with a linking reagent having the structure of R x ⁇ L s2 ⁇ R x , wherein each variable is independently as described herein.
- each R x is ⁇ Br.
- R SP1 of two amino acid residues of a pair of amino acid residues suitable for stapling can each independently react with a linking reagent to form a staple.
- a suitable linking reagent comprises two reactive groups, each can independently react with R SP1 of each amino acid residue.
- a linking reagent has the structure of H ⁇ L” ⁇ H or a salt thereof, wherein the reagent comprises two amino groups, and L” is a covalent bond, or an optionally substituted, bivalent C 1 - C 20 aliphatic group wherein one or more methylene units of the aliphatic group are optionally and independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ Cy ⁇ , ⁇ O ⁇ , ⁇ S ⁇ , ⁇ S ⁇ S ⁇ , ⁇ N(R’) ⁇ , ⁇ C(O) ⁇ , ⁇ C(S) ⁇ , ⁇ C(NR’) ⁇ , ⁇ C(O)N(R’) ⁇ , ⁇ N(R’)C(O)N(R’) ⁇ , ⁇ N(R’)C(O)O ⁇ , ⁇ S(O) ⁇ , ⁇ S(O) 2 ⁇ , ⁇ S(O) 2 N(R’) ⁇ , ⁇ C(O)S ⁇ , or ⁇ C(O)O ⁇ .
- such a linking agent can react with two amino acid residues each independently having a R SP1 group that is ⁇ COOH or an activated form thereof.
- Suitable embodiments for L including those described for L herein that fall within the scope of L”.
- L is L wherein L is an optionally substituted bivalent linear or branched C 1-10 hydrocarbon chain wherein one or more methylene units of L are independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ C(O) ⁇ , ⁇ N(R’) ⁇ , ⁇ Cy ⁇ or ⁇ O ⁇ .
- L is an optionally substituted bivalent linear or branched C 1-10 hydrocarbon chain.
- L is an optionally substituted bivalent linear C 1-10 hydrocarbon chain. In some embodiments, L is a bivalent linear or branched C 1-10 hydrocarbon chain. In some embodiments, L is a bivalent linear C 1-10 hydrocarbon chain. In some embodiments, L is optionally substituted ⁇ (CH 2 )n ⁇ , wherein n is 1-10. In some embodiments, L is ⁇ (CH 2 )n ⁇ , wherein n is 1-10. In some embodiments, L is ⁇ CH 2 ⁇ . In some embodiments, L is ⁇ (CH 2 ) 2 ⁇ . In some embodiments, L is ⁇ (CH 2 ) 3 ⁇ . In some embodiments, L is ⁇ (CH 2 ) 4 ⁇ .
- L is an optionally substituted bivalent linear C 1-10 hydrocarbon chain wherein one or more methylene units of L are independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ C(O) ⁇ , ⁇ N(R’) ⁇ , ⁇ Cy ⁇ or ⁇ O ⁇ .
- a linking reagent is a diamine or a salt thereof.
- a reagent has the structure of NHR ⁇ L” ⁇ NHR or a salt thereof, wherein each variable is independently as described herein.
- each R is independently ⁇ H or optionally substituted C 1-6 aliphatic.
- each R is independently ⁇ H or C 1-6 aliphatic.
- each R is independently ⁇ H or optionally substituted C 1-6 alkyl. In some embodiments, each R is independently ⁇ H or C 1-6 alkyl. In some embodiments, a reagent has the structure of NH 2 ⁇ L” ⁇ NH 2 or a salt thereof. In some embodiments, L” is optionally substituted ⁇ (CH 2 )n ⁇ wherein n is 1-10. In some embodiments, L” is ⁇ (CH 2 ) 4 ⁇ .
- a staple, L s is ⁇ L s1 ⁇ L s2 ⁇ L s3 ⁇ , wherein L s1 is L a of a first amino acid residue of a stapled pair, L s3 is L a of a second amino acid residue of a stapled pair, and L s2 is ⁇ C(O) ⁇ N(R’) ⁇ L” ⁇ N(R’) ⁇ C(O) ⁇ , wherein each variable is independently as described herein.
- L” is optionally substituted ⁇ (CH 2 )n ⁇ wherein n is 1-10.
- L” is ⁇ (CH 2 ) 4 ⁇ .
- each of L s1 and L s3 is independently optionally substituted ⁇ (CH 2 )n ⁇ wherein n is 1-10. In some embodiments, n is 2. In some embodiments, a first amino acid residue is Gln (e.g., X 10 ). In some embodiments, a second amino acid residue is GlnR (e.g., X 14 ). In some embodiments, two GlnR can form such a staple through [diaminobutane]. [0512] In some embodiments, a linking reagent has the structure of H ⁇ Cy ⁇ L” ⁇ NHR or a salt thereof, wherein ⁇ Cy ⁇ comprises a second amino group.
- R is ⁇ H or optionally substituted C 1- 6 aliphatic. In some embodiments, R is ⁇ H or C 1-6 aliphatic. In some embodiments, R is ⁇ H or optionally substituted C 1-6 alkyl. In some embodiments, R is ⁇ H or C 1-6 alkyl. In some embodiments, R is methyl.
- a linking reagent has the structure of H ⁇ Cy ⁇ L” ⁇ NH 2 or a salt thereof, wherein ⁇ Cy ⁇ comprises a second amino group. In some embodiments, ⁇ Cy ⁇ is optionally substituted n some embodiments, ⁇ Cy ⁇ is . In some embodiments, L” is a covalent bond.
- L is optionally substituted ⁇ (CH 2 )n ⁇ wherein n is 1-10. In some embodiments, L” is ⁇ (CH 2 ) ⁇ . In some embodiments, a linking reagent is r a salt thereof. In some embodiments, a linking reagent is or a salt thereof. [0513] In some embodiments, L s2 is ⁇ C(O) ⁇ Cy ⁇ N(R’) ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, R’ is ⁇ H. In some embodiments, ⁇ Cy ⁇ is .
- each of L s1 and L s3 is independently optionally substituted ⁇ (CH 2 )n ⁇ wherein n is 1-10. In some embodiments, n is 2. In some embodiments, ⁇ Cy ⁇ is closer to a N-terminus than ⁇ N(R’) ⁇ . In some embodiments, ⁇ Cy ⁇ is closer to a C-terminus than ⁇ N(R’) ⁇ . In some embodiments, a first amino acid residue is Gln (e.g., X 10 ). In some embodiments, a second amino acid residue is GlnR (e.g., X 14 ). In some embodiments, two GlnR can form such a staple through [4aminopiperidine].
- L s2 is ⁇ C(O) ⁇ Cy ⁇ (CH 2 )n ⁇ N(R’) ⁇ C(O) ⁇ , wherein each variable is independently as described herein.
- R’ is ⁇ H.
- R’ is R as described herein, e.g., optionally substituted C 1-6 aliphatic, C 1-6 alkyl, etc.
- R is methyl.
- n is 1.
- ⁇ Cy ⁇ is .
- ⁇ Cy ⁇ is closer to a N-terminus than ⁇ N(R’) ⁇ .
- ⁇ Cy ⁇ is closer to a C-terminus than ⁇ N(R’) ⁇ .
- each of L s1 and L s3 is independently optionally substituted ⁇ (CH 2 )n ⁇ wherein n is 1- 10.
- n is 2.
- a first amino acid residue is Gln (e.g., X 10 ).
- a second amino acid residue is GlnR (e.g., X 14 ).
- two GlnR can form such a staple through [4mampiperidine].
- a methylene unit is replaced with ⁇ Cy ⁇ .
- a linking reagent has the structure of H ⁇ Cy ⁇ H, wherein Cy comprises two secondary amino groups.
- ⁇ Cy ⁇ is optionally substituted 8-20 membered bicyclic ring.
- H ⁇ Cy ⁇ H comprises two ⁇ NH ⁇ .
- ⁇ Cy ⁇ is optionally substituted n
- ⁇ Cy ⁇ is optionally substituted
- the meta connection site is closer to a N-terminus than the para connection site (relative to the spiro carbon atom).
- the meta connection site (relative to the spiro carbon atom) is closer to a C-terminus than the para connection site (relative to the spiro carbon atom).
- L s2 is ⁇ C(O) ⁇ Cy ⁇ C(O) ⁇ wherein ⁇ Cy ⁇ is as described herein.
- each of L s1 and L s3 is independently optionally substituted ⁇ (CH 2 )n ⁇ wherein n is 1-10.
- n is 2.
- a first amino acid residue is Gln (e.g., X 10 ).
- a second amino acid residue is GlnR (e.g., X 14 ).
- GlnR e.g., X 14
- two GlnR can form such a staple through [29N2spiroundecane].
- two GlnR can form such a staple through [39N2spiroundecane].
- a pair of amino acid residue suitable for stapling both independently has the structure of ⁇ N(R a1 ) ⁇ L a1 ⁇ C( ⁇ L a ⁇ R SP1 )(R a3 ) ⁇ L a2 ⁇ C(O) ⁇ or ⁇ N(R a1 ) ⁇ C( ⁇ L a ⁇ R SP1 )(R a3 ) ⁇ C(O) ⁇ , wherein each variable is independently as described herein, and R SP1 is an amino group.
- R SP1 is ⁇ NHR wherein R is as described herein.
- R is ⁇ H.
- R is optionally substituted C 1-6 aliphatic.
- R is optionally substituted C 1-6 alkyl. In some embodiments, R is C 1-6 aliphatic. In some embodiments, R is C 1-6 alkyl. In some embodiments, R SP1 is ⁇ NH 2 . In some embodiments, such two amino acid residue may be linked by a di-acid linking reagent.
- a linking reagent has the structure of HOOC ⁇ L” ⁇ COOH, or a salt thereof, or an activated form thereof, wherein L” is as described herein. In some embodiments, L” is ⁇ Cy ⁇ Cy ⁇ . In some embodiments, L” is ⁇ Cy ⁇ . In some embodiments, ⁇ Cy ⁇ is optionally substituted phenylene.
- ⁇ Cy ⁇ is optionally substituted 1,2-phenylene. In some embodiments, ⁇ Cy ⁇ is optionally substituted 1,3-phenylene. In some embodiments, each ⁇ Cy ⁇ is independently optionally substituted 1,2- phenylene. In some embodiments, each ⁇ Cy ⁇ is independently optionally substituted 1,3-phenylene. In some embodiments, L” is optionally substituted ome embodiments, a linking agent is or a salt or an activated form thereof. In some embodiments, L” is optionally substituted In some embodiments, a linking agent is a salt or an activated form thereof. In some embodiments, L” is 1,3-phenylene. In some embodiments, a linking agent is or a salt or an activated form thereof.
- L is optionally substituted ⁇ (CH 2 )n ⁇ , wherein n is 1-10. In some embodiments, L” is optionally substituted ⁇ CH 2 ⁇ . In some embodiments, L” is ⁇ C(R’) 2 ⁇ . In some embodiments, L” is ⁇ C(CH 3 ) 2 ⁇ . In some embodiments, a linking agent is (CH 3 ) 2 C(COOH) 2 or a salt or an activated form thereof. In some embodiments, L” is ⁇ CH 2 CH 2 ⁇ . In some embodiments, a linking agent is HOOCCH 2 CH 2 COOH or a salt or an activated form thereof.
- a staple is L s , wherein L s2 is ⁇ N(R’) ⁇ L” ⁇ N(R’) ⁇ , and each of L s1 and L s3 is independently as described herein.
- L is ⁇ Cy ⁇ Cy ⁇ , wherein each ⁇ Cy ⁇ is independently as described herein.
- L” is ⁇ Cy ⁇ as described herein.
- ⁇ Cy ⁇ is optionally substituted phenylene.
- ⁇ Cy ⁇ is optionally substituted 1,2-phenylene.
- ⁇ Cy ⁇ is optionally substituted 1,3-phenylene.
- each ⁇ Cy ⁇ is independently optionally substituted 1,2-phenylene. In some embodiments, each ⁇ Cy ⁇ is independently optionally substituted 1,3-phenylene. In some embodiments, L” is optionally substituted ⁇ (CH 2 )n ⁇ , wherein n is 1-10. In some embodiments, L” is optionally substituted ⁇ CH 2 ⁇ . In some embodiments, L” is ⁇ C(R’) 2 ⁇ . In some embodiments, L” is ⁇ C(CH 3 ) 2 ⁇ . In some embodiments, L” is ⁇ CH 2 CH 2 ⁇ . In some embodiments, each of L s1 and L s3 is independently optionally substituted ⁇ (CH 2 )n ⁇ wherein n is 1-10.
- n is 2. In some embodiments, n is 4. In some embodiments, a first amino acid residue is Lys (e.g., X 10 ). In some embodiments, a second amino acid residue is Lys (e.g., X 14 ). In some embodiments, two Lys can form such a staple through [Biphen33COOH]. In some embodiments, two Lys can form such a staple through [diphenate]. In some embodiments, two Lys can form such a staple through [isophthalate]. In some embodiments, two Lys can form such a staple through [Me2Mal]. In some embodiments, two Lys can form such a staple through [succinate]. [0520] In some embodiments, X 10 is stapled.
- X 10 is stapled with X 14 . In some embodiments, X 10 is stapled with X 7 .
- X 10 is Lys, Phe, TriAzLys, GlnR, Leu, PyrS2, Aib, Ala, sAla, AsnR, hGlnR, dOrn, PyrS1, dLys, dDab, [mPyr]Cys, PyrS3, iPrLys, [mXyl]Cys, TriAzOrn, 1MeK, [C3]Cys, [IsoE]Cys, DGlnR, Orn, [mPyr]hCys, [Red]Cys, [C3]hCys, 4PipA, sCH2S, [8FBB]Cys, [pXyl]Cys, [pXyl]hCys,
- X 10 is Lys. In some embodiments, X 10 is Phe. In some embodiments, X 10 is TriAxLys. In some embodiments, X 10 is GlnR. In some embodiments, X 10 is Leu. In some embodiments, X 10 is PryS2. In some embodiments, X 10 is Aib. In some embodiments, X 10 is Ala. In some embodiments, X 10 is Val. [0522] In some embodiments, X 10 is or comprises a residue of an amino acid or a moiety selected from Table A-I, Table A-II, Table A-III and Table A-IV.
- X 11 Various types of amino acid residues can be used for X 11 , e.g., a residue of an amino acid of formula A-I, A-II, A-III, A-IV, A-V, A-VI, etc. or a salt thereof in accordance with the present disclosure.
- X 11 is ⁇ N(R a1 ) ⁇ L a1 ⁇ C(R a2 )(R a3 ) ⁇ L a2 ⁇ C(O) ⁇ , wherein each variable is independently as described herein.
- X 11 is ⁇ N(R a1 ) ⁇ C(R a2 )(R a3 ) ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, X 11 is ⁇ N(R a1 ) ⁇ C(R a2 )H ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, R a1 is ⁇ H. In some embodiments, R a3 is ⁇ H. [0524] In some embodiments, X 11 is a residue of an amino acid suitable for stapling as described herein.
- an amino acid residue suitable for stapling is ⁇ N(R a1 ) ⁇ L a1 ⁇ C( ⁇ L a ⁇ R SP1 )(R a3 ) ⁇ L a2 ⁇ C(O) ⁇ wherein each variable is independently as described herein. In some embodiments, it is ⁇ N(R a1 ) ⁇ C( ⁇ L a ⁇ R SP1 )(R a3 ) ⁇ C(O) ⁇ wherein each variable is independently as described herein.
- each amino acid residue in a pair of amino acid residues suitable for stapling, is independently ⁇ N(R a1 ) ⁇ L a1 ⁇ C( ⁇ L a ⁇ R SP1 )(R a3 ) ⁇ L a2 ⁇ C(O) ⁇ or ⁇ N(R a1 ) ⁇ C( ⁇ L a ⁇ R SP1 )(R a3 ) ⁇ C(O) ⁇ , wherein each variable is independently as described herein.
- R a1 is ⁇ H.
- R a3 is ⁇ H.
- both R a1 and R a3 are ⁇ H.
- X 11 is a residue of an amino acid, e.g., having the structure of formula A- I, A-II, A-III, A-IV, A-V, A-VI, etc., whose side chain comprise a functional group suitable for stapling, e.g., a double bond. In some embodiments, X 11 is a residue of an amino acid that comprises one and no more than one functional groups for stapling.
- X 11 is a residue of an amino acid that comprises one and no more than one double bond for stapling.
- X 11 comprises a ring structure, and its amino group is part of a ring.
- X 11 is an amino acid as described herein (e.g., of formula A-I, A-II, A-III, etc.), wherein R a1 and R a3 are taken together to form an optionally substituted ring, e.g., an optionally substituted 3-10 membered ring.
- R a1 and R a3 are taken together with their intervening atoms to form an optionally substituted 3- 10 membered saturated or partially saturated ring having, in addition to the intervening atoms, 0-5 heteroatoms.
- R a2 and R a3 are taken together to form an optionally substituted ring, e.g., an optionally substituted 3-10 membered ring.
- R a2 and R a3 are taken together with their intervening atoms to form an optionally substituted 3-10 membered saturated or partially saturated ring having, in addition to the intervening atoms, 0-5 heteroatoms.
- a formed ring e.g., by R a1 and R a3 taken together with their intervening atoms, by R a2 and R a3 taken together with their intervening atoms, or by any other two suitable R taken together with their intervening atoms, either in X 11 or another moiety, is saturated.
- a formed ring is monocyclic.
- a formed ring has no heteroatoms in addition to the intervening atoms.
- a formed ring has at least one heteroatom in addition to the intervening atoms.
- a formed ring has at least one nitrogen in addition to the intervening atoms.
- L a1 and L a2 are covalent bond.
- a formed ring is unsubstituted.
- a formed ring is substituted.
- a substituent comprises a double bond which is suitable for metathesis with another double bond to form a staple.
- a substituent bonds to a nitrogen ring atom e.g., see PyrS2).
- X 11 is a residue of PyrS2.
- L a is ⁇ (CH 2 ) n1 ⁇ N(R’) ⁇ C(O) ⁇ (CH 2 ) n2 ⁇ , wherein each variable is independently as described herein, and each ⁇ CH 2 ⁇ is optionally substituted.
- L a is ⁇ (CH 2 ) n1 ⁇ N(R’) ⁇ C(O) ⁇ (CH 2 ) n2 ⁇ , wherein each variable is independently as described herein.
- ⁇ (CH 2 ) n1 ⁇ is bonded to X 11 .
- n1 is 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10.
- n1 is 1.
- n1 is 2.
- n1 is 3. In some embodiments, n2 is 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10. In some embodiments, n2 is 1. In some embodiments, n2 is 2. In some embodiments, n2 is 3. In some embodiments, n2 is 4. In some embodiments, n2 is 5. In some embodiments, R’ of ⁇ N(R’) ⁇ of L a and R a3 are taken together with their intervening atoms to form an optionally substituted ring. In some embodiments, a formed ring is optionally substituted 3-10 membered monocyclic, saturated or partially unsaturated ring having, in addition to the nitrogen atom to which R’ is attached, 0-3 heteroatoms.
- a formed ring is saturated. In some embodiments, a formed ring is 3-membered. In some embodiments, a formed ring is 4-membered. In some embodiments, a formed ring is 5-membered. In some embodiments, a formed ring is 6-membered. In some embodiments, a formed ring is 7-membered. In some embodiments, a formed ring is 8-membered. In some embodiments, a formed ring has no ring heteroatoms other than the nitrogen atom to which R’ is attached. In some embodiments, X 11 is a residue of PyrS2. [0529] In some embodiments, X 11 is stapled. In some embodiments, X 11 is stapled with X 4 .
- X 11 is PyrS2 and stapled. In some embodiments, X 11 is Lys and stapled. [0530] In some embodiments, X 11 is a residue of PyrS2 or Lys. [0531] In some embodiments, X 11 is a residue of PyrS2 and stapled. [0532] In some embodiments, a staple, e.g., L s , has the structure of ⁇ L s1 ⁇ L s2 ⁇ L s3 , wherein each variable is independently as described herein. In some embodiments, L s1 or L s3 is L a of X 11 as described herein. In some embodiments, L s3 is L a of X 11 as described herein.
- L s1 is L a of another amino acid residue, e.g., X 4 . In some embodiments, L s1 is L as described herein. In some embodiments, L is an optionally substituted bivalent linear or branched C 1-10 hydrocarbon chain. In some embodiments, L is an optionally substituted bivalent linear C 1-10 hydrocarbon chain. In some embodiments, L is a bivalent linear or branched C 1-10 hydrocarbon chain. In some embodiments, L is a bivalent linear C 1-10 hydrocarbon chain. In some embodiments, L is optionally substituted ⁇ (CH 2 )n ⁇ , wherein n is 1-10. In some embodiments, L is ⁇ (CH 2 )n ⁇ , wherein n is 1-10.
- L is ⁇ CH 2 ⁇ . In some embodiments, L is ⁇ (CH 2 ) 2 ⁇ . In some embodiments, L is ⁇ (CH 2 ) 3 ⁇ . In some embodiments, L is ⁇ (CH 2 ) 4 ⁇ . In some embodiments, L is an optionally substituted bivalent linear or branched C 1-10 hydrocarbon chain wherein one or more methylene units of L are independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ C(O) ⁇ , ⁇ N(R’) ⁇ , ⁇ Cy ⁇ or ⁇ O ⁇ .
- L is an optionally substituted bivalent linear C 1-10 hydrocarbon chain wherein one or more methylene units of L are independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ C(O) ⁇ , ⁇ N(R’) ⁇ , ⁇ Cy ⁇ or ⁇ O ⁇ .
- L s3 is L as described herein.
- L s3 is ⁇ (CH 2 ) n1 ⁇ N(R’) ⁇ C(O) ⁇ (CH 2 ) n2 ⁇ , wherein each variable is independently as described herein, and each ⁇ CH 2 ⁇ is optionally substituted.
- L s3 is ⁇ (CH 2 ) n1 ⁇ N(R’) ⁇ C(O) ⁇ (CH 2 ) n2 ⁇ , wherein each variable is independently as described herein.
- ⁇ (CH 2 ) n1 ⁇ is bonded to X 11 .
- n1 is 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10.
- n1 is 1.
- n1 is 2.
- n1 is 3.
- n2 is 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10.
- n2 is 1.
- n2 is 2.
- n2 is 3.
- n2 is 4.
- n2 is 5.
- R’ of ⁇ N(R’) ⁇ of L a and R a3 are taken together with their intervening atoms to form an optionally substituted ring.
- a formed ring is optionally substituted 3-10 membered monocyclic, saturated or partially unsaturated ring having, in addition to the nitrogen atom to which R’ is attached, 0-3 heteroatoms.
- a formed ring is saturated.
- a formed ring is 3-membered.
- a formed ring is 4-membered.
- a formed ring is 5-membered.
- a formed ring is 6-membered.
- X 11 is PyrS2, Lys, 3Thi, Ala, Phe, SPip3, PyrSadNip3Butene, SPip2, Az3, DapAc7EDA, Leu, 3allyloxyPyrSa, PyrSaV3Butene, Az2, PyrS1, PyrSc72SMe3ROMe, PyrSc72RMe3SOMe, PyrSc7O45RMe, PyrSc7O45SMe, PyrSc73Me2, PyrSc7, PyrSaA3Butene, PyrSadA3Butene, Dap7Gly, Dap7Pent, DapAc7PDA, Dap7Abu, 4VinylPyrSa, PyrSadV3Butene, PyrSaSar3Butene, PyrSaNip3Butene, PyrSaPro3Butene, PyrSa4V
- X 11 is PyrS2. In some embodiments, X 11 is Lys. In some embodiments, X 11 is 3Thi. In some embodiments, X 11 is Ala. In some embodiments, X 11 is Phe. In some embodiments, X 11 is S3MePyrSc7. In some embodiments, X 11 is R3MePyrSc7. In some embodiments, X 11 is S3iPrPyrSc7. In some embodiments, X 11 is R3iPrPyrSc7.
- X 11 is or comprises a residue of an amino acid or a moiety selected from Table A-I, Table A-II, Table A-III and Table A-IV.
- Various types of amino acid residues can be used for X 12 , e.g., a residue of an amino acid of formula A-I, A-II, A-III, A-IV, A-V, A-VI, etc. or a salt thereof in accordance with the present disclosure.
- X 12 is ⁇ N(R a1 ) ⁇ L a1 ⁇ C(R a2 )(R a3 ) ⁇ L a2 ⁇ C(O) ⁇ , wherein each variable is independently as described herein.
- X 12 is ⁇ N(R a1 ) ⁇ C(R a2 )(R a3 ) ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, X 12 is ⁇ N(R a1 ) ⁇ C(R a2 )H ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, R a1 is ⁇ H. In some embodiments, R a3 is ⁇ H. [0537] In some embodiments, X 12 comprises a side chain comprising an optionally substituted aromatic group. In some embodiments, X 12 is an aromatic amino acid residue as described herein.
- an aromatic group is optionally substituted 5-membered heteroaryl having 1-3 heteroatoms. In some embodiments, an aromatic group is optionally substituted 5-membered heteroaryl having 1-3 nitrogen atoms. In some embodiments, an aromatic group is optionally substituted 5-membered heteroaryl having one oxygen atom. In some embodiments, an aromatic group is optionally substituted 5-membered heteroaryl having one sulfur atom. In some embodiments, an aromatic group is optionally substituted 6-membered heteroaryl having 1-3 heteroatoms. In some embodiments, an aromatic group is optionally substituted 6- membered heteroaryl having 1 nitrogen atom. In some embodiments, an aromatic group is optionally substituted phenyl.
- X 12 comprises a side chain which is or comprises an optionally substituted aromatic group, wherein each substituent of the aromatic group is independently selected from halogen, ⁇ OR, ⁇ R, ⁇ C(O)OH, ⁇ C(O)NH 2 , ⁇ CN, or –NO 2 , wherein each R is independently C 1-4 alkyl or haloalkyl.
- an aromatic group is phenyl.
- an aromatic group is optionally substituted 8-10 membered bicyclic aryl or heteroaryl having 1-5 heteroatoms.
- X 12 comprises a side chain which is or comprises an optionally substituted aromatic group, wherein each substituent of the aromatic group is independently halogen.
- X 12 comprises a side chain which is or comprises two optionally substituted aromatic groups. In some embodiments, X 12 comprises a side chain which is or comprises an optionally substituted aromatic group, wherein each substituent of the aromatic group is independently selected from halogen or ⁇ OH. In some embodiments, an aromatic group is phenyl. In some embodiments, an aromatic group is optionally substituted 8-10 membered bicyclic aryl or heteroaryl having 0-5 heteroatoms. In some embodiments, an aromatic group is optionally substituted 9-10 membered bicyclic aryl or heteroaryl having one heteroatom. In some embodiments, X 12 is a residue of an amino acid of formula A-I or a salt thereof.
- an amino acid residue has the structure of ⁇ NH ⁇ C(R a2 )(R a3 ) ⁇ C(O) ⁇ or a salt thereof. In some embodiments, an amino acid residue has the structure of ⁇ NH ⁇ CH(R a3 ) ⁇ C)O) ⁇ or a salt thereof.
- R a3 is ⁇ L a ⁇ R’ wherein each variable is independently as described herein. In some embodiments, R’ is R as described herein. In some embodiments, R is an optionally substituted group selected from phenyl, 10- membered bicyclic aryl, 5-6 membered heteroaryl having 1-4 heteroatoms, and 9-10 membered bicyclic heteroaryl having 1-5 heteroatoms.
- each substituent is independently halogen or ⁇ OH or C 1-6 haloaliphatic. In some embodiments, each substituent is independently halogen or ⁇ OH. In some embodiments, R is optionally substituted phenyl. In some embodiments, R is phenyl. In some embodiments, R is optionally substituted aryl. In some embodiments, R is aryl. In some embodiments, R is optionally substituted 5-membered heteroaryl having 1-4 heteroatoms. In some embodiments, R is optionally substituted 5-membered heteroaryl having 1 heteroatom. In some embodiments, optionally substituted R is 6-membered heteroaryl having 1-4 heteroatoms.
- optionally substituted R is 6- membered heteroaryl having 1 heteroatom. In some embodiments, R is optionally substituted 9-membered heteroaryl having 1-5 heteroatoms. In some embodiments, R is optionally substituted 9-membered heteroaryl having 1 heteroatom. In some embodiments, R is optionally substituted 10-membered heteroaryl having 1-5 heteroatoms. In some embodiments, R is optionally substituted 10-membered heteroaryl having 1 heteroatom. In some embodiments, a heteroatom is nitrogen. In some embodiments, a heteroatom is oxygen. In some embodiments, a heteroatom is sulfur. As described herein, L a is L. In some embodiments, L is a covalent bond.
- L is an optionally substituted bivalent linear or branched C 1-10 hydrocarbon chain. In some embodiments, L is an optionally substituted bivalent linear C 1-10 hydrocarbon chain. In some embodiments, L is a bivalent linear or branched C 1-10 hydrocarbon chain. In some embodiments, L is a bivalent linear C 1-10 hydrocarbon chain. In some embodiments, L is optionally substituted ⁇ (CH 2 )n ⁇ , wherein n is 1-10. In some embodiments, L is ⁇ (CH 2 )n ⁇ , wherein n is 1-10. In some embodiments, L is ⁇ CH 2 ⁇ . In some embodiments, L is ⁇ (CH 2 ) 2 ⁇ .
- L is ⁇ (CH 2 ) 3 ⁇ . In some embodiments, L is ⁇ (CH 2 ) 4 ⁇ . In some embodiments, L is an optionally substituted bivalent linear or branched C 1-10 hydrocarbon chain wherein one or more methylene units of L are independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ C(O) ⁇ , ⁇ N(R’) ⁇ , ⁇ Cy ⁇ or ⁇ O ⁇ . In some embodiments, L is an optionally substituted bivalent linear C 1-10 hydrocarbon chain wherein one or more methylene units of L are independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ C(O) ⁇ , ⁇ N(R’) ⁇ , ⁇ Cy ⁇ or ⁇ O ⁇ .
- X 12 is a residue of an amino acid selected from 3Thi, 2F3MeF, Phe, 2COOHF, 2ClF, 2FurA, 2OMeF, 2MeF, 2BrF, 2CNF, 2NO2F, 2PyrA, 3PyrA, 4PyrA, His, 1NapA, 2Thi, and 2cmbF.
- X 12 is a residue of 3Thi, 2F3MeF, or Phe.
- X 12 is a residue of 3Thi.
- X 12 is a residue of 2F3MeF.
- X 12 is a residue of Phe. In some embodiments, X 12 is a residue of 2COOHF. In some embodiments, X 12 is a residue of 2ClF. In some embodiments, X 12 is a residue of 2FurA. In some embodiments, X 12 is a residue of 2OMeF. In some embodiments, X 12 is a residue of 2MeF. In some embodiments, X 12 is a residue of 2BrF. In some embodiments, X 12 is a residue of 2CNF. In some embodiments, X 12 is a residue of 2NO2F. In some embodiments, X 12 is a residue of 2PyraA.
- X 12 is a residue of 3PyrA. In some embodiments, X 12 is a residue of 4PyrA. In some embodiments, X 12 is a residue of His. In some embodiments, X 12 is a residue of 1NapA. In some embodiments, X 12 is a residue of 2Thi. In some embodiments, X 12 is a residue of 2cmbF. In some embodiments, 3Thi provides better properties and/or activities than, e.g., Phe. [0539] In some embodiments, X 12 is a residue of an amino acid whose side chain is hydrophobic.
- X 12 is a residue of nLeu, CypA, Ala, Leu, hLeu, Npg, Cpa, Nva, Cba, ChA, Val, Ile, Chg, hnLeu, or OctG.
- X 12 is a residue of nLeu or CypA.
- X 12 is a residue of nLeu.
- X 12 is a residue of CypA.
- X 12 is a residue of Ala.
- X 12 is a residue of Leu. In some embodiments, X 12 is a residue of hLeu. In some embodiments, X 12 is a residue of Npg. In some embodiments, X 12 is a residue of Cpa. In some embodiments, X 12 is a residue of Nva. In some embodiments, X 12 is a residue of Cba. In some embodiments, X 12 is a residue of ChA. In some embodiments, X 12 is a residue of Val. In some embodiments, X 12 is a residue of Ile. In some embodiments, X 12 is a residue of Chg. In some embodiments, X 12 is a residue of hnLeu.
- X 12 is a residue of OctG. [0540] In some embodiments, X 12 is a residue of amino acid that comprises an acidic or polar group. In some embodiments, X 12 is a residue of amino acid whose side chain comprises an acidic group, e.g., a ⁇ COOH group or a salt form thereof (e.g., a compound of formula A-IV, etc.). Various acidic amino acid residues described herein may be utilized for X 12 , e.g., those described for X 2 , X 5 , X 6 , etc. In some embodiments, X 12 is 2COOHF.
- X 12 is a residue of amino acid whose side chain comprises a polar group. In some embodiments, X 12 is a residue of amino acid whose side chain comprises an amide group, e.g., ⁇ C(O)N(R’) 2 such as ⁇ CONH 2 . For example, in some embodiments, X 12 is a residue of 2cbmF. Various other polar amino acid residues described herein may also be utilized for X 12 .
- X 12 is a residue of an amino acid selected from 3Thi, 2F3MeF, Phe, nLeu, 2COOHF, CypA, 2ClF, Ala, Abu, Leu, hLeu, Npg, Cpa, Nva, Cba, ChA, 2FurA, 2OMeF, 2MeF, 2BrF, 2CNF, 2NO2F, 2PyrA, 3PyrA, 4PyrA, His, 1NapA, Val, Ile, Chg, DiethA, hnLeu, OctG, 2Thi, and 2cmbF.
- X 12 is 3Thi, Phe, 2F3MeF, PyrS2, 2ClF, hnLeu, BztA, 2Thi, 2MeF, 2FF, 34ClF, Lys, nLeu, 2COOHF, 2PhF, hCbA, hCypA, hCha, CypA, hPhe, DipA, HepG, Dap7Abu, hhLeu, hhSer, HexG, [2IAPAc]2NH2F, Ala, Abu, Leu, hLeu, Npg, Cpa, PyrS1, [Bnc]2NH2F, [Phc]2NH2F, [BiPh]2NH2F, [3PyAc]2NH2F, Nva, Cba, ChA, 2FurA, 2OMeF, 2BrF, 2CNF, 2NO2F, 2Pyr
- X 12 is 3Thi. In some embodiments, X 12 is Phe. In some embodiments, X 12 is 3F3MeF. In some embodiments, X 12 is PyrS2. In some embodiments, X 12 is 2ClF. In some embodiments, X 12 is hnLeu. In some embodiments, X 12 is BztA. In some embodiments, X 12 is 2Thi. In some embodiments, X 12 is 2MeF. In some embodiments, X 12 is 2FF. In some embodiments, X 12 is 34ClF. In some embodiments, X 12 is 2NH2F. In some embodiments, X 12 is Trp. In some embodiments, X 12 is 5ClW.
- X 12 is 6ClW. In some embodiments, X 12 is 2NH2F. In some embodiments, X 12 is [124TriAc]2NH2F. In some embodiments, X 12 is [124TriPr]2NH2F. In some embodiments, X 12 is [6QuiAc]2NH2F. In some embodiments, X 12 is [2PyAc]2NH2F. In some embodiments, X 12 is [2PyPrpc]2NH2F. In some embodiments, X 12 is [3PyPrpc]2NH2F. In some embodiments, X 12 is [4PyPrpc]2NH2F.
- X 12 is [MeOPr]2NH2F. In some embodiments, X 12 is [PhOPr]2NH2F. In some embodiments, X 12 is [Me2MeOPr]2NH2F. In some embodiments, X 12 is [Me2NAc]2NH2F. In some embodiments, X 12 is [Me2NPr]2NH2F. In some embodiments, X 12 is [NdiMeButC]2NH2F. In some embodiments, X 12 is [3IAPAc]2NH2F. In some embodiments, X 12 is [15PyraPy]2NH2F.
- X 12 is [MorphAc]2NH2F. In some embodiments, X 12 is [Nic]2NH2F. In some embodiments, X 12 is [2PyzCO]2NH2F. In some embodiments, X 12 is [5pymCO]2NH2F. In some embodiments, X 12 is [3FPyr2c]2NH2F. In some embodiments, X 12 is [4FPyr3c]2NH2F. [0543] In some embodiments, X 12 is an amino acid residue for stapling as described herein. In some embodiments, X 12 is stapled, e.g., with X 5 . In some embodiments, X 12 is PyrS1.
- X 12 is PyrS2. [0544] In some embodiments, X 12 is or comprises a residue of an amino acid or a moiety selected from Table A-IV. [0545] In some embodiments, X 12 interacts with Trp383 of beta-catenin or an amino acid residue corresponding thereto. In some embodiments, X 12 interacts with Asn415 of beta-catenin or an amino acid residue corresponding thereto. In some embodiments, X 12 interacts with Trp383 and Asn415 of beta-catenin or amino acid residues corresponding thereto.
- X 13 Various types of amino acid residues can be used for X 13 , e.g., a residue of an amino acid of formula A-I, A-II, A-III, A-IV, A-V, A-VI, etc. or a salt thereof in accordance with the present disclosure.
- X 13 is ⁇ N(R a1 ) ⁇ L a1 ⁇ C(R a2 )(R a3 ) ⁇ L a2 ⁇ C(O) ⁇ , wherein each variable is independently as described herein.
- X 13 is ⁇ N(R a1 ) ⁇ C(R a2 )(R a3 ) ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, X 13 is ⁇ N(R a1 ) ⁇ C(R a2 )H ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, R a1 is ⁇ H. In some embodiments, R a3 is ⁇ H. [0547] In some embodiments, X 13 comprises a side chain which is or comprises an optionally substituted aromatic group. In some embodiments, X 13 is an aromatic amino acid residue as described herein.
- X 13 comprises a side chain comprising an optionally substituted aromatic group.
- X 13 is an aromatic amino acid residue as described herein.
- an aromatic group is optionally substituted 5-membered heteroaryl having 1-3 heteroatoms.
- an aromatic group is optionally substituted 5-membered heteroaryl having 1-3 nitrogen atoms.
- an aromatic group is optionally substituted 5-membered heteroaryl having one sulfur atom.
- an aromatic group is optionally substituted phenyl.
- X 13 comprises a side chain which is or comprises an optionally substituted aromatic group, wherein each substituent of the aromatic group is independently selected from halogen, ⁇ OR, ⁇ R, ⁇ C(O)OH, or ⁇ CN, wherein each R is independently hydrogen or C 1-4 alkyl or haloalkyl.
- an aromatic group is phenyl.
- an aromatic group is optionally substituted 8-10 membered bicyclic aryl or heteroaryl having 1-5 heteroatoms.
- X 13 comprises a side chain which is or comprises an optionally substituted aromatic group, wherein each substituent of the aromatic group is independently halogen.
- X 13 comprises a side chain which is or comprises two optionally substituted aromatic groups. In some embodiments, X 13 comprises a side chain which is or comprises an optionally substituted aromatic group, wherein each substituent of the aromatic group is independently selected from halogen or ⁇ OH. In some embodiments, an aromatic group is phenyl. In some embodiments, an aromatic group is optionally substituted 8-10 membered bicyclic aryl or heteroaryl having 0-5 heteroatoms. In some embodiments, an aromatic group is optionally substituted 9-10 membered bicyclic aryl or heteroaryl having one heteroatom. In some embodiments, X 13 is a residue of an amino acid of formula A-I or a salt thereof.
- an amino acid residue has the structure of ⁇ NH ⁇ C(R a2 )(R a3 ) ⁇ C(O) ⁇ or a salt thereof. In some embodiments, an amino acid residue has the structure of ⁇ NH ⁇ CH(R a3 ) ⁇ C)O) ⁇ or a salt thereof.
- R a3 is ⁇ L a ⁇ R’ wherein each variable is independently as described herein. In some embodiments, R’ is R as described herein. In some embodiments, R is an optionally substituted group selected from phenyl, 10-membered bicyclic aryl, 5-6 membered heteroaryl having 1-4 heteroatoms, and 9-10 membered bicyclic heteroaryl having 1-5 heteroatoms.
- each substituent is independently halogen or ⁇ OH or C 1-6 haloaliphatic. In some embodiments, each substituent is independently halogen or ⁇ OH. In some embodiments, R is optionally substituted phenyl. In some embodiments, R is phenyl. In some embodiments, R is optionally substituted aryl. In some embodiments, R is aryl. In some embodiments, R is optionally substituted 5- membered heteroaryl having 1-4 heteroatoms. In some embodiments, R is optionally substituted 5- membered heteroaryl having 1 heteroatom. In some embodiments, optionally substituted R is 6-membered heteroaryl having 1-4 heteroatoms.
- optionally substituted R is 6-membered heteroaryl having 1 heteroatom. In some embodiments, R is optionally substituted 9-membered heteroaryl having 1-5 heteroatoms. In some embodiments, R is optionally substituted 9-membered heteroaryl having 1 heteroatom. In some embodiments, R is optionally substituted 10-membered heteroaryl having 1-5 heteroatoms. In some embodiments, R is optionally substituted 10-membered heteroaryl having 1 heteroatom. In some embodiments, a heteroatom is nitrogen. In some embodiments, a heteroatom is oxygen. In some embodiments, a heteroatom is sulfur. As described herein, L a is L. In some embodiments, L is a covalent bond.
- L is an optionally substituted bivalent linear or branched C 1-10 hydrocarbon chain. In some embodiments, L is an optionally substituted bivalent linear C 1-10 hydrocarbon chain. In some embodiments, L is a bivalent linear or branched C 1-10 hydrocarbon chain. In some embodiments, L is a bivalent linear C 1-10 hydrocarbon chain. In some embodiments, L is optionally substituted ⁇ (CH 2 )n ⁇ , wherein n is 1-10. In some embodiments, L is ⁇ (CH 2 )n ⁇ , wherein n is 1-10. In some embodiments, L is ⁇ CH 2 ⁇ . In some embodiments, L is ⁇ (CH 2 ) 2 ⁇ .
- L is ⁇ (CH 2 ) 3 ⁇ . In some embodiments, L is ⁇ (CH 2 ) 4 ⁇ . In some embodiments, L is an optionally substituted bivalent linear or branched C 1-10 hydrocarbon chain wherein one or more methylene units of L are independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ C(O) ⁇ , ⁇ N(R’) ⁇ , ⁇ Cy ⁇ or ⁇ O ⁇ . In some embodiments, L is an optionally substituted bivalent linear C 1-10 hydrocarbon chain wherein one or more methylene units of L are independently replaced with ⁇ C(R’) 2 ⁇ , ⁇ C(O) ⁇ , ⁇ N(R’) ⁇ , ⁇ Cy ⁇ or ⁇ O ⁇ .
- X 13 is a residue of BztA, 34ClF, or 2NapA. In some embodiments, X 13 is a residue of BztA. In some embodiments, X 13 is a residue of 34ClF. In some embodiments, X 13 is a residue of 2NapA. In some embodiments, X 13 is a residue of 3BrF. In some embodiments, X 13 is a residue of 3Thi. In some embodiments, X 13 is a residue of 34MeF.
- X 13 is BztA, 34ClF, 3Thi, Phe, GlnR, 34MeF, 2NapA, Lys, PyrS2, 3BrF, 7FBztA, 2BrF, 3F3MeF, 4F3MeF, RbMe2NapA, RbMeBzta, SbMeBzta, 5IndA, 7ClBztA, 7MeBztA, Leu, 2ClF, 3ClF, 4BrF, 4ClF, or 3MeF.
- X 13 is BztA.
- X 13 is 34ClF.
- X 13 is 3Thi. In some embodiments, X 13 is Phe. In some embodiments, X 13 is GlnR. In some embodiments, X 13 is 34MeF. In some embodiments, X 13 is 2NapA. In some embodiments, X 13 is Lys. In some embodiments, BztA provides better properties and/or activities than, e.g., Trp. [0551] In some embodiments, X 13 is or comprises a residue of an amino acid or a moiety selected from Table A-IV. [0552] In some embodiments, X 13 interacts with Gln379 of beta-catenin or an amino acid residue corresponding thereto.
- X 13 interacts with Leu382 of beta-catenin or an amino acid residue corresponding thereto. In some embodiments, X 13 interacts with Val416 of beta-catenin or an amino acid residue corresponding thereto. In some embodiments, X 13 interacts with Asn415 of beta-catenin or an amino acid residue corresponding thereto. In some embodiments, X 13 interacts with Trp383 of beta-catenin or an amino acid residue corresponding thereto. In some embodiments, X 13 interacts with Gln379, Leu382, Val416, Asn415, and Trp383 of beta-catenin or amino acid residues corresponding thereto.
- X 14 Various types of amino acid residues can be used for X 14 , e.g., a residue of an amino acid of formula A-I, A-II, A-III, A-IV, A-V, A-VI, etc. or a salt thereof in accordance with the present disclosure.
- X 14 is ⁇ N(R a1 ) ⁇ L a1 ⁇ C(R a2 )(R a3 ) ⁇ L a2 ⁇ C(O) ⁇ , wherein each variable is independently as described herein.
- X 14 is ⁇ N(R a1 ) ⁇ C(R a2 )(R a3 ) ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, X 14 is ⁇ N(R a1 ) ⁇ C(R a2 )H ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, R a1 is ⁇ H. In some embodiments, R a3 is ⁇ H. [0554] In some embodiments, X 14 is an amino acid residue suitable for stapling. In some embodiments, X 14 is stapled. In some embodiments, X 14 is stapled with X 10 as described herein.
- X 14 is stapled with X 7 as described herein.
- X 14 is an amino acid residue suitable for stapling, e.g., those described for X 7 , X 10 , etc.
- Various types of amino acid residues can be used for X 14 .
- X 14 is GlnR, Lys, sAla, Gln, Cys, TriAzLys, AsnR, hGlnR, 4PipA, sAbu, Orn, dGlnR, [4mampiperidine]GlnR, [39N2spiroundecane]GlnR, [29N2spiroundecane]GlnR, iPrLys, sCH2S, [diaminobutane]GlnR, or [4aminopiperidine]GlnR.
- X 14 is GlnR.
- X 14 is Lys.
- X 14 is sAla. In some embodiments, X 14 is Gln. In some embodiments, X 14 is Cys. In some embodiments, X 14 is TriAzLys. In some embodiments, X 14 is AsnR. In some embodiments, X 14 is hGlnR. In some embodiments, X 14 is 4PipA. In some embodiments, X 14 is sAbu. In some embodiments, X 14 is Orn. In some embodiments, X 14 is dGlnR. In some embodiments, X 14 is [4mampiperidine]GlnR. In some embodiments, X 14 is [39N2spiroundecane]GlnR.
- X 14 is [29N2spiroundecane]GlnR. In some embodiments, X 14 is iPrLys. In some embodiments, X 14 is sCH2S. In some embodiments, X 14 is [diaminobutane]GlnR. In some embodiments, X 14 is [4aminopiperidine]GlnR. [0557] In some embodiments, X 14 is an aromatic amino acid residue as described herein. In some embodiments, X 14 is BtzA. [0558] In some embodiments, v14 is a polar amino acid residue as described herein. In some embodiments, X 14 is Gln.
- X 14 is a C-terminus amino acid residue. In some embodiments, X 14 has a free ⁇ COOH or a salt form thereof. In some embodiments, ⁇ C(O)OH of X 14 is capped. In some embodiments, ⁇ C(O)OH of X 14 is converted into ⁇ C(O)N(R’) 2 , wherein each R is independently as described herein. In some embodiments, ⁇ C(O)N(R’) 2 is ⁇ C(O)NHR’. In some embodiments, each R’ is independently R. In some embodiments, each R’ is ⁇ H. In some embodiments, R is H. In some embodiments, R is optionally substituted C 1-6 aliphatic.
- R is optionally substituted C 1- 6 alkyl. In some embodiments, R is ethyl. In some embodiments, R is . In some embodiments, R is ⁇ CH(CH 3 )CH 2 OH. In some embodiments, R is ⁇ (S) ⁇ CH(CH 3 )CH 2 OH. In some embodiments, R is ⁇ (R) ⁇ CH(CH 3 )CH 2 OH. In some embodiments, R is ⁇ CH(CH 2 OH) 2 . [0560] In some embodiments, two R’ groups are taken together with the nitrogen atom to which they are attached to form a ring as described herein.
- ⁇ N(R’) 2 is [0561]
- X 14 is GlnR, BztA, sAla, 34ClF, Cys, Ala, Lys, AsnR, aMeC, PyrS2, Gln, hGlnR, 3Thi, Lys, Pen, GlnR, TriAzLys, hCys, 4PipA, sAbu, Orn, 1MeK, [4mampiperidine]GlnR, [39N2spiroundecane]GlnR, [29N2spiroundecane]GlnR, iPrLys, sCH2S, AsnEDA, AsnS3APyr, [diaminobutane]GlnR, [4aminopiperidine]GlnR, dGlnR, GlnEDA, AsnPpz, GlnPpz, GlnR
- X 14 is GlnR. In some embodiments, X 14 is BztA. In some embodiments, X 14 is sAla. In some embodiments, X 14 is 34ClF. In some embodiments, X 14 is Cys. In some embodiments, X 14 is Ala. In some embodiments, X 14 is Lys. In some embodiments, X 14 is AsnR. In some embodiments, X 14 is aMeC. In some embodiments, X 14 is PyrS2. In some embodiments, X 14 comprises a C-terminal group, e.g., ⁇ NH2. In some embodiments, X 14 is Gln. In some embodiments, X 14 is hGlnR.
- X 14 is 3Thi. In some embodiments, X 14 is Lys. In some embodiments, X 14 is GlnR*3. In some embodiments, X 14 is dLys. In some embodiments, X 14 is GlnMePDA. In some embodiments, X 14 is GlnT4CyMe. In some embodiments, X 14 is GlnMeBDA. In some embodiments, X 14 is Gln5DA. In some embodiments, X 14 is Gln6DA. In some embodiments, X 14 is TriAzOrn. In some embodiments, X 14 is Phe. In some embodiments, X 14 is GlnC4CyMe.
- X 14 is Gln3ACPip. In some embodiments, X 14 is GlnPipAz. In some embodiments, X 14 is GlnPip4AE. In some embodiments, X 14 forms intramolecular hydrogen bonding. [0562] In some embodiments, X 14 is or comprises a residue of an amino acid or a moiety selected from Table A-I, Table A-II, Table A-III and Table A-IV. [0563] In some embodiments, p15 is 1. In some embodiments, p15 is 0.
- X 15 Various types of amino acid residues can be used for X 15 , e.g., a residue of an amino acid of formula A-I, A-II, A-III, A-IV, A-V, A-VI, etc. or a salt thereof in accordance with the present disclosure.
- X 15 is ⁇ N(R a1 ) ⁇ L a1 ⁇ C(R a2 )(R a3 ) ⁇ L a2 ⁇ C(O) ⁇ , wherein each variable is independently as described herein.
- X 15 is ⁇ N(R a1 ) ⁇ C(R a2 )(R a3 ) ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, X 15 is ⁇ N(R a1 ) ⁇ C(R a2 )H ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, R a1 is ⁇ H. In some embodiments, R a3 is ⁇ H. [0565] Various types of amino acid residues can be used for X 15 .
- X 15 is a residue of Ala, Leu, Val, Aib, MorphNva, Thr, dAla, dLeu, [BiotinPEG8]Lys, Glu, or AzLys.
- X 15 is or comprises a label, e.g., a label for detection, binding, etc.
- a label is or comprises biotin.
- X 15 is [BiotinPEG8]Lys.
- X 15 is a hydrophobic amino acid residue as described herein, e.g., those described for X 3 , X 8 , etc.
- X 15 is Ala. In some embodiments, X 15 is Leu. In some embodiments, X 15 is Val. In some embodiments, X 15 is Aib. In some embodiments, X 15 is dAla. In some embodiments, X 15 is dLeu. [0568] In some embodiments, X 15 is an amino acid residue whose side chain comprises an amino group. In some embodiments, X 15 is MorphNva. [0569] In some embodiments, X 15 is an amino acid residue suitable for stapling as described herein. In some embodiments, X 15 is GlnR. In some embodiments, it is stapled with X 11 . In some embodiments, X 11 is Lys.
- X 15 is a polar amino acid residue as described herein, e.g., those described for X 2 , X 5 , X 6 , etc. In some embodiments, X 15 is Thr. In some embodiments, X 15 is ⁇ Ser. [0571] In some embodiments, X 15 is an acidic amino acid residue as described herein, e.g., those described for X 2 , X 5 , X 6 , etc. In some embodiments, X 15 is Glu. [0572] In some embodiments, X 15 is a C-terminus amino acid residue. In some embodiments, X 15 has a free ⁇ COOH or a salt form thereof.
- ⁇ C(O)OH of X 15 is capped. In some embodiments, ⁇ C(O)OH of X 15 is converted into ⁇ C(O)N(R’) 2 , wherein each R is independently as described herein. In some embodiments, ⁇ C(O)N(R’) 2 is ⁇ C(O)NHR’. In some embodiments, each R’ is independently R. In some embodiments, each R’ is ⁇ H. In some embodiments, R is H. In some embodiments, R is optionally substituted C 1-6 aliphatic. In some embodiments, R is optionally substituted C 1- 6 alkyl. In some embodiments, R is ethyl.
- R is n some embodiments, R is ⁇ CH(CH 3 )CH 2 OH. In some embodiments, R is ⁇ (S) ⁇ CH(CH 3 )CH 2 OH. In some embodiments, R is ⁇ (R) ⁇ CH(CH 3 )CH 2 OH. In some embodiments, R is ⁇ CH(CH 2 OH) 2 . [0573] In some embodiments, an agent comprises a C-terminal group. In some embodiments, a C- terminal group is ⁇ OH. In some embodiments, a C-terminal group is ⁇ NH 2 .
- X 15 is Ala, GlnR, Leu, Val, Ser, Thr, 3Thi, BztA, Aib, MorphNva, dAla, dLeu, Pro, Phe, [BiotinPEG8]Lys, Throl, Glu, AzLys, Npg, Trp, Tyr, Lys, Prool, Alaol, Gly, dPro, Asn, Gln, Ala_D3, [mPEG4]Lys, [mPEG8]Lys, [mPEG16]Lys. In some embodiments, X 15 is Ala.
- X 15 comprises a C-terminal group, e.g., ⁇ NH 2 .
- X 15 is GlnR.
- X 15 is Leu.
- X 15 is Val.
- X 15 is Ser.
- X 15 is Thr.
- X 15 is 3Thi.
- X 15 is BztA.
- X 15 is [mPEG37]-Lys.
- X 15 is dVal.
- X 15 is 34ClF.
- X 15 is or comprises a residue of an amino acid or a moiety selected from Table A-IV.
- p16 is 1. In some embodiments, p16 is 0.
- Various types of amino acid residues can be used for X 16 , e.g., a residue of an amino acid of formula A-I, A-II, A-III, A-IV, A-V, A-VI, etc. or a salt thereof in accordance with the present disclosure.
- X 16 is ⁇ N(R a1 ) ⁇ L a1 ⁇ C(R a2 )(R a3 ) ⁇ L a2 ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, X 16 is ⁇ N(R a1 ) ⁇ C(R a2 )(R a3 ) ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, X 16 is ⁇ N(R a1 ) ⁇ C(R a2 )H ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, R a1 is ⁇ H.
- R a3 is ⁇ H.
- Various types of amino acid residues can be used for X 16 .
- X 16 is a residue of Ser, Ala, Glu, Aib, Asp, Thr, or aThr.
- X 16 is a polar amino acid residue as described herein, e.g., those described for X 2 , X 5 , X 6 , etc.
- X 16 is Thr.
- X 16 is ⁇ Ser.
- X 16 is aThr.
- X 16 is a hydrophobic amino acid residue as described herein, e.g., those described for X 3 , X 8 , etc.
- X 16 is Ala.
- X 16 is Leu.
- X 16 is Val.
- X 16 is Aib.
- X 16 is dAla.
- X 16 is dLeu.
- X 16 is an acidic amino acid residue as described herein, e.g., those described for X 2 , X 5 , X 6 , etc.
- X 16 is Glu.
- X 16 is Asp. [0582] In some embodiments, X 16 is Ala, Ser, Glu, GlnR, BztA, Thr, Aib, Asp, Lys, aThr, Val, or Arg. In some embodiments, X 16 comprises a C-terminal group, e.g., NH 2 , OH, Serol, NHEt, NHMe, dAlaol, etc. [0583] In some embodiments, X 16 is or comprises a residue of an amino acid or a moiety selected from Table A-IV. [0584] In some embodiments, p17 is 1. In some embodiments, p17 is 0.
- X 17 Various types of amino acid residues can be used for X 17 , e.g., a residue of an amino acid of formula A-I, A-II, A-III, A-IV, A-V, A-VI, etc. or a salt thereof in accordance with the present disclosure.
- X 17 is ⁇ N(R a1 ) ⁇ L a1 ⁇ C(R a2 )(R a3 ) ⁇ L a2 ⁇ C(O) ⁇ , wherein each variable is independently as described herein.
- X 17 is ⁇ N(R a1 ) ⁇ C(R a2 )(R a3 ) ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, X 17 is ⁇ N(R a1 ) ⁇ C(R a2 )H ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, R a1 is ⁇ H. In some embodiments, R a3 is ⁇ H. [0586] In some embodiments, X 17 is a hydrophobic amino acid residue as described herein, e.g., those described for X 3 , X 8 , etc.
- X 17 is a residue of Ala or Leu. In some embodiments, X 17 is a residue of Ala. In some embodiments, X 17 is a residue of Leu. [0587] In some embodiments, X 17 is Ala, Leu, GlnR, GlnR, Pro, Thr, Val, Lys, Arg, [Ac]Lys, [mPEG4]Lys, [mPEG8]Lys, or [mPEG16]Lys. In some embodiments, X 17 comprises a C-terminal group, e.g., NH 2 , NHEt, OH, etc. In some embodiments, X 17 is [Ac-dPEG2]-Lys.
- X 17 is [Ac-PEG8]-Lys. In some embodiments, X 17 is [Oct-dPEG2]-Lys. In some embodiments, X 17 is [Oct-PEG8]- Lys. In some embodiments, X 17 is [C18-dPEG2]-Lys. In some embodiments, X 17 is [C18-PEG8]-Lys. In some embodiments, X 17 is [AdamantC-dPEG2]-Lys. In some embodiments, X 17 is [AdamantC-PEG8]-Lys. In some embodiments, X 17 is [lithocholate-dPEG2]-Lys.
- X 17 is [lithocholate-PEG8]- Lys. [0588] In some embodiments, X 17 is or comprises a residue of an amino acid or a moiety selected from Table A-IV. [0589] In some embodiments, X 17 comprises a polar side chain. In some embodiments, it is a polar amino acid residue as described herein. In some embodiments, X 17 comprises a non-polar side chain. In some embodiments, X 17 comprises a hydrophobic side chain. In some embodiments, it is a hydrophobic amino acid residue as described herein. In some embodiments, X 17 comprises an aliphatic side chain. In some embodiments, X 17 comprises an alkyl side chain.
- a side chain of X 17 is C 1-10 alkyl.
- X 17 comprises a side chain comprising an optionally substituted aromatic group. In some embodiments, it is an aromatic amino acid residue as described herein.
- X 17 comprises a side chain comprising an acidic group, e.g., ⁇ COOH. In some embodiments, it is an acidic amino acid residue as described herein.
- X 17 comprises a side chain comprising a basic group, e.g., ⁇ N(R) 2 . In some embodiments, it is a basic amino acid residue as described herein.
- X 17 comprises a detectable moiety such as a fluorescent moiety.
- X 17 is Ala, dAla, or Leu. In some embodiments, X 17 is Ala. In some embodiments, X 17 is dAla. In some embodiments, X 17 is Leu. [0590] In some embodiments, X 17 is or comprises a residue of an amino acid or a moiety selected from Table A-IV. [0591] In some embodiments, p17 is 1. In some embodiments, p17 is 0. [0592] Various types of amino acid residues can be used for X 18 , e.g., a residue of an amino acid of formula A-I, A-II, A-III, A-IV, A-V, A-VI, etc.
- X 18 is ⁇ N(R a1 ) ⁇ L a1 ⁇ C(R a2 )(R a3 ) ⁇ L a2 ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, X 18 is ⁇ N(R a1 ) ⁇ C(R a2 )(R a3 ) ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, X 18 is ⁇ N(R a1 ) ⁇ C(R a2 )H ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, R a1 is ⁇ H.
- R a3 is ⁇ H.
- X 18 comprises a polar side chain. In some embodiments, it is a polar amino acid residue as described herein. In some embodiments, X 18 comprises a non-polar side chain. In some embodiments, X 18 comprises a hydrophobic side chain. In some embodiments, it is a hydrophobic amino acid residue as described herein. In some embodiments, X 18 comprises an aliphatic side chain. In some embodiments, X 18 comprises an alkyl side chain. In some embodiments, a side chain of X 18 is C 1-10 alkyl. In some embodiments, X 18 comprises a side chain comprising an optionally substituted aromatic group.
- X 18 comprises a side chain comprising an acidic group, e.g., ⁇ COOH. In some embodiments, it is an acidic amino acid residue as described herein. In some embodiments, X 18 comprises a side chain comprising a basic group, e.g., ⁇ N(R) 2 . In some embodiments, it is a basic amino acid residue as described herein. In some embodiments, X 18 comprises a detectable moiety such as a fluorescent moiety. In some embodiments, X 18 is Aib, Ala, or Leu. In some embodiments, X 18 is Ala or Leu. In some embodiments, X 18 is Aib.
- X 18 is Ala. In some embodiments, X 18 is Leu. In some embodiments, X 18 is Pro. In some embodiments, X 18 is [Ac]Lys. In some embodiments, X 18 is [mPEG4]Lys. In some embodiments, X 18 is [mPEG8]Lys. In some embodiments, X 18 is [mPEG16]Lys. In some embodiments, X 18 is Thr. In some embodiments, X 18 is GlnR. In some embodiments, X 18 is [mPEG37]Lys. In some embodiments, X 18 is [PEG4triPEG16]Lys.
- X 18 is [PEG4triPEG36]Lys. In some embodiments, X 18 comprises a C-terminal group as described herein. [0594] In some embodiments, X 18 is or comprises a residue of an amino acid or a moiety selected from Table A-IV. [0595] In some embodiments, p18 is 1. In some embodiments, p18 is 0. [0596] Various types of amino acid residues can be used for X 19 , e.g., a residue of an amino acid of formula A-I, A-II, A-III, A-IV, A-V, A-VI, etc. or a salt thereof in accordance with the present disclosure.
- X 19 is ⁇ N(R a1 ) ⁇ L a1 ⁇ C(R a2 )(R a3 ) ⁇ L a2 ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, X 19 is ⁇ N(R a1 ) ⁇ C(R a2 )(R a3 ) ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, X 19 is ⁇ N(R a1 ) ⁇ C(R a2 )H ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, R a1 is ⁇ H.
- R a3 is ⁇ H.
- X 19 comprises a polar side chain. In some embodiments, it is a polar amino acid residue as described herein. In some embodiments, X 19 comprises a non-polar side chain. In some embodiments, X 19 comprises a hydrophobic side chain. In some embodiments, it is a hydrophobic amino acid residue as described herein. In some embodiments, X 19 comprises an aliphatic side chain. In some embodiments, X 19 comprises an alkyl side chain. In some embodiments, a side chain of X 19 is C 1-10 alkyl. In some embodiments, X 19 comprises a side chain comprising an optionally substituted aromatic group.
- X 19 comprises a side chain comprising an acidic group, e.g., ⁇ COOH. In some embodiments, it is an acidic amino acid residue as described herein. In some embodiments, X 19 comprises a side chain comprising a basic group, e.g., ⁇ N(R) 2 . In some embodiments, it is a basic amino acid residue as described herein. In some embodiments, X 19 comprises a detectable moiety such as a fluorescent moiety. In some embodiments, X 19 is Aib, Ala, or Leu. In some embodiments, X 19 is Ala or Leu. In some embodiments, X 19 is Aib.
- X 19 is Ala. In some embodiments, X 19 is Leu. In some embodiments, X 19 is Thr. In some embodiments, X 19 is Val. In some embodiments, X 19 is Pro. [0598] In some embodiments, X 19 is or comprises a residue of an amino acid or a moiety selected from Table A-IV. [0599] In some embodiments, p19 is 1. In some embodiments, p19 is 0. [0600] Various types of amino acid residues can be used for X 20 , e.g., a residue of an amino acid of formula A-I, A-II, A-III, A-IV, A-V, A-VI, etc. or a salt thereof in accordance with the present disclosure.
- X 20 is ⁇ N(R a1 ) ⁇ L a1 ⁇ C(R a2 )(R a3 ) ⁇ L a2 ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, X 20 is ⁇ N(R a1 ) ⁇ C(R a2 )(R a3 ) ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, X 20 is ⁇ N(R a1 ) ⁇ C(R a2 )H ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, R a1 is ⁇ H.
- R a3 is ⁇ H.
- X 20 comprises a polar side chain. In some embodiments, it is a polar amino acid residue as described herein. In some embodiments, X 20 comprises a non-polar side chain. In some embodiments, X 20 comprises a hydrophobic side chain. In some embodiments, it is a hydrophobic amino acid residue as described herein. In some embodiments, X 20 comprises an aliphatic side chain. In some embodiments, X 20 comprises an alkyl side chain. In some embodiments, a side chain of X 20 is C 1-10 alkyl. In some embodiments, X 20 comprises a side chain comprising an optionally substituted aromatic group.
- X 20 comprises a side chain comprising an acidic group, e.g., ⁇ COOH. In some embodiments, it is an acidic amino acid residue as described herein. In some embodiments, X 20 comprises a side chain comprising a basic group, e.g., ⁇ N(R) 2 . In some embodiments, it is a basic amino acid residue as described herein. In some embodiments, X 20 comprises a detectable moiety such as a fluorescent moiety. In some embodiments, X 20 is Aib, Ala, or Leu. In some embodiments, X 20 is Ala or Leu. In some embodiments, X 20 is Aib.
- X 20 is Ala. In some embodiments, X 20 is Leu. In some embodiments, X 20 is Lys. In some embodiments, X 20 is nLeu. In some embodiments, X 20 is Val. In some embodiments, X 20 is Arg. [0602] In some embodiments, X 20 is or comprises a residue of an amino acid or a moiety selected from Table A-IV. [0603] In some embodiments, p20 is 1. In some embodiments, p20 is 0.
- X 21 Various types of amino acid residues can be used for X 21 , e.g., a residue of an amino acid of formula A-I, A-II, A-III, A-IV, A-V, A-VI, etc. or a salt thereof in accordance with the present disclosure.
- X 21 is ⁇ N(R a1 ) ⁇ L a1 ⁇ C(R a2 )(R a3 ) ⁇ L a2 ⁇ C(O) ⁇ , wherein each variable is independently as described herein.
- X 21 is ⁇ N(R a1 ) ⁇ C(R a2 )(R a3 ) ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, X 21 is ⁇ N(R a1 ) ⁇ C(R a2 )H ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, R a1 is ⁇ H. In some embodiments, R a3 is ⁇ H. [0605] In some embodiments, X 21 comprises a polar side chain. In some embodiments, it is a polar amino acid residue as described herein. In some embodiments, X 21 comprises a non-polar side chain.
- X 21 comprises a hydrophobic side chain. In some embodiments, it is a hydrophobic amino acid residue as described herein. In some embodiments, X 21 comprises an aliphatic side chain. In some embodiments, X 21 comprises an alkyl side chain. In some embodiments, a side chain of X 21 is C 1-10 alkyl. In some embodiments, X 21 comprises a side chain comprising an optionally substituted aromatic group. In some embodiments, it is an aromatic amino acid residue as described herein. In some embodiments, X 21 comprises a side chain comprising an acidic group, e.g., ⁇ COOH. In some embodiments, it is an acidic amino acid residue as described herein.
- X 21 comprises a side chain comprising a basic group, e.g., ⁇ N(R) 2 . In some embodiments, it is a basic amino acid residue as described herein. In some embodiments, X 21 comprises a detectable moiety such as a fluorescent moiety. In some embodiments, X 21 is Aib, Ala, or Leu. In some embodiments, X 21 is Ala or Leu. In some embodiments, X 21 is Aib. In some embodiments, X 21 is Ala. In some embodiments, X 21 is Leu. In some embodiments, X 21 is Lys. In some embodiments, X 21 is nLeu. In some embodiments, X 21 is Arg.
- X 21 is or comprises a residue of an amino acid or a moiety selected from Table A-IV. [0607] In some embodiments, p21 is 1. In some embodiments, p21 is 0. [0608] Various types of amino acid residues can be used for X 22 , e.g., a residue of an amino acid of formula A-I, A-II, A-III, A-IV, A-V, A-VI, etc. or a salt thereof in accordance with the present disclosure.
- X 22 is ⁇ N(R a1 ) ⁇ L a1 ⁇ C(R a2 )(R a3 ) ⁇ L a2 ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, X 22 is ⁇ N(R a1 ) ⁇ C(R a2 )(R a3 ) ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, X 22 is ⁇ N(R a1 ) ⁇ C(R a2 )H ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, R a1 is ⁇ H.
- R a3 is ⁇ H.
- X 22 comprises a polar side chain. In some embodiments, it is a polar amino acid residue as described herein. In some embodiments, X 22 comprises a non-polar side chain. In some embodiments, X 22 comprises a hydrophobic side chain. In some embodiments, it is a hydrophobic amino acid residue as described herein. In some embodiments, X 22 comprises an aliphatic side chain. In some embodiments, X 22 comprises an alkyl side chain. In some embodiments, a side chain of X 22 is C 1-10 alkyl. In some embodiments, X 22 comprises a side chain comprising an optionally substituted aromatic group.
- X 22 comprises a side chain comprising an acidic group, e.g., ⁇ COOH. In some embodiments, it is an acidic amino acid residue as described herein. In some embodiments, X 22 comprises a side chain comprising a basic group, e.g., ⁇ N(R) 2 . In some embodiments, it is a basic amino acid residue as described herein. In some embodiments, X 22 comprises a detectable moiety such as a fluorescent moiety. In some embodiments, X 22 is Aib, Ala, or Leu. In some embodiments, X 22 is Ala or Leu. In some embodiments, X 22 is Aib.
- X 22 is Ala. In some embodiments, X 22 is Leu. In some embodiments, X 22 is Lys. [0610] In some embodiments, X 22 is or comprises a residue of an amino acid or a moiety selected from Table A-IV. [0611] In some embodiments, p22 is 1. In some embodiments, p22 is 0. [0612] Various types of amino acid residues can be used for X 23 , e.g., a residue of an amino acid of formula A-I, A-II, A-III, A-IV, A-V, A-VI, etc. or a salt thereof in accordance with the present disclosure.
- X 23 is ⁇ N(R a1 ) ⁇ L a1 ⁇ C(R a2 )(R a3 ) ⁇ L a2 ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, X 23 is ⁇ N(R a1 ) ⁇ C(R a2 )(R a3 ) ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, X 23 is ⁇ N(R a1 ) ⁇ C(R a2 )H ⁇ C(O) ⁇ , wherein each variable is independently as described herein. In some embodiments, R a1 is ⁇ H.
- R a3 is ⁇ H.
- X 23 comprises a polar side chain. In some embodiments, it is a polar amino acid residue as described herein. In some embodiments, X 23 comprises a non-polar side chain. In some embodiments, X 23 comprises a hydrophobic side chain. In some embodiments, it is a hydrophobic amino acid residue as described herein. In some embodiments, X 23 comprises an aliphatic side chain. In some embodiments, X 23 comprises an alkyl side chain. In some embodiments, a side chain of X 23 is C 1-10 alkyl. In some embodiments, X 23 comprises a side chain comprising an optionally substituted aromatic group.
- X 23 comprises a side chain comprising an acidic group, e.g., ⁇ COOH. In some embodiments, it is an acidic amino acid residue as described herein. In some embodiments, X 23 comprises a side chain comprising a basic group, e.g., ⁇ N(R) 2 . In some embodiments, it is a basic amino acid residue as described herein. In some embodiments, X 23 comprises a detectable moiety such as a fluorescent moiety. In some embodiments, X 23 is Aib, Ala, or Leu. In some embodiments, X 23 is Ala or Leu. In some embodiments, X 23 is Aib.
- X 23 is Ala. In some embodiments, X 23 is Leu. [0614] In some embodiments, X 23 is or comprises a residue of an amino acid or a moiety selected from Table A-IV. [0615] In some embodiments, p23 is 1. In some embodiments, p23 is 0.
- an agent is or comprises a peptide having the structure of: R N ⁇ [X] p ⁇ [X 0 ] p0 X 1 X 2 X 3 X 4 X 5 X 6 X 7 X 8 X 9 X 10 X 11 X 12 X 13 X 14 [X 15 ] p15 [X 16 ] p16 [X 17 ] p17 ⁇ [X] p’ ⁇ R C , or a salt thereof, wherein: each X is independently an amino acid residue; each p and p’ is independently 0-10; R N is independently a peptide, an amino protecting group or R’ ⁇ L RN ⁇ ; R C is independently a peptide, a carboxyl protecting group, ⁇ L RC ⁇ R’, ⁇ O ⁇ L RC ⁇ R’ or ⁇ N(R’) ⁇ L RC ⁇ R’; each of L RN and L RC is independently L; each L is independently a
- p is 0. In some embodiments, p is 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10. In some embodiments, p is 1. In some embodiments, p is 2. In some embodiments, p is 3. In some embodiments, p is 4. In some embodiments, p is 5. In some embodiments, p is 6. In some embodiments, p is 7. In some embodiments, p is 8. In some embodiments, p is 9. In some embodiments, p is 10. [0618] In some embodiments, p’ is 0. In some embodiments, p’ is 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10. In some embodiments, p’ is 1. In some embodiments, p’ is 2. In some embodiments, p’ is 3.
Landscapes
- Chemical & Material Sciences (AREA)
- Health & Medical Sciences (AREA)
- Organic Chemistry (AREA)
- Life Sciences & Earth Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Biochemistry (AREA)
- Molecular Biology (AREA)
- Genetics & Genomics (AREA)
- Biophysics (AREA)
- Veterinary Medicine (AREA)
- Animal Behavior & Ethology (AREA)
- Pharmacology & Pharmacy (AREA)
- Public Health (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Epidemiology (AREA)
- Toxicology (AREA)
- Zoology (AREA)
- Gastroenterology & Hepatology (AREA)
- Analytical Chemistry (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Medicines Containing Material From Animals Or Micro-Organisms (AREA)
Priority Applications (9)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| BR112023025528A BR112023025528A2 (pt) | 2021-06-08 | 2022-06-08 | Peptídeos grampeados e métodos destes |
| US18/568,212 US20240360179A1 (en) | 2021-06-08 | 2022-06-08 | Stapled peptides and methods thereof |
| JP2023575560A JP2024522368A (ja) | 2021-06-08 | 2022-06-08 | ステープルペプチドおよびその方法 |
| CA3218824A CA3218824A1 (en) | 2021-06-08 | 2022-06-08 | Stapled peptides and methods thereof |
| IL308790A IL308790A (en) | 2021-06-08 | 2022-06-08 | Clamped peptides and their methods |
| EP22820994.6A EP4355350A4 (en) | 2021-06-08 | 2022-06-08 | STAPLED PEPTIDES AND RELATED USES |
| KR1020237042998A KR20240031957A (ko) | 2021-06-08 | 2022-06-08 | 스테이플화된 펩티드 및 이의 방법 |
| CN202280053893.9A CN117794560A (zh) | 2021-06-08 | 2022-06-08 | 订书钉化肽及其方法 |
| MX2023014679A MX2023014679A (es) | 2021-06-08 | 2022-06-08 | Peptidos grapados y metodos para su obtencion. |
Applications Claiming Priority (6)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US202163208487P | 2021-06-08 | 2021-06-08 | |
| US63/208,487 | 2021-06-08 | ||
| US202163224834P | 2021-07-22 | 2021-07-22 | |
| US63/224,834 | 2021-07-22 | ||
| US202263303952P | 2022-01-27 | 2022-01-27 | |
| US63/303,952 | 2022-01-27 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2022261257A1 true WO2022261257A1 (en) | 2022-12-15 |
Family
ID=84425507
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2022/032738 Ceased WO2022261257A1 (en) | 2021-06-08 | 2022-06-08 | Stapled peptides and methods thereof |
Country Status (9)
| Country | Link |
|---|---|
| US (1) | US20240360179A1 (https=) |
| EP (1) | EP4355350A4 (https=) |
| JP (1) | JP2024522368A (https=) |
| KR (1) | KR20240031957A (https=) |
| BR (1) | BR112023025528A2 (https=) |
| CA (1) | CA3218824A1 (https=) |
| IL (1) | IL308790A (https=) |
| MX (1) | MX2023014679A (https=) |
| WO (1) | WO2022261257A1 (https=) |
Cited By (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US11834482B2 (en) | 2017-09-07 | 2023-12-05 | Fog Pharmaceuticals, Inc. | Agents modulating beta-catenin functions and methods thereof |
| WO2024130218A1 (en) * | 2022-12-15 | 2024-06-20 | Fog Pharmaceuticals, Inc. | Stapled peptides and methods thereof |
| WO2024130217A1 (en) * | 2022-12-15 | 2024-06-20 | Fog Pharmaceuticals, Inc. | Stapled peptides and methods thereof |
| WO2024130224A3 (en) * | 2022-12-16 | 2024-10-31 | Purdue Research Foundation | Stapled peptides for sensitization of cancer to treatment |
| WO2024254017A3 (en) * | 2023-06-06 | 2025-04-24 | Parabilis Medicines, Inc. | Stapled peptides and methods thereof |
| US12398178B2 (en) | 2018-08-20 | 2025-08-26 | Parabilis Medicines, Inc. | Collections of peptides, peptide agents, and methods of use thereof |
| WO2025265097A1 (en) * | 2024-06-20 | 2025-12-26 | Parabilis Medicines, Inc. | Stapled peptides and methods thereof |
Citations (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2010068684A2 (en) * | 2008-12-09 | 2010-06-17 | Dana Farber Cancer Institute, Inc. | Methods and compositions for specific modulation of mcl-1 |
| US20170152286A1 (en) * | 2015-12-01 | 2017-06-01 | The University Of Hong Kong | Stapled helical peptides and methods of synthesis |
| US20170342108A1 (en) * | 2014-11-28 | 2017-11-30 | Seoul National University R&Db Foundation | Cell penetrating stapled peptide, manufacturing method therefor, and use thereof |
| US20200247858A1 (en) * | 2017-09-07 | 2020-08-06 | Fog Pharmaceuticals, Inc. | Agents modulating beta-catenin functions and methods thereof |
| US20200276323A1 (en) * | 2017-10-27 | 2020-09-03 | Ohio State Innovation Foundation | Polypeptide conjugates for intracellular delivery of stapled peptides |
Family Cites Families (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2012040459A2 (en) * | 2010-09-22 | 2012-03-29 | President And Fellows Of Harvard College | Beta-catenin targeting peptides and uses thereof |
| EP3391898A3 (en) * | 2013-03-13 | 2019-02-13 | President and Fellows of Harvard College | Stapled and stitched polypeptides and uses thereof |
| MX2021001943A (es) * | 2018-08-20 | 2021-07-15 | Fog Pharmaceuticals Inc | Colecciones de péptidos, agentes peptídicos y métodos de uso de los mismos. |
| AU2021314310A1 (en) * | 2020-07-22 | 2023-03-16 | Fog Pharmaceuticals, Inc. | Stapled peptides and methods thereof |
-
2022
- 2022-06-08 KR KR1020237042998A patent/KR20240031957A/ko active Pending
- 2022-06-08 EP EP22820994.6A patent/EP4355350A4/en active Pending
- 2022-06-08 US US18/568,212 patent/US20240360179A1/en active Pending
- 2022-06-08 IL IL308790A patent/IL308790A/en unknown
- 2022-06-08 CA CA3218824A patent/CA3218824A1/en active Pending
- 2022-06-08 BR BR112023025528A patent/BR112023025528A2/pt unknown
- 2022-06-08 JP JP2023575560A patent/JP2024522368A/ja active Pending
- 2022-06-08 MX MX2023014679A patent/MX2023014679A/es unknown
- 2022-06-08 WO PCT/US2022/032738 patent/WO2022261257A1/en not_active Ceased
Patent Citations (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2010068684A2 (en) * | 2008-12-09 | 2010-06-17 | Dana Farber Cancer Institute, Inc. | Methods and compositions for specific modulation of mcl-1 |
| US20170342108A1 (en) * | 2014-11-28 | 2017-11-30 | Seoul National University R&Db Foundation | Cell penetrating stapled peptide, manufacturing method therefor, and use thereof |
| US20170152286A1 (en) * | 2015-12-01 | 2017-06-01 | The University Of Hong Kong | Stapled helical peptides and methods of synthesis |
| US20200247858A1 (en) * | 2017-09-07 | 2020-08-06 | Fog Pharmaceuticals, Inc. | Agents modulating beta-catenin functions and methods thereof |
| US20200276323A1 (en) * | 2017-10-27 | 2020-09-03 | Ohio State Innovation Foundation | Polypeptide conjugates for intracellular delivery of stapled peptides |
Non-Patent Citations (1)
| Title |
|---|
| See also references of EP4355350A4 * |
Cited By (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US11834482B2 (en) | 2017-09-07 | 2023-12-05 | Fog Pharmaceuticals, Inc. | Agents modulating beta-catenin functions and methods thereof |
| US12398178B2 (en) | 2018-08-20 | 2025-08-26 | Parabilis Medicines, Inc. | Collections of peptides, peptide agents, and methods of use thereof |
| WO2024130218A1 (en) * | 2022-12-15 | 2024-06-20 | Fog Pharmaceuticals, Inc. | Stapled peptides and methods thereof |
| WO2024130217A1 (en) * | 2022-12-15 | 2024-06-20 | Fog Pharmaceuticals, Inc. | Stapled peptides and methods thereof |
| WO2024130224A3 (en) * | 2022-12-16 | 2024-10-31 | Purdue Research Foundation | Stapled peptides for sensitization of cancer to treatment |
| WO2024254017A3 (en) * | 2023-06-06 | 2025-04-24 | Parabilis Medicines, Inc. | Stapled peptides and methods thereof |
| WO2025265097A1 (en) * | 2024-06-20 | 2025-12-26 | Parabilis Medicines, Inc. | Stapled peptides and methods thereof |
Also Published As
| Publication number | Publication date |
|---|---|
| CA3218824A1 (en) | 2022-12-15 |
| US20240360179A1 (en) | 2024-10-31 |
| KR20240031957A (ko) | 2024-03-08 |
| IL308790A (en) | 2024-01-01 |
| BR112023025528A2 (pt) | 2024-02-27 |
| EP4355350A1 (en) | 2024-04-24 |
| MX2023014679A (es) | 2024-01-15 |
| JP2024522368A (ja) | 2024-06-18 |
| EP4355350A4 (en) | 2025-10-01 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| EP4355350A1 (en) | Stapled peptides and methods thereof | |
| JP6629218B2 (ja) | N−ベンジルトリプタンスリン誘導体、ならびにその調製方法および利用 | |
| CN113795251B (zh) | 酪蛋白水解蛋白酶p功能作为药物对imipridone样试剂响应的生物标志物的用途 | |
| CN117247382A (zh) | 吡啶并嘧啶酮化合物的晶型 | |
| WO2022020652A2 (en) | Stapled peptides and methods thereof | |
| JP2016535788A5 (https=) | ||
| BR112020004555A2 (pt) | agentes que modulam funções de beta-catenina e métodos dos mesmos | |
| Hu et al. | Discovery of highly potent and efficient CBP/p300 degraders with strong in vivo antitumor activity | |
| CA3110082A1 (en) | Collections of peptides, peptide agents, and methods of use thereof | |
| ES2943092T3 (es) | Sal que sirve como inhibidor de Akt y cristal de la misma | |
| WO2024130217A1 (en) | Stapled peptides and methods thereof | |
| WO2024130218A1 (en) | Stapled peptides and methods thereof | |
| JP2025514805A (ja) | 化合物及び使用 | |
| CN114173878A (zh) | 拟肽大环化合物及其用途 | |
| CN119462666B (zh) | 一种杂环化合物及其应用 | |
| CN117794560A (zh) | 订书钉化肽及其方法 | |
| WO2025265097A1 (en) | Stapled peptides and methods thereof | |
| HK40108355A (zh) | 订书钉化肽及其方法 | |
| HK40128981A (zh) | 订书钉化肽及其方法 | |
| HK40129655A (zh) | 订书钉化肽及其方法 | |
| WO2024199146A1 (zh) | 萘并异噁唑类化合物的制备方法 | |
| EP4644374A1 (en) | Naphthylamide compound, and preparation method therefor and use thereof | |
| WO2024255837A1 (zh) | 一种enpp1抑制剂的晶型 | |
| JP2024546110A (ja) | P53ペプチド模倣大環状分子 | |
| CN121620379A (zh) | 订书钉化肽及其方法 |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 22820994 Country of ref document: EP Kind code of ref document: A1 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 3218824 Country of ref document: CA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 308790 Country of ref document: IL |
|
| ENP | Entry into the national phase |
Ref document number: 2023575560 Country of ref document: JP Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: MX/A/2023/014679 Country of ref document: MX |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112023025528 Country of ref document: BR |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 202393552 Country of ref document: EA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 11202308811Q Country of ref document: SG |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 202417000467 Country of ref document: IN |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2022820994 Country of ref document: EP |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2022820994 Country of ref document: EP Effective date: 20240108 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 202280053893.9 Country of ref document: CN |
|
| ENP | Entry into the national phase |
Ref document number: 112023025528 Country of ref document: BR Kind code of ref document: A2 Effective date: 20231205 |