WO2022164789A1 - Tricyclic compounds useful in the treatment of cancer, autoimmune and inflammatory disoders - Google Patents
Tricyclic compounds useful in the treatment of cancer, autoimmune and inflammatory disoders Download PDFInfo
- Publication number
- WO2022164789A1 WO2022164789A1 PCT/US2022/013671 US2022013671W WO2022164789A1 WO 2022164789 A1 WO2022164789 A1 WO 2022164789A1 US 2022013671 W US2022013671 W US 2022013671W WO 2022164789 A1 WO2022164789 A1 WO 2022164789A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- compound
- cancer
- associated cancer
- malt1
- subject
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/495—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with two or more nitrogen atoms as the only ring heteroatoms, e.g. piperazine or tetrazines
- A61K31/505—Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim
- A61K31/519—Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim ortho- or peri-condensed with heterocyclic rings
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D487/00—Heterocyclic compounds containing nitrogen atoms as the only ring hetero atoms in the condensed system, not provided for by groups C07D451/00 - C07D477/00
- C07D487/02—Heterocyclic compounds containing nitrogen atoms as the only ring hetero atoms in the condensed system, not provided for by groups C07D451/00 - C07D477/00 in which the condensed system contains two hetero rings
- C07D487/04—Ortho-condensed systems
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/435—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with one nitrogen as the only ring hetero atom
- A61K31/44—Non condensed pyridines; Hydrogenated derivatives thereof
- A61K31/4427—Non condensed pyridines; Hydrogenated derivatives thereof containing further heterocyclic ring systems
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/435—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with one nitrogen as the only ring hetero atom
- A61K31/44—Non condensed pyridines; Hydrogenated derivatives thereof
- A61K31/4427—Non condensed pyridines; Hydrogenated derivatives thereof containing further heterocyclic ring systems
- A61K31/444—Non condensed pyridines; Hydrogenated derivatives thereof containing further heterocyclic ring systems containing a six-membered ring with nitrogen as a ring heteroatom, e.g. amrinone
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/495—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with two or more nitrogen atoms as the only ring heteroatoms, e.g. piperazine or tetrazines
- A61K31/50—Pyridazines; Hydrogenated pyridazines
- A61K31/5025—Pyridazines; Hydrogenated pyridazines ortho- or peri-condensed with heterocyclic ring systems
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K45/00—Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
- A61K45/06—Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D471/00—Heterocyclic compounds containing nitrogen atoms as the only ring hetero atoms in the condensed system, at least one ring being a six-membered ring with one nitrogen atom, not provided for by groups C07D451/00 - C07D463/00
- C07D471/02—Heterocyclic compounds containing nitrogen atoms as the only ring hetero atoms in the condensed system, at least one ring being a six-membered ring with one nitrogen atom, not provided for by groups C07D451/00 - C07D463/00 in which the condensed system contains two hetero rings
- C07D471/04—Ortho-condensed systems
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D491/00—Heterocyclic compounds containing in the condensed ring system both one or more rings having oxygen atoms as the only ring hetero atoms and one or more rings having nitrogen atoms as the only ring hetero atoms, not provided for by groups C07D451/00 - C07D459/00, C07D463/00, C07D477/00 or C07D489/00
- C07D491/12—Heterocyclic compounds containing in the condensed ring system both one or more rings having oxygen atoms as the only ring hetero atoms and one or more rings having nitrogen atoms as the only ring hetero atoms, not provided for by groups C07D451/00 - C07D459/00, C07D463/00, C07D477/00 or C07D489/00 in which the condensed system contains three hetero rings
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D491/00—Heterocyclic compounds containing in the condensed ring system both one or more rings having oxygen atoms as the only ring hetero atoms and one or more rings having nitrogen atoms as the only ring hetero atoms, not provided for by groups C07D451/00 - C07D459/00, C07D463/00, C07D477/00 or C07D489/00
- C07D491/12—Heterocyclic compounds containing in the condensed ring system both one or more rings having oxygen atoms as the only ring hetero atoms and one or more rings having nitrogen atoms as the only ring hetero atoms, not provided for by groups C07D451/00 - C07D459/00, C07D463/00, C07D477/00 or C07D489/00 in which the condensed system contains three hetero rings
- C07D491/20—Spiro-condensed systems
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/573—Immunoassay; Biospecific binding assay; Materials therefor for enzymes or isoenzymes
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/68—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
- G01N33/6863—Cytokines, i.e. immune system proteins modifying a biological response such as cell growth proliferation or differentiation, e.g. TNF, CNF, GM-CSF, lymphotoxin, MIF or their receptors
- G01N33/6869—Interleukin
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
- G01N2333/435—Assays involving biological materials from specific organisms or of a specific nature from animals; from humans
- G01N2333/52—Assays involving cytokines
- G01N2333/54—Interleukins [IL]
- G01N2333/5428—IL-10
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
- G01N2333/90—Enzymes; Proenzymes
- G01N2333/914—Hydrolases (3)
- G01N2333/948—Hydrolases (3) acting on peptide bonds (3.4)
- G01N2333/95—Proteinases, i.e. endopeptidases (3.4.21-3.4.99)
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2800/00—Detection or diagnosis of diseases
- G01N2800/52—Predicting or monitoring the response to treatment, e.g. for selection of therapy based on assay results in personalised medicine; Prognosis
Definitions
- This present application relates to tricyclic, and other multi-cyclic compounds, that are useful for treating proliferative disorders such as cancer, as well as autoimmune and inflammatory disorders.
- MALT1 (mucosa-associated lymphoid tissue lymphoma translocation protein 1) is an intracellular protein involved in lymphocyte proliferation via upstream signaling of NF- allianceB to control lymphocyte activation, survival, proliferation, and differentiation.
- a CARMA or CARD scaffold protein e.g., CARD 11 (caspase recruitment domain family member 11, also known as CARMA1), CARD14 (caspase recruitment domain family member 14, also known as CARMA2), CARD10 (caspase recruitment domain family member 10, also known as CARMA3), or CARD9 (caspase recruitment domain family member 9)
- CARMA or CARD scaffold protein e.g., CARD 11 (caspase recruitment domain family member 11, also known as CARMA1), CARD14 (caspase recruitment domain family member 14, also known as CARMA2), CARD10 (caspase recruitment domain family member 10, also known as CARMA3), or CARD9 (caspase recruitment domain family member 9)
- BCL10 B-cell CLL/Ly
- MALT1 is known to mediate NF-excellentB signaling by at least two mechanisms: firstly, MALT1 functions as a scaffold protein, recruiting NF-excellentB signaling proteins such as TRAF6, TABs (e.g., TAB1, TAB2, TAB3), TAK1 and NEMO-IKK a/0; and secondly, as a cysteine protease, it cleaves and deactivates negative regulators of NF-excellentB signaling, such as RelB, A20, or CYLD. See Rosebeck et al., Science, 2011, 331, 468-472.
- ABS-DLBCLs Activated B cell-like diffuse large B cell lymphomas
- MALT1 protease inhibition can dramatically inhibit growth and promote apoptosis of the highly aggressive ABC type DLBCLs. See Ferch U, et al., J Exp Med 2009, 206, 2313-2320; see also, Hailfmger S, et al., Proc Natl Acad Sci USA 2009, 106, 19946-19951.
- peptide substrates of MALT1, or fusion protein API2-MALT1 include A20, CYLD, BCL10, RelB, regnase-1, roquin-1, NIK, and LIMA la. See Rebeaud et al., Nat Immunol 2008, 9, 272-281; see also, Coomaert et al., Nat Immunol 20008, 9, 263-271; Staal et al., EMBO J 2011, 30, 1742-1752; Hailfinger et al., PNAS 2011, 108, 14596-14601; Jeltsch et al., Nat Immunol 2014, 15, 1079-1089; Uehata et al., Cell 2013, 153, 1036-1049; Nie et al., Nat Commun 2015, 6, 5908; and Baens et al., PLoS ONE 2014, 9, el03774.
- MALT1 has been shown to be involved in several different types of cancers, for example hematological malignancies such as mantle cell lymphoma, chronic lymphocytic leukemia (CLL) and solid tumors such as lung adenocarcinoma, breast cancer, pancreatic cancer, and glioblastoma.
- CLL chronic lymphocytic leukemia
- solid tumors such as lung adenocarcinoma, breast cancer, pancreatic cancer, and glioblastoma.
- MALT1 as an immunomodulatory protein, is also involved in innate and adaptive immunity and may have effects on several inflammatory disorders, e.g., psoriasis, multiple sclerosis, rheumatoid arthritis, Sjogren’s syndrome, ulcerative colitis, and different types of allergic disorders resulting from chronic inflammation. See Afofina et al., FEBS Journal 2015, DOI: 10.1 111/febs.
- the compound of Formula (I) has the structure: or a pharmaceutically acceptable salt thereof, wherein X, Y, Z, Q, n, R 1 , R 2 , R 3 , m, and R 4 are as defined herein.
- composition comprising a compound of Formula (I), or a pharmaceutically acceptable salt thereof, and at least one pharmaceutically acceptable excipient.
- Also provided are methods for treating a MALT1 -associated autoimmune disorder in a subject comprising administering to a subject identified or diagnosed as having a MALT1- associated autoimmune disorder an effective amount of a compound of Formula (I), or a pharmaceutically acceptable salt thereof, or a pharmaceutical composition as described herein.
- Also provided are methods for treating a MALT1 -associated autoimmune disorder in a subject comprising administering to a subject identified or diagnosed as having a MALT1- associated autoimmune disorder an effective amount of a compound of Formula (I), or a pharmaceutically acceptable salt thereof, or a pharmaceutical composition as described herein.
- Also provided are methods for treating a MALT1 -associated autoimmune disorder in a subject comprising administering an effective amount of a compound of Formula (I), or a pharmaceutically acceptable salt thereof, or a pharmaceutical composition as described herein, to a subject determined to have a MALT1 -associated autoimmune disorder.
- Also provided are methods for treating a MALT1 -associated inflammatory disorder in a subject comprising administering to a subject identified or diagnosed as having a MALT1- associated inflammatory disorder an effective amount of a compound of Formula (I), or a pharmaceutically acceptable salt thereof, or a pharmaceutical composition as described herein.
- Also provided are methods for treating a MALT1 -associated inflammatory disorder in a subject comprising administering to a subject identified or diagnosed as having a MALT1- associated inflammatory disorder an effective amount of a compound of Formula (I), or a pharmaceutically acceptable salt thereof, or a pharmaceutical composition as described herein.
- Also provided are methods for treating a MALT1 -associated inflammatory disorder in a subject comprising administering an effective amount of a compound of Formula (I), or a pharmaceutically acceptable salt thereof, or a pharmaceutical composition as described herein, to a subject determined to have a MALT1 -associated inflammatory disorder.
- Also provided are methods for inhibiting CBM complex pathway activity in a mammalian cell comprising contacting the mammalian cell with a compound of Formula (I), or a pharmaceutically acceptable salt thereof.
- Also provided are methods for inhibiting MALT1 protease activity in a mammalian cell comprising contacting the mammalian cell with a compound of Formula (I), or a pharmaceutically acceptable salt thereof.
- Also provided are methods of treating an individual with a MALT1 -associated cancer that include administering a compound of Formula (I), or a pharmaceutically acceptable salt thereof, before, during, or after administration of other anticancer drug(s) (e.g., a first MALT1 inhibitor or another MALT1 inhibitor).
- a compound of Formula (I) or a pharmaceutically acceptable salt thereof, before, during, or after administration of other anticancer drug(s) (e.g., a first MALT1 inhibitor or another MALT1 inhibitor).
- Also provided herein is a process for preparing a compound of Formula (I), or a pharmaceutically acceptable salt thereof.
- Also provided herein is a compound of Formula (I), or a pharmaceutically acceptable salt thereof obtained by a process of preparing the compound as defined herein.
- tautomer refers to compounds whose structures differ markedly in arrangement of atoms, but which exist in easy and rapid equilibrium, and it is to be understood that compounds provided herein may be depicted as different tautomers, and when compounds have tautomeric forms, all tautomeric forms are intended to be within the scope of the disclosure, and the naming of the compounds does not exclude any tautomer.
- tautomeric forms The following is an example of included tautomeric forms:
- certain compounds provided herein may contain one or more centers of asymmetry and may therefore be prepared and isolated in a mixture of isomers such as a racemic mixture, or in an enantiomerically pure form.
- halo refers to one of the halogens, group 17 of the periodic table.
- the term refers to fluorine, chlorine, bromine and iodine.
- the term refers to fluorine or chlorine.
- C1-C6 alkyl refers to a linear or branched hydrocarbon chain containing 1, 2, 3, 4, 5 or 6 carbon atoms, for example methyl, ethyl, n-propyl, iso-propyl, n-butyl, sec-butyl, tertbutyl, n-pentyl and n-hexyl.
- a C1-C3 alkyl group is linear or branched hydrocarbon chain containing 1, 2, or 3 carbon atoms.
- C1-C6 haloalkyl refers to a hydrocarbon chain substituted with at least one halogen atom independently chosen at each occurrence, for example fluorine, chlorine, bromine and iodine.
- the halogen atom may be present at any position on the hydrocarbon chain.
- a C1-C3 haloalkyl group is linear or branched hydrocarbon chain containing 1, 2, or 3 carbon atoms substituted with at least one halogen atom.
- C1-C3 haloalkyl may refer to chloromethyl, fluoromethyl, trifluoromethyl, chloroethyl e.g. 1 -chloroethyl and 2-chloroethyl, tri chloroethyl e.g. 1, 2, 2-tri chloroethyl, 2, 2, 2-tri chloroethyl, fluoroethyl e.g.
- C1-C6 alkoxy refers to a C1-C6 alkyl group which is attached to a molecule via oxygen. This includes moieties where the alkyl part may be linear or branched, such as methoxy, ethoxy, n-propoxy, iso-propoxy, n-butoxy, sec-butoxy, tert-butoxy, n-pentoxy and n- hexoxy.
- C1-C6 haloalkoxy refers to a C1-C6 alkyl group which is attached to a molecule via oxygen and where at least one hydrogen atom of the alkyl group is replaced with a halogen. This includes moieties where the alkyl part may be linear or branched, such as fluoromethoxy, difluoromethoxy, trifluoromethoxy, 2,2,2-trifluoroethoxy, or trifluoropropoxy.
- A represents a single or double bond, valence permitting.
- cyano refers to a -CN radical
- hydroxyl refers to an -OH radical
- amino refers to an -NH2 group.
- aryl refers to a 6-10 all carbon mono- or bicyclic group wherein at least one ring in the system is aromatic.
- Non-limiting examples of aryl groups include phenyl, naphthyl, tetrahydronaphthyl.
- the nonaromatic ring can be a cycloalkyl group, as defined herein.
- heteroaryl refers to a 5-10 membered mono- or bicyclic group wherein at least one ring in the system is aromatic; wherein one or more carbon atoms in at least one ring in the system is/are replaced with an heteroatom independently selected from N, O, and S.
- Heteroaryl groups include rings where one or more atoms are oxidized (e.g., carbon, nitrogen, and sulfur), such as a pyridone moiety.
- Non-limiting examples of heteroaryl groups include pyridine, pyrimidine, pyrrole, imidazole, and indole.
- the non-aromatic ring can be a cycloalkyl or heterocyclyl group, as defined herein.
- cycloalkoxy refers to a saturated or partially unsaturated 3-10 mono- or bicyclic hydrocarbon group connected through an oxy (i.e., -O-); wherein bicyclic systems include fused, spiro (optionally referred to as “spirocycloalkyl” groups), and bridged ring systems.
- spirocycloalkyl groups include fused, spiro (optionally referred to as “spirocycloalkyl” groups), and bridged ring systems.
- Non-limiting examples of cycloalkoxy groups include cyclopropoxy, cyclohexoxy, spiro[2.3]hexoxy, and bicyclo[l.l.l]pentoxy.
- cycloalkyl refers to a saturated or partially unsaturated 3-10 mono- or bicyclic hydrocarbon group; wherein bicyclic systems include fused, spiro (optionally referred to as “spirocycloalkyl” groups), and bridged ring systems.
- spirocycloalkyl groups include cyclopropyl, cyclohexyl, spiro[2.3]hexyl, and bicyclo[l.l.l]pentyl.
- heterocyclyl refers to a saturated or partially unsaturated 3-12 membered hydrocarbon monocyclic or bicyclic ring system, that is not aromatic, having at least one heteroatom within the ring selected from N, O and S.
- Bicyclic heterocyclyl groups include fused, spiro (optionally referred to as “spiroheterocyclyl” groups), and bridged ring systems.
- the heterocyclyl ring system may include oxo substitution at one or more C, N, or S ring members.
- the heterocyclyl group may be denoted as, for example, a “5-10 membered heterocyclyl group,” which is a ring system containing 5, 6, 7, 8, 9 or 10 atoms at least one being a heteroatom.
- heterocyclyl group may be bonded to the rest of the molecule through any carbon atom or through a heteroatom such as nitrogen.
- exemplary heterocyclyl groups include, but are not limited to, piperidinyl, piperazinyl, morpholino, tetrahydropyranyl, azetidinyl, oxetanyl, 2-azaspiro[3.3]heptanyl, pyrrolidin-2-one, sulfolane, isothiazoline S,S-dioxide, and decahydronaphthalenyl.
- geometric refers to substituent atoms or groups attached to the same atom in a molecule.
- the term “vicinal” refers to substituent atoms or groups attached to adjacent atoms in a molecule.
- the stereochemical relationship between the substituent atoms or groups can be cis, trans, undefined, or unresolved.
- the symbol depicts the point of attachment of an atom or moiety to the indicated atom or group in the remainder of the molecule.
- the compounds of Formula (I) include pharmaceutically acceptable salts thereof.
- the compounds of Formula (I) also include other salts of such compounds which are not necessarily pharmaceutically acceptable salts, and which may be useful as intermediates for preparing and/or purifying compounds of Formula (I) and/or for separating enantiomers of compounds of Formula (I).
- Non-limiting examples of pharmaceutically acceptable salts of compounds of Formula (I) include trifluoroacetic acid and hydrochloride salts.
- the compounds of Formula (I) or their salts may be isolated in the form of solvates, and accordingly that any such solvate is included within the scope of the present disclosure.
- compounds of Formula (I) and salts thereof can exist in unsolvated as well as solvated forms with pharmaceutically acceptable solvents such as water, ethanol, and the like.
- the compounds of Formula (I) include the compounds of Examples 1-203 and stereoisomers and pharmaceutically acceptable salts thereof. In some embodiments, the compounds of Formula (I) include the compounds of Examples 1-203 and pharmaceutically acceptable salts thereof. In some embodiments, the compounds of Examples 1-203 are in the free base form. In some embodiments, the compounds of Examples 1-203 are in the form of pharmaceutically acceptable salts.
- pharmaceutically acceptable indicates that the compound, or salt or composition thereof is compatible chemically and/or toxicologically with the other ingredients comprising a formulation and/or the subject being treated therewith.
- Protecting groups can be a temporary substituent which protects a potentially reactive functional group from undesired chemical transformations.
- the choice of the particular protecting group employed is well within the skill of one of ordinary skill in the art. A number of considerations can determine the choice of protecting group including, but not limited to, the functional group being protected, other functionality present in the molecule, reaction conditions at each step of the synthetic sequence, other protecting groups present in the molecule, functional group tolerance to conditions required to remove the protecting group, and reaction conditions for the thermal decomposition of the compounds provided herein.
- the field of protecting group chemistry has been reviewed (Greene, T. W. and Wuts, P. G. M. Protective Groups in Organic Synthesis, 2. sup. ed. Wiley: New York, 1991).
- a nitrogen protecting group can be any temporary substituent which protects an amine moiety from undesired chemical transformations.
- moieties formed when such protecting groups are bonded to an amine include, but are not limited to allylamine, benzylamines (e.g., bezylamine, p- methoxybenzylamine, 2,4-dimethoxybenzylamine, and tritylamine), acetylamide, trichloroacetammide, trifluoroacetamide, pent-4-enamide, phthalimides, carbamates (e.g., methyl carbamate, t-butyl carbamate, benzyl carbamate, allyl carbamates, 2,2,2- tri chloroethyl carbamate, and 9-fluorenylmethyl carbamate), imines, and sulfonamides (e.g., benzene sulfonamide, p-toluenesulfonamide, and p
- An oxygen protecting group can be any temporary substituent which protects a hydroxyl moiety from undesired chemical transformations.
- moieties formed when such protecting groups are bonded to a hydroxyl include, but are not limited to esters (e.g., acetyl, t- butyl carbonyl, and benzoyl), benzyl (e.g., benzyl, p-methoxybenzyl, and 2,4-dimethoxybenzyl, and trityl), carbonates (e.g., methyl carbonate, allyl carbonate, 2,2,2-trichloroethyl carbonate and benzyl carbonate) ketals, and acetals, and ethers.
- esters e.g., acetyl, t- butyl carbonyl, and benzoyl
- benzyl e.g., benzyl, p-methoxybenzyl, and 2,4-dimethoxybenzyl,
- Compounds provided herein may also contain unnatural proportions of atomic isotopes at one or more of the atoms that constitute such compounds. That is, an atom, in particular when mentioned in relation to a compound according to Formula (I), comprises all isotopes and isotopic mixtures of that atom, either naturally occurring or synthetically produced, either with natural abundance or in an isotopically enriched form.
- the compounds provided herein therefore also comprise compounds with one or more isotopes of one or more atoms, and mixtures thereof, including radioactive compounds, wherein one or more non-radioactive atoms has been replaced by one of its radioactive enriched isotopes.
- Radiolabeled compounds are useful as therapeutic agents, e.g., cancer therapeutic agents, research reagents, e.g., assay reagents, and diagnostic agents, e.g., in vivo imaging agents. All isotopic variations of the compounds provided herein, whether radioactive or not, are intended to be encompassed within the scope of the present disclosure.
- IC50 values are shown in Tables A and B.
- MALT1 inhibitors are useful for treating diseases and disorders which can be treated with a MALT1 inhibitor, such as MALT1- associated cancers, including hematological cancers and solid tumors, MALT1 -associated autoimmune disorders, and MALT1 -associated inflammatory disorders.
- treat or “treatment” refer to therapeutic or palliative measures.
- Beneficial or desired clinical results include, but are not limited to, alleviation, in whole or in part, of symptoms associated with a disease or disorder or condition, diminishment of the extent of disease, stabilized (i.e., not worsening) state of disease, delay or slowing of disease progression, amelioration or palliation of the disease state (e.g., one or more symptoms of the disease), and remission (whether partial or total), whether detectable or undetectable.
- Treatment can also mean prolonging survival as compared to expected survival if not receiving treatment.
- the term “subject” refers to any animal, including mammals such as humans. In some embodiments, the subject is a human. In some embodiments, the subject has experienced and/or exhibited at least one symptom of the disease or disorder to be treated and/or prevented.
- the term “pediatric subject” as used herein refers to a subject under the age of 21 years at the time of diagnosis or treatment.
- the term “pediatric” can be further be divided into various subpopulations including: neonates (from birth through the first month of life); infants (1 month up to two years of age); children (two years of age up to 12 years of age); and adolescents (12 years of age through 21 years of age (up to, but not including, the twenty-second birthday)).
- Berhman RE Kliegman R, Arvin AM, Nelson WE. Nelson Textbook of Pediatrics, 15th Ed. Philadelphia: W.B. Saunders Company, 1996; Rudolph AM, et al. Rudolph 's Pediatrics, 21st Ed.
- a pediatric subject is from birth through the first 28 days of life, from 29 days of age to less than two years of age, from two years of age to less than 12 years of age, or 12 years of age through 21 years of age (up to, but not including, the twenty-second birthday).
- a pediatric subject is from birth through the first 28 days of life, from 29 days of age to less than 1 year of age, from one month of age to less than four months of age, from three months of age to less than seven months of age, from six months of age to less than 1 year of age, from 1 year of age to less than 2 years of age, from 2 years of age to less than 3 years of age, from 2 years of age to less than seven years of age, from 3 years of age to less than 5 years of age, from 5 years of age to less than 10 years of age, from 6 years of age to less than 13 years of age, from 10 years of age to less than 15 years of age, or from 15 years of age to less than 22 years of age.
- compounds of Formula (I), or a pharmaceutically acceptable salt thereof are useful for preventing diseases and disorders as defined herein (for example, autoimmune disorders, inflammatory disorders, and cancer).
- diseases and disorders as defined herein (for example, autoimmune disorders, inflammatory disorders, and cancer).
- preventing means the prevention of the onset, recurrence or spread, in whole or in part, of the disease or condition as described herein, or a symptom thereof.
- regulatory agency refers to a country's agency for the approval of the medical use of pharmaceutical agents with the country.
- FDA U.S. Food and Drug Administration
- NF-excellentB is a family of transcription factors, including p50, p52, p65 (RelA), RelB, and c-Rel, which can bindto the kB enhancer element as various homo- and heterodimers to induce transcription of a number of genes.
- a CBM complex is formed via phosphorylation of a CARD or C ARMA protein, likely by a protein kinase C (e.g., protein kinase C beta or protein kinase C theta) and recruitment of the BCL10-MALT1 complex.
- a protein kinase C e.g., protein kinase C beta or protein kinase C theta
- the CBM complex can function as a scaffold protein in the activation of the NF-excellentB pathway.
- the CBM complex can activate the IKK complex (e.g., IKKy (also called NEMO), IKKa, and IKKP), likely by ubiquintination (e.g., K63 -linked ubiquitination) of MALT1, which results in the recruitment, ubiquitination (e.g., K63-linked ubiquitination), and degredation of IKKy, thereby releasing IKKa and IKKP to phosphorylate I MéB, resulting in the ubiquitination (e.g., K48-linked ubiquitination) and degradation of I CongressB, releasing the NF-excellentB transcription factors (typically of the NF-excellentB 1 subtype: p50-RelA and p50-cRel) to the nucleus.
- IKK complex e.g., IKKy (also called NEMO), IKKa, and IKK
- ubiquitin ligase TRAF6 Tumor necrosis factor receptor (TNFR)-associated factor 6
- the CBM complex may also affect NF-excellentB signaling through addtitional protein complexes, such as TAB1/2-TAK and the linear ubiquitin chain assembly complex (LUBAC).
- addtitional protein complexes such as TAB1/2-TAK and the linear ubiquitin chain assembly complex (LUBAC).
- MALT1 can also activate the JNK pathway (also called the JNK/AP-1 pathway), though less work has been done to study this area. See, e.g., Juilland, Front. Immunol. 9 (2016): 1927, and Wang, et al., Oncogenesis 6.7 (2017): e365-e365.
- MALT1 has cysteine protease activity.
- substrates of wild-type MALT1 include BCL10, A20, CYLD, RelB, Regnase 1, roquin-1, and HOILE
- the API2-MALT1 also called cIAP2; amino terminus of inhibitor of apoptosis 2 fusion protein has also been shown to cleave NIK and LIMA1a. BCL10 cleavage by MALT1 is believed to result in BCL10-independent NF-excellentB activation.
- MALT1 can reduce negative regulation of the NF-excellentB pathway, as A20 is a deubiquitinating enzyme that has been suggested to reduce the ubiquitination of MALT1 and thus recruitment and activation of the IKK complex.
- CYLD CYLD Lysine 63 Deubiquitinase
- CYLD CYLD Lysine 63 Deubiquitinase
- Cleavage of RelB typically results in relief of negative regulation of the NF-excellentB pathway, as RelB forms transcriptionally inactive complexes with RelA and c-Rel.
- HOIL1 also known as RBCK1
- MALT1 can also autoprocess, which promotes signaling through the NF-excellentB pathway through a mechanism that is not fully understood.
- NIK NF-excellentB inducing kinase
- the API2-MALT1 protease generates a c-terminal fragment of NIK that is resistant to proteasomal degradation and thereby increases noncanonical NF-excellentB signaling.
- LIMA1a LIM domain and actin-binding protein 1
- MCPIP-1 or Zc3hl2a Regulatory RNase 1
- roquin-1 also known as RC3H1
- mRNAs including those of cytokines, chemokines, and costimulatory proteins such as ICOS, 0X40, and TNF. This activity may be independent of MALT1 activity in the NF-excellentB and JNK pathways.
- MALT1 is also involved in oncogenic BCR signalling in ibrutinib -responsive cell lines and biopsie samples, coordinated by a multiprotein supercomplex formed by MYD88, TLR9 and the BCR (hereafter termed the My-T-BCR supercomplex).
- the My-T-BCR supercomplex co-localizes with mTOR on endolysosomes, where it drives pro-survival NF-excellentB and mTOR signalling. See Phelan et al., Nature 2018 Aug;560(7718):387-391.
- inhibition of MALT1 can provide beneficial effects to many types of disorders associated with aberrant signaling in the NF-excellentB pathway or JNK pathway.
- inhibition of MALT1 can decrease flux through the NF-excellentB or JNK pathways resulting from one or more of:
- tumor suppressor gene An inactivated tumor suppressor gene.
- tumor suppressor genes that can be inactivated include BRCA1 and p53 (e.g., p53 H61L or I123T). See, e.g., Sau, et al. Cell Stem Cell 19.1 (2016): 52-65, Xia, et al. Cancer Immunol. Res. 2.9 (2014): ⁇ 23-830, Johansson, et al. Oncotarget 7.38 (2016): 62627.
- Non-limiting examples of cell surface receptors include HER1 and HER2. See, e.g., Xia, et al. Cancer Immunol. Res. 2.9 (2014): ⁇ 23-830 and Pan, Mol. Cancer Res. 14.1 (2016): 93-102.
- components of a CBM complex include MALT1, CARD11, CARD 14, CARD10, CARD9, and BCL10.
- MALT1 protease e.g., a wild-type MALT1 protease or a dysregulated MALT1 protease
- substrates of a MALT1 protease include BCL10, A20, CYLD, RelB, Regnase 1, roquin-1, HOIL1, NIK, and LIMA la.
- Dysregulation of one or more components of the NF-excellentB pathway downstream of a CBM complex include TRAF6, IKKa, IKK ⁇ , IKKêt (also called NEMO), IkBa, p50, p52, p65 (RelA), RelB, and c-Rel.
- a component of the JNK pathway downstream of a CBM complex include JNK1 (Mitogen -Activated Protein Kinase 8), JNK2 (Mitogen- Activated Protein Kinase 9), JNK3 (Mitogen-Activated Protein Kinase 10), or an AP-1 transcription factor (e.g., a heterodimer of any of the c-Fos, c-Jun, ATF, or JDP families).
- JNK1 Mitogen -Activated Protein Kinase 8
- JNK2 Mitogen- Activated Protein Kinase 9
- JNK3 Mitogen-Activated Protein Kinase 10
- an AP-1 transcription factor e.g., a heterodimer of any of the c-Fos, c-Jun, ATF, or JDP families.
- Dysregulation of one or more fusion proteins caused by chromosome translocation of MALT1 gene includes the cIAP-MALTl fusion protein.
- Dysregulation of one or more components of the My-T-BCR supercomplex include MYD88, TLR9, and mTOR.
- CBM complex pathway includes genes, transcripts, and proteins in a signaling pathway that includes a CBM.
- a CBM complex pathway can include, for example, cell surface receptors (e.g., CD28, BCR, HER1, and HER2), a signal transducer between a cell surface receptor and a CBM complex (e.g, a protein kinase C beta or protein kinase C theta), a component of a CBM complex (e.g., MALT1, CARD11, CARD14, CARD10, CARD9, or BCL10), substrates of a MALT1 protease (e.g., BCL10, A20, CYLD, RelB, Regnase 1, roquin-1, HOIL1, NIK, and LIMA la), a component of the NF-excellentB pathway downstream of a CBM complex (e g., CD28, BCR, HER1, and HER2), a signal transducer between a cell surface receptor
- CBM complex pathway-associated disease or disorder refers to diseases or disorders associated with or having a dysregulation of a gene in a CBM complex pathway, a protein in a CBM complex pathway, or the expression or activity or level of any (e.g., one or more) of the same (e.g., any of the types of dysregulation of a gene in a CBM complex pathway, a protein in a CBM complex pathway, or the expression or activity or level of any of the same, as described herein).
- Non-limiting examples of a CBM complex pathway-associated diseases or disorders include, for example, CBM-related primary immunodeficiency diseases, autoimmune disorders, multiple sclerosis, colitis, psoriasis, and cancer.
- Non-limiting examples of a CBM complex pathway- associated disease or disorder include MALT1 -associated diseases or disorders such as MALT1- associated cancers, MALT1 -associated autoimmune disorders, and MALT1 -associated inflammatory disorders.
- CBM complex pathway-associated autoimmune disorder refers to autoimmune disorders associated with or having a dysregulation of a CBM complex pathway gene, a CBM complex pathway protein, or the expression or activity or level of any (e.g., one or more) of the same (e.g., any of the types of dysregulation of a CBM complex pathway gene, a CBM complex pathway protein, or the expression or activity or level of any of the same described herein).
- a CBM complex pathway-associated autoimmune disorders are described herein.
- CBM complex pathway-associated inflammatory disorder refers to inflammatory disorders associated with or having a dysregulation of a CBM complex pathway gene, a CBM complex pathway protein, or the expression or activity or level of any (e.g., one or more) of the same (e.g., any of the types of dysregulation of a CBM complex pathway gene, a CBM complex pathway protein, or the expression or activity or level of any of the same described herein).
- a CBM complex pathway-associated inflammatory disorders are described herein.
- a CBM complex pathway-associated disease or disorder is a CBM complex pathway-associated cancer, such as a CBM complex pathway cell surface receptor- associated cancer (e.g., a CD28-associated cancer, a BCR-associated cancer, a HER1 -associated cancer, or a HER2-associated cancer), a cancer associated with a signal transducer between a cell surface receptor and a CBM complex (e.g, a protein kinase C beta (PKC ⁇ )-associated cancer or a protein kinase C theta (PCK ⁇ )-associated cancer), a component of a CBM complex-associated cancer (e.g., a MALT1 -associated cancer, a CARD11 -associated cancer, a CARD14-associated cancer, a CARDlO-associated cancer, a CARD9-associated cancer, or a BCL10-associated cancer), a MALT1 protease substrate-associated cancer (e.g., a BCL10-associated cancer, an MALT1 prote
- CBM complex pathway-associated cancer refers to cancers associated with or having a dysregulation of a gene in a CBM complex pathway, a protein in a CBM complex pathway, or the expression or activity or level of any (e.g., one or more) of the same (e.g., any of the types of dysregulation of a gene in a CBM complex pathway, a protein in a CBM complex pathway, or the expression or activity or level of any of the same, as described herein) (e.g., upon diagnosis or after developing resistance to previous therapies.
- Non-limiting examples of a CBM complex pathway-associated cancer are described herein.
- a CBM pathway-associated cancer can be a CBM complex pathway cell surface receptor-associated cancer (e.g., a CD28-associated cancer, a BCR-associated cancer, a HERl- associated cancer, or a HER2-associated cancer), a cancer associated with a signal transducer between a cell surface receptor and a CBM complex (e.g, a protein kinase C beta (PKC ⁇ )- associated cancer or a protein kinase C theta (PCK ⁇ )-associated cancer, a component of a CBM complex-associated cancer (e.g., a MALT1 -associated cancer, a CARD11 -associated cancer, a CARD14-associated cancer, a CARDlO-associated cancer, a CARD9-associated cancer, or a BCL10-associated cancer), a MALT1 protease substrate-associated cancer (e.g., a BCL10- associated cancer, an A20-associated cancer, a CYLD-associated cancer,
- a dysregulation can be a dysregulation that results in aberrant activation of a gene, protein, or expression or activity or level of any of the same. Activation can be through any appropriate mechanism, including, but not limited to, gene amplification, activating mutation, activating translocation, transcriptional activation, epigenetic alteration, and/or overexpression of the protein product of the oncogene. In some embodiments, a dysregulation can be a dysregulation that results in aberrant inactivation of a gene, protein, or expression or activity or level of any of the same.
- Inactivation can be through any appropriate mechanism, including, but not limited to, gene deletion, inactivating mutation, inactivating translocation, transcriptional silencing, epigenetic alteration, and degradation of mRNA and/or protein products of the gene.
- a dysregulation whether it be activation or inactivation, is a dysregulation that results in increased signaling through the NF-excellentB or JNK signaling pathways.
- wild-type describes a nucleic acid (e.g., a MALT1 gene or a MALT1 mRNA) or protein (e.g., a MALT1 protein) that is found in a subject that does not have a disease or disorder associated with the nucleic acid or the protein (e.g., the MALT1 gene, MALT1 mRNA, or MALT1 protein) (and optionally also does not have an increased risk of developing a disease or disorder associated with the nucleic acid or the protein and/or is not suspected of having a disease or disorder associated with the gene or the protein), or is found in a cell or tissue from a subject that does not have a disease or disorder associated with the gene or the protein (e.g., a MALT1- associated cancer, autoimmune disorder, or inflammatory disorder) (and optionally also does not have an increased risk of developing a disease or disorder associated with the nucleic acid or the protein and/or is not suspected of having a disease or disorder associated with the nucleic acid or the protein).
- the subject has been identified or diagnosed as having a cancer with a dysregulation of a CBM complex pathway-associated gene (e.g., a MALT1 gene), a CBM complex pathway-associated protein (e.g., a MALT1 protein), or expression or activity, or level of any of the same (a CBM complex pathway-associated-associated cancer) (e.g., as determined using a regulatory agency -approved, e.g., FDA-approved, assay or kit).
- the subject has has a cancer resistant to one or more previous therapies.
- the subject has a tumor that is positive for a dysregulation of a CBM complex pathway-associated gene (e.g., a MALT1 gene), a CBM complex pathway-associated protein (e.g., a MALT1 protein), or expression or activity, or level of any of the same (e.g., as determined using a regulatory agency- approved, e.g., FDA-approved, assay or kit).
- a CBM complex pathway-associated gene e.g., a MALT1 gene
- a CBM complex pathway-associated protein e.g., a MALT1 protein
- expression or activity e.g., as determined using a regulatory agency- approved, e.g., FDA-approved, assay or kit.
- the subject can be a subject with a tumor(s) that is positive for a dysregulation of a CBM complex pathway-associated gene (e.g., a MALT1 gene), a CBM complex pathway-associated protein (e.g., a MALT1 protein), or expression or activity, or level of any of the same (e.g., identified as positive using a regulatory agency-approved, e.g., FDA- approved, assay or kit).
- a CBM complex pathway-associated gene e.g., a MALT1 gene
- a CBM complex pathway-associated protein e.g., a MALT1 protein
- expression or activity e.g., identified as positive using a regulatory agency-approved, e.g., FDA- approved, assay or kit.
- the subject can be a subject whose tumors have a dysregulation of a CBM complex pathway-associated gene (e.g., a MALT1 gene), a CBM complex pathway-associated protein (e.g., a MALT1 protein), or expression or activity, or a level of the same (e.g., where the tumor is identified as such using a regulatory agency-approved, e.g., FDA-approved, kit or assay).
- the subject has a tumor resistant to one or more previous therapies.
- the subject is suspected of having a CBM complex pathway-associated-associated cancer.
- the subject has a tumor that is suspected of being resistant to one or more previous therapies.
- the subject has a clinical record indicating that the subject has a tumor that has a dysregulation of a CBM complex pathway-associated gene (e.g., a MALT1 gene), a CBM complex pathway-associated protein (e.g., a MALT1 protein), or expression or activity, or level of any of the same (and optionally the clinical record indicates that the subject should be treated with any of the compositions provided herein).
- the subject is a pediatric subject.
- the subject has a clinical record indicating that the subject has a tumor resistant to one or more previous therapies.
- the subject has been identified or diagnosed as having a cancer that, based on histological examination, is determined to be associated with a dysregulation of a CBM complex pathway-associated gene (e.g., aMALTl gene), a CBM complex pathway-associated protein (e.g., a MALT1 protein), or expression or activity, or level of any of the same (a CBM complex pathway- associated-associated cancer).
- a CBM complex pathway-associated gene e.g., aMALTl gene
- a CBM complex pathway-associated protein e.g., a MALT1 protein
- the subject has been identified or diagnosed as having an autoimmune disorder with a dysregulation of a CBM complex pathway-associated gene (e.g., a MALT1 gene), a CBM complex pathway-associated protein (e.g., a MALT1 protein), or expression or activity, or level of any of the same (a CBM complex pathway-associated-associated autoimmune disorder) (e.g., as determined using a regulatory agency-approved, e.g., FDA- approved, assay or kit).
- a CBM complex pathway-associated gene e.g., a MALT1 gene
- a CBM complex pathway-associated protein e.g., a MALT1 protein
- expression or activity e.g., as determined using a regulatory agency-approved, e.g., FDA- approved, assay or kit.
- the subject has a tumor that is positive for a dysregulation of a CBM complex pathway-associated gene (e.g., a MALT1 gene), a CBM complex pathway-associated protein (e.g., a MALT1 protein), or expression or activity, or level of any of the same (e.g., as determined using a regulatory agency -approved, e.g., FDA-approved, assay or kit).
- a CBM complex pathway-associated gene e.g., a MALT1 gene
- a CBM complex pathway-associated protein e.g., a MALT1 protein
- expression or activity e.g., as determined using a regulatory agency -approved, e.g., FDA-approved, assay or kit.
- the subject is suspected of having a CBM complex pathway- associated-associated autoimmune disorder.
- the subject has a clinical record indicating that the subject has a tumor that has a dysregulation of a CBM complex pathway- associated gene (e.g., a MALT1 gene), a CBM complex pathway-associated protein (e.g., a MALT1 protein), or expression or activity, or level of any of the same (and optionally the clinical record indicates that the subject should be treated with any of the compositions provided herein).
- the subject is a pediatric subject.
- the subject has been identified or diagnosed as having an autoimmune disorder that, based on histological examination, is determined to be associated with a dysregulation of a CBM complex pathway- associated gene (e.g., a MALT1 gene), a CBM complex pathway-associated protein (e.g., a MALT1 protein), or expression or activity, or level of any of the same (a CBM complex pathway- associated-associated autoimmune disorder).
- a CBM complex pathway- associated gene e.g., a MALT1 gene
- a CBM complex pathway-associated protein e.g., a MALT1 protein
- the subject has been identified or diagnosed as having an inflammatory disorder with a dysregulation of a CBM complex pathway-associated gene (e.g., a MALT1 gene), a CBM complex pathway-associated protein (e.g., a MALT1 protein), or expression or activity, or level of any of the same (a CBM complex pathway-associated-associated inflammatory disorder) (e.g., as determined using a regulatory agency-approved, e.g., FDA- approved, assay or kit).
- a CBM complex pathway-associated gene e.g., a MALT1 gene
- a CBM complex pathway-associated protein e.g., a MALT1 protein
- expression or activity e.g., as determined using a regulatory agency-approved, e.g., FDA- approved, assay or kit.
- the subject has a tumor that is positive for a dysregulation of a CBM complex pathway-associated gene (e.g., a MALT1 gene), a CBM complex pathway-associated protein (e.g., a MALT1 protein), or expression or activity, or level of any of the same (e.g., as determined using a regulatory agency -approved, e.g., FDA-approved, assay or kit).
- a CBM complex pathway-associated gene e.g., a MALT1 gene
- a CBM complex pathway-associated protein e.g., a MALT1 protein
- expression or activity e.g., as determined using a regulatory agency -approved, e.g., FDA-approved, assay or kit.
- the subject is suspected of having a CBM complex pathway- associated-associated inflammatory disorder.
- the subject has a clinical record indicating that the subject has a tumor that has a dysregulation of a CBM complex pathway- associated gene (e.g., a MALT1 gene), a CBM complex pathway-associated protein (e.g., a MALT1 protein), or expression or activity, or level of any of the same (and optionally the clinical record indicates that the subject should be treated with any of the compositions provided herein).
- the subject is a pediatric subject.
- the subject has been identified or diagnosed as having an inflammatory disorder that, based on histological examination, is determined to be associated with a dysregulation of a CBM complex pathway- associated gene (e.g., a MALT1 gene), a CBM complex pathway-associated protein (e.g., a MALT1 protein), or expression or activity, or level of any of the same (a CBM complex pathway- associated-associated inflammatory disorder).
- a CBM complex pathway- associated gene e.g., a MALT1 gene
- a CBM complex pathway-associated protein e.g., a MALT1 protein
- CBM complex pathway cell surface receptor-associated cancer refers to cancers associated with or having a dysregulation of a gene, a protein, or the expression or activity or level of any (e.g., one or more) of the same associated with a CBM complex pathway cell surface receptor.
- a CBM complex pathway cell surface receptor- associated cancer is selected from the group consisting of a CD28-associated cancer, a BCR- associated cancer, a HER1 -associated cancer, a HER2-associated cancer, and combinations thereof.
- * -associated cancer refers to cancers associated with or having a dysregulation of a * gene, a * protein, or the expression or activity or level of any (e.g., one or more) of the same (e.g., any of the types of dysregulation of a * gene, a * protein, or the expression or activity or level of any of the same described herein), where refers to a particular CBM complex pathway gene or protein, described herein.
- the * -associated cancer is selected from the group consisting of: CD28-associated cancer, BCR-associated cancer, HER1- associated cancer, HER2-associated cancer, PKCP-associated cancer, PKC ⁇ -associated cancer, MALT1 -associated cancer, CARD11 -associated cancer, CARD14-associated cancer, A20- associated cancer, CYLD-associated cancer, RelB-associated cancer, HOIL1 -associated cancer, NIK-associated cancer, Regnase 1-associated cancer, LIMA1a-associated cancer, roquin-1- associated cancer, TRAF6-associated cancer, TAK1 -associated cancer, TAB 1-associated cancer, TAB2-associated cancer, TAB3-associated cancer, MKK7-associated cancer, IKK ⁇ -associated cancer, IKK ⁇ -associated cancer, IKKy-associated cancer, IkB ⁇ -associated cancer, p50-associated cancer, p65 -associated cancer, c-Rel-associated cancer, JNK 1-associated cancer, JNK2-associated cancer, JNK3 -
- the *-associated cancer is a CD28- associated cancer. In some embodiments, the *-associated cancer is a BCR-associated cancer. In some embodiments, the *-associated cancer is a HER1 -associated cancer. In some embodiments, the *-associated cancer is a HER2-associated cancer. In some embodiments, the *-associated cancer is a PKCP-associated cancer. In some embodiments, the *-associated cancer is a PKC9- associated cancer. In some embodiments, the *-associated cancer is a MALT1 -associated cancer. In some embodiments, the *-associated cancer is a CARD11 -associated cancer. In some embodiments, the *-associated cancer is a CARD14-associated cancer.
- the *-associated cancer is an A20-associated cancer. In some embodiments, the *-associated cancer is a CYLD-associated cancer. In some embodiments, the *-associated cancer is a RelB-associated cancer. In some embodiments, the *-associated cancer is a HOIL 1-associated cancer. In some embodiments, the *-associated cancer is a NIK-associated cancer. In some embodiments, the *- associated cancer is a Regnase 1-associated cancer. In some embodiments, the *-associated cancer is a LIMA1a-associated cancer. In some embodiments, the *-associated cancer is a roquin-1- associated cancer. In some embodiments, the *-associated cancer is a TRAF6-associated cancer.
- the *-associated cancer is a TAK 1-associated cancer. In some embodiments, the *-associated cancer is a TAB 1-associated cancer. In some embodiments, the *- associated cancer is a TAB2-associated cancer. In some embodiments, the *-associated cancer is a TAB3-associated cancer. In some embodiments, the *-associated cancer is a MKK7-associated cancer, and an IKKa-associated cancer. In some embodiments, the *-associated cancer is an IKK ⁇ - associated cancer. In some embodiments, the *-associated cancer is an ZKKy-associated cancer. In some embodiments, the *-associated cancer is an IkB ⁇ -associated cancer. In some embodiments, the *-associated cancer is a p50-associated cancer.
- the *-associated cancer is a p65-associated cancer. In some embodiments, the *-associated cancer is a c-Rel-associated cancer. In some embodiments, the *-associated cancer is a JNK1 -associated cancer. In some embodiments, the *-associated cancer is a JNK2-associated cancer. In some embodiments, the *- associated cancer is a JNK3 -associated cancer. In some embodiments, the *-associated cancer is a AP-1 transcription factor-associated cancer. In some embodiments, the *-associated cancer is a MYD88 transcription factor-associated cancer.
- the phrase “dysregulation of a * gene, a * protein, or the expression or activity or level of any of the same” refers to a genetic mutation (e.g., a chromosomal translocation that results in the expression of a fusion protein including a * domain and a fusion partner, a mutation in a * gene that results in the expression of a * protein that includes a deletion of at least one amino acid as compared to a wildtype * protein, a mutation in a * gene that results in the expression of a * protein with one or more point mutations as compared to a wild-type * protein, a mutation in a * gene that results in the expression of a * protein with at least one inserted amino acid as compared to a wild-type * protein, a gene duplication that results in an increased level of * protein in a cell, or a mutation in a regulatory sequence (e.g., a promoter and/or enhancer) that results in an increased level of * protein in a cell, or a mutation in
- an increased copy number of the * gene can result in overexpression of the * protein.
- a dysregulation of a * gene, a * protein, or expression or activity, or level of any of the same can be the result of a gene or chromosome translocation which results in the expression of a fusion protein that contains a first portion of *, and a second portion of a partner protein (i.e., that is not *).
- dysregulation of a * gene, a * protein, or expression or activity or level of any of the same can be a result of a gene translocation of one * gene with another non-* gene.
- the * gene, a * protein, or the expression or activity or level of any of the same is selected from the group consisting of: CD28, BCR, HER1, HER2, PKC ⁇ , PKC ⁇ , MALT1, CARD11, CARD14, A20, CYLD, RelB, HOIL1, NIK, Regnase 1, LIMA1a, roquin-1, TRAF6, TAK1, TAB1, TAB2, TAB3, MKK7, IKK ⁇ , IKK ⁇ , IKKy, IkBa, p50, p65, c-Rel, JNK1, JNK2, JNK3, MYD88, and an AP-1 transcription factor.
- the * gene or * protein is CD28.
- the * gene or * protein is BCR. In some embodiments, the * gene or * protein is HERL In some embodiments, the * gene or * protein is HER2. In some embodiments, the * gene or * protein is PKC ⁇ . In some embodiments, the * gene or * protein is PKC9. In some embodiments, the * gene or * protein is MALT1. In some embodiments, the * gene or * protein is CARD11. In some embodiments, the * gene or * protein is CARD14. In some embodiments, the * gene or * protein is A20. In some embodiments, the * gene or * protein is CYLD. In some embodiments, the * gene or * protein is RelB. In some embodiments, the * gene or * protein is HOIL1.
- the * gene or * protein is NIK. In some embodiments, the * gene or * protein is Regnase 1. In some embodiments, the * gene or * protein is LIMA1a. In some embodiments, the * gene or * protein is roquin-1. In some embodiments, the * gene or * protein is TRAF6. In some embodiments, the * gene or * protein is TAK1. In some embodiments, the * gene or * protein is TAB1. In some embodiments, the * gene or * protein is TAB2. In some embodiments, the * gene or * protein is TAB3. In some embodiments, the * gene or * protein is MKK7. In some embodiments, the * gene or * protein is IKKa.
- the * gene or * protein is IKKp. In some embodiments, the * gene or * protein is IKKy. In some embodiments, the * gene or * protein is IkBa. In some embodiments, the * gene or * protein is p50. In some embodiments, the * gene or * protein is p65. In some embodiments, the * gene or * protein is c-Rel. In some embodiments, the * gene or * protein is JNK1. In some embodiments, the * gene or * protein is JNK2. In some embodiments, the * gene or * protein is JNK3. In some embodiments, the * gene or * protein is MYD88 transcription factor. In some embodiments, the * gene or * protein is AP-1 transcription factor.
- dysregulation of a * gene, a * protein, or expression or activity, or level of any of the same can be a mutation in a * gene that encodes a * protein that is constitutively active or has increased activity as compared to a protein encoded by a * gene that does not include the mutation.
- an increased copy number of the * gene can result in overexpression of * protein.
- the * gene, * protein, or expression or activity, or level of any of the same is CD28.
- the * gene, * protein, or expression or activity, or level of any of the same is BCR.
- the * gene, * protein, or expression or activity, or level of any of the same is HER1.
- the * gene, * protein, or expression or activity, or level of any of the same is HER2.
- the * gene, * protein, or expression or activity, or level of any of the same is HER2.
- the * gene, * protein, or expression or activity, or level of any of the same is HER2.
- * gene, * protein, or expression or activity, or level of any of the same is PKC ⁇ .
- the * gene, * protein, or expression or activity, or level of any of the same is PKC9.
- the * gene, * protein, or expression or activity, or level of any of the same is CARD14.
- the * gene, * protein, or expression or activity, or level of any of the same is CARD9.
- the * gene, * protein, or expression or activity, or level of any of the same is CARD10.
- the * gene, * protein, or expression or activity, or level of any of the same is CARD11.
- the * gene, * protein, or expression or activity, or level of any of the same is MALT1.
- a dysregulation of an * gene, an * protein, or expression or activity, or level of any of the same can be a mutation in an * gene that encodes an * protein that is constitutively inactive or has decreased activity as compared to a protein encoded by an * gene that does not include the mutation.
- the * gene, * protein, or expression or activity, or level of any of the same is A20.
- the * gene, * protein, or expression or activity, or level of any of the same is CYLD.
- the * gene, * protein, or expression or activity, or level of any of the same is RelB.
- the * gene, * protein, or expression or activity, or level of any of the same is RelB. In some embodiments, the
- * gene, * protein, or expression or activity, or level of any of the same is HOIL1.
- the * gene, * protein, or expression or activity, or level of any of the same is NIK.
- Diseases or disorders “associated” with a particular gene or protein described herein refer to diseases or disorder associated with or having a dysregulation of the particular gene, the particular protein, or the expression or activity or level of any (e.g., one or more) of the same (e.g., any of the types of dysregulation of the particular gene, the particular protein, or the expression or activity or level of any of the same described herein).
- diseases or disorders are described herein.
- cancers “associated” with a particular gene or protein described herein refer to cancers associated with or having a dysregulation of the particular gene, the particular protein, or the expression or activity or level of any (e.g., one or more) of the same (e.g., any of the types of dysregulation of the particular gene, the particular protein, or the expression or activity or level of any of the same described herein).
- a dysregulation of the particular gene, the particular protein, or the expression or activity or level of any of the same described herein e.g., one or more
- Non-limiting examples of dysregulation of a CD28 gene or a CD28 protein can be found in, for example, Rohr, et al., Leukemia 30.5 (2016): 1062-1070, Yoo, et al., Haematologica 101.6 (2016): 757-763, and Lee, et al., Haematologica 100.12 (2015): e505.
- Non-limiting examples of dysregulation of a BCR gene or a BCR protein can be found in, for example, Yang and Fu, Crit. Rev. Oncol. /Hematol. 93.3 (2015): 277-292, Weisberg, et al. Nat. Rev. Cancer 7.5 (2007): 345-356, and Jabbour, et al. Cancer 117.9 (2011): 1800-1811.
- Non-limiting examples of dysregulation of a HER1 gene or a HER1 protein can be found in, for example, Zhang, et al., Oncotarget 7.48 (2016): 78985, Ellison, et al., Journal of Clinical Pathology 66.2 (2013): 79-89, Midha, et al., American Journal of Cancer Research 5.9 (2015): 2892, and Yamamoto, et al., Lung Cancer 63.3 (2009): 315-321.
- Non-limiting examples of dysregulation of a HER2 gene or a HER2 protein can be found, for example, Petrelli, Fausto, et al., Breast Cancer Research and Treatment 166.2 (2017): 339-349, Yan, et al., Cancer and Metastasis Reviews 34.1 (2015): 157-164, Koshkin, et al., Bladder Cancer 5.1 (2019): 1-12, and Connell, et al., ESMO Open 2.5 (2017).
- cancer associated with a signal transducer between a cell surface receptor and a CBM complex refers to cancers associated with or having a dysregulation of a gene, a protein, or the expression or activity or level of any (e.g., one or more) of the same associated with a signal transducer between a cell surface receptor and a CBM complex.
- a cancer associated with a signal transducer between a cell surface receptor and a CBM complex is selected from the group consisting of a PKC ⁇ -associated cancer, PCK ⁇ - associated cancer, and a combination thereof.
- cancers “associated” with a particular gene or protein described in this paragraph refer to cancers associated with or having a dysregulation of the particular gene, the particular protein, or the expression or activity or level of any (e.g., one or more) of the same (e.g., any of the types of dysregulation of the particular gene, the particular protein, or the expression or activity or level of any of the same described herein).
- a dysregulation of the particular gene, the particular protein, or the expression or activity or level of any of the same e.g., one or more
- Non-limiting examples of such cancers are described herein.
- component of a CBM complex-associated cancer refers to cancers associated with or having a dysregulation of a gene, a protein, or the expression or activity or level of any (e g., one or more) of the same associated with a component of a CBM complex.
- a component of a CBM complex-associated cancer is selected from the group consisting of a MALT1 -associated cancer, a CARD11 -associated cancer, a CARD14- associated cancer, a CARDlO-associated cancer, a CARD9-associated cancer, a BCL10- associated cancer, and combinations thereof.
- a CBM complex-associated cancer is selected from the group consisting of a MALT1 -associated cancer, a CARD11 -associated cancer, a BCL10-associated cancer, and combinations thereof.
- the cancers “associated” with a particular gene or protein described in this paragraph refer to cancers associated with or having a dysregulation of the particular gene, the particular protein, or the expression or activity or level of any (e.g., one or more) of the same (e.g., any of the types of dysregulation of the particular gene, the particular protein, or the expression or activity or level of any of the same described herein). Non-limiting examples of such cancers are described herein.
- MALT1 -associated autoimmune disorder refers to autoimmune disorders associated with or having a dysregulation of a MALT1 gene, a MALT1 protein (also called herein MALT1 protease protein or MALT1 protease), or the expression or activity or level of any (e.g., one or more) of the same (e.g., any of the types of dysregulation of a MALT1 gene, a MALT1 protease, a MALT1 protease domain, or the expression or activity or level of any of the same described herein).
- MALT1 -associated autoimmune disorders are described herein.
- MALT1 -associated inflammatory disorder refers to inflammatory disorders associated with or having a dysregulation of a MALT1 gene, a MALT1 protein (also called herein MALT1 protease protein or MALT1 protease), or the expression or activity or level of any (e.g., one or more) of the same (e.g., any of the types of dysregulation of a MALT1 gene, a MALT1 protease, a MALT1 protease domain, or the expression or activity or level of any of the same described herein).
- MALT1 -associated inflammatory disorders are described herein.
- MALT1 -associated cancer refers to cancers associated with or having a dysregulation of a MALT1 gene, a MALT1 protein (also called herein MALT1 protease protein or MALT1 protease), or the expression or activity or level of any (e.g., one or more) of the same (e.g., any of the types of dysregulation of a MALT1 gene, a MALT1 protein, a MALT1 protease domain, or the expression or activity or level of any of the same described herein).
- MALT1 -associated cancer are described herein.
- the phrase “dysregulation of a MALT1 gene, a MALT1 protein, or the expression or activity or level of any of the same” refers to a genetic mutation (e.g., a chromosomal translocation that results in the expression of a fusion protein including a MALT1 protease domain and a fusion partner, a mutation in a MALT1 gene that results in the expression of a MALT1 protein that includes a deletion of at least one amino acid as compared to a wild-type MALT1 protein, a mutation in a MALT1 gene that results in the expression of a MALT1 protein with one or more point mutations as compared to a wild-type MALT1 protein, a mutation in a MALT1 gene that results in the expression of a MALT1 protein with at least one inserted amino acid as compared to a wild-type MALT1 protein, a gene duplication that results in an increased level of MALT1 protein in a cell, or a mutation in a regulatory sequence (e.g
- a dysregulation of a MALT1 gene, a MALT1 protein, or expression or activity, or level of any of the same can be a mutation in a MALT1 gene that encodes a MALT1 protein that is constitutively active or has increased activity as compared to a protein encoded by a MALT1 gene that does not include the mutation.
- an increased copy number of the MALT1 gene can result in overexpression of MALT1 protease.
- a dysregulation of a MALT1 gene, a MALT1 protein, or expression or activity, or level of any of the same can be the result of a gene or chromosome translocation which results in the expression of a fusion protein that contains a first portion of MALT1 that includes a functional protease domain, and a second portion of a partner protein (i.e., that is not MALT1).
- dysregulation of a MALT1 gene, a MALT1 protein, or expression or activity or level of any of the same can be a result of a gene translocation of one MALT1 gene with another non-MALTl gene.
- SEQ ID NO: 7 (UniParc Accession No. UPI000004D05E) MSLLGDPLQALPPSAAPTGPLLAPPAGATLNRLREPLLRRLSELLDQAPEG RGWRRLAELAGSRGRLRLSCLDLEQCSLKVLEPEGSPSLCLLKLMGEKGC TVTELSDFLQAMEHTEVLQLLSPPGIKITVNPESKAVLAGQFVKLCCRATG HPFVQYQWFKMNKEIPNGNTSELIFNAVHVKDAGFYVCRVNNNFTFEFS QWSQLDVCDIPESFQRSVDGVSESKLQICVEPTSQKLMPGSTLVLQCVAV GSPIPHYQWFKNELPLTHETKKLYMVPYVDLEHQGTYWCHVYNDRDSQ DSKKVEIIIGRTDEAVECTEDELNNLGHPDNKEQTTDQPLAKDKVALLIGN MNYREHPKLKAPLVDVYELTN
- Non-limiting examples of dysregulation of a MALTl gene or a MALT1 protein are shown in Table Bl below.
- CARD11 -associated autoimmune disorder refers to autoimmune disorders associated with or having a dysregulation of a CARD11 gene, a CARD11 protein, or the expression or activity or level of any (e.g., one or more) of the same (e g., any of the types of dysregulation of a CARD11 gene, a CARD11 protein, or the expression or activity or level of any of the same described herein).
- CARD11 -associated inflammatory disorder refers to inflammatory disorders associated with or having a dysregulation of a CARD11 gene, a CARD 11 protein, or the expression or activity or level of any (e.g., one or more) of the same (e.g., any of the types of dysregulation of a CARD11 gene, a CARD11 protein, or the expression or activity or level of any of the same described herein).
- CARD 11 -associated cancer refers to cancers associated with or having a dysregulation of a CARD11 gene, a CARD11 protein, or the expression or activity or level of any (e.g., one or more) of the same (e.g., any of the types of dysregulation of a CARD11 gene, a CARD11 protein, or the expression or activity or level of any of the same described herein).
- a CARD11 -associated cancer are described herein.
- the phrase “dysregulation of a CARD11 gene, a CARD11 protein, or the expression or activity or level of any of the same” refers to a genetic mutation (e.g., a chromosomal translocation that results in the expression of a fusion protein including a CARD11 domain and a fusion partner, a mutation in a CARD11 gene that results in the expression of a CARD11 protein that includes a deletion of at least one amino acid as compared to a wild-type CARD11 protein, a mutation in a CARD11 gene that results in the expression of a CARD11 protein with one or more point mutations as compared to a wild-type CARD11 protein, a mutation in a CARD11 gene that results in the expression of a CARD11 protein with at least one inserted amino acid as compared to a wild-type CARD11 protein, a gene duplication that results in an increased level of CARD11 protein in a cell, or a mutation in a regulatory sequence (e.g., a
- a dysregulation of a CARD11 gene, a CARD11 protein, or expression or activity, or level of any of the same can be a mutation in a CARD11 gene that encodes a CARD11 protein that is constitutively active or has increased activity as compared to a protein encoded by a CARD11 gene that does not include the mutation.
- an increased copy number of the CARD11 gene can result in overexpression of CARD11 protein.
- a dysregulation of a CARD11 gene, a CARD11 protein, or expression or activity, or level of any of the same can be the result of a gene or chromosome translocation which results in the expression of a fusion protein that contains a first portion of CARD11, and a second portion of a partner protein (i.e., that is not CARD11).
- dysregulation of a CARD11 gene, a CARD11 protein, or expression or activity or level of any of the same can be a result of a gene translocation of one CARD11 gene with another non-CARDl 1 gene.
- SEQ ID NO: 8 (UniParc Accession No. UPI00003FED38) MPGGGPEMDDYMETLKDEEDALWENVECNRHMLSRYINPAKLTPYLRQ CKVIDEQDEDEVLNAPMLPSKINRAGRLLDILHTKGQRGYVVFLESLEFY YPELYKLVTGKEPTRRFSTIVVEEGHEGLTHFLMNEVIKLQQQMKAKDLQ RCELLARLRQLEDEKKQMTLTRVELLTFQERYYKMKEERDSYNDELVKV KDDNYNLAMRYAQLSEEKNMAVMRSRDLQLEIDQLKHRLNKMEEECKL ERNQSLKLKNDIENRPKKEQVLELERENEMLKTKNQELQSIIQAGKRSLPD SDKAILDILEHDRKEALEDRQELVNRIYNLQEEARQAEELRDKYLEEKED LELKCSTLGKDCEMYKHRMN
- Non-limiting examples of dysregulation of a CARD11 gene or a CARD11 protein are shown in Table B2 below.
- CARD14-associated autoimmune disorder refers to autoimmune disorders associated with or having a dysregulation of a CARD14 gene, a CARD14 protein, or the expression or activity or level of any (e.g., one or more) of the same (e.g., any of the types of dysregulation of a CARD 14 gene, a CARD 14 protein, or the expression or activity or level of any of the same described herein).
- CARD14-associated inflammatory disorder refers to inflammatory disorders associated with or having a dysregulation of a CARD14 gene, a CARD14 protein, or the expression or activity or level of any (e.g., one or more) of the same (e.g., any of the types of dysregulation of a CARD 14 gene, a CARD 14 protein, or the expression or activity or level of any of the same described herein).
- CARD14-associated cancer refers to cancers associated with or having a dysregulation of a CARD 14 gene, a CARD 14 protein, or the expression or activity or level of any (e.g., one or more) of the same (e.g., any of the types of dysregulation of a CARD 14 gene, a CARD 14 protein, or the expression or activity or level of any of the same described herein).
- CARDlO-associated autoimmune disorder refers to autoimmune disorders associated with or having a dysregulation of a CARD10 gene, a CARD10 protein, or the expression or activity or level of any (e.g., one or more) of the same (e.g., any of the types of dysregulation of a CARDIO gene, a CARD10 protein, or the expression or activity or level of any of the same described herein).
- CARDlO-associated inflammatory disorder refers to inflammatory disorders associated with or having a dysregulation of a CARD10 gene, a CARDIO protein, or the expression or activity or level of any (e.g., one or more) of the same (e.g., any of the types of dysregulation of a CARD10 gene, a CARD10 protein, or the expression or activity or level of any of the same described herein).
- CARDlO-associated cancer refers to cancers associated with or having a dysregulation of a CARD10 gene, a CARD10 protein, or the expression or activity or level of any (e.g., one or more) of the same (e.g., any of the types of dysregulation of a CARD10 gene, a CARD 10 protein, or the expression or activity or level of any of the same described herein).
- the phrase “dysregulation of a CARD10 gene, a CARD10 protein, or the expression or activity or level of any of the same” refers to a genetic mutation (e.g., a chromosomal translocation that results in the expression of a fusion protein including a CARDIO domain and a fusion partner, a mutation in a CARD10 gene that results in the expression of a CARD10 protein that includes a deletion of at least one amino acid as compared to a wild-type CARD10 protein, a mutation in a CARDIO gene that results in the expression of a CARD10 protein with one or more point mutations as compared to a wild-type CARD10 protein, a mutation in a CARD10 gene that results in the expression of a CARD10 protein with at least one inserted amino acid as compared to a wild-type CARD10 protein, a gene duplication that results in an increased level of CARD10 protein in a cell, or a mutation in a regulatory sequence (e.g., a
- a dysregulation of a CARD10 gene, a CARD10 protein, or expression or activity, or level of any of the same can be a mutation in a CARD10 gene that encodes a CARD10 protein that is constitutively active or has increased activity as compared to a protein encoded by a CARD10 gene that does not include the mutation.
- an increased copy number of the CARD10 gene can result in overexpression of CARD10 protein.
- a dysregulation of a CARD10 gene, a CARD10 protein, or expression or activity, or level of any of the same can be the result of a gene or chromosome translocation which results in the expression of a fusion protein that contains a first portion of CARD10, and a second portion of a partner protein (i.e., that is not CARD10).
- dysregulation of a CARD10 gene, a CARD10 protein, or expression or activity or level of any of the same can be a result of a gene translocation of one CARD10 gene with another non-CARDlO gene.
- CARD9-associated autoimmune disorder refers to autoimmune disorders associated with or having a dysregulation of a CARD9 gene, a CARD9 protein, or the expression or activity or level of any (e.g., one or more) of the same (e.g., any of the types of dysregulation of a C ARD9 gene, a CARD9 protein, or the expression or activity or level of any of the same described herein).
- CARD9-associated inflammatory disorder refers to inflammatory disorders associated with or having a dysregulation of a CARD9 gene, a CARD9 protein, or the expression or activity or level of any (e.g., one or more) of the same (e.g., any of the types of dysregulation of a CARD9 gene, a CARD9 protein, or the expression or activity or level of any of the same described herein).
- CARD9-associated cancer refers to cancers associated with or having a dysregulation of a CARD9 gene, a CARD9 protein, or the expression or activity or level of any (e.g., one or more) of the same (e.g., any of the types of dysregulation of a CARD9 gene, a CARD9 protein, or the expression or activity or level of any of the same described herein).
- the phrase “dysregulation of a CARD9 gene, a CARD9 protein, or the expression or activity or level of any of the same” refers to a genetic mutation (e.g., a chromosomal translocation that results in the expression of a fusion protein including a CARD9 domain and a fusion partner, a mutation in a CARD9 gene that results in the expression of a CARD9 protein that includes a deletion of at least one amino acid as compared to a wild-type CARD9 protein, a mutation in a CARD9 gene that results in the expression of a CARD9 protein with one or more point mutations as compared to a wild-type CARD9 protein, a mutation in a CARD9 gene that results in the expression of a CARD9 protein with at least one inserted amino acid as compared to a wild-type CARD9 protein, a gene duplication that results in an increased level of CARD9 protein in a cell, or a mutation in a regulatory sequence (e.g., a
- a dysregulation of a CARD9 gene, a CARD9 protein, or expression or activity, or level of any of the same can be a mutation in a CARD9 gene that encodes a CARD9 protein that is constitutively active or has increased activity as compared to a protein encoded by a CARD9 gene that does not include the mutation.
- an increased copy number of the CARD9 gene can result in overexpression of CARD9 protein.
- a dysregulation of a CARD9 gene, a CARD9 protein, or expression or activity, or level of any of the same can be the result of a gene or chromosome translocation which results in the expression of a fusion protein that contains a first portion of CARD9, and a second portion of a partner protein (i.e., that is not CARD9).
- dysregulation of a CARD9 gene, a CARD9 protein, or expression or activity or level of any of the same can be a result of a gene translocation of one CARD9 gene with another non-CARD9 gene.
- SEQ ID NO: 11 (UniParc Accession No. UPI000013E4EB) MSDYENDDECWSVLEGFRVTLTSVIDPSRITPYLRQCKVLNPDDEEQVLS DPNLVIRKRKVGVLLDILQRTGHKGYVAFLESLELYYPQLYKKVTGKEPA RVFSMIIDASGESGLTQLLMTEVMKLQKKVQDLTALLSSKDDFIKELRVK DSLLRKHQERVQRLKEECEAGSRELKRCKEENYDLAMRLAHQSEEKGAA LMRNRDLQLEIDQLKHSLMKAEDDCKVERKHTLKLRHAMEQRPSQELL WELQQEKALLQARVQELEASVQEGKLDRSSPYIQVLEEDWRQALRDHQE QANTIFSLRKDLRQGEARRLRCMEEKEMFELQCLALRKDSKMYKDRIEAI LLQMEEVAIERDQAIATREELHAQHAR
- BCL10-associated autoimmune disorder refers to autoimmune disorders associated with or having a dysregulation of a BCL10 gene, a BCL10 protein, or the expression or activity or level of any (e.g., one or more) of the same (e.g., any of the types of dysregulation of a BCL10 gene, a BCL10 protein, or the expression or activity or level of any of the same described herein).
- BCL10-associated inflammatory disorder refers to inflammatory disorders associated with or having a dysregulation of a BCL10 gene, a BCL10 protein, or the expression or activity or level of any (e.g., one or more) of the same (e g., any of the types of dysregulation of a BCL10 gene, a BCL10 protein, or the expression or activity or level of any of the same described herein).
- BCL10-associated cancer refers to cancers associated with or having a dysregulation of a BCL10 gene, a BCL10 protein, or the expression or activity or level of any (e.g., one or more) of the same (e.g., any of the types of dysregulation of a BCL10 gene, a BCL10 protein, or the expression or activity or level of any of the same described herein).
- the phrase “dysregulation of a BCL10 gene, a BCL10 protein, or the expression or activity or level of any of the same” refers to a genetic mutation (e.g., a chromosomal translocation that results in the expression of a fusion protein including a BCL10 domain and a fusion partner, a mutation in a BCL10 gene that results in the expression of a BCL10 protein that includes a deletion of at least one amino acid as compared to a wild-type BCL10 protein, a mutation in a BCL10 gene that results in the expression of a BCL10 protein with one or more point mutations as compared to a wild-type BCL10 protein, a mutation in a BCL10 gene that results in the expression of a BCL10 protein with at least one inserted amino acid as compared to a wild-type BCL10 protein, a gene duplication that results in an increased level of BCL10 protein in a cell, or a mutation in a regulatory sequence (e.g., a
- a dysregulation of a BCL10 gene, a BCL10 protein, or expression or activity, or level of any of the same can be the result of a gene or chromosome translocation which results in the expression of a fusion protein that contains a first portion of BCL10, and a second portion of a partner protein (i.e., that is notBCL10).
- dysregulation of a BCL10 gene, a BCL10 protein, or expression or activity or level of any of the same can be a result of a gene translocation of one BCL10 gene with another non- BCL10 gene.
- Non-limiting examples of dysregulation of a BCL10 gene or a BCL10 protein are shown in Table B3 below.
- MALT1 protease substrate-associated cancer refers to cancers associated with or having a dysregulation of a gene, a protein, or the expression or activity or level of any (e.g., one or more) of the same associated with a MALT1 protease substrate.
- a MALTl protease substrate-associated cancer is selected from the group consisting of a BCL10-associated cancer, an A20-associated cancer, a CYLD-associated cancer, a RelB- associated cancer, a Regnase 1 -associated cancer, a roquin-1 -associated cancer, a H0IL1- associated cancer, a NIK associated cancer, a LIMA1a-associated cancer, and combinations thereof.
- a MALT1 protease substrate-associated cancer is selected from the group consisting of a BCL10-associated cancer, an A20-associated cancer, a CYLD-associated cancer, and combinations thereof.
- cancers “associated” with a particular gene or protein described in this paragraph refer to cancers associated with or having a dysregulation of the particular gene, the particular protein, or the expression or activity or level of any (e.g., one or more) of the same (e.g., any of the types of dysregulation of the particular gene, the particular protein, or the expression or activity or level of any of the same described herein).
- a dysregulation of the particular gene, the particular protein, or the expression or activity or level of any of the same e.g., one or more
- Non-limiting examples of such cancers are described herein.
- Non-limiting examples of dysregulation of an A20 gene or an A20 protein are shown in Table B4 below.
- SEQ ID NO: 14 (UniParc Accession No. UPI0000073A15)
- Non-limiting examples of dysregulation of a CYLD gene or a CYLD protein can be found, for example, in Massoumi, Future Oncology 7.2 (2011): 285-297, Alameda, J. P., et al., Oncogene 29.50 (2010): 6522-6532, Williams, et al., Modem Pathology (2020): 1-13, and Courtois and Gilmore. Oncogene 25.51 (2006): 6831-6843.
- SEQ ID NO: 16 (UniParc Accession No. UPI000004D30E) MSGPCGEKPVLEASPTMSLWEFEDSHSRQGTPRPGQELAAEEASALELQ MKVDFFRKLGYSSTEIHSVLQKLGVQADTNTVLGELVKHGTATERERQT SPDPCPQLPLVPRGGGTPKAPNLEPPLPEEEKEGSDLRPVVIDGSNVAMSH GNKEVFSCRGILLAVNWFLERGHTDITVFVPSWRKEQPRPDVPITDQHILR ELEKKKILVFTPSRRVGGKRVVCYDDRFIVKLAYESDGIVVSNDTYRDLQ GERQEWKRFIEERLLMYSFVNDKFMPPDDPLGRHGPSLDNFLRKKPLTLE HRKQPCPYGRKCTYGIKCRFFHPERPSCPQRSVADELRANALLSPPRAPSK DKNGRRPSPSSQSSSLLEESEQC
- cancer associated with a component of the NF-excellentB pathway downstream of a CBM complex refers to cancers associated with or having a dysregulation of a gene, a protein, or the expression or activity or level of any (e.g., one or more) of the same associated with a component of the NF-excellentB pathway downstream of a CBM complex.
- a cancer associated with a component of the NF-excellentB pathway downstream of a CBM complex is selected from the group consisting of a TAK1 -associated cancer, a TRAF6-associated cancer, a TAB 1 -associated cancer, a TAB2-associated cancer, a TAB3 -associated cancer, a MKK7-associated cancer, an IKKa-associated cancer, an IKK ⁇ -associated cancer, an IKKy- associated cancer, an IkB ⁇ -associated cancer, a p50-associated cancer, a p65 (RelA)-associated cancer, a c-Rel-associated cancer, and combinations thereof.
- a cancer associated with a component of the NF-excellentB pathway downstream of a CBM complex is an IKKy- associated cancer.
- the cancers “associated” with a particular gene or protein described in this paragraph refer to cancers associated with or having a dysregulation of the particular gene, the particular protein, or the expression or activity or level of any (e.g., one or more) of the same (e.g., any of the types of dysregulation of the particular gene, the particular protein, or the expression or activity or level of any of the same described herein).
- Non-limiting examples of such cancers are described herein.
- TAB3 An exemplary sequence of human TAB3 is shown below: SEQ ID NO: 24 (UniParc Accession No. UPI0000071648) MAQSSPQLDIQVLHDLRQRFPEIPEGVVSQCMLQNNNNLEACCRALSQES SKYLYMEYHSPDDNRMNRNRLLHINLGIHSPSSYHPGDGAQLNGGRTLV HS S SDGHIDPQHAAGKQLICL VQEPHS AP A VVAATPNYNPFFMNEQNRS A ATPPSQPPQQPSSMQTGMNPSAMQGPSPPPPPPSYMHIPRYSTNPITVTVS QNLPSGQTVPRALQILPQIPSNLYGSPGSIYIRQTSQSSSGRQTPQSTPWQSS PQGPVPHYSQRPLPVYPHQQNYQPSQYSPKQQIPQSAYHSPPPSQCPSPF SSPQHQVQPSQLGHIFMPPSPSTTPPHPYQQGPPSYQKQGSHS
- SEQ ID NO: 25 (UniParc Accession No. UPI000012F494)
- Non-limiting examples of dysregulation of an IKKy gene or an IKKy protein are described in, for example, Courtois and Gilmore, Oncogene 25.51 (2006): 6831-6843.
- SEQ ID NO: 30 (UniParc Accession No. UPI000000D917)
- cancer associated with a component of the JNK pathway downstream of a CBM complex refers to cancers associated with or having a dysregulation of a gene, a protein, or the expression or activity or level of any (e.g., one or more) of the same associated with a component of the JNK pathway downstream of a CBM complex.
- a cancer associated with a component of the JNK pathway downstream of a CBM complex is selected from the group consisting of a JNK1 -associated cancer, a JNK2-associated cancer, a JNK3 -associated cancer, a MYD88 transcription factor-associated cancer, an AP-1 transcription factor-associated cancer, and combinations thereof.
- cancers “associated” with a particular gene or protein described in this paragraph refer to cancers associated with or having a dysregulation of the particular gene, the particular protein, or the expression or activity or level of any (e.g., one or more) of the same (e.g., any of the types of dysregulation of the particular gene, the particular protein, or the expression or activity or level of any of the same described herein).
- a dysregulation of the particular gene, the particular protein, or the expression or activity or level of any of the same e.g., one or more
- Non-limiting examples of such cancers are described herein.
- SEQ ID NO: 35 (UniParc Accession No. UPI0000049042) MSLHFLYYCSEPTLDVKIAFCQGFDKQVDVSYIAKHYNMSKSKVDNQFY SVEVGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPF QNQTHAKRAYRELVLMKCVNHKNIISLLNVFTPQKTLEEFQDVYLVMEL MDANLCQVIQMELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVK SDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGYKENVDIW
- Q is -CH 2 -, 0, or NH
- X is N or C
- Y is N or C
- Z is N or CR 5 ; wherein when one of X and Y is N, the other of X and Y is C; n is 1, 2, or 3;
- R x is hydrogen or halogen
- R 1 is hydrogen, halogen, cyano, hydroxyl, C1-C3 alkoxy, C1-C3 haloalkoxy, C1-C3 haloalkyl, -NR A R B , or C1-C3 alkyl optionally substituted with 1-3 substituents selected from hydroxyl and C1-C3 alkoxy;
- Z is N or CR 5 ; wherein when one of X and Y is N, the other of X and Y is C; n is 1, 2, or 3;
- R x is hydrogen or halogen
- R 1 is hydrogen, halogen, cyano, hydroxyl, C1-C3 alkoxy, C1-C3 haloalkoxy, C1-C3 haloalkyl, -NR A R B , or C1-C3 alkyl optionally substituted with 1-3 substituents selected from hydroxyl and C1-C3 alkoxy;
- R 2 is hydrogen, halogen, amino, or C1-C3 alkyl; each R 3 is independently deuterium, halogen, hydroxyl, C3-C6 cycloalkyl, C1-C3 alkyl, C1-C3 alkoxy, C1-C3 haloalkoxy, or C1-C3 haloalkyl; or two R 3 together with the carbon atom to which they are attached come together to form an oxo group, a 4-8 membered heterocyclyl, or a C3-C8 cycloalkyl; m is 0, 1, 2, or 3;
- R 4 is phenyl or 5-9 membered heteroaryl; wherein each R 4 group is optionally substituted with 1-3 substituents independently selected from R 6 ;
- R A , R B , R C , R D , R E , and R F are independently hydrogen, C1-C3 alkyl, C3-C6 cycloalkyl, or R A and R B , or R c and R D , or R E and R F , together with the nitrogen atom to which they are attached come together to form a 4-6 membered heterocyclyl optionally substituted with 1-2 halogens.
- the compound of Formula (I), or a pharmaceutically acceptable salt thereof has the structure: wherein: each is a single or double bond;
- Q is -CH 2 -, O, or NH
- X is N or C
- Y is N or C
- Z is N or CR 5 ; wherein when one of X and Y is N, the other of X and Y is C; n is 1, 2, or 3;
- R 1 is hydrogen, halogen, cyano, hydroxyl, C1-C3 alkoxy, C1-C3 haloalkoxy, C1-C3 haloalkyl, -NR A R B , or C1-C3 alkyl optionally substituted with 1-3 substituents selected from hydroxyl and C1-C3 alkoxy;
- R 2 is hydrogen, halogen, amino, or C1-C3 alkyl; each R 3 is independently deuterium, halogen, hydroxyl, C3-C6 cycloalkyl, C1-C3 alkyl, C1-C3 alkoxy, C1-C3 haloalkoxy, or C1-C3 haloalkyl; or two R 3 together with the carbon atom to which they are attached come together to form an oxo group, a 4-8 membered heterocyclyl, or a C3-C8 cycloalkyl; m is 0, 1, 2, or 3;
- R 4 is phenyl or 5-9 membered heteroaryl; wherein each R 4 group is optionally substituted with 1-3 substituents independently selected from R 6 ;
- R A , R B , R C , R D , R E , and R F are independently hydrogen, C1-C3 alkyl, C3-C6 cycloalkyl, or R A and R B , or R c and R D , or R E and R F , together with the nitrogen atom to which they are attached come together to form a 4-6 membered heterocyclyl optionally substituted with 1-2 halogens.
- Q is -CH 2 -. In some embodiments, Q is O. In some embodiments, Q is NH.
- the five-membered nitrogen-containing ring formed in part by X and Y, is a heteroaromatic ring.
- X is C and Y is C.
- X is N and Y is C.
- X is C and Y is N.
- Z is N. In some embodiments, Z is CR 5 .
- X is C; Y is C; and Z is CR 5 . In some embodiments, X is N; Y is C; and Z is CR 5 . In some embodiments, X is C; Y is N; and Z is CR 5 . In some embodiments, X is C; Y is C; and Z is N. In some embodiments, X is N; Y is C; and Z is N. In some embodiments, X is C; Y is N; and Z is N.
- R 1 is halogen, cyano, hydroxyl, C1-C3 alkoxy, C1-C3 haloalkyl, - NR A R B , or C1-C3 alkyl optionally substituted with 1-3 substituents selected from hydroxyl and C1-C3 alkoxy.
- R 1 is halogen or cyano. In some embodiments, R 1 is chloro or cyano. In some embodiments, R 1 is hydrogen. In some embodiments, R 1 is halogen. In some embodiments, R 1 is fluoro. In some embodiments, R 1 is chloro. In some embodiments, R 1 is cyano. In some embodiments, R 1 is hydroxyl.
- R 1 is C1-C3 alkoxy. In some embodiments, R 1 is methoxy or ethoxy.
- R 1 is C1-C3 haloalkoxy. In some embodiments, R 1 is trifluoromethoxy, difluoromethoxy, or fluoromethoxy. In some embodiments, R 1 is C1-C3 haloalkyl. In some embodiments, R 1 is difluoromethyl, trifluoromethyl or 2,2,2-trifluoroethyl.
- R 1 is -NR A R B .
- R A and R B are independently hydrogen or C1-C3 alkyl.
- one of R A and R B is hydrogen and the other of R A and R B is C1-C3 alkyl.
- one of R A and R B is hydrogen and the other of R A and R B is methyl.
- one of R A and R B is hydrogen and the other of R A and R B is ethyl.
- R A and R B are both hydrogens.
- R A and R B are both C1-C3 alkyl.
- R A and R B are both methyl.
- one of R A and R B is methyl and the other of R A and R B is ethyl.
- R A and R B are both ethyl.
- R A and R B together with the nitrogen atom to which they are attached come together to form a 4-6 membered heterocyclyl. In certain embodiments, R A and R B together with the nitrogen atom to which they are attached come together to form a 4 membered heterocyclyl. In some embodiments, R A and R B together with the nitrogen atom to which they are attached come together to form a 5 membered heterocyclyl. In some embodiments, R A and R B together with the nitrogen atom to which they are attached come together to form a 6 membered heterocyclyl.
- R 1 is C1-C3 alkyl optionally substituted with 1-3 substituents selected from hydroxyl and C1-C3 alkoxy. In certain embodiments, R 1 is C1-C3 alkyl optionally substituted with 1 substituent selected from hydroxyl and C1-C3 alkoxy. In certain of these embodiments, R 1 is methyl optionally substituted with 1 substituent selected from hydroxyl and C1-C3 alkoxy. In certain embodiments, R 1 is ethyl optionally substituted with 1 substituent selected from hydroxyl and C1-C3 alkoxy. In certain embodiments, R 1 is C1-C3 alkyl optionally substituted with hydroxyl. In certain embodiments, R 1 is C1-C3 alkyl optionally substituted with C1-C3 alkoxy (e.g., methoxy). In some embodiments, R 1 is hydroxymethyl or methoxyethyl.
- R 1 is unsubstituted C1-C3 alkyl (e.g., methyl or ethyl).
- R 2 is hydrogen. In some embodiments, R 2 is halogen. In some embodiments, R 2 is fluoro. In some embodiments, R 2 is chloro. In some embodiments, R 2 is amino. In some embodiments, R 2 is C1-C3 alkyl, such as methyl. In some embodiments, n is 1, 2, or 3. In some embodiments, n is 1 or 2. In some embodiments, n is 2 or 3. In some embodiments, n is 1 or 3. In some embodiments, n is 1. In some embodiments, n is 2. In some embodiments, n is 3.
- m is 0, 1, 2, or 3. In some embodiments, m is 0, 1, or 2. In some embodiments, m is 1, 2, or 3. In some embodiments, m is 0, 2, or 3. In some embodiments, m is 0, 1, or 3. In some embodiments, m is 0 or 1. In some embodiments, m is 0 or 2. In some embodiments, m is 0 or 3. In some embodiments, m is 1 or 2. In some embodiments, m is 1 or 3. In some embodiments, m is 2 or 3. In some embodiments, m is 0. In some embodiments, m is 1. In some embodiments, m is 2. In some embodiments, m is 3.
- each R 3 is independently deuterium, halogen, hydroxyl, C3-C6 cycloalkyl, C1-C3 alkyl, C1-C3 haloalkyl, C1-C3 alkoxy, or C1-C3 haloalkoxy.
- each R 3 is deuterium.
- each R 3 is independently halogen. In some embodiments, R 3 is fluoro. In some embodiments, R 3 is chloro. In some embodiments, each R 3 is independently hydroxyl.
- each R 3 is independently C3-C6 cycloalkyl, C1-C3 alkyl, C1-C3 alkoxy, C1-C3 haloalkoxy, or C1-C3 haloalkyl.
- each R 3 is independently C1-C3 alkyl.
- R 3 is methyl or ethyl.
- each R 3 is independently C1-C3 alkoxy.
- R 3 is methoxy or ethoxy.
- each R 3 is independently C1-C3 haloalkoxy.
- R 3 is trifluoromethoxy, difluoromethoxy, or fluoromethoxy.
- each R 3 is independently C1-C3 haloalkyl.
- each R 3 is trifluoromethyl or 2,2,2- tri fluoroethyl.
- Q is -CH 2 -, m is 1, and each R 3 is C1-C3 alkyl. In some embodiments, Q is -CH 2 -, m is 2, and each R 3 is C1-C3 alkyl. In some embodiments, Q is -CH 2 - , m is 2, and R 3 is C1-C3 alkyl, the R 3 groups are geminal C1-C3 alkyl groups. In some embodiments, Q is -CH 2 - and each R 3 is independently C1-C3 alkyl. In some embodiments, Q is -CH 2 -, m is 2, and the R 3 groups are geminal.
- Q is -CH 2 -, m is 2, and each R 3 is C1-C3 haloalkyl.
- Q is -CH 2 - and the R 3 groups are geminal C1-C3 haloalkyl groups
- Q is -CH 2 -, m is 2, one R 3 is C1-C3 alkyl, and the other R 3 is C1-C3 haloalkyl.
- Q is -CH 2 -, m is 2, one R 3 is C1-C3 alkoxy, and the other R 3 is C1-C3 haloalkyl.
- Q is -CH 2 -
- the R 3 groups are geminal C1-C3 alkyl and C1-C3 haloalkyl groups
- Q is -CH 2 -
- m is 2
- one R 3 is C1-C3 alkyl and the other R 3 is C3-C6 cycloalkyl.
- m is 2 and one R 3 is trifluoromethyl and the other R 3 is ethoxy.
- Q is -CH 2 - and the R 3 groups are geminal C1-C3 alkyl and C3-C6 cycloalkyl groups.
- Q is -CH 2 -, m is 2, and one R 3 is C1-C3 haloalkyl and the other R 3 is C3-C6 cycloalkyl. In some embodiments, Q is -CH 2 - and the R 3 groups are geminal C1-C3 haloalkyl and C3-C6 cycloalkyl groups.
- Q is -CH 2 -, m is 1, and each R 3 is methyl. In some embodiments, Q is -CH 2 -, m is 2, and each R 3 is methyl. In some embodiments, Q is -CH 2 -, m is 2, each R 3 is methyl, and the two R 3 groups are geminal methyl groups. In some embodiments, Q is -CH 2 -, each R 3 is independently methyl. In some embodiments, Q is -CH 2 -, m is 2, and the R 3 groups are geminal. In some embodiments, Q is -CH 2 -, m is 2, and each R 3 is trifluoromethyl.
- Q is -CH 2 - and the R 3 groups are geminal trifluoromethyl groups. In some embodiments, Q is -CH 2 -, m is 2, and one R 3 is methyl and the other R 3 is trifluoromethyl. In some embodiments, Q is -CH 2 - and the R 3 groups are geminal methyl and trifluoromethyl groups. In some embodiments, Q is -CH 2 -, m is 2, and one R 3 is methyl and the other R 3 is cyclopropyl. In some embodiments, Q is -CH 2 - and the R 3 groups are geminal methyl and cyclopropyl groups.
- Q is -CH 2 -, m is 2, and one R 3 is trifluoromethyl and the other R 3 is cyclopropyl. In some embodiments, Q is -CH 2 - and the R 3 groups are geminal trifluoromethyl and cyclopropyl groups.
- Q is -CH 2 -
- m is 2
- the two R 3 together with the carbon atom to which they are attached come together to form an oxo group.
- m is 2 and the two R 3 together with the carbon atom to which they are attached come together to form a C3- C8 cycloalkyl (e.g., a cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl, cycloheptyl, or cyclooctyl).
- m is 2 and the two R 3 together with the carbon atom to which they are attached form cyclopropyl or cyclobutyl.
- two R 3 together with the carbon atom to which they are attached come together to form a 4-8 membered heterocyclyl.
- m is 2 and the two R 3 together with the carbon atom to which they are attached come together to form a 4-8 membered heterocyclyl.
- two R 3 together with the carbon atom to which they are attached come together to form a 4-6 membered heterocyclyl.
- two R 3 together with the carbon atom to which they are attached come together to form a 4 membered heterocyclyl such as oxetanyl or azetidinyl.
- two R 3 together with the carbon atom to which they are attached come together to form a 5 membered heterocyclyl. In some embodiments, two R 3 together with the carbon atom to which they are attached come together to form a 6 membered heterocyclyl such tetrahydropyranyl. In some embodiments, m is 2 and the two R 3 together with the carbon atom to which they are attached form oxetanyl or tetrahydropyranyl .
- m is 3; two R 3 groups are methyl, and one R 3 is selected from the group consisting of methyl and hydroxyl.
- Q is O, m is 1, and each R 3 is C1-C3 alkyl. In some embodiments, Q is O, m is 2, and each R 3 is C1-C3 alkyl. In some embodiments, Q is O, m is 2, and R 3 is Cl- C3 alkyl, the R 3 groups are geminal C1-C3 alkyl groups. In some embodiments, Q is O and each R 3 is independently C1-C3 alkyl. In some embodiments, Q is O, m is 2, and the R 3 groups are geminal. In some embodiments, Q is O, m is 2, and each R 3 is C1-C3 haloalkyl.
- Q is O and the R 3 groups are geminal C1-C3 haloalkyl groups.
- Q is O, m is 2, one R 3 is C1-C3 alkyl, and the other R 3 is C1-C3 haloalkyl.
- Q is O, the R 3 groups are geminal C1-C3 alkyl and C1-C3 haloalkyl groups.
- Q is O, m is 2, one R 3 is C1-C3 alkyl and the other R 3 is C3-C6 cycloalkyl.
- Q is O and the R 3 groups are geminal C1-C3 alkyl and C3-C6 cycloalkyl groups.
- Q is O, m is 2, and one R 3 is C1-C3 haloalkyl and the other R 3 is C3-C6 cycloalkyl. In some embodiments, Q is O and the R 3 groups are geminal C1-C3 haloalkyl and C3- C6 cycloalkyl groups.
- Q is O, m is 1, and each R 3 is methyl. In some embodiments, Q is O, m is 2, and each R 3 is methyl. In some embodiments, Q is O, m is 2, each R 3 is methyl, and the two R 3 groups are geminal methyl groups. In some embodiments, Q is O, each R 3 is independently methyl. In some embodiments, Q is O, m is 2, and the R 3 groups are geminal. In some embodiments, Q is O, m is 2, and each R 3 is trifluorom ethyl. In some embodiments, Q is O and the R 3 groups are geminal trifluoromethyl groups.
- Q is O, m is 2, and one R 3 is methyl and the other R 3 is trifluoromethyl. In some embodiments, Q is O and the R 3 groups are geminal methyl and trifluoromethyl groups. In some embodiments, Q is O, m is 2, and one R 3 is methyl and the other R 3 is cyclopropyl. In some embodiments, Q is O and the R 3 groups are geminal methyl and cyclopropyl groups. In some embodiments, Q is O, m is 2, and one R 3 is trifluoromethyl and the other R 3 is cyclopropyl. In some embodiments, Q is O and the R 3 groups are geminal trifluoromethyl and cyclopropyl groups.
- Q is O
- m 2
- the two R 3 together with the carbon atom to which they are attached come together with the carbon atom to which they are attached come together to form an oxo group.
- m is 2 and the two R 3 together with the carbon atom to which they are attached come together to form a C3-C8 cycloalkyl (e.g., a cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl, cycloheptyl, or cyclooctyl).
- Q is NH, m is 1, and each R 3 is C1-C3 alkyl. In some embodiments, Q is NH, m is 2, and each R 3 is C1-C3 alkyl. In some embodiments, Q is NH, m is 2, and R 3 is C1-C3 alkyl, the R 3 groups are geminal C1-C3 alkyl groups. In some embodiments, Q is NH and each R 3 is independently C1-C3 alkyl. In some embodiments, Q is NH, m is 2, and the R 3 groups are geminal. In some embodiments, Q is NH, m is 2, and each R 3 is C1-C3 haloalkyl.
- Q is NH and the R 3 groups are geminal C1-C3 haloalkyl groups.
- Q is NH, m is 2, one R 3 is C1-C3 alkyl, and the other R 3 is C1-C3 haloalkyl.
- Q is NH, the R 3 groups are geminal C1-C3 alkyl and C1-C3 haloalkyl groups.
- Q isNH, m is 2, one R 3 is C1-C3 alkyl and the other R 3 is C3-C6 cycloalkyl.
- Q is NH and the R 3 groups are geminal C1-C3 alkyl and C3-C6 cycloalkyl groups. In some embodiments, Q is NH, m is 2, and one R 3 is C1-C3 haloalkyl and the other R 3 is C3-C6 cycloalkyl. In some embodiments, Q is NH and the R 3 groups are geminal C1-C3 haloalkyl and C3-C6 cycloalkyl groups.
- Q is NH, m is 1, and each R 3 is methyl. In some embodiments, Q is NH, m is 2, and each R 3 is methyl. In some embodiments, Q is NH, m is 2, each R 3 is methyl, and the two R 3 groups are geminal methyl groups. In some embodiments, Q is NH, each R 3 is independently methyl. In some embodiments, Q is NH, m is 2, and the R 3 groups are geminal. In some embodiments, Q is NH, m is 2, and each R 3 is trifluoromethyl. In some embodiments, Q is NH and the R 3 groups are geminal trifluoromethyl groups.
- Q is NH, m is 2, and one R 3 is methyl and the other R 3 is trifluoromethyl. In some embodiments, Q is NH and the R 3 groups are geminal methyl and trifluoromethyl groups. In some embodiments, Q is NH, m is 2, and one R 3 is methyl and the other R 3 is cyclopropyl. In some embodiments, Q is NH and the R 3 groups are geminal methyl and cyclopropyl groups. In some embodiments, Q is NH, m is 2, and one R 3 is trifluoromethyl and the other R 3 is cyclopropyl. In some embodiments, Q is NH and the R 3 groups are geminal trifluoromethyl and cyclopropyl groups.
- Q is NH
- m 2
- the two R 3 together with the carbon atom to which they are attached come together with the carbon atom to which they are attached come together to form an oxo group.
- m is 2 and the two R 3 together with the carbon atom to which they are attached come together to form a C3-C8 cycloalkyl (e.g., a cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl, cycloheptyl, or cyclooctyl).
- R 4 is phenyl or 5-6 membered heteroaryl; wherein each R 4 group is optionally substituted with 1-2 independently selected R 6 . In some embodiments, R 4 is phenyl or 5-6 membered heteroaryl; wherein each R 4 group is optionally substituted with 2-3 independently selected R 6 . In some embodiments, R 4 is phenyl or 5-6 membered heteroaryl; wherein each R 4 group is optionally substituted with 1 or 3 independently selected R 6 . In some embodiments, R 4 is phenyl or 5-6 membered heteroaryl; wherein each R 4 group is optionally substituted with 1 independently selected R 6 .
- R 4 is phenyl or 5-6 membered heteroaryl; wherein each R 4 group is optionally substituted with 2 independently selected R 6 . In some embodiments, R 4 is phenyl or 5-6 membered heteroaryl; wherein each R 4 group is optionally substituted with 3 independently selected R 6 .
- R 4 is phenyl or 5 membered heteroaryl; wherein each R 4 group is optionally substituted with 1-3 substituents independently selected from R 6 . In some embodiments, R 4 is phenyl or 6 membered heteroaryl; wherein each R 4 group is optionally substituted with 1-3 substituents independently selected from R 6 .
- R 4 is phenyl optionally substituted with 1-3 independently selected R 6 . In certain embodiments, R 4 is phenyl optionally substituted with 1 R 6 . In certain embodiments, R 4 is phenyl optionally substituted with 2 independently selected R 6 . In certain embodiments, R 4 is phenyl optionally substituted with 3 independently selected R 6 .
- R 4 is unsubstituted phenyl.
- R 4 is phenyl substituted with 1-3 substituents independently selected from R 6 . In certain embodiments, R 4 is phenyl substituted with R 6 . In certain embodiments, R 4 is phenyl substituted with 2 independently selected R 6 . In some embodiments, R 4 is phenyl substituted with 3 independently selected R 6 . In some embodiments, R 4 is 5-6 membered heteroaryl optionally substituted with 1-3 (e.g., 2) substituents independently selected from R 6 . In some embodiments, R 4 is 6 membered heteroaryl optionally substituted with 1-3 (e.g., 2) substituents independently selected from R 6 .
- R 4 is unsubstituted 5-6 membered heteroaryl.
- R 4 is 5-6 membered heteroaryl substituted with 1-3 substituents independently selected from R 6 .
- R 4 is 5-9 membered heteroaryl optionally substituted with 1-3 (e.g., 1 or 2) independently selected R 6 . In some embodiments, R 4 is 5-9 membered heteroaryl substituted with 1-3 (e.g., 2) substituents independently selected from R 6 . In some embodiments, R 4 is 9 membered heteroaryl optionally substituted with 1-3 (e.g., 2) substituents independently selected from R 6 . In some embodiments, R 4 is 9 membered heteroaryl substituted with one substituent selected from R 6 . In some embodiments, R 4 is 9 membered heteroaryl containing pyridyl. In some embodiments, R 4 is , wherein ring B is a 4-5 membered heterocyclyl optionally substituted with 1-2 (e.g., 1) substituents selected from R 6 . In some embodiments, R 4 is
- R 4 is unsubstituted 5-6 membered heteroaryl.
- at least one of R 6 is halogen.
- at least one of R 6 is fluoro.
- at least one of R 6 is chloro.
- one of R 6 is halogen.
- one of R 6 is fluoro.
- one of R 6 is chloro.
- two of R 6 is halogen.
- two of R 6 is fluoro.
- two of R 6 is chloro.
- three of R 6 is halogen.
- three of R 6 is fluoro.
- three of R 6 is chloro.
- at least one of R 6 is cyano.
- at least one of R 6 is amino.
- R E and R F are independently hydrogen or C1-C3 alkyl.
- one of R E and R F is hydrogen and the other of R E and R F is C1-C3 alkyl.
- one of R E and R F is hydrogen and the other of R E and R F is C3-C6 cycloalkyl.
- one of R E and R F is C1-C3 alkyl and the other of R E and R F is C3-C6 cycloalkyl.
- one of R E and R F is hydrogen and the other of R E and R F is methyl.
- one of R E and R F is hydrogen and the other of R E and R F is ethyl. In some embodiments, one of R E and R F is hydrogen and the other of R E and R F is cyclopropyl. In some embodiments, one of R E and R F is methyl and the other of R E and R F is cyclopropyl. In certain embodiments, R E and R F are both hydrogens. In certain embodiments, R E and R F are both C1-C3 alkyl. In some embodiments, R E and R F are both methyl. In some embodiments, one of R E and R F is methyl and the other of R E and R F is ethyl. In some embodiments, R E and R F are both ethyl.
- R E and R F together with the nitrogen atom to which they are attached come together to form a 4-6 membered heterocyclyl. In some embodiments, R E and R F together with the nitrogen atom to which they are attached come together to form a 4-6 membered heterocyclyl optionally substituted with 1-2 halogens. In certain embodiments, R E and R F together with the nitrogen atom to which they are attached come together to form a 4 membered heterocyclyl. In certain embodiments, R E and R F together with the nitrogen atom to which they are attached come together to form azetidine- 1-yl or 3,3-difluoro-azetidine-1-yl.
- R E and R F together with the nitrogen atom to which they are attached come together to form a 5 membered heterocyclyl. In some embodiments, R E and R F together with the nitrogen atom to which they are attached come together to form a 6 membered heterocyclyl.
- each (C1-C3 alkyl) is the same. In some embodiments, each (C1-C3 alkyl) is different. In some embodiments, each (C1-C3 alkyl) is methyl.
- each (C1-C3 alkyl) is the same. In some embodiments, each (C1-C3 alkyl) is different. In some embodiments, each (C1-C3 alkyl) is methyl.
- p is 1. In some embodiments, p is 2.
- At least one of R 6 is C1-C3 alkoxy. In some embodiments, at least one of R 6 is methoxy or ethoxy.
- At least one of R 6 is C1-C3 haloalkyl optionally substituted with hydroxyl. In some embodiments, at least one of R 6 is unsubstituted C1-C3 haloalkyl. In some embodiments, at least one of R 6 is C1-C3 haloalkyl substituted with hydroxyl. In some embodiments, at least one of R 6 is trifluoromethyl, 2,2-difluoroethyl, or 2,2,2-trifluoroethyl. In some embodiments, at least one of R 6 is 1 -hydroxy -2,2-difluoroethyl.
- At least one of R 6 is C1-C3 haloalkoxy. In some embodiments, at least one of R 6 is trifluorom ethoxy.
- At least one of R 6 is 5-6 membered heteroaryl optionally substituted with halogen, cyano, hydroxyl, C1-C3 alkoxy, C1-C3 haloalkoxy, amino, C1-C3 haloalkyl, 4-6 membered heterocyclyl, or C1-C3 alkyl optionally substituted with hydroxyl or -NR E R F .
- At least one of R 6 is 5-6 membered heteroaryl optionally substituted with halogen, cyano, hydroxyl, C1-C3 alkoxy, C1-C3 haloalkoxy, C1-C3 alkyl optionally substituted with hydroxyl or -NR E R F , amino, or C1-C3 haloalkyl.
- R 6 is 5-6 membered heteroaryl optionally substituted with Cl -C3 alkyl optionally substituted with hydroxyl or -NR E R F .
- At least one of R 6 is 5-6 membered heteroaryl optionally substituted with halogen, C1-C3 haloalkyl, or C1-C3 alkyl optionally substituted with hydroxyl or -NR E R F . In some embodiments, R 6 is 5-6 membered heteroaryl substituted with C1-C3 alkyl substituted with hydroxyl or -NR E R F . In some embodiments, R 6 is 5-6 membered heteroaryl substituted with hydroxymethyl, aminomethyl, hydroxyethyl, aminoethyl, propan-2-ol, or propan-2-amine. In some embodiments, at least one of R 6 is 5-6 membered heteroaryl optionally substituted with a 4- 6 membered heterocyclyl.
- At least one of R 6 is 5 membered heteroaryl optionally substituted with halogen, cyano, hydroxyl, C1-C3 alkoxy, C1-C3 haloalkoxy, C1-C3 alkyl, amino, or C1-C3 haloalkyl. In some embodiments, at least one of R 6 is 6 membered heteroaryl optionally substituted with halogen, cyano, hydroxyl, C1-C3 alkoxy, C1-C3 haloalkoxy, amino, C1-C3 haloalkyl, or C1-C3 alkyl optionally substituted with hydroxyl or -NR E R F .
- R 6 is 5 membered heteroaryl substituted with hydroxymethyl, aminomethyl, hydroxyethyl, aminoethyl, propan-2-ol, or propan-2-amine. In some embodiments, R 6 is 6 membered heteroaryl substituted with hydroxymethyl, aminomethyl, hydroxy ethyl, aminoethyl, propan-2-ol, or propan- 2-amine.
- At least one of R 6 is C1-C3 alkyl optionally substituted with hydroxyl, -NR E R F , or C1-C3 alkoxy. In some embodiments, at least one of R 6 is C1-C4 alkyl optionally substituted with hydroxyl, -NR E R F , or C1-C3 alkoxy. In certain embodiments, at least one of R 6 is methyl optionally substituted with hydroxyl, -NR E R F , or C1-C3 alkoxy. In some embodiments, at least one of R 6 is hydroxymethyl, 2-aminoethyl, or methoxyethyl.
- At least one of R 6 is ethyl optionally substituted with hydroxyl, -NR E R F , or C1-C3 alkoxy. In some embodiments, at least one of R 6 is 1 -hydroxy ethyl or 2-hydroxypropan-2-yl.
- R E and R F are independently hydrogen or C1-C3 alkyl. In some embodiments, one of R E and R F is hydrogen and the other of R E and R F is C1-C3 alkyl. In some embodiments, one of R E and R F is hydrogen and the other of R E and R F is C3-C6 cycloalkyl. In some embodiments, one of R E and R F is C1-C3 alkyl and the other of R E and R F is C3-C6 cycloalkyl. In some embodiments, one of R E and R F is hydrogen and the other of R E and R F is methyl. In some embodiments, one of R E and R F is hydrogen and the other of R E and R F is ethyl.
- one of R E and R F is hydrogen and the other of R E and R F is cyclopropyl. In some embodiments, one of R E and R F is methyl and the other of R E and R F is cyclopropyl. In certain embodiments, R E and R F are both hydrogens. In certain embodiments, R E and R F are both C1-C3 alkyl. In some embodiments, R E and R F are both methyl. In some embodiments, one of R E and R F is methyl and the other of R E and R F is ethyl. In some embodiments, R E and R F are both ethyl.
- R E and R F together with the nitrogen atom to which they are attached come together to form a 4-6 membered heterocyclyl. In certain embodiments, R E and R F together with the nitrogen atom to which they are attached come together to form a 4 membered heterocyclyl. In certain embodiments, R E and R F together with the nitrogen atom to which they are attached come together to form azetidinyl or 2-oxoazetidin-1-yl. In some embodiments, R E and R F together with the nitrogen atom to which they are attached come together to form a 5 membered heterocyclyl.
- R E and R F together with the nitrogen atom to which they are attached come together to form 2-oxopyrrolidin-1-yl. In some embodiments, R E and R F together with the nitrogen atom to which they are attached come together to form a 6 membered heterocyclyl.
- At least one of R 6 is 3-8 membered heterocyclyl. In certain embodiments, at least one of R 6 is 3 membered heterocyclyl. In certain embodiments, at least one of R 6 is 4 membered heterocyclyl. In certain embodiments, at least one of R 6 is 5 membered heterocyclyl. In certain embodiments, at least one of R 6 is 6 membered heterocyclyl. In certain embodiments, at least one of R 6 is 7 membered heterocyclyl. In certain embodiments, at least one of R 6 is 8 membered heterocyclyl. In some embodiments, at least one of R 6 is C3-C6 cycloalkoxy. In some embodiments, at least one of R 6 is cyclopropoxy or cyclobutoxy.
- R 4 is pyridyl, pyrimidinyl, pyrazinyl, pyrrolyl, or imidazolyl; each of which is substituted with 2 R 6 : one R 6 is triazolyl, imidazolyl, oxazolyl, pyrazolyl, or pyrrolidinyl; and the other R 6 is methyl, methoxy, trifluoromethyl, trifluoromethoxy, chloro, or cyano.
- R 4 is pyridyl, pyrimidinyl, or pyrazinyl; each of which is substituted with 2 R 6 : one R 6 is triazolyl, imidazolyl, oxazolyl, pyrazolyl, or pyrrolidinyl; and the other R 6 is methyl, methoxy, trifluoromethyl, trifluoromethoxy, chloro, or cyano.
- R 4 is pyridyl substituted with 2 R 6 : one R 6 is triazolyl, imidazolyl, or oxazolyl; and the other R 6 is methyl, methoxy, trifluoromethyl, trifluoromethoxy, chloro, or cyano.
- each R 6 is independently selected from halogen; cyano; amino; Cl- C3 alkoxy; C1-C3 haloalkyl; C1-C3 haloalkoxy; C1-C3 alkyl; and C3-C6 cycloalkoxy.
- R 4 is 3-pyridyl or 4-pyridyl substituted with 1-3 independently selected R 6 .
- R 4 when R 4 is R 6 is selected from the group consisting of cyano, halogen, C1-C3 haloalkyl optionally substituted with hydroxyl, C1-C3 haloalkoxy, and C1-C3 alkoxy.
- R 4 when R 4 is from the group consisting of cyano, chloro, difluoromethyl, trifluoromethyl, difluoromethoxy, and methoxy. For example, when R 4 is trifluoromethyl (e.g., chloro).
- R 6A is selected from the group consisting of: cyano, fluoro, chloro, methyl, ethyl, methoxy, trifluoromethyl;
- R 6B is selected from the group consisting of: 1,2,3-triazol-2-yl, 4-methyl-1,2,3-triazol-2- yl, 4-methyl-1,2,3-triazol-1-yl, 4-amino-1,2,3-triazol-2-yl, 5-cyano-1,2,3-triazol-1-yl, 1,2,3- triazol- 1 -yl, 3 -methyl- 1 ,2,4-triazol- 1 -yl, 5-methyl- 1 ,2,4-triazol- 1 -yl, 5-amino- 1 ,2,4-triazol- 1 -yl, 1-methyl-5-amino-1,2,4-triazol-3-yl, 1,2,4-triazol-4-on-2-yl, tetrazol-5-yl, 2-methyl-tetrazol-5-yl, 1 -methyl -tetrazol-5-yl, imidazol-1-yl, 1-methyl-imidazol-3-y
- R 6A is selected from the group consisting of: cyano, chloro, methyl, and trifluoromethyl; and R 6B is selected from the group consisting of: 1,2,3-triazol-2-yl, 4-methyl-1,2,3- triazol-2-yl, 4-methyl-1,2,3-triazol-1-yl, 4-amino-1,2,3-triazol-2-yl, 5-cyano-1,2,3-triazol- 1-yl, 1,2, 3 -triazol- 1-yl, 3-methyl-1,2,4-triazol-1-yl, 5-methyl-1,2,4-triazol-1-yl, 5-amino- 1,2,4-triazol-1-yl, 1-methyl-5-amino-1,2,4-triazol-3-yl, and 1,2,4-triazol-4-on-2-yl.
- R 6A is chloro
- R 6B is selected from the group consisting of: 1,2,3-triazol-2-yl, 1,2, 3 -triazol- 1-yl, and 1,2,4-triazol-4-on-2-yl.
- R 6A is selected from the group consisting of: cyano, halogen, C1-C3 alkyl, C1-C3 alkoxy, and C1-C3 haloalkyl;
- R 6A is selected from the group consisting of: cyano, fluoro, chloro, methyl, ethyl, methoxy, trifluoromethyl;
- R 6B is selected from the group consisting of: 1,2,3-triazol-2-yl, 4-methyl-1,2,3- triazol-2-yl, 4-methyl-1,2,3-triazol-1-yl, 4-amino-1,2,3-triazol-2-yl, 5-cyano-1,2,3-triazol- 1-yl, 1,2, 3 -triazol- 1-yl, 3-methyl-1,2,4-triazol-1-yl, 5-methyl-1,2,4-triazol-1-yl, 5-amino- 1,2,4-triazol-1-yl, 1-methyl-5-amino-1,2,4-triazol-3-yl, 1,2,4-triazol-4-on-2-yl, tetrazol-5- yl, 2-methyl-tetrazol-5-yl, 1-methyl-tetrazol-5-yl, imidazol-1-yl, 1-methyl-imidazol-3-yl,
- R 6C is selected from the group consisting of: cyano, fluoro, chloro, methyl, ethyl, methoxy, methyl, and trifluoromethyl.
- R 6A is selected from the group consisting of: cyano, chloro, and trifluoromethyl
- R 6B is selected from the group consisting of: 1,2,3-triazol-2-yl, 4-methyl-1,2,3- triazol-2-yl, 4-methyl-1,2,3-triazol-1-yl, 4-amino-1,2,3-triazol-2-yl, 5-cyano-1,2,3-triazol- 1-yl, 1,2, 3 -triazol- 1-yl, 3-methyl-1,2,4-triazol-1-yl, 5-methyl-1,2,4-triazol-1-yl, 5-amino- 1,2,4-triazol-1-yl, 1-methyl-5-amino-1,2,4-triazol-3-yl, and 1,2,4-triazol-4-on-2-yl; and
- R 6C is selected from the group consisting of: cyano, chloro, methyl, and trifluoromethyl. In some embodiments, when
- R 6A is chloro
- R 6B is selected from the group consisting of: 1,2,3-triazol-2-yl and 1,2,4-triazol-4- on-2-yl;
- R 6C is selected from the group consisting of: cyano, chloro, methyl, and tri fluoromethyl.
- R 5 is hydrogen
- R 5 is halogen.
- R 5 is fluoro.
- R 5 is chloro.
- R 5 is cyano.
- R 5 is hydroxyl.
- R 5 is C1-C3 alkoxy. In some embodiments, R 5 is methoxy or ethoxy.
- R 5 is C1-C3 haloalkoxy. In some embodiments, R 5 is trifluoromethoxy, difluoromethoxy, or fluoromethoxy.
- R 5 is C1-C3 haloalkyl. In some embodiments, R 5 is trifluoromethyl or 2,2,2-trifluoroethyl.
- R 5 is -NR C R D .
- R c and R D are independently hydrogen or C1-C3 alkyl.
- one of R c and R D is hydrogen and the other of R c and R D is C1-C3 alkyl.
- one of R c and R D is hydrogen and the other of R c and R D is methyl.
- one of R c and R D is hydrogen and the other of R c and R D is ethyl.
- R c and R D are both hydrogens.
- R c and R D are both C1-C3 alkyl.
- R c and R D are both methyl.
- one of R c and R D is methyl and the other of R c and R D is ethyl.
- R c and R D are both ethyl.
- R c and R D together with the nitrogen atom to which they are attached come together to form a 4-6 membered heterocyclyl. In certain embodiments, R c and R D together with the nitrogen atom to which they are attached come together to form a 4 membered heterocyclyl. In some embodiments, R c and R D together with the nitrogen atom to which they are attached come together to form a 5 membered heterocyclyl. In some embodiments, R c and R D together with the nitrogen atom to which they are attached come together to form a 6 membered heterocyclyl.
- R 5 is C1-C3 alkyl. In some embodiments, R 5 is methyl or ethyl.
- R x is hydrogen. In some embodiments, R x is halogen. In some embodiments, R x is fluoro. In some embodiments, R x is chloro.
- the compound is a compound selected from Table 1, or a pharmaceutically acceptable salt thereof.
- a process of preparing a compound of Formula (I) comprising: reacting a compound of Formula (I- A) with R 4 -NH 2 ; to form the compound of Formula (I).
- reacting the compound of Formula (I-A) with R 4 -NH 2 is performed in the presence of POCh and pyridine.
- reacting the compound of Formula (I-A) with R 4 -NH 2 is performed in the presence of N,N,N',N' -tetramethylchloroformamidinium hexafluorophosphate (TCFH).
- TCFH N,N,N',N' -tetramethylchloroformamidinium hexafluorophosphate
- reacting the compound of Formula (I-A) with R 4 -NH 2 is performed in the presence of N-methylimidazole (NMI).
- NMI N-methylimidazole
- the compound of Formula (I-A) is prepared from a compound of Formula (I-A-N):
- the process comprises reacting a compound of Formula (I-A-N-i) with a compound of Formula (I-A-N-ii) to form the compound of Formula (I-A-N).
- reacting the compound of Formula (I-A-N-i) with the compound of Formula (I-A-N-ii) is performed in the presence of acid.
- the acid is selected from the group consisting of hydrochloric acid and acetic acid.
- a process of preparing a compound of Formula (I) comprising: reacting a compound of Formula (I-B) with R 4 -Hal, where Hal is selected from the group consisting of Cl, Br, I, and OSO2CF3; to form the compound of Formula (I).
- reacting the compound of Formula (I-B) with R 4 -Hal is performed in the presence of a catalyst and a ligand.
- the catalyst is tris(dibenzylideneacetone)dipalladium(0).
- the ligand is 4,5-bis(diphenylphosphino)- 9,9-dimethylxanthene.
- the compound of Formula (I-B) is prepared from a compound of Formula (I-A-N):
- the process comprises reacting a compound of Formula (I-A-N-i) with a compound of Formula (I-A-N-ii) to form the compound of Formula (I-A-N).
- reacting the compound of Formula (I-A-N-i) with the compound of Formula (I-A-N-ii) is performed in the presence of acid.
- the acid is selected from the group consisting of hydrochloric acid and acetic acid.
- Some embodiments provide a method of treating an autoimmune disorder (e.g., a MALT1- associated autoimmune disorder) in a subject in need of such treatment, the method comprising administering to the subject an effective amount of a compound of Formula (I), or a pharmaceutically acceptable salt thereof or a pharmaceutical composition thereof.
- the autoimmune disorder is rheumatoid arthritis, multiple sclerosis, or systemic lupus erythematosus (SLE).
- Some embodiments provide a method of treating an inflammatory disorder (e.g., a MALT1 -associated inflammatory disorder) in a subject in need of such treatment, the method comprising administering to the subject an effective amount of a compound of Formula (I), or a pharmaceutically acceptable salt thereof or a pharmaceutical composition thereof.
- the inflammatory disorder is chronic graft versus host disease (cGVHD).
- Some embodiments provide a method of treating cancer (e.g., a MALT1 -associated cancer) in a subject in need of such treatment, the method comprising administering to the subject an effective amount of a compound of Formula (I), or a pharmaceutically acceptable salt thereof or a pharmaceutical composition thereof.
- a method for treating a MALT1 -associated cancer in a subject in need of such treatment comprising a) detecting a dysregulation of a MALT1 gene, a MALT1 protease, or the expression or activity or level of any of the same in a sample from the subject; and b) administering an effective amount of a compound of Formula (I), or a pharmaceutically acceptable salt thereof.
- the dysregulation of a MALT1 gene, a MALT1 protease, or the expression or activity or level of any of the same includes one or more fusion proteins.
- the cancer e.g., MALT1 -associated cancer
- the cancer is a hematological cancer.
- the cancer is a solid tumor.
- the cancer e.g., MALT1 -associated cancer
- a lung cancer e.g., small cell lung carcinoma or non-small cell lung carcinoma
- thyroid cancer e.g., papillary thyroid cancer, medullary thyroid cancer (e.g., sporadic medullary thyroid cancer or hereditary medullary thyroid cancer), differentiated thyroid cancer, recurrent thyroid cancer, or refractory differentiated thyroid cancer
- thyroid adenoma endocrine gland neoplasms
- lung adenocarcinoma bronchioles lung cell carcinoma, multiple endocrine neoplasia type 2A or 2B (MEN2A or MEN2B, respectively)
- pheochromocytoma parathyroid hyperplasia
- breast cancer mammary cancer
- mammary carcinoma mammary neoplasm
- colorectal cancer e.g., metastatic colorectal cancer
- papillary renal cell carcinoma e.g., papillary renal
- the cancer e.g., MALT1 -associated cancer
- ALL acute lymphoblastic leukemia
- AML acute myeloid leukemia
- cancer in adolescents adrenocortical carcinoma
- anal cancer appendix cancer
- astrocytoma atypical teratoid/rhabdoid tumor
- basal cell carcinoma basal cell carcinoma
- bile duct cancer bladder cancer
- AML acute my
- the cancer is a hematological cancer, such as a leukemia or a lymphoma.
- a hematological cancer e.g., hematological cancers that are MALT1 -associated cancers
- leukemias lymphomas (nonHodgkin's lymphoma), Hodgkin's disease (also called Hodgkin's lymphoma), and myeloma, for instance, acute lymphocytic leukemia (ALL), acute myeloid leukemia (AML), acute promyelocytic leukemia (APL), chronic lymphocytic leukemia (CLL), chronic myeloid leukemia (CML), chronic myelomonocytic leukemia (CMML), chronic neutrophilic leukemia (CNL), acute undifferentiated leukemia (AUL), anaplastic large-cell lymphoma (ALCL), prolymphocytic leukemia (PML
- ALL acute lymphocytic leukemia
- hematological cancers include myeloproliferative disorders (MPD) such as polycythemia vera (PV), essential thrombocytopenia (ET) and idiopathic primary myelofibrosis (IMF/IPF/PMF).
- MPD myeloproliferative disorders
- PV polycythemia vera
- ET essential thrombocytopenia
- IMF/IPF/PMF idiopathic primary myelofibrosis
- the hematological cancer e.g., the hematological cancer that is a MALT1 -associated cancer
- AML or CMML.
- the cancer is glioblastoma, chronic myelogenous leukemia, myeloid leukemia, or non-Hodgkin’s lymphoma.
- the cancer e.g., the MALT1 -associated cancer
- the cancer is a solid tumor.
- solid tumors e.g., solid tumors that are MALT1 -associated cancers
- lung cancer e.g., lung adenocarcinoma, small-cell lung carcinoma
- pancreatic cancer pancreatic ductal carcinoma
- breast cancer colon cancer
- colorectal cancer prostate cancer
- renal cell carcinoma neuroblastoma
- neuroblastoma melanoma.
- the subject is a human.
- Compounds of Formula (I) and pharmaceutically acceptable salts thereof are also useful for treating a MALT1 -associated cancer.
- Compounds of Formula (I) and pharmaceutically acceptable salts thereof are also useful for treating a MALT1 -associated autoimmune disorder.
- Compounds of Formula (I) and pharmaceutically acceptable salts thereof are also useful for treating a MALT1 -associated inflammatory disease.
- a method for treating a subject diagnosed with or identified as having a MALT1 -associated cancer comprising administering to the subject an effective amount of a compound of Formula (I), or a pharmaceutically acceptable salt thereof, or a pharmaceutical composition thereof as defined herein.
- a compound of Formula (I) is selected from Examples 1-168.
- Dysregulation of a MALT1 protease, a MALT1 gene, or the expression or activity or level of any (e.g., one or more) of the same can contribute to tumorigenesis.
- a fusion protein can have increased protease activity as compared to a wild-type MALT1 protein, increased expression (e.g., increased levels) of a wild-type MALT1 protease in a mammalian cell can occur due to aberrant cell signaling and/or dysregulated autocrine/paracrine signaling (e.g., as compared to a control non-cancerous cell), MALT1 mRNA splice variants may also result in dysregulation of MALT1 .
- provided herein is a method for treating cancer in a subj ect in need thereof, including administering to the subject an effective amount of a compound of Formula (I), or a pharmaceutically acceptable salt thereof.
- a method for treating a CBM complex pathway-associated cancer such as any of those disclosed herein
- a method for treating a cancer in a subject in need thereof including (a) identifying the cancer as being a CBM complex pathway- associated cancer; and (b) administering to the subject an effective amount of a compound of Formula (I), or a pharmaceutically acceptable salt thereof.
- Identifying the cancer identifying the cancer in the subject as a CBM complex pathway- associated cancer can be performed by any appropriate method.
- the step of identifying the cancer in the subject as a CBM complex pathway-associated cancer includes performing an assay to detect dysregulation in a CBM complex pathway-associated gene, a CBM complex pathway-associated protease protein, or expression or activity or level of any of the same in a sample from the subject.
- the method further includes obtaining a sample from the subject (e.g., a biopsy sample).
- An assay can be any appropriate assay.
- the assay is selected from the group consisting of sequencing (e.g., pyrosequencing or next generation sequencing), immunohistochemistry, enzyme-linked immunosorbent assay, and fluorescence in situ hybridization (FISH).
- Also provided herein is a method for treating a cancer in a subject in need thereof, including administering to the subject an effective amount of a compound of Formula (I), or a pharmaceutically acceptable salt thereof to a subject identified as having a CBM complex pathway-associated cancer. Also provided herein is a method of treating a MALT1 -associated cancer in a subject, including administering to a subject identified or diagnosed as having a MALT1 -associated cancer an effective amount of a compound of Formula (I), or a pharmaceutically acceptable salt thereof.
- a method for treating cancer in a subject in need thereof including: (a) determining that the cancer is associated with a dysregulation of a MALT1 gene, a MALT1 protease, or expression or activity or level of any of the same; and (b) administering to the subject an effective amount of a compound of Formula (I), or a pharmaceutically acceptable salt thereof.
- the step of determining that the cancer in the subject is a MALT1 -associated cancer includes performing an assay to detect dysregulation in a MALT1 gene, a MALT1 protease protein, or expression or activity or level of any of the same in a sample from the subject.
- the method further includes obtaining a sample from the subject (e.g., a biopsy sample).
- An assay can be any appropriate assay.
- the assay is selected from the group consisting of sequencing (e.g., pyrosequencing or next generation sequencing), immunohistochemistry, enzyme-linked immunosorbent assay, and fluorescence in situ hybridization (FISH).
- a CBM complex pathway-associated cancer can be any appropriate CBM complex pathway-associated cancer (such as any of those described herein).
- a CBM complex pathway-associated cancer is selected from the group consisting of a CBM complex pathway cell surface receptor-associated cancer, a cancer associated with a signal transducer between a cell surface receptor and a CBM complex, a component of a CBM complex-associated cancer, a MALT1 protease substrate-associated cancer, a cancer associated with a component of the NF-excellentB pathway downstream of a CBM complex, a cancer associated with a component of the JNK pathway downstream of a CBM complex, and a combination thereof.
- the CBM complex pathway cell surface receptor-associated cancer is selected from the group consisting of a CD28-associated cancer, a BCR-associated cancer, a HER1- associated cancer, a HER2-associated cancer, and combinations thereof.
- the cancer associated with a signal transducer between a cell surface receptor and a CBM complex is a protein kinase C beta (PKC ⁇ )-associated cancer, a protein kinase C theta (PCK ⁇ )-associated cancer, or a combination thereof.
- the component of a CBM complex- associated cancer is selected from the group consisting of a MALT1 -associated cancer, a CARD11 -associated cancer, a CARD14-associated cancer, a CARDlO-associated cancer, a CARD9-associated cancer, a BCL10-associated cancer, and combinations thereof.
- the component of a CBM complex-associated cancer is selected from the group consisting of a MALT1 -associated cancer, a CARD11 -associated cancer, a BCL10-associated cancer, and combinations thereof. See, e.g., Tables Bl, B2, and B3 for exemplary dysregulations in MALT1, CARD11, and BCL10.
- the MALT1 protease substrate-associated cancer is selected from the group consisting of a BCL10-associated cancer, an A20- associated cancer, a CYLD-associated cancer, a RelB-associated cancer, a Regnase 1 -associated cancer, a roquin-1 -associated cancer, a HOIL1 -associated cancer, a NIK associated cancer, a LIMA1a-associated cancer, and a combination thereof.
- the MALT1 protease substrate-associated cancer is selected from the group consisting of a BCL10-associated cancer, an A20-associated cancer, a CYLD-associated cancer, and combinations thereof.
- the cancer associated with a component of the NF-excellentB pathway downstream of a CBM complex is selected from the group consisting of a TAKl-associated cancer, a TRAF6-associated cancer, a TAB 1 -associated cancer, a TAB2-associated cancer, a TAB3 -associated cancer, a MKK7- associated cancer, an IKK ⁇ -associated cancer, an IKK ⁇ -associated cancer, an IKKy-associated cancer, an IkB ⁇ -associated cancer, a p50-associated cancer, a p65 (RelA)-associated cancer, a c- Rel-associated cancer, and combinations thereof.
- the cancer associated with a component of the NF-excellentB pathway downstream of a CBM complex is an IKKy-associated cancer.
- the cancer associated with a component of the JNK pathway downstream of a CBM complex is selected from the group consisting of a JNK 1 -associated cancer, a JNK2- associated cancer, a JNK3 -associated cancer, a MYD88 transcription factor-associated cancer, an AP-1 transcription factor-associated cancer, and combinations thereof.
- the CBM complex pathway-associated cancer is a MALT1- associated cancer.
- a MALT1 -associated cancer can have any appropriate dysregulation, such as any of those described herein.
- the MALT1 -associated cancer comprises an IAP2-MALT1 fusion.
- the MALT1 -associated cancer comprises an IGH- MALT1 fusion.
- a method for treating an autoimmune disorder in a subject in need thereof including: (a) determining that the autoimmune disorder is associated with a dysregulation of a MALT1 gene, a MALT1 protease, or expression or activity or level of any of the same; and (b) administering to the subject an effective amount of a compound of Formula (I), or a pharmaceutically acceptable salt thereof.
- a method of treating a MALT1 -associated autoimmune disorder in a subject including administering an effective amount of a compound of Formula (I), or a pharmaceutically acceptable salt thereof to a subj ect determined to have a MALT1 -associated autoimmune disorder.
- provided herein is a method for treating an inflammatory disorder in a subject in need thereof, including administering to the subject an effective amount of a compound of Formula (I), or a pharmaceutically acceptable salt thereof.
- a method of treating a MALT1 -associated inflammatory disorder in a subject including administering to a subject identified or diagnosed as having a MALT1 -associated inflammatory disorder an effective amount of a compound of Formula (I), or a pharmaceutically acceptable salt thereof.
- Also provided herein is a method for treating an inflammatory disorder in a subject in need thereof, including: (a) determining that the inflammatory disorder is associated with a dysregulation of a MALT1 gene, a MALT1 protease, or expression or activity or level of any of the same; and (b) administering to the subject an effective amount of a compound of Formula (I), or a pharmaceutically acceptable salt thereof.
- a method of treating a MALT1 -associated inflammatory disorder in a subject including administering an effective amount of a compound of Formula (I), or a pharmaceutically acceptable salt thereof to a subject determined to have a MALT1 -associated inflammatory disorder
- a method for treating a CBM complex pathway-associated disease or disorder in a subject in need thereof including administering to the subject an effective amount of a compound of Formula (I), or a pharmaceutically acceptable salt thereof.
- a method for treating a disease or disorder in a subject in need thereof including: (a) identifying the cancer as being a CBM complex pathway-associated disease or disorder; and (b) administering to the subject an effective amount of a compound of Formula (I), or a pharmaceutically acceptable salt thereof.
- a method for treating a disease or disorder in a subject in need thereof including: administering to the subject an effective amount of a compound of Formula (I), or a pharmaceutically acceptable salt thereof to a subject identified as having a CBM complex pathway-associated disease or disorder.
- a CBM complex pathway-associated disease or disorder can be any appropriate CBM complex pathway-associated disease or disorder, such as any of those described herein.
- the CBM complex pathway-associated disease or disorder is an autoimmune disease.
- the CBM complex pathway-associated disease or disorder is an inflammatory disease.
- the CBM complex pathway-associated cancer is selected from the group consisting of a CBM complex pathway cell surface receptor-associated cancer, a disease or disorder associated with a signal transducer between a cell surface receptor and a CBM complex, a component of a CBM complex-associated cancer, a MALT1 protease substrate-associated cancer, a disease or disorder associated with a component of the NF-excellentB pathway downstream of a CBM complex, a disease or disorder associated with a component of the JNK pathway downstream of a CBM complex, and a combination thereof.
- the CBM complex pathway-associated disease or disorder is a MALT1 -associated disease or disorder.
- compounds of Formula (I), or a pharmaceutically acceptable salt thereof can be useful for inhibiting the processes of cells, such as inhibiting the proliferation of cells. Accordingly, provided herein is a method for inhibiting mammalian cell proliferation, including contacting the mammalian cell with a compound of Formula (I), or a pharmaceutically acceptable salt thereof. Also provided herein is a method for inhibiting CBM complex pathway activity in a mammalian cell, including contacting the mammalian cell with a compound of Formula (I), or a pharmaceutically acceptable salt thereof.
- a method for inhibiting MALT1 protease activity in a mammalian cell including contacting the mammalian cell with a compound of Formula (I), or a pharmaceutically acceptable salt thereof.
- the contacting occurs in vivo.
- the contacting occurs in vitro.
- a mammalian cell can be any appropriate cell.
- the mammalian cell is a mammalian immune cell.
- the mammalian cell is a mammalian cancer cell.
- the mammalian cancer cell is a mammalian CBM complex pathway-associated cancer cell.
- the mammalian cancer cell is a mammalian MALT1 -associated cancer cell.
- the mammalian cell has dysregulation of a MALT1 gene, a MALT1 protease protein, or expression or activity or level of any of the same.
- the dysregulation of a MALT1 gene, a MALT1 protease protein, or expression or activity or level of any of the same is an IAP2-MALT1 fusion, an IGH-MALT1 fusion, or a combination thereof.
- Compounds of Formula (I), or a pharmaceutically acceptable salt thereof can also be useful in the manufacture of medicaments. Accordingly, provided herein is a use of a compound of Formula (I), or a pharmaceutically acceptable salt thereof in the manufacture of a medicament for the treatment of a CBM complex pathway-associated disease or disorder.
- a CBM complex pathway-associated disease or disorder can be any appropriate CBM complex pathway-associated disease or disorder, such as those described herein.
- the CBM complex pathway-associated disease or disorder is selected from the group consisting of a CBM complex pathway cell surface receptor-associated cancer, a disease or disorder associated with a signal transducer between a cell surface receptor and a CBM complex, a component of a CBM complex- associated cancer, a MALT1 protease substrate-associated cancer, a disease or disorder associated with a component of the NF-excellentB pathway downstream of a CBM complex, a disease or disorder associated with a component of the JNK pathway downstream of a CBM complex, and a combination thereof.
- the CBM complex pathway-associated disease or disorder is a CBM complex pathway-associated autoimmune disorder.
- the CBM complex pathway-associated disease or disorder is a CBM complex pathway-associated inflammatory disorder. In some embodiments, the CBM complex pathway-associated disease or disorder is a CBM complex pathway-associated cancer. In some embodiments, the CBM complex pathway-associated disease or disorder is a MALT1 -associated disease or disorder. In some embodiments, the MALT1 -associated disease or disorder comprises a dysregulation of a MALT1 gene, a MALT1 protease protein, or expression or activity or level of any of the same.
- the dysregulation of a MALT1 gene, a MALT1 protease protein, or expression or activity or level of any of the same is an IAP2-MALT1 fusion, an IGH-MALT1 fusion, or a combination thereof.
- the compounds provided herein exhibit brain and/or central nervous system (CNS) penetrance. Such compounds are capable of crossing the blood brain barrier and inhibiting a MALT1 protease in the brain and/or other CNS structures. In some embodiments, the compounds provided herein are capable of crossing the blood brain barrier in an effective amount.
- treatment of a subject with cancer e.g., a MALT1 -associated cancer such as a MALT1 -associated brain or CNS cancer
- administration e.g., oral administration
- the compounds provided herein are useful for treating a primary brain tumor or metastatic brain tumor.
- the compounds can be used in the treatment of one or more of gliomas such as glioblastoma (also known as glioblastoma multiforme), astrocytomas, oligodendrogliomas, ependymomas, and mixed gliomas, meningiomas, medulloblastomas, gangliogliomas, schwannomas (neurilemmomas), and craniopharyngiomas (see, for example, the tumors listed in Louis, D.N. et al. Acta Neuropathol 131(6), 803-820 (June 2016)).
- the brain tumor is a primary brain tumor.
- the subject has previously been treated with another anticancer agent, e.g., another protease inhibitor (e.g., a compound that is not a compound of Formula (I)).
- another anticancer agent e.g., another protease inhibitor (e.g., a compound that is not a compound of Formula (I)).
- the brain tumor is a metastatic brain tumor.
- the subject has previously been treated with another anticancer agent, e.g., another protease inhibitor (e.g., a compound that is not a compound of Formula (I)).
- an assay used to determine whether the subject has a dysregulation of a gene e.g., a MALT1 gene
- a protein e.g., a MALT1 protein
- expression or activity or level of any of the same using a sample from a subject can include, for example, next generation sequencing, immunohistochemistry, fluorescence microscopy, break apart FISH analysis, Southern blotting, Western blotting, FACS analysis, Northern blotting, and PCR-based amplification (e.g., RT-PCR and quantitative real-time RT-PCR).
- the assays are typically performed, e.g., with at least one labelled nucleic acid probe or at least one labelled antibody or antigen-binding fragment thereof. Assays can utilize other detection methods known in the art for detecting dysregulation of a gene (e.g., a MALT1 gene), a protein (e.g., a MALT1 protein), or expression or activity or levels of any of the same.
- the sample is a biological sample or a biopsy sample (e.g., a paraffin-embedded biopsy sample) from the subject.
- the subject is a subject suspected of having a MALT1 -associated cancer, a subject having one or more symptoms of a MALT1 -associated cancer, and/or a subject that has an increased risk of developing a MALT1- associated cancer).
- dysregulation of a gene e.g., a MALT1 gene
- a MALT1 protein e.g., a MALT1 protein
- the expression or activity or level of any of the same can be identified using a liquid biopsy (variously referred to as a fluid biopsy or fluid phase biopsy).
- Liquid biopsy methods can be used to detect total tumor burden and/or the dysregulation of a gene (e.g., a MALT1 protein), a MALT1 protein (e.g., a MALT 1 protein), or the expression or activity or level of any of the same.
- Liquid biopsies can be performed on biological samples obtained relatively easily from a subject (e.g., via a simple blood draw) and are generally less invasive than traditional methods used to detect tumor burden and/or dysregulation of a gene (e.g., a MALT1 gene), a protein (e.g., a MALT1 protein), or the expression or activity or level of any of the same.
- a gene e.g., a MALT1 gene
- a protein e.g., a MALT1 protein
- liquid biopsies can be used to detect the presence of dysregulation of a gene (e.g., a MALT1 gene), a protein (e.g., a MALT1 protein), or the expression or activity or level of any of the same at an earlier stage than traditional methods.
- the biological sample to be used in a liquid biopsy can include, blood, plasma, urine, cerebrospinal fluid, saliva, sputum, broncho-alveolar lavage, bile, lymphatic fluid, cyst fluid, stool, ascites, and combinations thereof.
- a liquid biopsy can be used to detect circulating tumor cells (CTCs).
- CTCs circulating tumor cells
- a liquid biopsy can be used to detect cell-free DNA.
- cell-free DNA detected using a liquid biopsy is circulating tumor DNA (ctDNA) that is derived from tumor cells.
- Analysis of ctDNA can be used to identify dysregulation of a gene (e.g., a MALT1 gene), a protein (e.g., a MALT1 protein), or the expression or activity or level of any of the same.
- a gene e.g., a MALT1 gene
- a protein e.g., a MALT1 protein
- ctDNA derived from a single gene can be detected using a liquid biopsy.
- ctDNA derived from a plurality of genes e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100 or more, or any number of genes in between these numbers
- a liquid biopsy e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100 or more, or any number of genes in between these numbers
- ctDNA derived from a plurality of genes can be detected using any of a variety of commercially - available testing panels (e.g., commercially available testing panels designed to detect dysregulation of a gene (e.g., a MALT1 gene), a protein (e.g., a MALT1 protein), or the expression or activity or level of any of the same).
- a gene e.g., a MALT1 gene
- a protein e.g., a MALT1 protein
- Liquid biopsies can be used to detect dysregulation of a gene (e.g., a MALT1 gene), a protein (e.g., a MALT1 protein), or the expression or activity or level of any of the same including, without limitation, point mutations or single nucleotide variants (SNVs), copy number variants (CNVs), genetic fusions (e.g., translocations or rearrangements), insertions, deletions, or any combination thereof.
- a liquid biopsy can be used to detect a germline mutation.
- a liquid biopsy can be used to detect a somatic mutation.
- a liquid biopsy can be used to detect a primary genetic mutation (e.g., a primary mutation or a primary fusion that is associated with initial development of a disease, e.g., cancer).
- a dysregulation of a gene e.g., a MALT1 gene
- a protein e.g., a MALT1 protein
- the expression or activity or level of any of the same identified using a liquid biopsy is also present in a cancer cell that is present in the subject (e.g., in a tumor).
- any of the types of dysregulation of a gene e.g., a MALT1 gene
- a protein e.g., a MALT1 protein
- the expression or activity or level of any of the same described herein can be detected using a liquid biopsy.
- a genetic mutation identified via a liquid biopsy can be used to identify the subject as a candidate for a particular treatment.
- detection of dysregulation of a gene e.g., a MALT1 gene
- a protein e.g., a MALT1 protein
- the expression or activity or level of any of the same in the subject can indicate that the subject will be responsive to a treatment that includes administration of a compound of Formula (I), or a pharmaceutically acceptable salt thereof.
- Liquid biopsies can be performed at multiple times during a course of diagnosis, a course of monitoring, and/or a course of treatment to determine one or more clinically relevant parameters including, without limitation, progression of the disease and/or efficacy of a treatment.
- a first liquid biopsy can be performed at a first time point and a second liquid biopsy can be performed at a second time point during a course of diagnosis, a course of monitoring, and/or a course of treatment.
- the first time point can be a time point prior to diagnosing a subject with a disease (e.g., when the subject is healthy), and the second time point can be a time point after subject has developed the disease (e.g., the second time point can be used to diagnose the subject with the disease).
- the first time point can be a time point prior to diagnosing a subject with a disease (e.g., when the subject is healthy), after which the subject is monitored, and the second time point can be a time point after monitoring the subject.
- the first time point can be a time point after diagnosing a subject with a disease, after which a treatment is administered to the subject, and the second time point can be a time point after the treatment is administered; in such cases, the second time point can be used to assess the efficacy of the treatment (e.g., if the genetic mutation(s) detected at the first time point are reduced in abundance or are undetectable).
- a treatment to be administered to a subject can include a compound of Formula (I), or a pharmaceutically acceptable salt thereof.
- the efficacy of a compound of Formula (I), or a pharmaceutically acceptable salt thereof can be determined by assessing the allele frequency of a dysregulation of a gene (e.g., a MALT1 gene) in cfDNA obtained from a subject at different time points, e.g., cfDNA obtained from the subject at a first time point and cfDNA obtained from the subject at a second time point, where at least one dose of a compound of Formula (I), or a pharmaceutically acceptable salt thereof, is administered to the subject between the first and second time points.
- Some embodiments of these methods can further include administering to the subject at least one dose of the compound of Formula (I), or a pharmaceutically acceptable salt thereof, between the first and second time points.
- a reduction e.g., a 1% to about a 99% reduction, a 1% to about a 95% reduction, a 1% to about a 90% reduction, a 1% to about a 85% reduction, a 1% to about a 80% reduction, a 1% to about a 75% reduction, a 1% reduction to about a 70% reduction, a 1% reduction to about a 65% reduction, a 1% reduction to about a 60% reduction, a 1% reduction to about a 55% reduction, a 1% reduction to about a 50% reduction, a 1% reduction to about a 45% reduction, a 1% reduction to about a 40% reduction, a 1% reduction to about a 35% reduction, a 1% reduction to about a 30% reduction, a 1% reduction to about a 25% reduction, a 1% reduction to about a 20% reduction, a 1% reduction to about a 15% reduction, a 1% reduction to about a 10% reduction, a 1% to about a 5% reduction, a
- the AF is reduced such that the level is below the detection limit of the instrument.
- an increase in the allele frequency (AF) of the dysregulation of a gene (e.g., MALT1 gene) in the cfDNA obtained from the subject at the second time point as compared to the allele frequency (AF) of the dysregulation of a gene (e.g., MALT1 gene) in the cfDNA obtained from the subject at the first time point indicates that the compound of Formula (I), or a pharmaceutically acceptable salt thereof, was not effective in the subject.
- Some embodiments of these methods can further include, administering additional doses of a compound of Formula (I), or a pharmaceutically acceptable salt thereof, to a subject in which a compound of Formula (I), or a pharmaceutically acceptable salt thereof, was determined to be effective. Some embodiments of these methods can further include, administering a different treatment (e.g., a treatment that does not include the administration of a compound of Formula (I), or a pharmaceutically acceptable salt thereof, as a monotherapy) to a subject in which a compound of Formula (I), or a pharmaceutically acceptable salt thereof, was determined not to be effective.
- a different treatment e.g., a treatment that does not include the administration of a compound of Formula (I), or a pharmaceutically acceptable salt thereof, as a monotherapy
- the time difference between the first and second time points can be about 1 day to about 1 year, about 1 day to about 11 months, about 1 day to about 10 months, about 1 day to about 9 months, about 1 day to about 8 months, about 1 day to about 7 months, about 1 day to about 6 months, about 1 day to about 5 months, about 1 day to about 4 months, about 1 day to about 3 months, about 1 day to about 10 weeks, about 1 day to about 2 months, about 1 day to about 6 weeks, about 1 day to about 1 month, about 1 day to about 25 days, about 1 day to about 20 days, about 1 day to about 15 days, about 1 day to about 10 days, about 1 day to about 5 days, about 2 days to about 1 year, about 5 days to about 1 year, about 10 days to about 1 year, about 15 days to about 1 year, about 20 days to about 1 year, about 25 days to about 1 year, about 1 month to about 1 year, about 6 weeks to about 1 year, about 2 months to about 1 year, about 3 months to about 1 year, about 4 months to
- the subject can be previously identified as having a cancer having a dysregulated gene (e.g., any of the examples of a dysregulated gene described herein) (e.g., a MALT1 gene).
- a subject can have been previously diagnosed as having any of the types of cancer described herein.
- the subject can have one or more metastases (e.g., one or more brain metastases).
- the cfDNA comprises ctDNA such as MALT1- associated ctDNA.
- the cfDNA is ctDNA such as MALT1 -associated ctDNA.
- at least some portion of cfDNA is determined to be MALT1 -associated ctDNA, for example, a sequenced and/or quantified amount of the total cfDNA is determined to have a MALT1 fusion and/or overexpression of MALT1.
- compositions provided herein may be, for example, surgery, radiotherapy, and chemotherapeutic agents, such as other protease inhibitors, kinase inhibitors, signal transduction inhibitors, and/or monoclonal antibodies.
- chemotherapeutic agents such as other protease inhibitors, kinase inhibitors, signal transduction inhibitors, and/or monoclonal antibodies.
- a surgery may be open surgery or minimally invasive surgery.
- Compounds of Formula (I), or a pharmaceutically acceptable salt thereof therefore may also be useful as adjuvants to cancer treatment, that is, they can be used in combination with one or more additional therapies or therapeutic agents, for example, a chemotherapeutic agent that works by the same or by a different mechanism of action.
- a compound of Formula (I), or a pharmaceutically acceptable salt thereof can be used prior to administration of an additional therapeutic agent or additional therapy.
- a subject in need thereof can be administered one or more doses of a compound of Formula (I), or a pharmaceutically acceptable salt thereof for a period of time and then undergo at least partial resection of the tumor.
- the treatment with one or more doses of a compound of Formula (I), or a pharmaceutically acceptable salt thereof reduces the size of the tumor (e.g., the tumor burden) prior to the at least partial resection of the tumor.
- a subject in need thereof can be administered one or more doses of a compound of Formula (I), or a pharmaceutically acceptable salt thereof for a period of time and under one or more rounds of radiation therapy.
- the treatment with one or more doses of a compound of Formula (I), or a pharmaceutically acceptable salt thereof reduces the size of the tumor (e.g., the tumor burden) prior to the one or more rounds of radiation therapy.
- a subject has a cancer (e.g., a locally advanced or metastatic tumor) that is refractory or intolerant to standard therapy (e.g., administration of a chemotherapeutic agent), such as a first MALT1 inhibitor, a kinase inhibitor, immunotherapy, cell or gene therapy, or radiation (e.g., radioactive iodine).
- a chemotherapeutic agent such as a first MALT1 inhibitor, a kinase inhibitor, immunotherapy, cell or gene therapy, or radiation (e.g., radioactive iodine).
- a subject has a cancer (e.g., a locally advanced or metastatic tumor) that is refractory or intolerant to prior therapy (e.g., administration of a chemotherapeutic agent, such as a first MALT1 inhibitor or another protease inhibitor, immunotherapy, cell or gene therapy, or radiation (e.g., radioactive iodine).
- a subject has a cancer (e.g., a locally advanced or metastatic tumor) that has no standard therapy.
- a subject is MALT1 -protease inhibitor naive.
- the subject is naive to treatment with a selective MALT1 -protease inhibitor.
- a subject is not MALT1 -protease inhibitor naive.
- the compound of Formula (I), or a pharmaceutically acceptable salt thereof is administered in combination with an effective amount of at least one additional therapeutic agent selected from one or more additional therapies or therapeutic (e.g., chemotherapeutic or immunomodulatory) agents.
- An additional therapy or therapeutic agent can be any appropriate additional therapy or therapeutic agent, such as any of those described herein.
- Non-limiting examples of additional therapeutic agents include: other MALT1 -targeted therapeutic agents (i.e. a first or second MALT1 protease inhibitor, e.g., JNJ-67856633 or CTX- 177), other protease inhibitors, kinase inhibitors (e.g., receptor tyrosine kinase-targeted therapeutic agents such as BTK or EGFR inhibitors), signal transduction pathway inhibitors, checkpoint inhibitors, modulators of the apoptosis pathway (e.g., venetoclax or obataclax); cytotoxic chemotherapeutics, angiogenesis-targeted therapies, immune-targeted agents (including antibody and cell-based immunotherapies, and antibody-drug conjugates) and radiotherapy.
- MALT1 -targeted therapeutic agents i.e. a first or second MALT1 protease inhibitor, e.g., JNJ-67856633 or CTX- 177
- the compound of Formula (I), or a pharmaceutically acceptable salt thereof, and the additional therapeutic agent are administered simultaneously as separate dosages. In some embodiments, the compound of Formula (I), or a pharmaceutically acceptable salt thereof, and the additional therapeutic agent are administered as separate dosages sequentially in any order.
- the other MALT1 -targeted therapeutic is another protease inhibitor exhibiting MALT1 inhibition activity. In some embodiments, the other MALT1 -targeted therapeutic inhibitor is selective for a MALT1 protease.
- Exemplary MALT1 protease inhibitors can exhibit inhibition activity (ICso) against a MALT1 protease of less than about 1000 nM, less than about 500 nM, less than about 200 nM, less than about 100 nM, less than about 50 nM, less than about 25 nM, less than about 10 nM, or less than about 1 nM as measured in an assay as described herein.
- a MALT1 protease inhibitors can exhibit inhibition activity (ICso) against a MALT1 protease of less than about 25 nM, less than about 10 nM, less than about 5 nM, or less than about 1 nM as measured in an assay as provided herein.
- Non-limiting examples of protease-targeted therapeutic agents include JNJ-67856633 and CTX-177.
- Non-limiting examples of multi-kinase inhibitors include alectinib (9-Ethyl-6,6-dimethyl- 8-[4-(morpholin-4-yl)piperidin- 1 -y 1 ] - 11 -oxo-6, 11 -dihydro-5H-benzo[b]carbazole-3 - carbonitrile); amuvatinib (MP470, HPK56) (N-(l,3-benzodioxol-5-ylmethyl)-4- ([l]benzofuro[3,2-d]pyrimidin-4-yl)piperazine-l -carbothioamide); apatinib (YN968D1) (N-[4- (1 -cyanocyclopentyl) phenyl-2-(4-picolyl)amino-3 -Nicotinamide methanesulphonate); cabozantinib (Cometriq XL-184) (N-(4-((6,
- Non-limiting examples of receptor tyrosine kinase (e.g., Trk) targeted therapeutic agents include afatinib, cabozantinib, cetuximab, crizotinib, dabrafenib, entrectinib, erlotinib, gefitinib, imatinib, lapatinib, lestaurtinib, nilotinib, pazopanib, panitumumab, pertuzumab, sunitinib, trastuzumab, 1-((3S,4R)-4-(3-fluorophenyl)-1-(2-methoxyethyl)pyrrolidin-3-yl)-3-(4-methyl-3-(2- methylpyrimidin-5-yl)-l -phenyl- 1H-pyrazol-5-yl)urea, AG 879, AR-772, AR-786, AR-256, AR- 618,
- the additional therapeutic agent is a BRAF inhibitor.
- BRAF inhibitor include dabrafenib, vemurafenib (also called RG7204 or PLX4032), sorafenib tosylate, PLX-4720, GDC-0879, BMS-908662 (Bristol-Meyers Squibb), LGX818 (Novartis), PLX3603 (Hofmann-LaRoche), RAF265 (Novartis), RO5185426 (Hofmann- LaRoche), and GSK2118436 (GlaxoSmithKline). Additional examples of a BRAF inhibitor are known in the art.
- the additional therapeutic agent is an epidermal growth factor receptor typrosine kinase inhibitor (EGFR).
- EGFR inhibitors can include osimertinib (merelectinib, Tagrisso), erlotinib (Tarceva), gefitinib (Iressa), cetuximab (Erbitux), necitumumab (Portrazza), neratinib (Nerlynx), lapatinib (Tykerb), panitumumab (Vectibix), and vandetanib (Caprelsa).
- the additional therapeutic agent is a Ras-Raf-MEK-ERK pathway inhibitors (e.g., binimetinib, selumetinib, encorafenib, sorafenib, trametinib, and vemurafenib), PI3K-Akt-mTOR-S6K pathway inhibitors (e.g., everolimus, rapamycin, perifosine, temsirolimus), and other kinase inhibitors, such as baricitinib, brigatinib, capmatinib, danusertib, ibrutinib, milciclib, quercetin, regorafenib, ruxolitinib, semaxanib, AP32788, BLU285, BLU554, INCB39110, INCB40093, INCB50465, INCB52793, INCB54828, MGCD265, NMS-088, NMS-
- the additional therapeutic agent is a BTK inhibitor.
- BTK inhibitors include ibrutinib, acalabrutinib, and zanubrutinib.
- the additional therapeutic agent is a Bcl-2 inhibitor.
- Bcl-2 inhibitors include venetoclax, navitoclax, oblimersen, obatoclax, and AT-101.
- the additional therapeutic agent is a PI3K inhibitor.
- PI3K inhibitors include idelali sib, copanlisib, duvelisib, alpelisib, taselisib, buparlisib, umbralisib, and copanlisib.
- the additional therapeutic agent is a mTOR inhibitor.
- mTOR inhibitors include everolimus, temsirolimus, and ridaforolimus.
- the additional therapeutic agent is a HD AC inhibitor.
- HD AC inhibitors include vorinostat, romidepsin, belinostat, chidamide, panobinostat, CXD101, and abexinostat.
- the additional therapeutic agent is a checkpoint inhibitor.
- checkpoint inhibitors include ipilimumab, tremelimumab, nivolumab, pidilizumab, MPDL3208A, MEDI4736, MSB0010718C, BMS-936559, BMS-956559, BMS- 935559 (MDX-1105), AMP-224, and pembrolizumab.
- the additional therapeutic agent is a cytotoxic chemotherapeutic.
- cytotoxic chemotherapeutics include arsenic trioxide, bleomycin, bendamustine, cabazitaxel, capecitabine, carboplatin, cisplatin, cyclophosphamide, cytarabine, dacarbazine, daunorubicin, docetaxel, doxorubicin, etoposide, fluorouracil, gemcitabine, irinotecan, lomustine, methotrexate, mitomycin C, oxaliplatin, paclitaxel, pemetrexed, temozolomide, and vincristine.
- the additional therapeutic agent is an angiogenesis-targeted therapeutic.
- angiogenesis-targeted therapies include lenalidomide, enzastaurine, aflibercept, and bevacizumab.
- an additional therapy or therapeutic agent can include a histidyl- tRNA synthetase (HRS) polypeptide or an expressible nucleotide that encodes the HRS polypeptide.
- HRS histidyl- tRNA synthetase
- an immunotherapy refers to an agent that modulates the immune system.
- an immunotherapy can increase the expression and/or activity of a regulator of the immune system.
- an immunotherapy can decrease the expression and/or activity of a regulator of the immune system.
- an immunotherapy can recruit and/or enhance the activity of an immune cell.
- the immunotherapy is a cellular immunotherapy (e.g., adoptive T- cell therapy, dendritic cell therapy, natural killer cell therapy).
- the cellular immunotherapy is sipuleucel-T (APC8015; ProvengeTM; Plosker (2011) Drugs 71(1): 101-108).
- the cellular immunotherapy includes cells that express a chimeric antigen receptor (CAR).
- the cellular immunotherapy is a CAR-T cell therapy.
- the CAR-T cell therapy is tisagenlecleucel (Kymria).
- the CAR-T cell therapy is axicabtagene ciloleucel (Yescarta).
- the CAR-T cell therapy is brexucabtagene autoleucel (Tecartus). In some embodiments, the CAR-T cell therapy is relmacabtagene autoleucel. In some embodiments, the CAR-T cell therapy is ALLO- 501.
- the immunotherapy is an antibody therapy (e.g., a monoclonal antibody, a conjugated antibody, or a bispecific antibody).
- the antibody therapy is bevacizumab (MvastiTM, Avastin®), trastuzumab (Herceptin®), avelumab (Bavencio®), rituximab (Mab TheraTM, Rituxan®), rituximab with human hyaluronidase (Rituxan HycelaTM), edrecolomab (Panorex), daratumuab (Darzalex®), olaratumab (LartruvoTM), ofatumumab (Arzerra®), alemtuzumab (Campath®), cetuximab (Erbitux®), oregovomab, pembrolizumab (Keytruda®), dinutiximab (Unituxin®), obi
- the immunotherapy is an antibody-drug conjugate.
- the antibody-drug conjugate is gemtuzumab ozogamicin (MylotargTM), inotuzumab ozogamicin (Besponsa®), brentuximab vedotin (Adcetris®), ado-trastuzumab emtansine (TDM- 1; Kadcyla®), mirvetuximab soravtansine (IMGN853), anetumab ravtansine, polatuzumab vedotine, loncastuximab tesirine (ADCT-402), camidanlumab tesirine (ADCT-301), or naratuximab emtansine (Debio 1562).
- MylotargTM gemtuzumab ozogamicin
- Besponsa® inotuzumab ozogamicin
- Adcetris® brentux
- the immunotherapy includes blinatumomab (AMG103; Blincyto®) or midostaurin (Rydapt).
- the immunotherapy includes a toxin. In some embodiments, the immunotherapy is denileukin diftitox (Ontak®).
- the immunotherapy is a cytokine therapy.
- the cytokine therapy is an interleukin 2 (IL-2) therapy, an interferon alpha (IFNa) therapy, a granulocyte colony stimulating factor (G-CSF) therapy, an interleukin 12 (IL-12) therapy, an interleukin 15 (IL- 15) therapy, an interleukin 7 (IL-7) therapy or an erythropoietin-alpha (EPO) therapy.
- the IL-2 therapy is aldesleukin (Proleukin®).
- the IFNa therapy is IntronA® (Roferon-A®).
- the G-CSF therapy is filgrastim (Neupogen®).
- the immunotherapy is an immune checkpoint inhibitor. In some embodiments, the immunotherapy includes one or more immune checkpoint inhibitors. In some embodiments, the immune checkpoint inhibitor is a CTLA-4 inhibitor, a PD-1 inhibitor or a PD- L1 inhibitor. In some embodiments, the CTLA-4 inhibitor is ipilimumab (Yervoy®) or tremelimumab (CP-675,206). In some embodiments, the PD-1 inhibitor is pembrolizumab (Keytruda®) or nivolumab (Opdivo®). In some embodiments, the PD-L1 inhibitor is atezolizumab (Tecentriq®), avelumab (Bavencio®) or durvalumab (ImfinziTM).
- the immunotherapy is mRNA-based immunotherapy.
- the mRNA-based immunotherapy is CV9104 (see, e.g., Rausch et al. (2014) Human Vaccin Immunother 10(11): 3146-52; and Kubler et al. (2015) J. Immunother Cancer 3:26).
- the immunotherapy is bacillus Calmette-Guerin (BCG) therapy.
- the immunotherapy is an oncolytic virus therapy.
- the oncolytic virus therapy is talimogene alherparepvec (T-VEC; Imlygic®).
- the immunotherapy is a cancer vaccine.
- the cancer vaccine is a human papillomavirus (HPV) vaccine.
- the HPV vaccine is Gardasil®, Gardasil9® or Cervarix®.
- the cancer vaccine is a hepatitis B virus (HBV) vaccine.
- the HBV vaccine is Engerix-B®, Recombivax HB® or GL13020 (Tarmogen®).
- the cancer vaccine is Twinrix® or Pediarix®.
- the cancer vaccine is BiovaxID®, Oncophage®, GV AX, ADXS11-001, ALVAC-CEA, PROSTVAC®, Rindopepimut®, CimaVax-EGF, lapuleucel-T (APC8024; NeuvengeTM), GRNVAC1, GRNVAC2, GRN-1201, hepcortespenlisimut-L (Hepko-V5), DCVAX®, SCIB1, BMT CTN 1401, PrCa VBIR, PANVAC, ProstAtak®, DPX-Survivac, or viagenpumatucel-L (HS-110).
- the immunotherapy is a peptide vaccine.
- the peptide vaccine is nelipepimut-S (E75) (NeuVaxTM), IMA901, or SurVaxM (SVN53-67).
- the cancer vaccine is an immunogenic personal neoantigen vaccine (see, e.g., Ott et al. (2017) Nature 547: 217-221; Sahin et al. (2017) Nature 547: 222-226).
- the cancer vaccine is RGSH4K, or NEO-PV-01.
- the cancer vaccine is a DNA-based vaccine.
- the DNA-based vaccine is a mammaglobin-A DNA vaccine (see, e.g., Kim et al. (2016) Oncolmmunology 5(2): el069940).
- immune-targeted agents are selected from aldesleukin, interferon alfa-2b, ipilimumab, lambrolizumab, nivolumab, prednisone, and sipuleucel-T.
- the additional therapy is radiotherapy.
- radiotherapy include radioiodide therapy, external-beam radiation, and radium 223 therapy.
- the additional therapeutic agent is GSK-3368715, PF-06821497, ceralasertib; AZD6738, BI-894999, MAK-683, AZD-6738, taminadenant, TAK-981, MIK-665, or danvatirsen.
- Additional kinase inhibitors include those described in, for example, U.S. Patent No. 7,514,446; 7,863,289; 8,026,247; 8,501,756; 8,552,002; 8,815,901; 8,912,204; 9,260,437; 9,273,051; U.S. Publication No. US 2015/0018336; International Publication No. WO 2007/002325; WO 2007/002433; WO 2008/080001; WO 2008/079906; WO 2008/079903; WO
- the subject was previously administered one or more standard of care therapies for a lymphoma.
- the previously administered standard of care therapy is polatuzumab vedotine, selinexor, axicabtagene ciloleucel (Yescarta), tisagenlecleucel (Kymriah), bendamustine in combination with rituximab and polatuzumab vedotin, tafasitamab in combination with lenalidomide, or rituximab with human hyaluronidase (Rituxan Hycela).
- the subject is concomitantly receiving standard of care therapy for a lymphoma.
- the standard of care therapy is polatuzumab vedotine, selinexor, axicabtagene ciloleucel (Yescarta), tisagenlecleucel (Kymriah), bendamustine in combination with rituximab and polatuzumab vedotin, tafasitamab in combination with lenalidomide, or rituximab with human hyaluronidase (Rituxan Hycela).
- tumorigenesis may vary between different cancer types, the cellular and molecular mechanisms required for metastasis appear to be similar for all solid tumor types.
- the cancer cells lose growth inhibitory responses, undergo alterations in adhesiveness and produce enzymes that can degrade extracellular matrix components. This leads to detachment of tumor cells from the original tumor, infiltration into the circulation through newly formed vasculature, migration and extravasation of the tumor cells at favorable distant sites where they may form colonies.
- methods for inhibiting, preventing, aiding in the prevention, or decreasing the symptoms of metastasis of a cancer in a subject in need thereof comprising administering to the subject an effective amount of a compound of Formula (I), or a pharmaceutically acceptable salt thereof or a pharmaceutical composition thereof.
- Such methods can be used in the treatment of one or more of the cancers described herein. See, e.g, US Publication No. 2013/0029925; International Publication No. WO 2014/083567; and US Patent No. 8,568,998.
- the cancer is a MALT1- associated cancer.
- the compound of Formula (I), or a pharmaceutically acceptable salt thereof is used in combination with an additional therapy or another therapeutic agent, as described herein. For example, a first or second MALT1 protease inhibitor.
- tumor is an art known term and means the formation of an additional tumor (e.g., a solid tumor) at a site distant from a primary tumor in a subject, where the additional tumor includes the same or similar cancer cells as the primary tumor.
- additional tumor e.g., a solid tumor
- Also provided are methods of decreasing the risk of developing a metastasis or an additional metastasis in a subject having a MALT1 -associated cancer that include: selecting, identifying, or diagnosing a subject as having a MALT1 -associated cancer, and administering an effective amount of a compound of Formula (I), or a pharmaceutically acceptable salt thereof to the subject selected, identified, or diagnosed as having a MALT1 -associated cancer. Also provided are methods of decreasing the risk of developing a metastasis or an additional metastasis in a subject having a MALT1 -associated cancer that includes administering an effective amount of a compound of Formula (I), or a pharmaceutically acceptable salt thereof to a subject having a MALT1 -associated cancer.
- the decrease in the risk of developing a metastasis or an additional metastasis in a subject having a MALT1 -associated cancer can be compared to the risk of developing a metastasis or an additional metastasis in the subject prior to treatment, or as compared to a subject or a population of subjects having a similar or the same MALT1 -associated cancer that has received no treatment or a different treatment.
- risk of developing a metastasis means the risk that a subject having a primary tumor will develop an additional tumor (e.g., a solid tumor) at a site distant from a primary tumor in a subject over a set period of time, where the additional tumor includes the same or similar cancer cells as the primary tumor.
- additional tumor e.g., a solid tumor
- risk of developing additional metastases means the risk that a subject having a primary tumor and one or more additional tumors at sites distant from the primary tumor (where the one or more additional tumors include the same or similar cancer cells as the primary tumor) will develop one or more further tumors distant from the primary tumor, where the further tumors include the same or similar cancer cells as the primary tumor. Methods for reducing the risk of developing additional metastasis are described herein.
- Some embodiments described herein provide methods of treating an autoimmune disorder (e.g., a MALT1 -associated autoimmune disorder), such as rheumatoid arthritis, multiple sclerosis, and SLE, the method comprising administering an effective amount of a compound of Formula (I), or a pharmaceutically acceptable salt thereof, to a subject in need thereof.
- an autoimmune disorder e.g., a MALT1 -associated autoimmune disorder
- rheumatoid arthritis rheumatoid arthritis, multiple sclerosis, and SLE
- Some embodiments described herein provide methods of treating an inflammatory disorder (e.g., a MALT1 -associated autoimmune disorder), such as chronic graft versus host disease, the method comprising administering an effective amount of a compound of Formula (I), or a pharmaceutically acceptable salt thereof, to a subject in need thereof.
- an inflammatory disorder e.g., a MALT1 -associated autoimmune disorder
- a pharmaceutically acceptable salt thereof e.g., chronic graft versus host disease
- a method for inhibiting MALT1 protease activity in a mammalian cell comprising contacting the mammalian cell with a compound of Formula (I).
- the contacting is in vitro.
- the contacting is in vivo.
- the contacting is in vivo, wherein the method comprises administering an effective amount of a compound of Formula (I), or a pharmaceutically acceptable salt thereof to a subject having a mammalian cell having MALT1 protease activity.
- the mammalian cell is a mammalian immune cell.
- the mammalian cell is a mammalian cancer cell.
- the mammalian cancer cell is any cancer as described herein.
- the mammalian cancer cell is a MALT1 -associated mammalian cancer cell.
- a method for inhibiting MALT1 protease activity in a mammalian mammalian cell comprising contacting the mammalian cell with a compound of Formula (I).
- the contacting is in vitro.
- the contacting is in vivo.
- the contacting is in vivo, wherein the method comprises administering an effective amount of a compound of Formula (I), or a pharmaceutically acceptable salt thereof to a mammal having a mammalian cell having MALT1 protease activity.
- the mammalian cell is a mammalian immune cell.
- the mammalian cell is a mammalian cancer cell.
- the mammalian cancer cell is any cancer as described herein. In some embodiments, the mammalian cancer cell is a MALT1 -associated mammalian cancer cell. In some embodiments, the mammalian cell is a gastrointestinal mammalian cell.
- contacting refers to the bringing together of indicated moieties in an in vitro system or an in vivo system.
- "contacting" a MALT1 protease with a compound provided herein includes the administration of a compound provided herein to a subject, such as a human, having a MALT1 protease, as well as, for example, introducing a compound provided herein into a sample containing a mammalian cellular or purified preparation containing the MALT1 protease.
- Also provided herein is a method of inhibiting mammalian cell proliferation, in vitro or in vivo, the method comprising contacting a mammalian cell with an effective amount of a compound of Formula (I), or a pharmaceutically acceptable salt thereof, or a pharmaceutical composition thereof as defined herein.
- a “MALT1 protease inhibitor” as defined herein includes any compound exhibiting MALT1 inhibition activity.
- a MALT1 protease inhibitor is selective for a MALT1 protease.
- Exemplary MALT1 protease inhibitors can exhibit inhibition activity (IC50) against a MALT1 protease of less than about 1000 nM, less than about 500 nM, less than about 200 nM, less than about 100 nM, less than about 50 nM, less than about 25 nM, less than about 10 nM, or less than about 1 nM as measured in an assay as described herein.
- a MALT1 protease inhibitor can exhibit inhibition activity (IC50) against a MALT1 protease of less than about 25 nM, less than about 10 nM, less than about 5 nM, or less than about 1 nM as measured in an assay as provided herein.
- a “first MALT1 protease inhibitor” or “first MALT1 inhibitor” is a MALT1 protease inhibitor as defined herein, but which does not include a compound of Formula (I), or a pharmaceutically acceptable salt thereof as defined herein.
- a “second MALT1 protease inhibitor” or a “second MALT1 inhibitor” is a MALT1 protease inhibitor as defined herein, but which does not include a compound of Formula (I), or a pharmaceutically acceptable salt thereof as defined herein.
- first and second MALT1 protease inhibitors are described herein.
- a first or second MALT1 protease inhibitor can be, for example, JNJ-67856633 or CTX-177.
- the phrase “effective amount” means an amount of compound that, when administered to a subject in need of such treatment, is sufficient to (i) treat a MALT1 -associated disease or disorder (such as a MALT1 -associated cancer), (ii) attenuate, ameliorate, or eliminate one or more symptoms of the particular disease, condition, or disorder, or (iii) delay the onset of one or more symptoms of the particular disease, condition, or disorder described herein.
- the amount of a compound of Formula (I), or a pharmaceutically acceptable salt thereof that will correspond to such an amount will vary depending upon factors such as the particular compound, disease condition and its severity, the identity (e.g., weight) of the subject in need of treatment, but can nevertheless be routinely determined by one skilled in the art.
- compounds of Formula (I), including pharmaceutically acceptable salts thereof can be administered in the form of pharmaceutical compositions.
- These compositions can be prepared in a manner well known in the pharmaceutical art, and can be administered by a variety of routes, depending upon whether local or systemic treatment is desired and upon the area to be treated. Administration can be topical (including transdermal, epidermal, ophthalmic and to mucous membranes including intranasal, vaginal and rectal delivery), pulmonary e.g., by inhalation or insufflation of powders or aerosols, including by nebulizer; intratracheal or intranasal), oral or parenteral.
- Oral administration can include a dosage form formulated for once-daily or twice-daily (BID) administration.
- Parenteral administration includes intravenous, intraarterial, subcutaneous, intraperitoneal intramuscular or injection or infusion; or intracranial, e.g., intrathecal or intraventricular, administration.
- Parenteral administration can be in the form of a single bolus dose, or can be, for example, by a continuous perfusion pump.
- Pharmaceutical compositions and formulations for topical administration can include transdermal patches, ointments, lotions, creams, gels, drops, suppositories, sprays, liquids and powders. Conventional pharmaceutical carriers, aqueous, powder or oily bases, thickeners and the like may be necessary or desirable.
- compositions which contain, as the active ingredient, a compound of Formula (I) or pharmaceutically acceptable salt thereof, in combination with one or more pharmaceutically acceptable excipients.
- a pharmaceutical composition prepared using a compound of Formula (I) or a pharmaceutically acceptable salt thereof.
- the composition is suitable for topical administration.
- the active ingredient is typically mixed with an excipient, diluted by an excipient or enclosed within such a carrier in the form of, for example, a capsule, sachet, paper, or other container.
- the excipient serves as a diluent, it can be a solid, semisolid, or liquid material, which acts as a vehicle, carrier or medium for the active ingredient.
- compositions can be in the form of tablets, pills, powders, lozenges, sachets, cachets, elixirs, suspensions, emulsions, solutions, syrups, aerosols (as a solid or in a liquid medium), ointments containing, for example, up to 10% by weight of the active compound, soft and hard gelatin capsules, suppositories, sterile injectable solutions, and sterile packaged powders.
- the composition is formulated for oral administration.
- the composition is a solid oral formulation.
- the composition is formulated as a tablet or capsule.
- compositions containing a compound of Formula (I) or a pharmaceutically acceptable salt thereof with a pharmaceutically acceptable carrier can be prepared by intimately mixing the compound of Formula (I), or a pharmaceutically acceptable salt thereof with a pharmaceutical carrier according to conventional pharmaceutical compounding techniques.
- the carrier can take a wide variety of forms depending upon the desired route of administration (e.g. , oral, parenteral).
- the composition is a solid oral composition.
- Suitable pharmaceutically acceptable carriers are well known in the art. Descriptions of some of these pharmaceutically acceptable carriers can be found in The Handbook of Pharmaceutical Excipients, published by the American Pharmaceutical Association and the Pharmaceutical Society of Great Britain.
- any of the usual pharmaceutical media can be employed.
- suitable carriers and additives include water, glycols, oils, alcohols, flavoring agents, preservatives, stabilizers, coloring agents and the like;
- suitable carriers and additives include starches, sugars, diluents, granulating agents, lubricants, binders, disintegrating agents and the like.
- Suitable binders include, without limitation, starch, gelatin, natural sugars such as glucose or beta-lactose, com sweeteners, natural and synthetic gums such as acacia, tragacanth or sodium oleate, sodium stearate, magnesium stearate, sodium benzoate, sodium acetate, sodium chloride and the like.
- Disintegrators include, without limitation, starch, methyl cellulose, agar, bentonite, xanthan gum and the like.
- Solid oral preparations can also be coated with substances such as sugars or be enteric-coated so as to modulate major site of absorption.
- the carrier will usually consist of sterile water and other ingredients can be added to increase solubility or preservation.
- Injectable suspensions or solutions can also be prepared utilizing aqueous carriers along with appropriate additives.
- the pharmaceutical compositions herein will contain, per dosage unit, e.g., tablet, capsule, powder, injection, teaspoonful and the like, an amount of the active ingredient necessary to deliver an effective dose as described herein.
- compositions comprising a compound of Formula (I) or a pharmaceutically acceptable salt thereof can be formulated in a unit dosage form, each dosage containing from about 5 to about 1,000 mg (1 g), more usually about 100 mg to about 500 mg, of the active ingredient.
- unit dosage form refers to physically discrete units suitable as unitary dosages for human subjects and other subjects, each unit containing a predetermined quantity of active material (i.e., a compound of Formula (I) or a pharmaceutically acceptable salt thereof ) calculated to produce the desired therapeutic effect, in association with a suitable pharmaceutical excipient.
- the compositions provided herein contain from about 5 mg to about 50 mg of the active ingredient.
- the active ingredient contains from about 5 mg to about 50 mg.
- One having ordinary skill in the art will appreciate that this embodies compounds or compositions containing about 5 mg to about 10 mg, about 10 mg to about 15 mg, about 15 mg to about 20 mg, about 20 mg to about 25 mg, about 25 mg to about 30 mg, about 30 mg to about 35 mg, about 35 mg to about 40 mg, about 40 mg to about 45 mg, or about 45 mg to about 50 mg of the active ingredient.
- the compositions provided herein contain from about 50 mg to about 500 mg of the active ingredient.
- the compositions provided herein contain about 50 mg to about 100 mg, about 100 mg to about 150 mg, about 150 mg to about 200 mg, about 200 mg to about 250 mg, about 250 mg to about 300 mg, about 350 mg to about 400 mg, or about 450 mg to about 500 mg of the active ingredient.
- the compositions provided herein contain about 10 mg, about 20 mg, about 80 mg, or about 160 mg of the active ingredient.
- the compositions provided herein contain from about 500 mg to about 1,000 mg of the active ingredient.
- the active ingredient contains from about 500 mg to about 1,000 mg of the active ingredient.
- this embodies compounds or compositions containing about 500 mg to about 550 mg, about 550 mg to about 600 mg, about 600 mg to about 650 mg, about 650 mg to about 700 mg, about 700 mg to about 750 mg, about 750 mg to about 800 mg, about 800 mg to about 850 mg, about 850 mg to about 900 mg, about 900 mg to about 950 mg, or about 950 mg to about 1,000 mg of the active ingredient.
- the daily dosage of the compound of Formula (I) or a pharmaceutically acceptable salt thereof can be varied over a wide range from 1.0 to 10,000 mg per adult human per day, or higher, or any range therein.
- the compositions are preferably provided in the form of tablets containing, 0.01, 0.05, 0.1, 0.5, 1.0, 2.5, 5.0, 10.0, 15.0, 25.0, 50.0, 100, 150, 160, 200, 250 and 500 milligrams of the active ingredient for the symptomatic adjustment of the dosage to the subject to be treated.
- An effective amount of the drug is ordinarily supplied at a dosage level of from about 0.1 mg/kg to about 1000 mg/kg of body weight per day, or any range therein.
- the range is from about 0.5 to about 500 mg/kg of body weight per day, or any range therein. More preferably, from about 1.0 to about 250 mg/kg of body weight per day, or any range therein. More preferably, from about 0.1 to about 100 mg/kg of body weight per day, or any range therein. In an example, the range can be from about 0.1 to about 50.0 mg/kg of body weight per day, or any amount or range therein. In another example, the range can be from about 0.1 to about 15.0 mg/kg of body weight per day, or any range therein. In yet another example, the range can be from about 0.5 to about 7.5 mg/kg of body weight per day, or any amount to range therein. Pharmaceutical compositions containing a compound of Formula (I) or a pharmaceutically acceptable salt thereof can be administered on a regimen of 1 to 4 times per day or in a single daily dose.
- the active compound may be effective over a wide dosage range and is generally administered in a pharmaceutically effective amount.
- Optimal dosages to be administered can be readily determined by those skilled in the art. It will be understood, therefore, that the amount of the compound actually administered will usually be determined by a physician, and will vary according to the relevant circumstances, including the mode of administration, the actual compound administered, the strength of the preparation, the condition to be treated, and the advancement of the disease condition. In addition, factors associated with the particular subject being treated, including subject response, age, weight, diet, time of administration and severity of the subject's symptoms, will result in the need to adjust dosages.
- the compounds provided herein can be administered in an amount ranging from about 1 mg/kg to about 100 mg/kg. In some embodiments, the compound provided herein can be administered in an amount of about 1 mg/kg to about 20 mg/kg, about 5 mg/kg to about 50 mg/kg, about 10 mg/kg to about 40 mg/kg, about 15 mg/kg to about 45 mg/kg, about 20 mg/kg to about 60 mg/kg, or about 40 mg/kg to about 70 mg/kg.
- kits useful for example, in the treatment of MALT1- associated diseases or disorders, such as cancer, which include one or more containers containing a pharmaceutical composition comprising an effective amount of a compound provided herein.
- kits can further include, if desired, one or more of various conventional pharmaceutical kit components, such as, for example, containers with one or more pharmaceutically acceptable carriers, additional containers, etc., as will be readily apparent to those skilled in the art.
- Instructions, either as inserts or as labels, indicating quantities of the components to be administered, guidelines for administration, and/or guidelines for mixing the components, can also be included in the kit.
- the compounds provided herein, including salts thereof, can be prepared using known organic synthesis techniques and can be synthesized according to any of numerous possible synthetic routes.
- the reactions for preparing the compounds provided herein can be carried out in suitable solvents which can be readily selected by one of skill in the art of organic synthesis.
- suitable solvents can be substantially non-reactive with the starting materials (reactants), the intermediates, or products at the temperatures at which the reactions are carried out, e.g., temperatures which can range from the solvent's freezing temperature to the solvent's boiling temperature.
- a given reaction can be carried out in one solvent or a mixture of more than one solvent.
- suitable solvents for a particular reaction step can be selected by the skilled artisan.
- Preparation of the compounds provided herein can involve the protection and deprotection of various chemical groups.
- the need for protection and deprotection, and the selection of appropriate protecting groups, can be readily determined by one skilled in the art.
- the chemistry of protecting groups can be found, for example, in Protecting Group Chemistry, 1 st Ed., Oxford University Press, 2000; March 's Advanced Organic Chemistry: Reactions, Mechanisms, and Structure, 5 th Ed., Wiley-Interscience Publication, 2001; and Peturssion, S. et al., “ Protecting Groups in Carbohydrate Chemistry,” J. Chem. Educ., 74(11), 1297 (1997).
- reactions sensitive to moisture or air were performed under nitrogen or argon using anhydrous solvents and reagents.
- the progress of reactions was determined by either analytical thin layer chromatography (TLC) usually performed with Sanpont precoated TLC plates, silica gel GF-254, layer thickness 0.25 mm or liquid chromatography-mass spectrometry (LC-MS).
- TLC analytical thin layer chromatography
- LC-MS liquid chromatography-mass spectrometry
- the analytical LC-MS system used consisted of Shimadzu LCMS-2020 with electrospray ionization in positive ion detection mode with 20ADXR pump, SIL-20ACXR autosampler, CTO-20AC column oven, M20A PDA Detector and LCMS 2020 MS detector.
- the column was usually HALO a C18 30*5.0 mm, 2.7 pm.
- the mobile phase A is water containing 0.05% TFA and mobile phase B is acetonitrile containing 0.05% TFA.
- the gradient is from 5% mobile phase B to 100% in 2.0 min, hold 0.7 min, then reverting to 5% mobile phase B over 0.05 min and maintained for 0.25 min.
- the Column Oven (CTO-20AC) was operated at a temperature of 40.0 °C.
- the flow rate was 1.5 mL/min, and the injection volume was 1 pl.
- PDA (SPD-M20A) detection was in the range 190-400 nm.
- the MS detector which was configured with electrospray ionization as ionizable source; Acquisition mode: Scan; Nebulizing Gas Flow: 1.5 L/min; Drying Gas Flow: 15 L/min; Detector Voltage: Tuning Voltage ⁇ 0.2 kv; DL Temperature: 250 °C; Heat Block Temperature: 250 °C; Scan Range: 90.00 - 900.00 m/z.
- ELSD (Alltech 3300) detector Parameters Drift Tube Temperature: 60 ⁇ 5 °C; N2 Flow-Rate: 1.8 ⁇ 0.2 L/min. Mobile phase gradients were optimized for the individual compounds.
- the GC-MS system was usually performed with Shimadzu GCMS-QP2010 Ultra with FID and MS Detector.
- the MS detector of acquisition mode Start Time: 2.00 min; End Time: 9.00 min; ACQ Mode: Scan; Event Time: 0.30 sec; Scan Speed: 2000; Start m/z: 50.00; End m/z: 550.00; Ion Source temperature: 200.00 °C; Interface temperature: 250.00 °C; Solvent Cut Time: 2.00 min.
- Preparative HPLC purifications were usually performed with Waters Auto purification system (2545-2767) with a 2489 UV detector.
- the column was Waters C18, 19 xl50 mm, 5 pm.
- the mobile phases consisted of mixtures of acetonitrile (5-95%) in water containing 0.1%FA. Flow rates were maintained at 25 mL/min, the injection volume was 1200 pL, and the UV detector used two channels 254 nm and 220 nm. Mobile phase gradients were optimized for the individual compounds.
- Chiral analytical chromatography was performed on one of Chiralpak AS, AD, Chiralcel OD, OJ Chiralpak IA, IB, IC, ID, IE, IF, IG, IH columns (Daicel Chemical Industries, Ltd.); (R,R) ⁇ Whelk-Ol, (5,5)-Whelk-01 columns (Regis technologies, Inc.
- CHIRAL Cellulose-SB, SC, SA columns (YMC Co., Ltd.) at different column sizes (50x4.6mm, 100x4.6mm, 150x4.6mm, 250x4.6mm, 50x3.0mm, 100x3.0mm) with noted percentage of either ethanol in hexane (%Et/Hex) or isopropanol in hexane (%IPA/Hex) as isocratic solvent systems.
- Chiral preparative chromatography was conducted on one of Chiralpak AS, AD, Chiralcel OD, OJ, Chiralpak IA, IB, IC, ID, IE, IF, IG, IH columns (Daicel Chemical Industries, Ltd.); (/?, A’j-Whelk- 01, (S,S)-Whelk-01 columns (Regis technologies, Inc. ); CHIRAL Cellulose-SB, SC, SA columns (YMC Co., Ltd.) at different column size (250x20mm, 250x30mm, 250x50mm) with desired isocratic solvent systems identified on chiral analytical chromatography.
- Abbreviations used herein include: -C(O)CH3 (Ac); acetic acid (AcOH); -OC(O)CH3 (OAc); aqueous (aq); Cbz (benzyloxycarbonyl); N,N-diisopropylethylamine (DIEA); N,'N- dimethylformamide (DMF); l-Ethyl-3-(3-dimethylaminopropyl)carbodiimide (EDCI); EtOAc (EtOAc); diethyl ether (ether or Et20); PE (PE); gram(s) (g); hour(s) (h or hr); 2-propanol (IP A); mass spectrum (ms or MS); microliter(s) (pL); milligram(s) (mg); milliliter(s) (mL); millimole (mmol); minute(s) (min); methyl t-butylether (MTBE); (benzotriazol-1-yl
- Examples 1 and 2 Single enantiomers obtained from a racemic mixture containing (R)-2-chloro-N-(5-chloro-6-(2H-1,2,3-triazol-2-yl)pyridin-3-yl)-8,8-dimethyl-7,8-dihydro- 6H cyclopenta[e]pyrazolo[1,5-a]pyrimidine-6-carboxamide and (S)-2-chloro-N-(5-chloro-6- (2H- 1 ,2,3-triazol-2-yl)pyridin-3-yl)-8,8-dimethyl-7,8-dihydro-6Hcyclopenta [e] pyr azolo [1 ,5- a] pyrimidine-6-carboxamide.
- Step 1 3-chloro-5-nitro-2-(2H-1,2,3-triazol-2-yl)pyridine
- Step 3 5-((dimethylamino)methylene)-2,2-dimethylcyclopentan-1-one
- Step 4 2-chloro-8, 8-dimethyl-7,8-dihydro-6H-cyclopenta[e]pyrazolo[1,5-a]pyrimidine
- Step 5 2-chloro-8,8-dimethyl-7,8-dihydro-6H-cyclopenta[e]pyrazolo[1,5-a]pyrimidine-6- carbonitrile
- Step 6 2-chloro-8,8-dimethyl-7,8-dihydro-6H-cyclopenta[e]pyrazolo[1,5-a]pyrimidine-6- carboxylic acid
- Step 7 2-chloro-N-(5-chloro-6-(2H-1,2,3-triazol-2-yl)pyridin-3-yl)-8,8-dimethyl-7,8- dihydro-6H-cyclopenta[e]pyrazolo[1,5-a]pyrimidine-6-carboxamide
- 2-chloro-8,8-dimethyl-7,8-dihydro-6H-cyclopenta[e] pyrazolo[1,5- a] pyrimidine-6-carboxylic acid 390 mg, 1.4 mmol
- ACN 20 mL
- 5-chloro-6- (triazol-2-yl)pyridin-3-amine 430.69 mg, 2.2 mmol
- TCFH (1.65 g, 5.8 mmol
- NMI 482.06 mg, 5.87 mmol
- the resulting mixture was stirred for 16 h at room temperature.
- the reaction mixture was quenched with water (100 mL).
- the resulting solution was extracted with ethyl acetate (100 mL x 3).
- the combined organic layers were dried over anhydrous sodium sulfate and concentrated under vacuum.
- Step 8 Separation of enantiomers to obtain (A)-2-chloro-N-(5-chloro-6-(2H-1,2,3-triazol- 2-yl)pyridin-3-yl)-8,8-dimethyl-7,8-dihydro-6H-cyclopenta[e]pyrazolo[1,5-a]pyrimidine-6 carboxamide and (S)-2-chloro-N-(5-chloro-6-(2H-1,2,3-triazol-2-yl)pyridin-3-yl)-8,8-dimethyl- 7,8-dihydro-6H-cyclopenta[e]pyrazolo[1,5-a]pyrimidine-6-carboxamide.
- Example 1 The first eluting isomer was concentrated and lyophilized to afford Example 1 (74.3 mg, 11.4% yield) as a white solid.
- the second eluting isomer was concentrated and lyophilized to afford Example 2 (69.6 mg, 10.6% yield) as a white solid.
- Examples 3 and 4 Single enantiomers obtained from a racemic mixture containing (R)-N-(5-chloro-6-(2H-1,2,3-triazol-2-yl)pyridin-3-yl)-2-cyano-8,8-dimethyl-7,8-dihydro- 6H-cyclopenta[e]pyrazolo[1,5-a]pyrimidine-6-carboxamide and (S)-N-(5-chloro-6-(2H- 1,2,3-triazol-2-yl)pyridin-3-yl)-2-cyano-8,8-dimethyl-7,8-dihydro-6H- cyclopenta[e]pyrazolo[1,5-a]pyrimidine-6-carboxamide.
- Step 1 8,8-dimethyl-7,8-dihydro-6H-cyclopenta[e]pyrazolo[1,5-a]pyrimidine-2- carbonitrile
- Step 2 8,8-dimethyl-7,8-dihydro-6H-cyclopenta[e]pyrazolo[1,5-a]pyrimidine-2,6- dicarbonitrile
- Step 4 N-(5-chloro-6-(2H-1,2,3-triazol-2-yl)pyridin-3-yl)-2-cyano-8,8-dimethyl-7,8- dihydro-6H-cyclopenta[e]pyrazolo[1,5-a]pyrimidine-6-carboxamide
- Aluminum trifluoromethanesulfonate (11 mg, 23.5 ⁇ mol) was added in portions at room temperature under nitrogen. The resulting mixture was stirred for 16 hours at 110 °C under nitrogen. The mixture was allowed to cool down to room temperature, diluted with water (50 mL) and then extracted with DCM (3x 50 mL). The organic layers were combined, washed with brine, dried and concentrated under vacuum.
- Step 5 Separation of enantiomers to obtain (A)-N-(5-chloro-6-(2H-1,2,3-triazol-2- yl)pyridin-3-yl)-2-cyano-8,8-dimethyl-7,8-dihydro-6H-cyclopenta[e]pyrazolo[1,5-a]pyrimidine- 6-carboxamide and (S)-N-(5-chloro-6-(2H-1,2,3-triazol-2-yl)pyridin-3-yl)-2-cyano-8,8-dimethyl- 7,8-dihydro-6H-cyclopenta[e]pyrazolo[1,5-a]pyrimidine-6-carboxamide.
- Example 3 The first eluting isomer was concentrated and lyophilized to afford Example 3 as a white solid (7.3 mg, 33% yield).
- the second eluting isomer was concentrated and lyophilized to afford Example 4 as a white solid (6.2 mg, 28% yield).
- LC-MS m/z 434 [M+H] + .
- LC-MS m/z 434 [M+H] + .
- Examples 5 and 6 Single enantiomers obtained from a racemic mixture containing (R)-N-(5-chloro-6-(2H-1,2,3-triazol-2-yl)pyridin-3-yl)-2,8,8-trimethyl-7,8-dihydro-6H- cyclopenta[e]pyrazolo[1,5-a]pyrimidine-6-carboxamide and (S)-N-(5-chloro-6-(2H-1,2,3- triazol-2-yl)pyridin-3-yl)-2,8,8-trimethyl-7,8-dihydro-6H-cyclopenta[e]pyrazolo[1,5- a] pyrimidine-6-carboxamide.
- Step 1 2-bromo-8, 8-dimethyl-7,8-dihydro-6H-cyclopenta[e]pyrazolo[1,5-a]pyrimidine
- Step 2 2-bromo-8, 8-dimethyl-7,8-dihydro-6H-cyclopenta[e]pyrazolo[1,5-a]pyrimidine- 6-carbonitrile
- Step 4 2, 8, 8-trimethyl-7,8-dihydro-6H-cyclopenta[e]pyrazolo[1,5-a]pyrimidine-6- carboxylic acid
- Step 6 Separation of enantiomers to obtain (S)-N-(5-chloro-6-(2H-1,2,3-triazol-2- yl)pyridin-3-yl)-2,8,8-trimethyl-7,8-dihydro-6H-cyclopenta[e]pyrazolo[1,5-a]pyrimidine-6- carboxamide and (A)-N-(5-chloro-6- (2H-1,2,3-triazol-2-yl)pyridin-3-yl)-2,8,8-trimethyl-7,8- dihydro-6H-cyclopenta[e]pyrazolo[1,5-a]pyrimidine-6-carboxamide.
- Example 5 The first eluting isomer was concentrated and lyophilized to afford Example 5 (6 mg, 6.2 % yield) as a white solid.
- the second eluting isomer was concentrated and lyophilized to afford Example 6 (8.6 mg, 8.9 % yield) as a white solid.
- LC-MS m/z 423 [M+H] + .
- LC-MS m/z 423 [M+H] + .
- Example 7 2-chloro-N-(5-chloro-6-(2H-1,2,3-triazol-2-yl)pyridin-3-yl)-9,9-dimethyl-
- Examples 8 and 9 Single enantiomers obtained from a racemic mixture containing (R)-2-chloro-N-(5-chloro-6-(2H-1,2,3-triazol-2-yl)pyridin-3-yl)-9,9-dimethyl-6,7,8,9- tetrahydropyrazolo[1,5-a]quinazoline-6-carboxamide and (S)-2-chloro-N-(5-chloro-6-(2H- 1,2,3-triazol-2-yl)pyridin-3-yl)-9,9-dimethyl-6,7,8,9-tetrahydropyrazolo[1,5-a]quinazoline- 6-carboxamide.
- Example 8 The first eluting isomer was concentrated and lyophilized to afford Example 8 as a white solid (34.6 mg, 35% yield).
- the second eluting isomer was concentrated and lyophilized to afford Example 9 as a white solid (31.1 mg, 31% yield).
- LC-MS m/z 457 [M+H] + .
- LC-MS m/z 457 [M+H] + .
- Examples 10 and 11 Single enantiomers obtained from a racemic mixture containing (R)-2-chloro-N-(5-chloro-6-(1-methyl-1H-pyrazol-3-yl)pyridin-3-yl)-8,8-dimethyl-7,8- dihydro-6H-cyclopenta[e]pyrazolo[1,5-a]pyrimidine-6-carboxamide and (S)-2-chloro-N-(5- chloro-6-(1-methyl-1H-pyrazol-3-yl)pyridin-3-yl)-8,8-dimethyl-7,8-dihydro-6H- cyclopenta[e]pyrazolo[1,5-a]pyrimidine-6-carboxamide.
- Step 1 5-chloro-6-(1-methyl-1H-pyrazol-3-yl)pyridin-3-amine
- Step 2 2-chloro-N-(5-chloro-6-(l -methyl- lEl-pyrazol-3-yl)pyridin-3-yl)-8,8-dimethyl- 7,8-dihydro-6H-cyclopenta[e]pyrazolo[1,5-a]pyrimidine-6-carboxamide
- Step 3 Separation of enantiomers to obtain (A)-2-chloro-N-(5-chloro-6-(1-methyl-1H- pyrazol-3-yl)pyridin-3-yl)-8,8-dimethyl-7,8-dihydro-6H-cyclopenta[e]pyrazolo[1,5- a]pyrimidine-6-carboxamide and (S)-2-chloro-N-(5-chloro-6-(1-methyl-1H-pyrazol-3-yl)pyridin-
- Example 10 The first eluting isomer was concentrated and lyophilized to afford Example 10 as a white solid (7.8 mg, 27% yield).
- the second eluting isomer was concentrated and lyophilized to afford Example 11 as a white solid (7.2 mg, 27% yield).
- Examples 12 and 13 Single enantiomers obtained from a racemic mixture containing (R)-2-chloro-N-(5-chloro-6-(1H-pyrazol-1-yl)pyridin-3-yl)-8,8-dimethyl-7,8-dihydro-6H- cyclopenta[e]pyrazolo[1,5-a]pyrimidine-6-carboxamide and (S)-2-chloro-N-(5-chloro-6- (1H-pyrazol-1-yl)pyridin-3-yl)-8,8-dimethyl-7,8-dihydro-6H-cyclopenta[e]pyrazolo[1,5- a] pyrimidine-6-carboxamide.
- Step 1 3-chloro-5-nitro-2-(1H-pyrazol-1-yl)pyridine
- Step 3 2-chloro-N-(5-chloro-6-(2H-1,2,3-triazol-2-yl)pyridin-3-yl)-8,8-dimethyl-7,8- dihydro-6H-cyclopenta[e]pyrazolo[1,5-a]pyrimidine-6-carboxamide
- Step 4 Separation of enantiomers to obtain (A)-2-chloro-N-(5-chloro-6-(1H-pyrazol-1- yl)pyridin-3-yl)-8,8-dimethyl-7,8-dihydro-6H-cyclopenta[e]pyrazolo[1,5-a]pyrimidine-6- carboxamide and (S)-2-chloro-N-(5-chloro-6-(1H-pyrazol-1-yl)pyridin-3-yl)-8,8-dimethyl-7,8- dihydro-6H-cyclopenta[e]pyrazolo[1,5-a]pyrimidine-6-carboxamide.
- Example 12 Fractions containing the first eluting isomer were concentrated and lyophilized to afford Example 12 as a white solid (25.8 mg, 31% yield). Fractions containing the second eluting isomer were concentrated and lyophilized to afford Example 13 as a white solid (32.1 mg, 38% yield).
- LC- MS m/z 442[M+H] + .
- LC- MS m/z 442[M+H] + .
- Examples 14 and 15 Single enantiomers obtained from a racemic mixture containing (R)-2-chloro-N-(5-chloro-6-(4-cyano-1H-pyrazol-1-yl)pyridin-3-yl)-8,8-dimethyl-7,8- dihydro-6H-cyclopenta[e]pyrazolo[1,5-a]pyrimidine-6-carboxamide and (S)-2-chloro-N-(5- chloro-6-(4-cyano-1H-pyrazol-1-yl)pyridin-3-yl)-8,8-dimethyl-7,8-dihydro-6H- cyclopenta[e]pyrazolo[1,5-a]pyrimidine-6-carboxamide.
- Step 1 1-(3-chloro-5-nitropyridin-2-yl)-1H-pyrazole-4-carbonitrile
- Step 3 2-chloro-N-(5-chloro-6-(4-cyano-1H-pyrazol-1-yl)pyridin-3-yl)-8,8-dimethyl-7,8- dihydro-6H-cyclopenta[e]pyrazolo[1,5-a]pyrimidine-6-carboxamide
- Step 4 Separation of enantiomers to obtain (A)-2-chloro-N-(5-chloro-6-(4-cyano-1H- pyrazol-1-yl)pyridin-3-yl)-8,8-dimethyl-7,8-dihydro-6H-cyclopenta[e]pyrazolo[1,5- a]pyrimidine-6-carboxamide and (S)-2-chloro-N-(5-chloro-6-(4-cyano-1H-pyrazol-1-yl)pyridin- 3-yl)-8,8-dimethyl-7,8-dihydro-6H-cyclopenta[e]pyrazolo[1,5-a]pyrimidine-6-carboxamide.
- LC-MS m/z 467 [M+H] + .
- LC-MS m/z 467 [M+H] + .
- Examples 16 and 17 Single enantiomers obtained from a racemic mixture containing (R)-2-chloro-N-(5-chloro-6-(pyrrolidin-1-yl)pyridin-3-yl)-8,8-dimethyl-7,8-dihydro-6H- cyclopenta[e]pyrazolo[1,5-a]pyrimidine-6-carboxamid and (S)-2-chloro-N-(5-chloro-6- (pyrrolidin-1-yl)pyridin-3-yl)-8,8-dimethyl-7,8-dihydro-6H-cyclopenta[e]pyrazolo[1,5- a] pyrimidine-6-carboxamide.
- Step 1 3-chloro-5-nitro-2-(pyrrolidin-1-yl)pyridine
- Step 3 2-chloro-N-(5-chloro-6-(pyrrolidin-1-yl)pyridin-3-yl)-8,8-dimethyl-7,8-dihydro- 6H-cyclopenta[e]pyrazolo[1,5-a]pyrimidine-6-carboxamide
- Step 4 Separation of enantiomers to obtain (A)-2-chloro-N-(5-chloro-6-(pyrrolidin-1- yl)pyridin-3-yl)-8,8-dimethyl-7,8-dihydro-6H-cyclopenta[e]pyrazolo[1,5-a]pyrimidine-6- carboxamide and (S)-2-chloro-N-(5-chloro-6-(pyrrolidin-1-yl)pyridin-3-yl)-8,8-dimethyl-7,8- dihydro-6H-cyclopenta[e]pyrazolo[1,5-a]pyrimidine-6-carboxamide.
- Example 16 The first eluting isomer was concentrated and lyophilized to afford Example 16 as a white solid (11.3 mg, 17% yield).
- the second eluting isomer was concentrated and lyophilized to afford Example 17 as a white solid (14.3 mg, 22% yield).
- LC-MS m/z 445 [M+H] + .
- LC-MS m/z 445 [M+H] + .
- Step 1 (Z)-5-((dimethylamino)methylene)spiro[2.4]heptan-4-one
- Step 2 2-bromo-6,7-dihydrospiro[cyclopenta[e]pyrazolo[1,5-a]pyrimidine-8,1'- cyclopropane]
- To a stirred solution of (Z)-5-((dimethylamino)methylene)spiro[2.4]heptan-4-one (5 g, 30.3 mmol) in toluene (50 mL) was added 5-bromo-1H-pyrazol-3-amine (4.9 g, 30.3 mmol) and AcOH (5 mL) at room temperature. The resulting mixture was stirred for 16 h at 120 °C. The mixture was allowed to cool down to room temperature and concentrated under reduced pressure.
- Step 3 2-bromo-6,7-dihydrospiro[cyclopenta[e]pyrazolo[1,5-a]pyrimidine-8,1'- cyclopropane]-6-carbonitrile
- Step 4 2-methyl-6,7-dihy drospirofcy cl openta[e]pyrazolo[1,5-a]pyrimidine-8,1'- cyclopropane]-6-carbonitrile
- Step 5 2-methyl-6,7-dihydrospiro[cyclopenta[e]pyrazolo[1,5-a]pyrimidine-8,1'- cyclopropane]-6-carboxamide
- Step 6 N-(5-chloro-6-(2H-1,2,3-triazol-2-yl)pyridin-3-yl)-2-methyl-6,7- dihydrospiro[cyclopenta[e]pyrazolo[1,5-a]pyrimidine-8,1'-cyclopropane]-6-carboxamide
- LC-MS m/z 421 [M+H] + .
- Step 1 3-hydroxy-2,2-dimethylcyclopentan-1-one
- Step 3 3-((tert-butyldiphenylsilyl)oxy)-5-((dimethylamino)methylene)-2,2- dimethylcyclopentan-1-one
- Step 4 7-((tert-butyldiphenylsilyl)oxy)-2-chloro-8,8-dimethyl-7,8-dihydro-6H- cyclopenta[e] pyrazolo[1,5-a]pyrimidine
- Step 5 7-((tert-butyldiphenylsilyl)oxy)-2-chloro-8,8-dimethyl-7,8-dihydro-6H- cyclopenta[e] pyrazolo[1,5-a]pyrimidine-6-carbonitrile
- Step 6 7-((tert-butyldiphenylsilyl)oxy)-2-chloro-8,8-dimethyl-7,8-dihydro-6H-cyclopenta
- Step 7 7-((tert-butyldiphenylsilyl)oxy)-2-chloro-N-(5-chloro-6-(2H-1,2,3-triazol-2- yl)pyridin-3-yl)-8,8-dimethyl-7,8-dihydro-6H-cyclopenta[e]pyrazolo[1,5-a]pyrimidine-6- carb oxami de
- Step 8 2-chloro-N-(5-chloro-6-(2H-1,2,3-triazol-2-yl)pyridin-3-yl)-7-hydroxy-8,8- dimethyl-7,8-dihydro-6H-cyclopenta[e]pyrazolo[1,5-a]pyrimidine-6-carboxamide (Example 19)
- Example 19 1 H NMR ( ⁇ 1 : 1 mixture of both racemic diastereomers, 400 MHz, Methanol- d 4 ) ⁇ : 8.71-8.75(m, 1H), 8.66-8.67 (m, 1H), 8.53-8.55 (m, 1H), 8.03 (s, 2H), 6.69 (s, 1H), 4.59- 4.60 (m, 1H), 4.11-4.13 (m, 1H), 1.64 (s, 3H), 1.58 (s, 3H).
- LC-MS m/z 459[M+H] + .
- Examples 20 and 21 Single enantiomers obtained from a racemic mixture containing (R)-N-(5-chloro-6-(2H-1,2,3-triazol-2-yl)pyridin-3-yl)-2-ethyl-8,8-dimethyl-7,8-dihydro-6H- cyclopenta[e]pyrazolo[1,5-a]pyrimidine-6-carboxamide and (S)-N-(5-chloro-6-(2H-1,2,3- triazol-2-yl)pyridin-3-yl)-2-ethyl-8,8-dimethyl-7,8-dihydro-6H-cyclopenta[e]pyrazolo[1,5- a] pyrimidine-6-carboxamide.
- Step 1 2-ethyl-8,8-dimethyl-7,8-dihydro-6H-cyclopenta[e]pyrazolo[1,5-a]pyrimidine-6- carbonitrile
- Step 2 2-ethyl-8,8-dimethyl-7,8-dihydro-6H-cyclopenta[e]pyrazolo[1,5-a]pyrimidine-6- carboxylic acid
- Step 3 N-(5-chloro-6-(2H-1,2,3-triazol-2-yl)pyridin-3-yl)-2-ethyl-8,8-dimethyl-7,8- dihydro-6H-cyclopenta[e]pyrazolo[1,5-a]pyrimidine-6-carboxamide
- Step 4 Separation of enantiomers to obtain (A)-N-(5-chloro-6-(2H-1,2,3-triazol-2- yl)pyridin-3-yl)-2-ethyl-8,8-dimethyl-7,8-dihydro-6H-cyclopenta[e]pyrazolo[1,5-a]pyrimidine- 6-carboxamide and (S)-N-(5-chloro-6-(2H-1,2,3-triazol-2-yl)pyridin-3-yl)-2-ethyl-8,8-dimethyl- 7,8-dihydro-6H-cyclopenta[e]pyrazolo [1,5-a]pyrimidine-6-carboxamide.
- Example 20 The first eluting isomer was concentrated and lyophilized to afford Example 20 as a white solid (5.3 mg, 12% yield).
- the second eluting isomer was concentrated and lyophilized to afford Example 21 as a white solid (4.5 mg, 11% yield).
- LC-MS m/z 437 [M+H] + .
- LC-MS m/z 437 [M+H] + .
- Step 1 2-chloro-N-(5-chloro-6-(4-(2-hydroxypropan-2-yl)-2H-1,2,3-triazol-2-yl)pyridin- 3-yl)-8,8-dimethyl-7,8-dihydro-6H-cyclopenta[e]pyrazolo[1,5-a]pyrimidine-6-carboxamide
- Step 2 Separation of enantiomers to obtain (R)-2-chloro-N-(5-chloro-6-(4-(2- hydroxypropan-2-yl)-2H-1,2,3-triazol-2-yl)pyridin-3-yl)-8,8-dimethyl-7,8-dihydro-6H- cyclopenta[e]pyrazolo[1,5-a]pyrimidine-6-carboxamide and (S)-2-chloro- N-(5-chloro-6-(4-(2- hydroxypropan-2-yl)-2H-1,2,3- triazol-2-yl) pyridin- 3-yl)- 8,8-dimethyl-7,8-dihydro-6H- cyclopenta [e]pyrazolo [1,5-a] pyrimidine-6- carboxamide.
- Example 22 (19.6 mg, 79% yield) as a white solid.
- the second eluting isomer was concentrated and lyophilized to afford Example 23 (19.1 mg, 77% yield) as a white solid.
- LC-MS m/z 501 [M+H] + .
- LC-MS m/z 501[M+H] + .
- Examples 24 and 25 Single enantiomers obtained from a racemic mixture containing (R)-N-(5-chloro-6-(2H-1,2,3-triazol-2-yl)pyridin-3-yl)-2-(difluoromethyl)-8,8- dimethyl-7,8-dihydro-6H-cyclopenta[e]pyrazolo[1,5-a]pyrimidine-6-carboxamide and (S)- N-(5-chloro-6-(2H-1,2,3-triazol-2-yl)pyridin-3-yl)-2-(difluoromethyl)-8,8-dimethyl-7,8- dihydro-6H-cyclopenta[e]pyrazolo[1,5-a]pyrimidine-6-carboxamide.
- Step 1 (6-cyano-8,8-dimethyl-7,8-dihydro-6H-cyclopenta[e]pyrazolo[1,5-a]pyrimidin-2- yl)boronic acid
- Step 2 2-(difluoromethyl)-8,8-dimethyl-7,8-dihydro-6H-cyclopenta[e]pyrazolo[1,5- a]pyrimidine-6-carbonitrile
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Life Sciences & Earth Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Engineering & Computer Science (AREA)
- Immunology (AREA)
- Pharmacology & Pharmacy (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Animal Behavior & Ethology (AREA)
- Molecular Biology (AREA)
- Epidemiology (AREA)
- Urology & Nephrology (AREA)
- Hematology (AREA)
- Biomedical Technology (AREA)
- Cell Biology (AREA)
- General Physics & Mathematics (AREA)
- Microbiology (AREA)
- Pathology (AREA)
- Biotechnology (AREA)
- Food Science & Technology (AREA)
- Physics & Mathematics (AREA)
- Analytical Chemistry (AREA)
- Biochemistry (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
- Nitrogen Condensed Heterocyclic Rings (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Nitrogen And Oxygen Or Sulfur-Condensed Heterocyclic Ring Systems (AREA)
Priority Applications (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP22704145.6A EP4284804A1 (en) | 2021-01-26 | 2022-01-25 | Tricyclic compounds useful in the treatment of cancer, autoimmune and inflammatory disorders |
| JP2023545277A JP2024505890A (ja) | 2021-01-26 | 2022-01-25 | がん、自己免疫及び炎症性障害の治療に有用な三環式化合物 |
| CN202280022524.3A CN117120442A (zh) | 2021-01-26 | 2022-01-25 | 用于治疗癌症、自身免疫性病症和炎性病症的三环化合物 |
| US18/273,879 US20240148732A1 (en) | 2021-01-26 | 2022-01-25 | Tricyclic compounds useful in the treatment of cancer, autoimmune and inflammatory disorders |
Applications Claiming Priority (6)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US202163141682P | 2021-01-26 | 2021-01-26 | |
| US63/141,682 | 2021-01-26 | ||
| US202163145344P | 2021-02-03 | 2021-02-03 | |
| US63/145,344 | 2021-02-03 | ||
| US202163276064P | 2021-11-05 | 2021-11-05 | |
| US63/276,064 | 2021-11-05 |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2022164789A1 true WO2022164789A1 (en) | 2022-08-04 |
| WO2022164789A9 WO2022164789A9 (en) | 2023-05-25 |
Family
ID=80349693
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2022/013671 Ceased WO2022164789A1 (en) | 2021-01-26 | 2022-01-25 | Tricyclic compounds useful in the treatment of cancer, autoimmune and inflammatory disoders |
Country Status (4)
| Country | Link |
|---|---|
| US (1) | US20240148732A1 (https=) |
| EP (1) | EP4284804A1 (https=) |
| JP (1) | JP2024505890A (https=) |
| WO (1) | WO2022164789A1 (https=) |
Cited By (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2023051759A1 (zh) * | 2021-09-30 | 2023-04-06 | 上海拓界生物医药科技有限公司 | 三环化合物及其制备方法 |
| CN116064763A (zh) * | 2021-07-09 | 2023-05-05 | 广州恩迈生物科技有限公司 | 以ifp35和nmi为靶点的疾病诊断和治疗 |
| WO2024020534A3 (en) * | 2022-07-22 | 2024-03-07 | Schrödinger, Inc. | Cyclic compounds and methods of using same |
| WO2024133859A1 (en) * | 2022-12-23 | 2024-06-27 | Janssen Pharmaceutica Nv | Malt1 inhibitors |
| WO2025059027A1 (en) * | 2023-09-11 | 2025-03-20 | Schrödinger, Inc. | Cyclopenta[e]pyrazolo[1,5-a]pyrimidine derivatives as malt1 inhibitors |
Citations (60)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2007002433A1 (en) | 2005-06-22 | 2007-01-04 | Plexxikon, Inc. | Pyrrolo [2, 3-b] pyridine derivatives as protein kinase inhibitors |
| WO2007110344A1 (en) | 2006-03-27 | 2007-10-04 | Nerviano Medical Sciences S.R.L. | Pyridyl- and pyrimidinyl-substituted pyrrole-, thiophene- and furane-derivatives as kinase inhibitors |
| WO2008080015A2 (en) | 2006-12-21 | 2008-07-03 | Plexxikon, Inc. | Compounds and methods for kinase modulation, and indications therefor |
| WO2008079903A1 (en) | 2006-12-21 | 2008-07-03 | Plexxikon, Inc. | Pyrrolo [2, 3-b] pyridine derivatives as kinase modulators |
| WO2008079909A1 (en) | 2006-12-21 | 2008-07-03 | Plexxikon, Inc. | Pyrrolo [2,3-b] pyridines as kinase modulators |
| WO2009007748A2 (en) | 2007-07-09 | 2009-01-15 | Astrazeneca Ab | Trisubstituted pyrimidine derivatives for the treatment of proliferative diseases |
| WO2009012283A1 (en) | 2007-07-17 | 2009-01-22 | Plexxikon Inc. | Compounds and methods for kinase modulation, and indications therefor |
| WO2009014637A2 (en) | 2007-07-19 | 2009-01-29 | Schering Corporation | Heterocyclic amide compounds as protein kinase inhibitors |
| US7514446B2 (en) | 2003-02-20 | 2009-04-07 | Smithkline Beecham Corporation | Pyrimidine compounds |
| WO2009071480A2 (en) | 2007-12-04 | 2009-06-11 | Nerviano Medical Sciences S.R.L. | Substituted dihydropteridin-6-one derivatives, process for their preparation and their use as kinase inhibitors |
| WO2009118411A2 (en) | 2008-03-28 | 2009-10-01 | Nerviano Medical Sciences S.R.L. | 3,4-dihydro-2h-pyrazino[1,2-a]indol-1-one derivatives active as kinase inhibitors, process for their preparation and pharmaceutical compositions comprising them |
| WO2009143018A2 (en) | 2008-05-19 | 2009-11-26 | Plexxikon, Inc. | Compounds and methods for kinase modulation, and indications therefor |
| WO2009143024A2 (en) | 2008-05-19 | 2009-11-26 | Plexxikon, Inc. | Compounds and methods for kinase modulation, and indications therefor |
| WO2009152083A1 (en) | 2008-06-10 | 2009-12-17 | Plexxikon, Inc. | 5h-pyrr0l0 [2,3-b] pyrazine derivatives for kinase modulation, and indications therefor |
| WO2010031816A1 (en) | 2008-09-19 | 2010-03-25 | Nerviano Medical Sciences S.R.L. | 3,4 DIHYDRO-2H-PYRROLO[1,2-a]PYRAZIN-1-ONE DERIVATIVES |
| WO2010111527A1 (en) | 2009-03-26 | 2010-09-30 | Plexxikon, Inc. | Pyrazolo [ 3, 4 -b] pyridines as kinase inhibitors and their medical use |
| WO2010145998A1 (en) | 2009-06-15 | 2010-12-23 | Nerviano Medical Sciences S.R.L. | Substituted pyrimidinylpyrrolopyridinone derivatives, process for their preparation and their use as kinase inhibitors |
| WO2011092120A1 (en) | 2010-01-29 | 2011-08-04 | Nerviano Medical Sciences S.R.L. | 6,7- dihydroimidazo [1,5-a] pyrazin-8 (5h) - one derivatives as protein kinase modulators |
| US8026247B2 (en) | 2004-09-15 | 2011-09-27 | Novartis Ag | Bicyclic amides as kinase inhibitors |
| WO2012101029A1 (en) | 2011-01-26 | 2012-08-02 | Nerviano Medical Sciences S.R.L. | Tricyclic derivatives, process for their preparation and their use as kinase inhibitors |
| WO2012101032A1 (en) | 2011-01-26 | 2012-08-02 | Nerviano Medical Sciences S.R.L. | Tricyclic pyrrolo derivatives, process for their preparation and their use as kinase inhibitors |
| WO2012109075A1 (en) | 2011-02-07 | 2012-08-16 | Plexxikon Inc. | Compounds and methods for kinase modulation, and indications therefor |
| WO2012113774A1 (en) | 2011-02-24 | 2012-08-30 | Nerviano Medical Sciences S.R.L. | Thiazolylphenyl-benzenesulfonamido derivatives as kinase inhibitors |
| WO2012139930A1 (en) | 2011-04-11 | 2012-10-18 | Nerviano Medical Sciences S.R.L. | Pyrazolyl-pyrimidine derivatives as kinase inhibitors |
| WO2012143248A1 (en) | 2011-04-19 | 2012-10-26 | Nerviano Medical Sciences S.R.L. | Substituted pyrimidinyl-pyrroles active as kinase inhibitors |
| WO2012152763A1 (en) | 2011-05-12 | 2012-11-15 | Nerviano Medical Sciences S.R.L. | Substituted indazole derivatives active as kinase inhibitors |
| WO2013014039A1 (en) | 2011-07-28 | 2013-01-31 | Nerviano Medical Sciences S.R.L. | Alkynyl substituted pyrimidinyl-pyrroles active as kinases inhibitors |
| US20130029925A1 (en) | 2010-02-18 | 2013-01-31 | Universite De Bretagne Occidentale (U.B.O.) | Method for Preventing Cancer Metastasis |
| WO2013050448A1 (en) | 2011-10-07 | 2013-04-11 | Nerviano Medical Sciences S.R.L. | 4-ALKYL SUBSTITUTED 3,4-DIHYDROPYRROLO[1,2-a]PYRAZIN-1(2H)-ONE DERIVATIVES AS KINASES INHIBITORS |
| WO2013050446A1 (en) | 2011-10-07 | 2013-04-11 | Nerviano Medical Sciences S.R.L. | SUBSTITUTED 3,4-DIHYDROPYRROLO[1,2-a]PYRAZIN-1(2H)-ONE DERIVATIVES AS KINASES INHIBITORS |
| WO2013102059A1 (en) | 2011-12-30 | 2013-07-04 | Pharmacyclics, Inc. | Pyrazolo [3, 4-d] pyrimidine and pyrrolo [2, 3-d] pyrimidine compounds as kinase inhibitors |
| US8501756B2 (en) | 2008-12-09 | 2013-08-06 | Novartis Ag | Heterobicyclic carboxamides as inhibitors for kinases |
| US8552002B2 (en) | 2004-06-24 | 2013-10-08 | Novartis Ag | Compounds and compositions as protein kinase inhibitors |
| US8568998B2 (en) | 2004-03-26 | 2013-10-29 | Whitehead Institute For Biomedical Research | Methods of diagnosing, preventing and treating cancer metastasis |
| WO2014011900A2 (en) | 2012-07-11 | 2014-01-16 | Blueprint Medicines | Inhibitors of the fibroblast growth factor receptor |
| WO2014019908A2 (en) | 2012-08-02 | 2014-02-06 | Nerviano Medical Sciences S.R.L. | Substituted pyrroles active as kinases inhibitors |
| WO2014072220A1 (en) | 2012-11-07 | 2014-05-15 | Nerviano Medical Sciences S.R.L. | Substituted pyrimidinyl and pyridinyl-pyrrolopyridinones, process for their preparation and their use as kinase inhibitors |
| WO2014083567A2 (en) | 2012-11-29 | 2014-06-05 | Yeda Research And Development Co. Ltd. | Methods of preventing tumor metastasis, treating and prognosing cancer and identifying agents which are putative metastasis inhibitors |
| US8815901B2 (en) | 2008-05-23 | 2014-08-26 | Novartis Ag | Quinoline carboxamide derivatives as protein tyrosine kinase inhibitors |
| WO2014160521A1 (en) | 2013-03-15 | 2014-10-02 | Blueprint Medicines Corporation | Piperazine derivatives and their use as kit modulators |
| WO2014184069A1 (en) | 2013-05-14 | 2014-11-20 | Nerviano Medical Sciences S.R.L. | Pyrrolo[2,3-d]pyrimidine derivatives, process for their preparation and their use as kinase inhibitors |
| WO2014194127A1 (en) | 2013-05-30 | 2014-12-04 | Plexxikon Inc. | Compounds for kinase modulation, and indications therefor |
| WO2015017533A1 (en) | 2013-07-30 | 2015-02-05 | Blueprint Medicines Corporation | Ntrk2 fusions |
| WO2015017528A1 (en) | 2013-07-30 | 2015-02-05 | Blueprint Medicines Corporation | Pik3c2g fusions |
| WO2015057873A1 (en) | 2013-10-17 | 2015-04-23 | Blueprint Medicines Corporation | Compositions useful for treating disorders related to kit |
| WO2015058129A1 (en) | 2013-10-17 | 2015-04-23 | Blueprint Medicines Corporation | Compositions useful for treating disorders related to kit |
| WO2015061572A1 (en) | 2013-10-25 | 2015-04-30 | Blueprint Medicines Corporation | Inhibitors of the fibroblast growth factor receptor |
| WO2015108992A1 (en) | 2014-01-15 | 2015-07-23 | Blueprint Medicines Corporation | Heterobicyclic compounds and their use as fgfr4 receptor inhibitors |
| WO2015112806A2 (en) | 2014-01-24 | 2015-07-30 | Tp Therapeutics, Inc. | Diaryl macrocycles as modulators of protein kinases |
| WO2015161277A1 (en) | 2014-04-18 | 2015-10-22 | Blueprint Medicines Corporation | Met fusions |
| WO2015161274A1 (en) | 2014-04-18 | 2015-10-22 | Blueprint Medicines Corporation | Pik3ca fusions |
| WO2015191666A2 (en) | 2014-06-10 | 2015-12-17 | Blueprint Medicines Corporation | Raf1 fusions |
| WO2015191667A1 (en) | 2014-06-10 | 2015-12-17 | Blueprint Medicines Corporation | Pkn1 fusions |
| WO2016011144A1 (en) | 2014-07-17 | 2016-01-21 | Blueprint Medicines Corporation | Tert fusions |
| WO2016011147A1 (en) | 2014-07-17 | 2016-01-21 | Blueprint Medicines Corporation | Prkc fusions |
| WO2016011141A1 (en) | 2014-07-17 | 2016-01-21 | Blueprint Medicines Corporation | Fgr fusions |
| WO2016022569A1 (en) | 2014-08-04 | 2016-02-11 | Blueprint Medicines Corporation | Compositions useful for treating disorders related to kit |
| WO2016075224A1 (en) | 2014-11-14 | 2016-05-19 | Nerviano Medical Sciences S.R.L. | 6-amino-7-bicyclo-7-deaza-purine derivatives as protein kinase inhibitors |
| WO2016081450A1 (en) | 2014-11-18 | 2016-05-26 | Blueprint Medicines Corporation | Prkacb fusions |
| WO2018226150A1 (en) * | 2017-06-05 | 2018-12-13 | Medivir Aktiebolag | Pyrazolopyrimidine as malt-1 inhibitors |
Family Cites Families (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2009108827A1 (en) * | 2008-02-29 | 2009-09-03 | Wyeth | Fused tricyclic pyrazolo[1, 5-a]pyrimidines, methods for preparation and uses thereof |
| BR112017023764A2 (pt) * | 2015-05-05 | 2018-07-31 | Bayer Pharma AG | derivados de ciclohexano substituído por amido |
-
2022
- 2022-01-25 EP EP22704145.6A patent/EP4284804A1/en active Pending
- 2022-01-25 WO PCT/US2022/013671 patent/WO2022164789A1/en not_active Ceased
- 2022-01-25 JP JP2023545277A patent/JP2024505890A/ja active Pending
- 2022-01-25 US US18/273,879 patent/US20240148732A1/en active Pending
Patent Citations (68)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US7514446B2 (en) | 2003-02-20 | 2009-04-07 | Smithkline Beecham Corporation | Pyrimidine compounds |
| US8568998B2 (en) | 2004-03-26 | 2013-10-29 | Whitehead Institute For Biomedical Research | Methods of diagnosing, preventing and treating cancer metastasis |
| US8552002B2 (en) | 2004-06-24 | 2013-10-08 | Novartis Ag | Compounds and compositions as protein kinase inhibitors |
| US8026247B2 (en) | 2004-09-15 | 2011-09-27 | Novartis Ag | Bicyclic amides as kinase inhibitors |
| WO2007002325A1 (en) | 2005-06-22 | 2007-01-04 | Plexxikon, Inc. | Pyrrolo[2,3-b] pyridine derivatives as protein kinase inhibitors |
| WO2007002433A1 (en) | 2005-06-22 | 2007-01-04 | Plexxikon, Inc. | Pyrrolo [2, 3-b] pyridine derivatives as protein kinase inhibitors |
| WO2007110344A1 (en) | 2006-03-27 | 2007-10-04 | Nerviano Medical Sciences S.R.L. | Pyridyl- and pyrimidinyl-substituted pyrrole-, thiophene- and furane-derivatives as kinase inhibitors |
| WO2008079903A1 (en) | 2006-12-21 | 2008-07-03 | Plexxikon, Inc. | Pyrrolo [2, 3-b] pyridine derivatives as kinase modulators |
| WO2008079909A1 (en) | 2006-12-21 | 2008-07-03 | Plexxikon, Inc. | Pyrrolo [2,3-b] pyridines as kinase modulators |
| WO2008079906A1 (en) | 2006-12-21 | 2008-07-03 | Plexxikon, Inc. | Pyrrolo [2, 3-b] pyridine derivatives as kinase modulators |
| WO2008080001A2 (en) | 2006-12-21 | 2008-07-03 | Plexxikon, Inc. | Compounds and methods for kinase modulation, and indications therefor |
| WO2008080015A2 (en) | 2006-12-21 | 2008-07-03 | Plexxikon, Inc. | Compounds and methods for kinase modulation, and indications therefor |
| US7863289B2 (en) | 2006-12-21 | 2011-01-04 | Plexxikon, Inc. | Compounds and methods for kinase modulation, and indications therefor |
| WO2009007748A2 (en) | 2007-07-09 | 2009-01-15 | Astrazeneca Ab | Trisubstituted pyrimidine derivatives for the treatment of proliferative diseases |
| WO2009012283A1 (en) | 2007-07-17 | 2009-01-22 | Plexxikon Inc. | Compounds and methods for kinase modulation, and indications therefor |
| WO2009014637A2 (en) | 2007-07-19 | 2009-01-29 | Schering Corporation | Heterocyclic amide compounds as protein kinase inhibitors |
| WO2009071480A2 (en) | 2007-12-04 | 2009-06-11 | Nerviano Medical Sciences S.R.L. | Substituted dihydropteridin-6-one derivatives, process for their preparation and their use as kinase inhibitors |
| WO2009118411A2 (en) | 2008-03-28 | 2009-10-01 | Nerviano Medical Sciences S.R.L. | 3,4-dihydro-2h-pyrazino[1,2-a]indol-1-one derivatives active as kinase inhibitors, process for their preparation and pharmaceutical compositions comprising them |
| WO2009143024A2 (en) | 2008-05-19 | 2009-11-26 | Plexxikon, Inc. | Compounds and methods for kinase modulation, and indications therefor |
| WO2009143018A2 (en) | 2008-05-19 | 2009-11-26 | Plexxikon, Inc. | Compounds and methods for kinase modulation, and indications therefor |
| US8912204B2 (en) | 2008-05-19 | 2014-12-16 | Plexxikon Inc. | Compounds and methods for kinase modulation, and indications therefor |
| US9260437B2 (en) | 2008-05-19 | 2016-02-16 | Plexxikon Inc. | Compounds and methods for kinase modulation, and indications therefor |
| US8815901B2 (en) | 2008-05-23 | 2014-08-26 | Novartis Ag | Quinoline carboxamide derivatives as protein tyrosine kinase inhibitors |
| WO2009152083A1 (en) | 2008-06-10 | 2009-12-17 | Plexxikon, Inc. | 5h-pyrr0l0 [2,3-b] pyrazine derivatives for kinase modulation, and indications therefor |
| WO2010031816A1 (en) | 2008-09-19 | 2010-03-25 | Nerviano Medical Sciences S.R.L. | 3,4 DIHYDRO-2H-PYRROLO[1,2-a]PYRAZIN-1-ONE DERIVATIVES |
| US8501756B2 (en) | 2008-12-09 | 2013-08-06 | Novartis Ag | Heterobicyclic carboxamides as inhibitors for kinases |
| WO2010111527A1 (en) | 2009-03-26 | 2010-09-30 | Plexxikon, Inc. | Pyrazolo [ 3, 4 -b] pyridines as kinase inhibitors and their medical use |
| WO2010145998A1 (en) | 2009-06-15 | 2010-12-23 | Nerviano Medical Sciences S.R.L. | Substituted pyrimidinylpyrrolopyridinone derivatives, process for their preparation and their use as kinase inhibitors |
| WO2011092120A1 (en) | 2010-01-29 | 2011-08-04 | Nerviano Medical Sciences S.R.L. | 6,7- dihydroimidazo [1,5-a] pyrazin-8 (5h) - one derivatives as protein kinase modulators |
| US20130029925A1 (en) | 2010-02-18 | 2013-01-31 | Universite De Bretagne Occidentale (U.B.O.) | Method for Preventing Cancer Metastasis |
| WO2012101032A1 (en) | 2011-01-26 | 2012-08-02 | Nerviano Medical Sciences S.R.L. | Tricyclic pyrrolo derivatives, process for their preparation and their use as kinase inhibitors |
| WO2012101029A1 (en) | 2011-01-26 | 2012-08-02 | Nerviano Medical Sciences S.R.L. | Tricyclic derivatives, process for their preparation and their use as kinase inhibitors |
| WO2012109075A1 (en) | 2011-02-07 | 2012-08-16 | Plexxikon Inc. | Compounds and methods for kinase modulation, and indications therefor |
| WO2012113774A1 (en) | 2011-02-24 | 2012-08-30 | Nerviano Medical Sciences S.R.L. | Thiazolylphenyl-benzenesulfonamido derivatives as kinase inhibitors |
| WO2012139930A1 (en) | 2011-04-11 | 2012-10-18 | Nerviano Medical Sciences S.R.L. | Pyrazolyl-pyrimidine derivatives as kinase inhibitors |
| WO2012143248A1 (en) | 2011-04-19 | 2012-10-26 | Nerviano Medical Sciences S.R.L. | Substituted pyrimidinyl-pyrroles active as kinase inhibitors |
| WO2012152763A1 (en) | 2011-05-12 | 2012-11-15 | Nerviano Medical Sciences S.R.L. | Substituted indazole derivatives active as kinase inhibitors |
| WO2013014039A1 (en) | 2011-07-28 | 2013-01-31 | Nerviano Medical Sciences S.R.L. | Alkynyl substituted pyrimidinyl-pyrroles active as kinases inhibitors |
| WO2013050446A1 (en) | 2011-10-07 | 2013-04-11 | Nerviano Medical Sciences S.R.L. | SUBSTITUTED 3,4-DIHYDROPYRROLO[1,2-a]PYRAZIN-1(2H)-ONE DERIVATIVES AS KINASES INHIBITORS |
| WO2013050448A1 (en) | 2011-10-07 | 2013-04-11 | Nerviano Medical Sciences S.R.L. | 4-ALKYL SUBSTITUTED 3,4-DIHYDROPYRROLO[1,2-a]PYRAZIN-1(2H)-ONE DERIVATIVES AS KINASES INHIBITORS |
| US20150018336A1 (en) | 2011-12-30 | 2015-01-15 | Pharmacyclics, Inc. | PYRAZOLO[3,4-d]PYRIMIDINE AND PYRAZOLO[2,3-d]PYRIMIDINE COMPOUNDS AS KINASE INHIBITORS |
| US9273051B2 (en) | 2011-12-30 | 2016-03-01 | Pharmacyclics Llc | Pyrazolo[3,4-d]pyrimidine and pyrrolo[2,3-d]pyrimidine compounds as kinase inhibitors |
| WO2013102059A1 (en) | 2011-12-30 | 2013-07-04 | Pharmacyclics, Inc. | Pyrazolo [3, 4-d] pyrimidine and pyrrolo [2, 3-d] pyrimidine compounds as kinase inhibitors |
| WO2014011900A2 (en) | 2012-07-11 | 2014-01-16 | Blueprint Medicines | Inhibitors of the fibroblast growth factor receptor |
| WO2014019908A2 (en) | 2012-08-02 | 2014-02-06 | Nerviano Medical Sciences S.R.L. | Substituted pyrroles active as kinases inhibitors |
| WO2014072220A1 (en) | 2012-11-07 | 2014-05-15 | Nerviano Medical Sciences S.R.L. | Substituted pyrimidinyl and pyridinyl-pyrrolopyridinones, process for their preparation and their use as kinase inhibitors |
| WO2014083567A2 (en) | 2012-11-29 | 2014-06-05 | Yeda Research And Development Co. Ltd. | Methods of preventing tumor metastasis, treating and prognosing cancer and identifying agents which are putative metastasis inhibitors |
| WO2014160521A1 (en) | 2013-03-15 | 2014-10-02 | Blueprint Medicines Corporation | Piperazine derivatives and their use as kit modulators |
| WO2014184069A1 (en) | 2013-05-14 | 2014-11-20 | Nerviano Medical Sciences S.R.L. | Pyrrolo[2,3-d]pyrimidine derivatives, process for their preparation and their use as kinase inhibitors |
| WO2014194127A1 (en) | 2013-05-30 | 2014-12-04 | Plexxikon Inc. | Compounds for kinase modulation, and indications therefor |
| WO2015017533A1 (en) | 2013-07-30 | 2015-02-05 | Blueprint Medicines Corporation | Ntrk2 fusions |
| WO2015017528A1 (en) | 2013-07-30 | 2015-02-05 | Blueprint Medicines Corporation | Pik3c2g fusions |
| WO2015057873A1 (en) | 2013-10-17 | 2015-04-23 | Blueprint Medicines Corporation | Compositions useful for treating disorders related to kit |
| WO2015058129A1 (en) | 2013-10-17 | 2015-04-23 | Blueprint Medicines Corporation | Compositions useful for treating disorders related to kit |
| WO2015061572A1 (en) | 2013-10-25 | 2015-04-30 | Blueprint Medicines Corporation | Inhibitors of the fibroblast growth factor receptor |
| WO2015108992A1 (en) | 2014-01-15 | 2015-07-23 | Blueprint Medicines Corporation | Heterobicyclic compounds and their use as fgfr4 receptor inhibitors |
| WO2015112806A2 (en) | 2014-01-24 | 2015-07-30 | Tp Therapeutics, Inc. | Diaryl macrocycles as modulators of protein kinases |
| WO2015161274A1 (en) | 2014-04-18 | 2015-10-22 | Blueprint Medicines Corporation | Pik3ca fusions |
| WO2015161277A1 (en) | 2014-04-18 | 2015-10-22 | Blueprint Medicines Corporation | Met fusions |
| WO2015191666A2 (en) | 2014-06-10 | 2015-12-17 | Blueprint Medicines Corporation | Raf1 fusions |
| WO2015191667A1 (en) | 2014-06-10 | 2015-12-17 | Blueprint Medicines Corporation | Pkn1 fusions |
| WO2016011144A1 (en) | 2014-07-17 | 2016-01-21 | Blueprint Medicines Corporation | Tert fusions |
| WO2016011147A1 (en) | 2014-07-17 | 2016-01-21 | Blueprint Medicines Corporation | Prkc fusions |
| WO2016011141A1 (en) | 2014-07-17 | 2016-01-21 | Blueprint Medicines Corporation | Fgr fusions |
| WO2016022569A1 (en) | 2014-08-04 | 2016-02-11 | Blueprint Medicines Corporation | Compositions useful for treating disorders related to kit |
| WO2016075224A1 (en) | 2014-11-14 | 2016-05-19 | Nerviano Medical Sciences S.R.L. | 6-amino-7-bicyclo-7-deaza-purine derivatives as protein kinase inhibitors |
| WO2016081450A1 (en) | 2014-11-18 | 2016-05-26 | Blueprint Medicines Corporation | Prkacb fusions |
| WO2018226150A1 (en) * | 2017-06-05 | 2018-12-13 | Medivir Aktiebolag | Pyrazolopyrimidine as malt-1 inhibitors |
Non-Patent Citations (76)
| Title |
|---|
| "March's Advanced Organic Chemistry: Reactions, Mechanisms, and Structure", 2001, WILEY-INTERSCIENCE PUBLICATION |
| "Pharmaceutical Dosage Forms: Parenteral Medications", vol. 1-2, 2000, AMERICAN PHARMACEUTICAL ASSOCIATION |
| AFOFINA ET AL., FEBS JOURNAL, 2015 |
| AFONINA ET AL., FEBS J, vol. 282, no. 17, 2015, pages 3286 - 3297 |
| ALAMEDA, J. P. ET AL., ONCOGENE, vol. 29, no. 50, 2010, pages 6522 - 6532 |
| AMIT M ET AL., ONCOGENE, vol. 36, 8 June 2017 (2017-06-08), pages 3232 - 3239 |
| AVERY MDFIRST LR: "Pediatric Medicine", 1994, WILLIAMS & WILKINS |
| BAENS ET AL., PLOS ONE, vol. 9, 2014, pages e103774 |
| BAENS ET AL., PLOS ONE, vol. 9, no. 8, 2014, pages el03774 |
| BERHMAN REKLIEGMAN RARVIN AMNELSON WE: "Nelson Textbook of Pediatrics", 1996, W.B. SAUNDERS COMPANY |
| CONNELL ET AL., ESMO OPEN, vol. 2, 2017, pages 5 |
| COORNAERT ET AL., NAT IMMUNOL, vol. 20008, no. 9, 2014, pages 1079 - 1089 |
| COURTOISGILMORE, ONCOGENE, vol. 25, no. 51, 2006, pages 6831 - 6843 |
| DING K ET AL., JBIOL CHEM, vol. 289, 6 June 2014 (2014-06-06), pages 16057 - 71 |
| ELLISON ET AL., JOURNAL OF CLINICAL PATHOLOGY, vol. 66, no. 2, 2013, pages 79 - 89 |
| FARINHA ET AL., J CLINICAL ONCOLOGY, vol. 23, 2005, pages 6370 - 6378 |
| FERCH U ET AL., J EXP MED, vol. 206, 2009, pages 2313 - 2320 |
| FLORIAN SCHLAUDERER ET AL: "Strukturelle Analyse von Phenothiazin-Derivaten als allosterische Inhibitoren der MALT1-Paracaspase", ANGEWANDTE CHEMIE, WILEY - V C H VERLAG GMBH & CO. KGAA, DE, vol. 125, no. 39, 14 August 2013 (2013-08-14), pages 10575 - 10579, XP071354975, ISSN: 0044-8249, DOI: 10.1002/ANGE.201304290 * |
| FORBES I T ET AL: "SYNTHESIS, BIOLOGICAL ACITIVITY, AND MOLECULAR MODELING STUDIES OF SELECTIVE 5-HT2C/2B RECEPTOR ANTAGONISTS", JOURNAL OF MEDICINAL CHEMISTRY, AMERICAN CHEMICAL SOCIETY, US, vol. 39, no. 25, 1996, pages 4966 - 4977, XP002061494, ISSN: 0022-2623, DOI: 10.1021/JM960571V * |
| GAO L ET AL., PANCREAS, vol. 44, January 2015 (2015-01-01), pages 134 - 143 |
| GREENE, T. W.WUTS, P. G. M.: "Protective Groups in Organic Synthesis", 1991, WILEY |
| HAILFINGER ET AL., PNAS, vol. 108, 2011, pages 14596 - 14601 |
| HAILFINGER S ET AL., PROC NATL ACAD SCI USA, vol. 106, 2009, pages 19946 - 19951 |
| HEZAM K ET AL., REV NEUROSCI, vol. 29, 26 January 2018 (2018-01-26), pages 93 - 98 |
| ISRAEL, COLD SPRING HARBOR PERSPECTIVES IN BIOLOGY, vol. 2, no. 3, 2010, pages a000158 |
| J CELL MOL MED., vol. 24, no. 13, July 2020 (2020-07-01), pages 7550 - 7562 |
| JABARA ET AL., J ALLERGY CLIN IMMUNOLOGY, vol. 132, 2013, pages 151 - 158 |
| JABBOUR ET AL., CANCER, vol. 117, no. 9, 2011, pages 1800 - 1811 |
| JAWORSKI ET AL., CELL MOL LIFE SCIENCE, vol. 73, 2016, pages 459 - 473 |
| JAWORSKI ET AL., EMBO J., vol. 33, no. 23, 2014, pages 2765 - 2781 |
| JIANG ET AL., CANCER RESEARCH, vol. 71, 2011, pages 2183 - 2192 |
| JOHANSSON ET AL., ONCOTARGET, vol. 7, no. 48, 2016, pages 78985 - 14 |
| JUILLANDTHOME, FRONTIERS IN IMMUNOLOGY, vol. 9, 2018, pages 1927 |
| KASPERKIEWICZ ET AL., SCIENTIFIC REPORTS, vol. 8, no. 1, 2018, pages 1 - 10 |
| KIM ET AL., ONCOLMMUNOLOGY, vol. 5, no. 2, 2016, pages e1069940 |
| KLEIN ET AL., NAT. COMM., vol. 6, no. 1, 2015, pages 1 - 17 |
| KOSHKIN ET AL., BLADDER CANCER, vol. 5, no. 1, 2019, pages 1 - 12 |
| KUBLER ET AL., J. IMMUNOTHER CANCER, vol. 3, 2015, pages 26 |
| LEE ET AL., HAEMATOLOGICA, vol. 100, no. 12, 2015, pages e505 |
| LOUIS, D.N. ET AL., ACTA NEUROPATHOL, vol. 131, no. 6, June 2016 (2016-06-01), pages 803 - 820 |
| LOWES ET AL., ANN REVIEW IMMUNOLOGY, vol. 32, 2014, pages 227 - 255 |
| LU ET AL., FRONT. IMMUNOL., vol. 9, 2018, pages 2078 |
| MASSOUMI, FUTURE ONCOLOGY, vol. 7, no. 2, 2011, pages 285 - 297 |
| MCGUIRE ET AL., J. NEUROINFLAMM., vol. 11, no. 1, 2014, pages 1 - 12 |
| MIDHA ET AL., AMERICAN JOURNAL OF CANCER RESEARCH, vol. 5, no. 9, 2015, pages 2892 |
| NIE ET AL., NAT COMMUN, vol. 6, 2015, pages 5908 |
| PAN ET AL., CANCER RES, vol. 14, 2016, pages 93 - 102 |
| PAN ET AL., MOL CANCER RES, vol. 14, 2016, pages 93 - 102 |
| PAN, MOL. CANCER RES., vol. 14, no. 1, 2016, pages 93 - 102 |
| PENAS ET AL., BLOOD, vol. 115, 2010, pages 2214 - 2219 |
| PETRELLI, FAUSTO ET AL., BREAST CANCER RESEARCH AND TREATMENT, vol. 166, no. 2, 2017, pages 339 - 349 |
| PETURSSION, S. ET AL.: "Protecting Groups in Carbohydrate Chemistry", J. CHEM. EDUC., vol. 74, no. 11, 1997, pages 1297 |
| PHELAN ET AL., NATURE, vol. 560, no. 7718, August 2018 (2018-08-01), pages 387 - 391 |
| PLOSKER, DRUGS, vol. 71, no. 1, 2011, pages 101 - 108 |
| RAUSCH ET AL., HUMAN VACCIN IMMUNOTHER, vol. 10, no. 11, 2014, pages 3146 - 52 |
| REBEAUD ET AL., NAT IMMUNOL, vol. 9, 2008, pages 272 - 281 |
| ROHR ET AL., LEUKEMIA, vol. 30, no. 5, 2016, pages 1062 - 1070 |
| ROSEBECK ET AL., SCIENCE, vol. 331, 2011, pages 468 - 472 |
| RUDOLPH AM ET AL.: "Rudolph's Pediatrics", 2002, MCGRAW-HILL |
| SAHIN ET AL., NATURE, vol. 547, 2017, pages 222 - 226 |
| SAU ET AL., CELL STEM CELL, vol. 19, no. 1, 2016, pages 52 - 65 |
| SHISUN, MOL. IMMUNOL., vol. 68, no. 2, 2015, pages 546 - 557 |
| STAAL ET AL., EMBO J, vol. 30, 2011, pages 1742 - 1752 |
| STREUBEL ET AL., CLIN CANCER RESEARCH, vol. 10, 2004, pages 476 - 480 |
| UEHATA ET AL., CELL, vol. 153, 2013, pages 1036 - 1049 |
| WANG ET AL., ONCOGENESIS, vol. 6, no. 7, 2017, pages e365 - e365 |
| WEISBERG ET AL., NAT. REV. CANCER, vol. 7, no. 5, 2007, pages 345 - 356 |
| WILLIAMS ET AL., MODERN PATHOLOGY, 2020, pages 1 - 13 |
| XIA ET AL., CANCER IMMUNOL. RES, vol. 2, no. 9, 2014, pages 823 - 830 |
| XIA ET AL., CANCER IMMUNOL. RES., vol. 2, no. 9, 2014, pages 823 - 830 |
| XIA ET AL., CANCER, vol. 2, no. 9, 2014, pages 823 - 830 |
| XIA ET AL., ONCOTARGETS AND THERAPY, vol. 11, 2018, pages 2063 |
| YAMAMOTO ET AL., LUNG CANCER, vol. 63, no. 3, 2009, pages 315 - 321 |
| YAN ET AL., CANCER AND METASTASIS REVIEWS, vol. 34, no. 1, 2015, pages 157 - 164 |
| YANGFU, CRIT. REV. ONCOL./HEMATOL., vol. 93, no. 3, 2015, pages 277 - 292 |
| YOO ET AL., HAEMATOLOGICA, vol. 101, no. 6, 2016, pages 757 - 763 |
Cited By (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN116064763A (zh) * | 2021-07-09 | 2023-05-05 | 广州恩迈生物科技有限公司 | 以ifp35和nmi为靶点的疾病诊断和治疗 |
| CN116064763B (zh) * | 2021-07-09 | 2024-07-02 | 广州恩迈生物科技有限公司 | 以ifp35和nmi为靶点的疾病诊断和治疗 |
| WO2023051759A1 (zh) * | 2021-09-30 | 2023-04-06 | 上海拓界生物医药科技有限公司 | 三环化合物及其制备方法 |
| WO2024020534A3 (en) * | 2022-07-22 | 2024-03-07 | Schrödinger, Inc. | Cyclic compounds and methods of using same |
| WO2024133859A1 (en) * | 2022-12-23 | 2024-06-27 | Janssen Pharmaceutica Nv | Malt1 inhibitors |
| WO2025059027A1 (en) * | 2023-09-11 | 2025-03-20 | Schrödinger, Inc. | Cyclopenta[e]pyrazolo[1,5-a]pyrimidine derivatives as malt1 inhibitors |
Also Published As
| Publication number | Publication date |
|---|---|
| WO2022164789A9 (en) | 2023-05-25 |
| JP2024505890A (ja) | 2024-02-08 |
| US20240148732A1 (en) | 2024-05-09 |
| EP4284804A1 (en) | 2023-12-06 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| CN114945571B (zh) | 环状化合物及其使用方法 | |
| JP2023538060A (ja) | 二環化合物、それを含む組成物、及びそれらの使用 | |
| WO2022164789A1 (en) | Tricyclic compounds useful in the treatment of cancer, autoimmune and inflammatory disoders | |
| KR20190076976A (ko) | Ret 키나제 억제제로서의 치환된 피라졸로[1,5-a]피리딘 화합물 | |
| WO2019156987A1 (en) | AhR MODULATORS | |
| AU2023312000A1 (en) | Cyclic compounds and methods of using same | |
| CN117120442A (zh) | 用于治疗癌症、自身免疫性病症和炎性病症的三环化合物 | |
| EP4308573B1 (en) | Cyclic compounds and methods of using same | |
| WO2025059027A1 (en) | Cyclopenta[e]pyrazolo[1,5-a]pyrimidine derivatives as malt1 inhibitors | |
| EA052528B1 (ru) | Циклические соединения и способы их применения | |
| HK40127987A (en) | Cyclic compounds and methods of using same | |
| JP2023541047A (ja) | がんの治療のための複素環式ペリ縮環cdc7キナーゼ阻害剤 | |
| CN117120447A (zh) | 环状化合物和其使用方法 | |
| CN122003418A (zh) | 作为malt1抑制剂的环戊并[e]吡唑并[1,5-a]嘧啶衍生物 |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 22704145 Country of ref document: EP Kind code of ref document: A1 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2023545277 Country of ref document: JP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2022704145 Country of ref document: EP |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2022704145 Country of ref document: EP Effective date: 20230828 |