WO2022139487A1 - 신규한 펩타이드 및 이의 용도 - Google Patents

신규한 펩타이드 및 이의 용도 Download PDF

Info

Publication number
WO2022139487A1
WO2022139487A1 PCT/KR2021/019658 KR2021019658W WO2022139487A1 WO 2022139487 A1 WO2022139487 A1 WO 2022139487A1 KR 2021019658 W KR2021019658 W KR 2021019658W WO 2022139487 A1 WO2022139487 A1 WO 2022139487A1
Authority
WO
WIPO (PCT)
Prior art keywords
peptide
pharmaceutical composition
preventing
composition
obesity
Prior art date
Application number
PCT/KR2021/019658
Other languages
English (en)
French (fr)
Inventor
신민정
정인혁
박찬
이수연
Original Assignee
(주)메디엔진
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by (주)메디엔진 filed Critical (주)메디엔진
Priority to US18/258,578 priority Critical patent/US20240034758A1/en
Priority to EP21911553.2A priority patent/EP4269428A1/en
Priority to JP2023562446A priority patent/JP2024503540A/ja
Priority to CN202180087261.XA priority patent/CN116888145A/zh
Publication of WO2022139487A1 publication Critical patent/WO2022139487A1/ko

Links

Images

Classifications

    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
    • C07K14/4701—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used
    • C07K14/4702—Regulators; Modulating activity
    • C07K14/4703—Inhibitors; Suppressors
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
    • C07K14/4701—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used
    • C07K14/4702—Regulators; Modulating activity
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00—Medicinal preparations containing peptides
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00—Drugs for disorders of the metabolism
    • A61P3/04—Anorexiants; Antiobesity agents
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00—Drugs for disorders of the metabolism
    • A61P3/08—Drugs for disorders of the metabolism for glucose homeostasis
    • A61P3/10—Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics

Definitions

  • the present invention relates to novel peptides derived from biological proteins and their anti-obesity and anti-diabetic uses.
  • Biopharmaceuticals are mainly protein drugs composed of hormones and antibodies, and additionally composed of genomes. Unlike pharmaceuticals centered on chemicals made of low-molecular substances, biopharmaceuticals are mostly made of high-molecular substances, so various problems arise from their size. Representatively, there are problems in the active aspect such as decreased accessibility to target substances and autoimmune reactions due to large size, and industrial problems such as increase in cost and time required due to increased complexity in production as the size increases. This is a phenomenon that occurs because ancillary structures exist as components in addition to the active site that has a major influence on the function of the protein. Significant improvements can be made in terms of several side effects and costs of pharmaceuticals.
  • the present inventors focused on the invention of a peptide derived from IF1 protein to improve the function of IF1 (ATPase inhibitory factor 1) protein expressed in vivo.
  • IF1 ATPase inhibitory factor 1
  • one aspect of the present invention provides a peptide comprising the amino acid sequence represented by SEQ ID NO: 1 or 2 derived from a biological protein.
  • IF1 ATPase inhibitory factor 1
  • IF1 ATPase inhibitory factor 1
  • the present inventors researched to find peptides having novel functionality in the IF1 protein (SEQ ID NOs: 3 and 4), and discovered the peptides of SEQ ID NOs: 1 and 2 having anti-obesity and anti-diabetic activity.
  • Another aspect of the present invention provides a pharmaceutical composition for preventing or treating obesity comprising the peptide as an active ingredient.
  • prevention refers to any action of inhibiting the progression of a disease or delaying the onset of a disease by administration of the pharmaceutical composition according to the present invention.
  • treatment refers to any action in which symptoms of a disease are improved or beneficially changed by administration of the pharmaceutical composition according to the present invention.
  • the present inventors administered a high-fat diet and a functional peptide to mice together to confirm the physiological activity of a peptide derived from IF1 protein (hereinafter referred to as a functional peptide) (obesity prevention experiment), or a high-fat diet to a mouse inducing obesity and functional peptide were administered together (obesity treatment experiment).
  • a functional peptide a peptide derived from IF1 protein
  • composition can be usefully used for both prevention and treatment of obesity.
  • the functional peptide inhibits lipid accumulation and differentiation of adipocytes, which are indicators of adipogenesis in adipocytes: peroxisome proliferator-activated receptor gamma (PPAR ⁇ ), adiponectin, and fatty acid-binding protein 4 (FABP4). , by suppressing the expression of C/EBPa (CCAAT/enhancer-binding protein alpha) and LPL (lipoprotein lipase) genes.
  • PPAR ⁇ peroxisome proliferator-activated receptor gamma
  • FABP4 fatty acid-binding protein 4
  • the functional peptide suppresses appetite, which can be achieved by suppressing the expression of AgRP (agouti-related protein) and NPY (neuropeptide Y), which are peptides that promote appetite in hypothalamic cells.
  • the composition for preventing or treating obesity may exhibit an anti-obesity effect by suppressing the differentiation of adipocytes and suppressing appetite.
  • Another aspect of the present invention provides a pharmaceutical composition for preventing or treating diabetes or diabetic complications comprising the functional peptide as an active ingredient.
  • the present inventors performed a glucose tolerance test by injecting a glucose solution after fasting an obesity-induced mouse and a type 2 diabetic mouse. As a result, it was confirmed that the blood glucose level was decreased by administration of the functional peptide ( FIGS. 4 and 5A, 5B ), and insulin secretion increased ( FIG. 5E ).
  • the composition for preventing or treating diabetes may exhibit an antidiabetic effect by improving glucose tolerance and promoting insulin secretion.
  • Diabetic complications refer to complications such as myocardial infarction, stroke, retinopathy, and renal failure caused by damage to the blood vessel wall due to prolonged hyperglycemia. If the hyperglycemic state is improved, diabetic complications can also be improved, so the functional peptide of the present invention can also be used for preventing or treating diabetic complications.
  • the pharmaceutical composition of the present invention may be prepared in a form further comprising an appropriate carrier, excipient or diluent commonly used in the preparation of the pharmaceutical composition, wherein the carrier includes a non-naturally occurring carrier. can do.
  • the pharmaceutical composition is each formulated in the form of powders, granules, tablets, capsules, suspensions, emulsions, syrups, aerosols, etc., external preparations, suppositories and sterile injection solutions according to conventional methods to be used.
  • powders granules, tablets, capsules, suspensions, emulsions, syrups, aerosols, etc.
  • external preparations suppositories and sterile injection solutions according to conventional methods to be used.
  • carriers, excipients and diluents that may be included in the pharmaceutical composition include lactose, dextrose, sucrose, sorbitol, mannitol, xylitol, erythritol, maltitol, starch, acacia gum, alginate, gelatin, calcium phosphate, calcium silicate, cellulose, methyl cellulose, microcrystalline cellulose, polyvinyl pyrrolidone, water, methylhydroxybenzoate, propylhydroxybenzoate, talc, magnesium stearate and mineral oil.
  • it is prepared using commonly used diluents or excipients such as fillers, extenders, binders, wetting agents, disintegrants, and surfactants.
  • Solid preparations for oral administration include tablets, pills, powders, granules, capsules, etc., and these solid preparations include at least one excipient, for example, starch, calcium carbonate, sucrose or lactose. It is prepared by mixing (lactose), gelatin, etc. In addition to simple excipients, lubricants such as magnesium stearate and talc are also used.
  • excipient for example, starch, calcium carbonate, sucrose or lactose. It is prepared by mixing (lactose), gelatin, etc.
  • lubricants such as magnesium stearate and talc are also used.
  • Liquid preparations for oral use include suspensions, solutions, emulsions, syrups, etc., and various excipients such as wetting agents, sweeteners, fragrances, and preservatives, in addition to simple diluents such as water and liquid paraffin, which are commonly used. have.
  • Formulations for parenteral administration include sterile aqueous solutions, non-aqueous solutions, suspensions, emulsions, freeze-dried preparations, and suppositories.
  • Non-aqueous solvents and suspending agents include propylene glycol, polyethylene glycol, vegetable oils such as olive oil, and injectable esters such as ethyl oleate.
  • the pharmaceutical composition may be in the form of a sterile injectable preparation as a sterile injectable aqueous or oleaginous suspension.
  • suspensions may be formulated according to techniques known in the art using suitable dispersing or wetting agents (eg, Tween 80) and suspending agents.
  • the sterile injectable preparation may also be a sterile injectable solution or suspension (eg, a solution in 1,3-butanediol) in a non-toxic parenterally acceptable diluent or solvent.
  • Vehicles and solvents that can be used permissibly include mannitol, water, Ringel's solution and isotonic sodium chloride solution.
  • sterile, non-volatile oils are conventionally employed as the solvent or suspending medium.
  • any non-volatile, less irritating oil may be used, including synthetic mono or diglycerides.
  • Fatty acids such as oleic acid and its glyceride derivatives are useful in injectable formulations as are pharmaceutically acceptable natural oils (eg olive oil or castor oil), especially their polyoxyethylated ones.
  • Parenteral administration of a pharmaceutical composition according to the present invention is particularly useful when the desired treatment involves a site or organ easily accessible by topical application.
  • Carriers for topical administration of the compounds of the present invention include, but are not limited to, mineral oil, liquid paraffin, white petrolatum, propylene glycol, polyoxyethylene, polyoxypropylene compounds, emulsifying waxes and water.
  • the content of the active ingredient included in the pharmaceutical composition of the present invention is not particularly limited thereto, but may be included in an amount of 0.0001 to 50% by weight, more preferably 0.01 to 10% by weight, based on the total weight of the final composition. .
  • Another aspect of the present invention is a method for treating obesity comprising administering the pharmaceutical composition for preventing or treating obesity to an individual in need of treatment, and administering the pharmaceutical composition for preventing or treating diabetes or diabetic complications to an individual in need of treatment It provides a method of treating diabetes or diabetic complications, comprising the step of administering.
  • the method of administering the pharmaceutical composition may be administered orally or parenterally as described above, and the dosage of the pharmaceutical composition may be determined by a treating expert.
  • the present invention relates to a biological protein-derived peptide and its pharmaceutical use, wherein the peptide suppresses appetite in an obese animal model, inhibits the lipid accumulation and differentiation of adipocytes, and promotes insulin secretion and improves glucose tolerance in a diabetic animal model Therefore, it can be usefully used for anti-obesity and anti-diabetic purposes.
  • A is the result of confirming the change in body weight while administering the IF1-derived peptide (hereinafter referred to as a functional peptide) to a mouse model induced by obesity with a high-fat diet for 6 weeks
  • B is the final result after administration for 6 weeks
  • C to E are the ratio of total body weight change during the administration period (C), the dietary intake efficiency during the administration period (D) and daily during the administration period after administration of the high-fat diet and the functional peptide to the mouse.
  • E results of checking the dietary intake
  • control control group
  • peptide functional peptide administration group (same in the drawings below).
  • Figure 2 shows the serum triglyceride level (A), serum free fatty acid level (B), area occupied by fat spheres in adipose tissue (C) and adipose tissue after administration of a high-fat diet and functional peptide to mice together for 30 days
  • the result of confirming the change in UCP-1 expression (D), and E is the result of confirming the change in UCP-1 expression in adipose tissue after administration of a high-fat diet and a functional peptide together for 6 weeks to an obesity-induced mouse.
  • A is the result of confirming the expression changes of genes related to adipocyte differentiation and growth after treatment with functional peptides in the differentiation process of adipocytes
  • B and C are hypothalamic cells with mouse-derived and human-derived functional peptides, respectively. It is the result of confirming the expression change of appetite-promoting genes after treatment.
  • A is the result of checking the blood glucose level by injecting a glucose solution after fasting the type 2 diabetes mouse model
  • B is the result of quantifying the total blood glucose change
  • C is the weight of the pancreas isolated from the mouse.
  • D is the result of comparing the result of adjusting the pancreatic weight to the mouse weight
  • E is the result of confirming the blood insulin concentration.
  • IF1 protein and IF1-derived peptide (hereinafter, referred to as a functional peptide; SEQ ID NO: 1 or 2) coding sequences were inserted into pGEX-4T-1 and pet28a vectors, respectively.
  • the vector was transformed into BL21 (DE3), an E. coli strain for expression, to establish a cell model stably expressing IF1 and functional peptides. After culturing the corresponding E. coli cells, protein expression was induced by treatment with 1 mM IPTG (Isopropyl ⁇ -D-1-thiogalactopyranoside).
  • Orient Bio received a 4-week-old C57BL/6J male and gave him a normal diet (Normal diet chow; ND) for 1 week, and it took time to adapt. At this time, the temperature of the breeding space was maintained at 18 ⁇ 24°C and the humidity at 50 ⁇ 60% as the entire breeding environment during the experiment period, and free feeding was implemented during both the adaptation period and the experiment period.
  • the mice that passed the adaptation period were divided into an obesity prevention experimental group and an obesity treatment experimental group, and were bred for each purpose.
  • a normal diet and a high-fat diet were prepared and provided as shown in Table 2 below.
  • Obesity was induced by providing a high-fat diet (see Table 1) for 8 weeks after an adaptation period of 1 week.
  • Example 2-1 PBS and peptide were administered through intraperitoneal injection once daily during the experimental period.
  • the corresponding conditions are as follows.
  • mice in the obesity prevention and obesity treatment groups were fasted for 12 hours, the tissues were separated and stored, and the serum was separated.
  • the reduction of free fatty acids (FIG. 2A) and triglycerides (FIG. 2B) in the functional peptide administration group compared to the control group.
  • DMEM Primary differentiation medium
  • FBS Fetal Bovine Serum
  • Antibiotics 0.5 mM 3-isobutyl-1-methylxanthine, 1 uM dexametahasone, 10 ⁇ g/ml Insulin to differentiate 3T3-L1 adipocytes into adipocytes
  • secondary differentiation medium DMEM, 10% FBS, 1% Antibiotics, 10 ⁇ g/ml Insulin
  • each substance control group: PBS, experimental group: functional peptide 100 nM was added to the medium during the differentiation period and used.
  • PPAR ⁇ peroxisome proliferator-activated receptor gamma
  • adiponectin adiponectin
  • FABP4 fatty acid-binding protein 4
  • C/EBPa C/EBPa
  • LPL lipoprotein lipase
  • the hypothalamic cells were treated with PBS (control group) and 100 nM mouse-derived functional peptide (experimental group) for 24 hours. After the end of the experiment, cells were recovered and the levels of Agrp (agouti-related peptide) and NPY (neuropeptide Y) genes, which are known to promote appetite, were observed. It was confirmed that the functional peptide also had an appetite suppressant action (FIG. 3B).
  • Type 2 diabetic mice (db/db) were used to confirm the effect of the functional peptide on glucose metabolism.
  • the db/db model corresponding to type 2 diabetic mice is an animal model in which genetic mutations are induced in the leptin receptor responsible for dietary control, and is a representative model of diabetes in which obesity is induced due to inability to regulate the insulin signaling pathway and satiety.
  • mice 8-week-old male C57BLKS/6J-db/m+ (Hetero mutant) and C57BLKS/6J-db/db (Homo mutant) mice were distributed from the Central Lab and fed a normal diet (Normal diet chow; ND) for 1 week. provided and took time to adapt. At this time, the temperature of the breeding space was maintained at 18 ⁇ 24°C and the humidity at 50 ⁇ 60% as the entire breeding environment during the experiment period, and free feeding was implemented during both the adaptation period and the experiment period.
  • Normal diet chow Normal diet chow
  • mice were divided into a control group and an experimental group, and each was bred for 44 days under the following conditions.
  • the normal diet was prepared and provided as shown in Table 1 above.
  • mice were fasted for 14 hours and then euthanized, and then dissected and tissues were collected for further analysis. In addition, blood was collected, and serum was separated and analyzed by centrifugation.
  • glucose tolerance improvement effect due to obesity and impaired glucose tolerance due to genetic mutations was confirmed through glucose tolerance tests.
  • Example 2-1 the obesity prevention mouse model of Example 2-1 was fasted for 12 hours, and a 20% glucose solution was injected intraperitoneally to observe the change in blood glucose level.
  • substances corresponding to each group were injected as in Example 3-1 30 minutes before the injection of the glucose solution.
  • the blood sugar level decreased in the functional peptide administration group from 30 minutes after the glucose injection.
  • FIG. 4 a decrease in blood glucose level by the functional peptide was confirmed (FIG. 4), confirming that the functional peptide has an effect of improving glucose metabolism.
  • Example 3-1 The diabetic mouse model of Example 3-1 was fasted for 12 hours, and a 20% glucose solution was injected by intraperitoneal injection to observe the change in blood glucose level. At this time, substances corresponding to each group were injected as in Example 3-1 30 minutes before the injection of the glucose solution. As a result of checking the change in blood sugar level, it was found that the blood sugar level significantly decreased in the functional peptide group compared to the db/db control group after 60, 90, and 12 minutes of glucose injection. In addition, as a result of quantifying the total blood glucose change (blood glucose level x time; GLUAUC), a decrease in blood glucose level by the functional peptide was confirmed (FIG. 5B), confirming that the functional peptide has an effect of improving glucose metabolism.
  • blood glucose level x time blood glucose level x time; GLUAUC
  • Example 3-1 To observe changes and disorders in hormone secretion resulting from diabetes, the tissue isolated from the diabetic mouse model of Example 3-1 was analyzed, and the weight of the pancreas, which plays a major role in hormone secretion, and blood of insulin hormone inducing glucose absorption My concentration was specifically tested.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Organic Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Diabetes (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Engineering & Computer Science (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Zoology (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Genetics & Genomics (AREA)
  • Biophysics (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Hematology (AREA)
  • Obesity (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Biochemistry (AREA)
  • Toxicology (AREA)
  • Molecular Biology (AREA)
  • Emergency Medicine (AREA)
  • Endocrinology (AREA)
  • Child & Adolescent Psychology (AREA)
  • Immunology (AREA)
  • Epidemiology (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Peptides Or Proteins (AREA)

Abstract

본 발명은 IF1 단백질 유래 펩타이드 및 이의 의약 용도에 관한 것으로 상기 펩타이드는 비만 동물 모델에서 식욕을 억제하고, 지방세포의 지질 축적 및 분화를 저해하며, 당뇨 동물 모델에서는 인슐린 분비를 촉진하고, 내당능을 개선하므로 항비만 및 항당뇨 용도로 유용하게 사용될 수 있다.

Description

신규한 펩타이드 및 이의 용도
본 발명은 생체 단백질에서 유래한 신규한 펩타이드 및 이의 항비만, 항당뇨 용도에 관한 것이다.
질병의 치료 및 예방에 사용되는 의약품은 화학물질로 이루어진 의약품과 바이오 의약품으로 나누어진다. 바이오 의약품은 호르몬, 항체 등으로 구성되는 단백질 의약품이 주를 이루며 추가로 유전체 등으로 구성된다. 저분자 물질로 이루어진 화학물질 위주의 의약품들과 달리, 바이오 의약품은 고분자 물질이 대부분이기에 그 크기로부터 비롯되는 다양한 문제점이 발생한다. 대표적으로 큰 크기에 따른 타겟 물질로의 접근성 저하와 자가면역반응 등과 같은 활성 측면의 문제점과 크기가 커짐에 따라 생산하는데 드는 복잡도가 올라가 이에 따른 비용 및 시간소요의 증가와 같은 산업적 문제점이 있다. 이는 단백질의 기능에 주요한 영향을 미치는 활성부위 이외에도 부수적인 구조물이 구성요소로서 존재하기 때문에 벌어지는 현상으로서, 단백질의 주요 활성부위를 알아낸다면 생체 내 기능은 유지하면서 단백질 의약품의 크기를 줄일 수 있으므로 단백질 의약품의 여러 부작용과 비용적 측면에서 상당한 개선이 이루어질 수 있다.
상기와 같은 상황에서 본 발명자들은 생체 내에서 발현되는 IF1 (ATPase inhibitory factor 1) 단백질의 기능 개선을 위해 IF1 단백질로부터 유래된 펩타이드의 발명에 집중하였다. 그 결과, 비만과 당 대사를 포함하여 대사 장애 개선 효과를 나타내는 IF1 유래 신규한 펩타이드를 발견하였다.
따라서, 본 발명의 목적은 상기 신규한 펩타이드 및 이의 의약 용도를 제공하는 것이다.
상기 목적을 달성하기 위하여, 본 발명의 일 양상은 생체 단백질에서 유래한 서열번호 1 또는 2로 표시되는 아미노산 서열을 포함하는 펩타이드를 제공한다.
IF1 (ATPase inhibitory factor 1)은 세포 내에서 발현되어 미토콘드리아 막에 존재하는 ATPase에 결합하여 회전운동을 방해하고 결과적으로 전자전달계에 의한 ATP 합성/분해를 방해하여 세포 내 에너지조절 및 미토콘드리아 항상성에 영향을 미치는 주요한 단백질로 알려져 있다.
본 발명자들은 IF1 단백질(서열번호 3 및 4)에서 신규한 기능성을 갖는 펩타이드를 찾기 위해 연구하여 항비만 및 항당뇨 활성을 갖는 서열번호 1 및 2의 펩타이드를 발굴하였다.
본 발명의 다른 양상은 상기 펩타이드를 유효성분으로 포함하는 비만의 예방 또는 치료용 약학 조성물을 제공한다.
본 발명에서 사용되는 용어, "예방"은 본 발명에 따른 약학 조성물의 투여에 의해 질환의 진행을 억제시키거나 발병을 지연시키는 모든 행위를 의미한다.
본 발명에서 사용되는 용어, "치료"는 본 발명에 따른 약학 조성물의 투여에 의해 질환의 증상이 호전되거나 이롭게 변경되는 모든 행위를 의미한다.
본 발명자들은 IF1 단백질에서 유래한 펩타이드(이하, 기능성 펩타이드로 기재함)의 생리 활성을 확인하기 위해 마우스에 고지방 식이와 기능성 펩타이드를 함께 투여하거나 (비만 예방 실험), 비만을 유도한 마우스에 고지방 식이와 기능성 펩타이드를 함께 투여하였다 (비만 치료 실험).
투여 결과, 마우스에 고지방 식이와 기능성 펩타이드를 함께 투여하면 대조군 대비 체중 증가가 억제되는 것을 확인하였고(도 1C), 비만을 유도한 마우스에 고지방 식이와 기능성 펩타이드를 함께 투여하면 체중 증가가 억제되고, 실험 종료 시점에서는 오히려 체중이 감소된 것을 확인하였다 (도 1A 및 1B).
따라서, 상기 조성물은 비만의 예방 및 치료 모두에 유용하게 사용될 수 있다.
한편, 상기 기능성 펩타이드는 지방세포의 지질 축적과 분화를 억제하며, 이는 지방세포에서 지방 분화의 지표인 PPARγ(peroxisome proliferator- activated receptor gamma), 아디포넥틴(adiponectin), FABP4(fatty acid-binding protein 4), C/EBPα(CCAAT/enhancer-binding protein alpha) 및 LPL(lipoprotein lipase) 유전자의 발현을 억제하여 이루어진다.
또한, 기능성 펩타이드는 식욕을 억제하며 이는 시상하부세포에서 식욕을 촉진하는 펩타이드인 AgRP (agouti-related protein) 및 NPY (neuropeptide Y)의 발현을 억제함으로써 이루어질 수 있다.
따라서, 상기 비만 예방 또는 치료용 조성물은 지방세포의 분화 억제 및 식욕 억제를 통해 항비만 효과를 나타낼 수 있다.
본 발명의 또 다른 양상은 상기 기능성 펩타이드를 유효성분으로 포함하는 당뇨병 또는 당뇨합병증의 예방 또는 치료용 약학 조성물을 제공한다.
본 발명자들은 기능성 펩타이드의 생리 활성을 추가적으로 확인하기 위해, 비만 유도 마우스 및 제2형 당뇨병 마우스를 금식시킨 후 포도당 용액을 주사하여 내당능 검사를 실시하였다. 그 결과, 기능성 펩타이드 투여에 의해 혈당 수치가 감소하고(도 4 및 5A, 5B), 인슐린 분비는 증가하는 것을 확인하였다(도 5E).
따라서, 상기 당뇨병의 예방 또는 치료용 조성물은 내당능 개선 및 인슐린 분비 촉진을 통해 항당뇨 효과를 나타낼 수 있다.
당뇨합병증은 장기간의 고혈당 상태로 인해 혈관벽이 손상되어 나타나는 심근경색, 뇌졸중, 망막증, 신부전 등의 합병증을 말한다. 고혈당 상태를 개선하면 당뇨합병증 또한 개선할 수 있으므로 본 발명의 기능성 펩타이드는 당뇨합병증 예방 또는 치료 용도로도 사용될 수 있다.
한편, 본 발명의 약학 조성물은 약학 조성물의 제조에 통상적으로 사용하는 적절한 담체, 부형제 또는 희석제를 추가로 포함하는 형태로 제조될 수 있는데, 상기 담체는 비자연적 담체 (non-naturally occuring carrier)를 포함할 수 있다.
구체적으로, 상기 약학 조성물은, 각각 통상의 방법에 따라 산제, 과립제, 정제, 캡슐제, 현탁액, 에멀젼, 시럽, 에어로졸 등의 경구형 제형, 외용제, 좌제 및 멸균 주사용액의 형태로 제형화하여 사용될 수 있다.
본 발명에서, 상기 약학 조성물에 포함될 수 있는 담체, 부형제 및 희석제로는 락토즈, 덱스트로즈, 수크로스, 솔비톨, 만니톨, 자일리톨, 에리스리톨, 말티톨, 전분, 아카시아 고무, 알지네이트, 젤라틴, 칼슘 포스페이트, 칼슘 실리케이트, 셀룰로즈, 메틸 셀룰로즈, 미정질 셀룰로스, 폴리비닐 피롤리돈, 물, 메틸히드록시벤조에이트, 프로필히드록시벤조에이트, 탈크, 마그네슘 스테아레이트 및 광물유를 들 수 있다. 제제화할 경우에는 보통 사용하는 충진제, 증량제, 결합제, 습윤제, 붕해제, 계면활성제 등의 희석제 또는 부형제를 사용하여 조제된다.
경구투여를 위한 고형 제제에는 정제, 환제, 산제, 과립제, 캡슐제 등이 포함되며, 이러한 고형제제는 적어도 하나 이상의 부형제 예를 들면, 전분, 칼슘카보네이트(calcium carbonate), 수크로스(sucrose) 또는 락토오스(lactose), 젤라틴 등을 섞어 조제된다. 또한 단순한 부형제 이외에 마그네슘 스티레이트, 탈크 같은 윤활제들도 사용된다.
경구를 위한 액상 제제로는 현탁제, 내용액제, 유제, 시럽제 등이 해당되는 데 흔히 사용되는 단순희석제인 물, 리퀴드 파라핀 이외에 여러 가지 부형제, 예를 들면 습윤제, 감미제, 방향제, 보존제 등이 포함될 수 있다. 비경구 투여를 위한 제제에는 멸균된 수용액, 비수성용제, 현탁제, 유제, 동결건조 제제, 좌제가 포함된다. 비수성용제, 현탁제로는 프로필렌글리콜(propylene glycol), 폴리에틸렌 글리콜, 올리브 오일과 같은 식물성 기름, 에틸올레이트와 같은 주사 가능한 에스테르 등이 사용될 수 있다.
상기 약학 조성물은 멸균 주사용 수성 또는 유성 현탁액으로서 멸균 주사용 제제의 형태일 수 있다. 이 현탁액은 적합한 분산제 또는 습윤제(예, 트윈 80) 및 현탁화제를 사용하여 본 분야에 공지된 기술에 따라 제형될 수 있다. 멸균 주사용 제제는 또한 무독성의 비경구적으로 허용되는 희석제 또는 용매중의 멸균 주사용액 또는 현탁액(예, 1,3-부탄디올중의 용액)일 수 있다. 허용적으로 사용될 수 있는 비히클 및 용매로는 만니톨, 물, 링겔 용액 및 등장성 염화나트륨 용액이 있다. 또한, 멸균 불휘발성 오일이 통상적으로 용매 또는 현탁화 매질로서 사용된다. 이러한 목적을 위해, 합성 모노 또는 디글리세라이드를 포함하여 자극성이 적은 어떠한 불휘발성 오일도 사용할 수 있다. 올레산 및 이의 글리세라이드 유도체와 같은 지방산이 약제학적으로 허용되는 천연오일(예, 올리브유 또는 피마자유), 특히 이들의 폴리옥시에틸화된 것과 마찬가지로 주사 제제에 유용하다.
본 발명에 따른 약학 조성물의 비경구 투여는 목적하는 치료가 국소 적용으로 접근이 용이한 부위 또는 기관과 관련이 있을 때 특히 유용하다. 본 발명의 화합물을 국소 투여하기 위한 담체로는 이들로 한정되는 것은 아니지만 광유, 유동 파라핀, 백색 와셀린, 프로필렌 글리콜, 폴리옥시에틸렌, 폴리옥시프로필렌 화합물, 유화 왁스 및 물이 포함된다.
본 발명의 약학 조성물에 포함된 상기 유효성분의 함량은 특별히 이에 제한되지 않으나, 최종 조성물의 총 중량을 기준으로 0.0001 내지 50 중량%, 보다 바람직하게는 0.01 내지 10 중량%의 함량으로 포함할 수 있다.
본 발명의 다른 양상은 상기 비만의 예방 또는 치료용 약학적 조성물을 치료가 필요한 개체에 투여하는 단계를 포함하는 비만 치료 방법, 상기 당뇨병 또는 당뇨합병증의 예방 또는 치료용 약학 조성물을 치료가 필요한 개체에 투여하는 단계를 포함하는 당뇨병 또는 당뇨합병증의 치료 방법을 제공한다.
본 발명의 치료 방법은 상술한 약학 조성물들을 이용하기 때문에, 이 둘 사이에 공통된 내용은 본 명세서의 과도한 복잡성을 피하기 위하여 그 기재를 생략한다.
약학적 조성물의 투여 방법은 상기 기재한 바와 같이 경구 또는 비경구로 투여될 수 있고, 약학적 조성물의 투여량은 치료 전문가에 의해 판단될 수 있다.
본 발명은 생체 단백질 유래 펩타이드 및 이의 의약 용도에 관한 것으로 상기 펩타이드는 비만 동물 모델에서 식욕을 억제하고, 지방세포의 지질 축적과 분화를 저해하며, 당뇨 동물 모델에서는 인슐린 분비를 촉진하고, 내당능을 개선하므로 항비만 및 항당뇨 용도로 유용하게 사용될 수 있다.
도 1에서 A는 고지방식이로 비만이 유도된 마우스 모델에 IF1 유래 펩타이드(이하, 기능성 펩타이드로 기재함)를 6주 동안 투여하면서 체중 변화를 확인한 결과이고, B는 6주 동안 투여한 후 최종 체중을 확인한 결과이며, C 내지 E는 마우스에 고지방식이와 기능성 펩타이드를 같이 투여한 후 각각 투여 기간 동안 전체 체중 변화량의 비율(C), 투여 기간 동안 식이섭취 효율(D) 및 투여 기간 동안 일일 식이 섭취량(E)을 확인한 결과이다: control: 대조군; 및 peptide: 기능성 펩타이드 투여군 (이하 도면에서도 동일함).
도 2는 마우스에 고지방식이와 기능성 펩타이드를 30일 동안 같이 투여한 후 혈청 중성지방 수준(A), 혈청 유리 지방산 수준(B), 지방조직에서 지방구가 차지하는 면적(C) 및 지방조직에서 UCP-1 발현 변화(D)를 확인한 결과이고, E는 비만이 유도된 마우스에 고지방식이와 기능성 펩타이드를 6주 동안 같이 투여한 후 지방조직에서 UCP-1 발현 변화를 확인한 결과이다.
도 3에서 A는 지방세포의 분화 과정에 기능성 펩타이드를 처리한 후 지방 분화 및 생장에 관하는 유전자들의 발현 변화를 확인한 결과이고, B 및 C는 시상하부 세포에 각각 마우스 유래 및 인간 유래 기능성 펩타이드를 처리한 후 식욕 촉진 유전자들의 발현 변화를 확인한 결과이다.
도 4는 고지방식이로 비만이 유도된 마우스 모델을 절식시킨 후 포도당 용액을 주사하여 전체 혈당 변화량을 확인한 결과이다.
도 5에서 A는 제2형 당뇨병 마우스 모델을 절식시킨 후 포도당 용액을 주사하여 혈당 수치를 확인한 결과, B는 전체 혈당 변화량을 정량한 결과이며, C는 상기 마우스에서 분리한 췌장의 무게를 측정한 결과, D는 췌장 무게를 마우스 체중으로 보정한 결과값을 비교한 결과이며, E는 혈중 인슐린 농도를 확인한 결과이다.
이하 하나 이상의 구체예를 실시예를 통하여 보다 상세하게 설명한다. 그러나 이들 실시예는 하나 이상의 구체예를 예시적으로 설명하기 위한 것으로 본 발명의 범위가 이들 실시예에 한정되는 것은 아니다.
실시예 1: IF1 유래 펩타이드의 분리 및 정제
IF1 단백질과 IF1 유래 펩타이드 (이하, 기능성 펩타이드로 기재함; 서열번호 1 또는 2) 코딩 서열을 각각 pGEX-4T-1 및 pet28a 벡터에 서열을 삽입시켰다. 상기 벡터를 발현용 대장균 균주인 BL21(DE3)에 형질전환(transformation)시켜 안정적으로 IF1 및 기능성 펩타이드를 발현하는 세포모델을 확립하였다. 해당 대장균 세포를 배양한 후, 1 mM IPTG (Isopropyl β-D-1-thiogalactopyranoside)를 처리하여 단백질 발현을 유도하였다. 이후 원심분리, 초음파분쇄(sonication) 과정을 통해 얻어진 용액을 친화성크로마토그래피 (affinity chromatography)로 분리하여 IF1 및 기능성 펩타이드를 분리하고, Snakeskin dialysis tubing을 이용해 pH 7.4의 PBS 용액으로 염 농도를 맞추고 순도를 높여 정제하였다. 대조군으로 사용한 GST는 pet28a 벡터 대신 pGEX-4T-1 벡터를 사용하여 생산하였다.
IF1 단백질 및 기능성 펩타이드의 서열을 하기 표 1에 기재하였다.
서열번호 서열명칭 서열 (Sequence)
1 기능성 펩타이드
(마우스)		 VSDSSDSMDTGAGSIREAGGAFGKREKAEEDRYFREKTKEQLAALRK
2 기능성 펩타이드
(인간)		 GSDQSENVDRGAGSIREAGGAFGKREQAEEERYFRAQSREQLAALKK
3 IF1
(마우스)		 VSDSSDSMDTGAGSIREAGGAFGKREKAEEDRYFREKTKEQLAALRKHHEDEIDHHSKEIERLQKQIERHKKKIQQLKNNH
4 IF1
(인간)		 GSDQSENVDRGAGSIREAGGAFGKREQAEEERYFRAQSREQLAALKKHHEEEIVHHKKEIERLQKEIERHKQKIKMLKHDD
실시예 2: 기능성 펩타이드의 항비만 효과 분석
2-1. 비만 마우스 모델 제작
오리엔트 바이오(ORIENT BIO)에서 4주령의 C57BL/6J 수컷을 분양 받아 1주간 정상식이 (Normal diet chow; ND)를 제공하며 적응하는 시간을 거쳤다. 이때, 실험기간 전체 사육환경으로 사육공간의 온도는 18~24℃, 습도는 50~60%를 항시 유지하였으며, 적응기간 및 실험기간 모두 자유급식을 이행하였다. 적응기간을 거친 마우스는 비만 예방 실험군과 비만 치료 실험군으로 나누어 각 목적에 맞게 사육하였다. 정상식이 및 고지방식이는 하기 표 2와 같이 제조하여 제공하였다.
성분 정상 식이 (g) 고지방 식이 (g)
corn starch 15 15
Casein 20 20
Sucrose 50 34
corn oil 5 3
Mineral mix 3.5 3.5
Vitamin mix 1 1
Cellulose 5 5
DL-methionine 0.3 0.3
choline bitartrate 0.2 0.2
Lard 17
Cholesterol 1
BHT 0.001 0.001
Total 100 (g) 100 (g)
- 비만 예방 실험군: 대조군과 실험군으로 나누어 각각 다음과 같은 조건으로 30일간 사육하였다.
대조군: 고지방식이(High fat diet; HFD) + PBS 투여 (n=10)
실험군: 고지방식이(HFD) +기능성 펩타이드 투여 (n=10)
- 비만 치료 실험군: 1주간의 적응기 이후 8주간 고지방 식이 (표 1 참조)를 제공하여 비만을 유도하고, 대조군과 실험군으로 나누어 각각 다음과 같은 조건으로 6주간 사육하였다.
대조군: 고지방식이(HFD) + PBS 투여 (n=10)
실험군: 고지방식이(HFD) + 기능성 펩타이드 투여 (n=10)
2-2. 기능성 펩타이드의 항비만 효과
실시예 2-1의 실험 조건에 따라 실험 기간 동안 매일 1회 복강주사를 통해 PBS와 펩타이드를 투여하였다. 이에 해당하는 조건은 다음과 같다.
대조군: PBS 복강주사 (하기 기능성 펩타이드 용액에 대응하는 부피)
실험군: 기능성 펩타이드 복강주사 (5 ㎎/㎏)
실험 기간 동안 모든 마우스의 체중을 측정하여 고지방식이 섭취에 따른 체중 변화를 관찰하였다. 그 결과, 비만 치료 실험군의 기능성 펩타이드 투여군에서 펩타이드를 투여한지 1주일이 경과한 시점부터 체중 증가 억제 효과가 나타나는 것을 확인하였으며, 이러한 체증 증가 억제 현상은 실험종료 시점까지 지속되었다 (도 1A). 최종 실험 종료 시점의 체중을 비교한 결과 대조군은 고지방식이로 인한 체중 증가로 비만이 급격하게 유도되었으나 기능성 펩타이드 투여군은 오히려 체중 감소 효과를 보였다 (도 1B).
비만 예방 실험군에서도 전체 실험 기간 동안 기능성 펩타이드 투여군에서 체중 변화 비율이 낮은 수준을 보였으며(도 1C), 식이효율 (체중 증가량을 식이섭취량으로 나눈 비율, Food Efficiency Ratio) (도 1D) 및 일일 식이섭취량 또한 기능성 펩타이드 투여군에서 감소한 것을 확인하여(도 1E) 기능성 펩타이드의 효과적인 항비만 효능을 확인하였다.
실험 종료 이후 비만 예방 및 비만 치료 실험군의 마우스를 12시간 절식시키고, 조직을 분리하여 보관하였으며 혈청을 분리하였다. 혈청 내 지질 지표들을 분석한 결과, 대조군 대비 기능성 펩타이드 투여군에서 유리 지방산 (도 2A)과 중성지방(도 2B)의 감소를 확인하였다.
또한, 지방조직을 H&E (Hematoxylin and Eosin) 염색 및 면역 염색으로 관찰한 결과 기능성 펩타이드 투여에 의해 지방구가 차지하는 면적이 15% 줄어들어 기능성 펩타이드가 지질 축적을 방지하는 것을 확인하였다 (도 2C). 지방조직 내 열 발생과 에너지 항상성 활성 인자인 UCP-1(uncoupling protein-1)의 발현도 또한 기능성 펩타이드 투여군에서 355% 증가하였다 (도 2D).
비만 치료 실험군에서 얻어진 지방 조직을 면역 염색을 통해 관찰한 결과, 비만 예방 실험군의 결과와 마찬가지로 UCP-1의 발현도가 263% 증가하는 것을 관찰하여(도 2E) 기능성 펩타이드에 의한 항비만 효과가 지질 축적 및 에너지 대사 활성화를 포함하는 것을 확인하였다.
2-3. 기능성 펩타이드의 항비만 효과 작용 기작 분석
3T3-L1 지방세포를 지방으로 분화시키기 위해 1차 분화 배지 (DMEM, 10% FBS (Fetal Bovine Serum), 1% Antibiotics, 0.5 mM 3-isobutyl-1-methylxanthine, 1 uM dexametahasone, 10 ㎍/㎖ Insulin)에서 2일, 2차 분화 배지 (DMEM, 10% FBS, 1% Antibiotics, 10 ㎍/㎖ Insulin)에서 6일, 총 8일 동안 배양하여 분화를 유도하였다. 이때, 배지에 각 물질 (대조군: PBS, 실험군: 기능성 펩타이드 100 nM)을 분화기간 동안 첨가하여 사용하였다.
실험 결과, 지방 분화의 지표인 PPARγ(peroxisome proliferator- activated receptor gamma), 아디포넥틴(adiponectin), FABP4(fatty acid-binding protein 4), C/EBPα(CCAAT/enhancer-binding protein alpha) 및 LPL(lipoprotein lipase) 유전자 수준이 모두 기능성 펩타이드 처리군에서 감소한 것을 확인하여 기능성 펩타이드가 지방 분화를 조절하여 항비만 효과를 나타내는 것을 알 수 있었다 (도 3A).
또한, mHypoE-N41 시상하부세포에서 기능성 펩타이드에 의한 식욕 조절 효과를 확인하기 위해 시상하부세포에 PBS (대조군)와 마우스 유래 기능성 펩타이드 100 nM (실험군)을 24시간 동안 처리하였다. 실험 종료 후 세포를 회수하여 식욕을 촉진하는 것으로 알려진 Agrp(agouti-related peptide)와 NPY(neuropeptide Y) 유전자의 수준을 관찰한 결과 Agrp 유전자는 대조군 대비 50.2% 감소, NPY 유전자는 48.8%가 감소하여 기능성 펩타이드가 식욕 억제 작용 또한 갖는 것을 확인하였다 (도 3B).
마찬가지로 시상하부 세포에 PBS (대조군)와 인간 유래 기능성 펩타이드 100 nM (실험군)을 24시간 동안 처리하여 식욕 관련 인자의 유전자 수준을 관찰한 결과 Agrp 유전자는 대조군 대비 47.5% 감소, NPY 유전자는 59.6%가 감소하여 human peptide에 의한 식욕 억제 작용을 확인하였다 (도 3C).
본 실시예의 결과를 통해 기능성 펩타이드의 항비만 효과를 최종 검증하였다.
실시예 3: 기능성 펩타이드의 당 대사 관련 효능 분석
3-1. 제2형 당뇨병 마우스 (db/db) 모델 사육
기능성 펩타이드의 당대사 관련 효과를 확인하기 위하여 제2형 당뇨병 마우스(db/db)를 사용하였다. 제2형 당뇨병 마우스에 해당하는 db/db 모델은 식이 조절을 담당하는 렙틴 수용체에 유전자 변이를 유발한 동물모델로 인슐린 신호경로 및 포만감 조절이 불가하여 비만이 유도되는 당뇨병의 대표적인 모델이다.
중앙실험동물(Central Lab)에서 8주령의 수컷 C57BLKS/6J-db/m+ (Hetero 변이), C57BLKS/6J-db/db (Homo 변이) 마우스를 분양 받아 1주간 보통식이 (Normal diet chow; ND)를 제공하며 적응하는 시간을 거쳤다. 이때, 실험기간 전체 사육환경으로 사육공간의 온도는 18~24℃, 습도는 50~60%를 항시 유지하였으며, 적응기간 및 실험기간 모두 자유급식을 이행하였다.
3-2. 기능성 펩타이드의 당 대사 개선 효능 분석
적응기간을 거친 마우스를 대조군과 실험군으로 나누어 각각 다음과 같은 조건으로 44일간 사육하였다. 정상식이는 상기 표 1과 같이 제조하여 제공하였다.
db/m+ 대조군: 정상식이 (ND) + PBS 복강투여 (n=10)
db/db 대조군: 정상식이 (ND) + PBS 복강투여 (n=10)
db/db 실험군: 정상식이 (ND) + 기능성 펩타이드 (5 ㎎/㎏) 복강투여 (n=10)
실험 기간 44일이 종료된 이후 마우스를 14시간 동안 절식시킨 후 안락사 시켰으며, 이후 해부하여 추가적인 분석을 위해 조직을 채취하였다. 또한, 혈액을 채집하여 원심분리로 혈청을 분리하고 분석하였다.
구체적으로 기능성 펩타이드의 당 대사 개선 효능을 평가하고자, 비만으로 인한 내당능 장애와 유전자 변이에 의한 내당능 장애 개선 효과를 내당능 검사를 통해 확인하였다.
먼저 실험 종료 시점에 실시예 2-1의 비만 예방 마우스 모델을 12시간 동안 절식시키고, 복강주사로 포도당 20% 용액을 주입하여 혈액 내 혈당 수치의 변화를 관찰하였다. 이때, 포도당 용액의 주사 30분 전 실시예 3-1과 같이 각 그룹에 해당하는 물질을 주사하였다. 혈당 수치 변화를 확인한 결과, 포도당 주사 30분 이후부터 혈당 수준이 기능성 펩타이드 투여군에서 감소하는 것을 알 수 있었다. 전체 혈당 변화량을 정량한 결과(혈당수치x시간; GLUAUC)에서도 기능성 펩타이드에 의한 혈당 수치 감소를 확인하여(도 4) 기능성 펩타이드가 당 대사를 개선하는 효과가 있음을 확인하였다.
실시예 3-1의 당뇨병 마우스 모델을 12시간 동안 절식시키고, 복강주사로 포도당 20% 용액을 주입하여 혈액 내 혈당 수치의 변화를 관찰하였다. 이때, 포도당 용액의 주사 30분 전 실시예 3-1과 같이 각 그룹에 해당하는 물질을 주사하였다. 혈당 수치 변화를 확인한 결과, 포도당 주사 60분, 90분, 12분 이후 혈당 수준이 db/db 대조군 대비 기능성 펩타이드 투여군에서 유의하게 감소하는 것을 알 수 있었다. 또한, 전체 혈당 변화량을 정량한 결과(혈당수치x시간; GLUAUC)에서도 기능성 펩타이드에 의한 혈당 수치 감소를 확인하여(도 5B) 기능성 펩타이드가 당 대사를 개선하는 효과가 있음을 확인하였다.
당뇨병으로 비롯되는 호르몬 분비 변화 및 장애를 관찰하고자 상기 실시예 3-1의 당뇨병 마우스 모델에서 분리한 조직을 분석하고, 호르몬 분비에 주요한 역할을 하는 췌장의 무게와 당 흡수를 유도하는 인슐린 호르몬의 혈액 내 농도를 특정적으로 검사하였다.
검사 결과, 췌장의 무게(도 5C)와 이를 체중으로 보정한 값(도 5D) 모두 기능성 펩타이드 투여군에서 증가한 것을 확인하여 기능성 펩타이드가 호르몬 분비 시스템에 긍정적인 영향을 미치는 것을 확인하였다. 또한, 기능성 펩타이드 투여군에서 혈중 인슐린 분비가 높아진 것으로 나타나 기능성 펩타이드에 의해 호르몬 분비가 촉진된 것을 알 수 있었다 (도 5E). 종합하여, 기능성 펩타이드가 대사에 긍정적인 영향을 미치는 것을 최종 검증하였다.

Claims (11)

  1. 서열번호 1 또는 2로 표시되는 아미노산 서열을 포함하는 펩타이드.
  2. 제1항의 펩타이드를 유효성분으로 포함하는 비만의 예방 또는 치료용 약학 조성물.
  3. 제2항에 있어서, 상기 조성물은 식욕을 억제하는, 비만의 예방 또는 치료용 약학 조성물.
  4. 제3항에 있어서, 상기 식욕 억제는 AgRP (agouti-related protein) 또는 NPY (neuropeptide Y) 펩타이드 억제에 의한 것인, 비만의 예방 또는 치료용 약학 조성물.
  5. 제2항에 있어서, 상기 조성물은 지방세포의 지질 축적 및 분화를 억제하는, 비만의 예방 또는 치료용 약학 조성물.
  6. 제2항에 있어서, 상기 조성물은 지방조직 내 열 발생과 에너지 항상성을 활성화시키는 UCP-1(uncoupling protein-1) 유전자의 발현을 증가시키는, 비만의 예방 또는 치료용 약학 조성물.
  7. 제1항의 펩타이드를 유효성분으로 포함하는 당뇨병 또는 당뇨합병증의 예방 또는 치료용 약학 조성물.
  8. 제7항에 있어서, 상기 조성물은 인슐린 분비를 촉진하는, 당뇨병 또는 당뇨합병증의 예방 또는 치료용 약학 조성물.
  9. 제7항에 있어서, 상기 조성물은 내당능을 개선하는, 당뇨병 또는 당뇨합병증의 예방 또는 치료용 약학 조성물.
  10. 제1항의 조성물을 치료가 필요한 개체에 투여하는 단계를 포함하는 비만 치료 방법.
  11. 제7항의 조성물을 치료가 필요한 개체에 투여하는 단계를 포함하는 당뇨병 또는 당뇨합병증 치료 방법.
PCT/KR2021/019658 2020-12-22 2021-12-22 신규한 펩타이드 및 이의 용도 WO2022139487A1 (ko)

Priority Applications (4)

Application Number Priority Date Filing Date Title
US18/258,578 US20240034758A1 (en) 2020-12-22 2021-12-22 Novel peptide and use thereof
EP21911553.2A EP4269428A1 (en) 2020-12-22 2021-12-22 Novel peptide and use thereof
JP2023562446A JP2024503540A (ja) 2020-12-22 2021-12-22 新規ペプチドおよびその用途
CN202180087261.XA CN116888145A (zh) 2020-12-22 2021-12-22 新型肽及其用途

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
KR20200180639 2020-12-22
KR10-2020-0180639 2020-12-22

Publications (1)

Publication Number Publication Date
WO2022139487A1 true WO2022139487A1 (ko) 2022-06-30

Family

ID=82158525

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/KR2021/019658 WO2022139487A1 (ko) 2020-12-22 2021-12-22 신규한 펩타이드 및 이의 용도

Country Status (6)

Country Link
US (1) US20240034758A1 (ko)
EP (1) EP4269428A1 (ko)
JP (1) JP2024503540A (ko)
KR (1) KR20220090473A (ko)
CN (1) CN116888145A (ko)
WO (1) WO2022139487A1 (ko)

Citations (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5906923A (en) * 1996-10-02 1999-05-25 Incyte Pharmaceuticals, Inc. ATPase inhibitor
US20040072739A1 (en) * 1999-11-10 2004-04-15 Anderson Christen M. Compositions and methods for regulating endogenous inhibitor of ATP synthase, including treatment for diabetes
KR20180107368A (ko) * 2017-03-17 2018-10-02 고려대학교 산학협력단 Atpif1을 함유하는 당뇨 치료용 약학조성물
WO2020055186A1 (ko) * 2018-09-14 2020-03-19 고려대학교 산학협력단 If1 을 유효성분으로 함유하는 비만 또는 근감소증의 예방 또는 치료용 약학 조성물

Family Cites Families (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CA3045599A1 (en) 2016-12-16 2018-06-21 Avixgen Inc Cytoplasmic transduction peptide and intracellular messenger comprising same

Patent Citations (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5906923A (en) * 1996-10-02 1999-05-25 Incyte Pharmaceuticals, Inc. ATPase inhibitor
US20040072739A1 (en) * 1999-11-10 2004-04-15 Anderson Christen M. Compositions and methods for regulating endogenous inhibitor of ATP synthase, including treatment for diabetes
KR20180107368A (ko) * 2017-03-17 2018-10-02 고려대학교 산학협력단 Atpif1을 함유하는 당뇨 치료용 약학조성물
WO2020055186A1 (ko) * 2018-09-14 2020-03-19 고려대학교 산학협력단 If1 을 유효성분으로 함유하는 비만 또는 근감소증의 예방 또는 치료용 약학 조성물

Non-Patent Citations (1)

* Cited by examiner, † Cited by third party
Title
ANNELISE GENOUX, PONS VéRONIQUE, RADOJKOVIC CLAUDIA, ROUX-DALVAI FLORENCE, COMBES GUILLAUME, ROLLAND CORINNE, MALET NICOLE, M: "Mitochondrial Inhibitory Factor 1 (IF1) Is Present in Human Serum and Is Positively Correlated with HDL-Cholesterol", PLOS ONE, vol. 6, no. 9, 14 September 2011 (2011-09-14), pages 1 - 8, XP055561582, DOI: 10.1371/journal.pone.0023949 *

Also Published As

Publication number Publication date
JP2024503540A (ja) 2024-01-25
US20240034758A1 (en) 2024-02-01
CN116888145A (zh) 2023-10-13
EP4269428A1 (en) 2023-11-01
KR20220090473A (ko) 2022-06-29

Similar Documents

Publication Publication Date Title
WO2018128515A1 (ko) 니클로사이드를 함유하는 Axin-GSK3 단백질 결합 관련 질환 치료용 약학조성물
WO2018194309A1 (ko) 인디루빈 유도체를 유효성분으로 포함하는 약학 조성물
CA2152420A1 (en) Therapeutic agent for the treatment of xerostomia
WO2022131428A1 (ko) 오를리스타트 및 아커만시아 뮤시니필라 eb-amdk19 균주를 포함하는 조성물
WO2022139487A1 (ko) 신규한 펩타이드 및 이의 용도
WO2015178653A1 (ko) Akkermansia muciniphila 균에서 유래하는 세포밖 소포를 유효성분으로 함유하는 대사질환의 치료 또는 예방용 조성물
WO2020262838A1 (ko) 천연물 추출물을 포함하는 안정성이 개선된 약제학적 조성물
WO2022139489A1 (ko) 알코올성 및 비알코올성 지방간의 예방 또는 치료용 약학 조성물
WO2023042959A1 (ko) 복합 진세노사이드 조성물을 포함하는 항염증 조성물
WO2021182913A1 (ko) 태반 추출물을 포함하는 간 질환 예방 또는 치료용 및 간 기능 개선용 조성물
WO2021033995A1 (ko) 초과 추출물을 함유하는 근육 감소 관련 질병의 예방, 개선, 또는 치료용 조성물
WO2014185607A1 (ko) 폐섬유화증 예방 또는 치료용 약학 조성물
JP7023518B2 (ja) 分泌障害の処置のための方法および組成物
WO2023153533A1 (ko) 후박 추출물을 유효성분으로 함유하는 근육 질환 예방 및 치료용 조성물
WO2021006607A1 (ko) Lgi3 유래 펩타이드를 유효성분으로 포함하는 당뇨병의 예방, 치료, 또는 개선용 조성물
WO2021002645A1 (ko) 하이드로겔 및 egfr 리간드를 유효성분으로 포함하는 당 배출용 조성물
WO2023058996A1 (ko) 항염증 활성을 갖는 펩타이드와 이의 용도
WO2022211303A1 (ko) 3-(4-(벤질옥시)페닐)헥스-4-이노익산 유도체의 신규 용도
WO2022114459A1 (ko) 모노메틸푸마레이트를 유효성분으로 포함하는 장기 섬유증의 예방 또는 치료용 약학적 조성물
WO2022173273A1 (ko) 아로니아 추출물을 포함하는 근육 질환의 예방 또는 치료용 조성물
WO2023022522A1 (ko) 지방간염, 지방증 또는 섬유증의 예방 또는 치료용 복합 제제
WO2023249354A1 (ko) 디메틸제일아스테럴을 포함하는 근육 감소로 인한 질환 예방 또는 치료용 약학 조성물
WO2022211396A1 (ko) 배암차즈기 추출물 또는 이의 유래 화합물을 유효성분으로 포함하는 근위축 예방 또는 치료용 약학적 조성물
WO2023277461A1 (ko) 20(s)-진세노사이드 rg3를 유효성분으로 포함하는 퇴행성 뇌질환 예방 또는 치료용 약학적 조성물
WO2024080435A1 (ko) 파르네솔을 포함하는 근육 줄기세포 증식 및 분화 촉진용 조성물.

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 21911553

Country of ref document: EP

Kind code of ref document: A1

WWE Wipo information: entry into national phase

Ref document number: 2023562446

Country of ref document: JP

WWE Wipo information: entry into national phase

Ref document number: 18258578

Country of ref document: US

WWE Wipo information: entry into national phase

Ref document number: 202180087261.X

Country of ref document: CN

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2021911553

Country of ref document: EP

Effective date: 20230724