WO2022080851A1 - 테스토스테론-특이적 어피바디 및 이의 용도 - Google Patents

테스토스테론-특이적 어피바디 및 이의 용도 Download PDF

Info

Publication number
WO2022080851A1
WO2022080851A1 PCT/KR2021/014103 KR2021014103W WO2022080851A1 WO 2022080851 A1 WO2022080851 A1 WO 2022080851A1 KR 2021014103 W KR2021014103 W KR 2021014103W WO 2022080851 A1 WO2022080851 A1 WO 2022080851A1
Authority
WO
WIPO (PCT)
Prior art keywords
amino acid
polypeptide
testosterone
present
seq
Prior art date
Application number
PCT/KR2021/014103
Other languages
English (en)
French (fr)
Inventor
박혜선
조현남
Original Assignee
인센 주식회사
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by 인센 주식회사 filed Critical 인센 주식회사
Priority to EP21880498.7A priority Critical patent/EP4230651A1/en
Priority to US18/031,467 priority patent/US20240018233A1/en
Publication of WO2022080851A1 publication Critical patent/WO2022080851A1/ko

Links

Images

Classifications

    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/26—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against hormones ; against hormone releasing or inhibiting factors
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K8/00—Cosmetics or similar toiletry preparations
    • A61K8/18—Cosmetics or similar toiletry preparations characterised by the composition
    • A61K8/30—Cosmetics or similar toiletry preparations characterised by the composition containing organic compounds
    • A61K8/64—Proteins; Peptides; Derivatives or degradation products thereof
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P17/00—Drugs for dermatological disorders
    • A61P17/14—Drugs for dermatological disorders for baldness or alopecia
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61Q—SPECIFIC USE OF COSMETICS OR SIMILAR TOILETRY PREPARATIONS
    • A61Q7/00—Preparations for affecting hair growth
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/52—Cytokines; Lymphokines; Interferons
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/78—Connective tissue peptides, e.g. collagen, elastin, laminin, fibronectin, vitronectin or cold insoluble globulin [CIG]
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00—Medicinal preparations containing peptides
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2318/00—Antibody mimetics or scaffolds
    • C07K2318/20—Antigen-binding scaffold molecules wherein the scaffold is not an immunoglobulin variable region or antibody mimetics
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2319/00—Fusion polypeptide
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2319/00—Fusion polypeptide
    • C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2319/00—Fusion polypeptide
    • C07K2319/20—Fusion polypeptide containing a tag with affinity for a non-protein ligand
    • C07K2319/21—Fusion polypeptide containing a tag with affinity for a non-protein ligand containing a His-tag
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2319/00—Fusion polypeptide
    • C07K2319/50—Fusion polypeptide containing protease site

Definitions

  • the present invention relates to testosterone-specific Affibodies and uses thereof.
  • Hair loss refers to a disease in which hair or body hair is lost due to various causes such as genetic factors, aging, stress, nutritional imbalance, and male hormones.
  • Types of hair loss include chronic hair loss (androgenic alopecia), traumatic alopecia, chemical hair loss, and the like.
  • FDA US Food and Drug Administration
  • Minoxidil and Finasteride Two types of hair loss treatments approved by the US Food and Drug Administration (FDA): Minoxidil and Finasteride. Although the mechanism of hair growth of minoxidil has not yet been precisely elucidated, vascular endothelial growth factor (VEGF, vascular endothelial growth factor (VEGF, vascular endothelial growth factor (VEGF, vascular endothelial growth factor (VEGF, vascular endothelial growth factor (VEGF, vascular endothelial growth factor (VEGF, vascular endothelial growth factor (VEGF, vascular endothelial growth factor (VEGF, vascular endothelial growth factor (
  • Finasteride is a substance that inhibits the production of DHT (dihydrotestosterone), which is the cause of male pattern hair loss and enlarged prostate, and blocks the function of 5-alpha-reductase.
  • DHT dihydrotestosterone
  • the present inventors have intensively researched and tried to develop a novel hair loss treatment agent that is excellent in improving the side effects and inconvenience of use of the existing hair loss treatment agent as described above, and is excellent in the treatment effect for hair loss.
  • a novel binding polypeptide affibody
  • affibody that binds to free testosterone and a complex that combines it with an angiogenic polypeptide (pro-angiogenic polypeptide)
  • pro-angiogenic polypeptide an angiogenic polypeptide
  • Another object of the present invention is to provide a complex comprising the polypeptide and at least one pro-angiogenic polypeptide.
  • Another object of the present invention is to provide a pharmaceutical composition for hair growth stimulation or hair loss treatment comprising the polypeptide or complex as an active ingredient.
  • Another object of the present invention is to provide a cosmetic composition for stimulating hair growth comprising the polypeptide or complex as an active ingredient.
  • the 'Affibody' molecule is a Z-domain, a region having affinity for IgG among Protein A of Staphylococcus aureus, and consists of 58 amino acid residues. It is made up of small proteins.
  • the 14 amino acids that form the binding surface with IgG can bind to various target antigens depending on the amino acid sequence, and can be randomly arranged to construct a library. Similar to antibodies, affibody molecules that can bind to various target antigens can be selected from a library through screening methods such as phage display and yeast two hybrid (Y2H). .
  • Affibody has a very small molecular weight of 6 kDa, and generally spreads systemically when administered to the human body compared to an IgG-type antibody having a molecular weight of 150 kDa, and is rapidly removed by renal filtration. Therefore, Affibody is mainly applied to research and development of diagnostic samples (Goldstein R et al., 2013, Expert Rev Anticancer Ther.). Affibody is also being developed in the form of a dual antibody conjugated to general IgG (Yu F et al., 2014, MAbs).
  • the present invention provides a polypeptide comprising an amino acid sequence having at least 94% sequence homology with the amino acid sequence of SEQ ID NO: 1, and specifically binding to testosterone:
  • VDNKFNKEMVQAMREISYLPNLNHTQIRAFIWVLFDDPSQSANLLAEAKKLNDAQAPK (SEQ ID NO: 1).
  • the polypeptide consists of the aforementioned Affibody® molecule.
  • affinity refers to a property or ability to specifically bind to a specific subject. In the field of biology such as the present invention, it is used as a term indicating the strength of binding force between specific substances, such as the ability of an enzyme and a substrate to bind, and the ability of an antibody to bind to an antigen.
  • amino acid refers to the most basic structural unit of a protein molecule. If you look at the structure of an amino acid, an amino group (-NH 2 ) and a carboxyl group (-COOH) are attached to one carbon atom, and hydrogen and R groups are connected here.
  • the term “protein” is a polymeric organic material constituting the body of all living things, and is a linkage of numerous amino acids. There are about 20 kinds of natural amino acids, and those in which these amino acids are linked together by chemical bonds called peptide bonds to form long side chains are called polypeptides.
  • the polypeptide of the present invention can be synthesized by a synthetic method known in the art, for example, by transforming an expression vector containing a nucleic acid molecule expressing a protein into a host cell to synthesize a recombinant protein, or by solid-phase synthesis techniques ) (Merrifield, J. Amer. Chem. Soc. 85:2149-54 (1963); Stewart, et al., Solid Phase Peptide Synthesis, 2nd. ed., Pierce Chem. Co.: Rockford , 111 (1984)).
  • the testosterone-specific polypeptide of the present invention may include a variant of the amino acid sequence within a range capable of specifically recognizing testosterone, as will be recognized by those skilled in the art.
  • the amino acid sequence of the polypeptide may be changed to improve the binding affinity and/or other biological properties of the polypeptide that specifically binds to testosterone.
  • modifications include, for example, deletions, insertions and/or substitutions of amino acid sequence residues of the polypeptide.
  • Such variants are said to have "substantial similarity", wherein when the two peptide sequences are optimally aligned, such as by the program GAP or BESTFIT using default gap weights, at least about 90% sequence identity, more preferably at least about 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% sequence identity.
  • residue positions that are not identical differ by conservative amino acid substitutions.
  • a “conservative amino acid substitution” is one in which an amino acid residue is substituted by another amino acid residue having a side chain (R group) with similar chemical properties (eg, charge or hydrophobicity). In general, conservative amino acid substitutions do not substantially change the functionality of the protein.
  • amino acid variations are made based on the relative similarity of amino acid side chain substituents, such as hydrophobicity, hydrophilicity, charge, size, and the like.
  • amino acid side chain substituents such as hydrophobicity, hydrophilicity, charge, size, and the like.
  • arginine, lysine and histidine are all positively charged residues; alanine, glycine and serine have similar sizes; It can be seen that phenylalanine, tryptophan and tyrosine have similar shapes. Therefore, based on these considerations, arginine, lysine and histidine; alanine, glycine and serine; And phenylalanine, tryptophan and tyrosine can be said to be biologically functional equivalents.
  • the hydropathic idex of amino acids may be considered.
  • Each amino acid is assigned a hydrophobicity index according to its hydrophobicity and charge: isoleucine (+4.5); valine (+4.2); leucine (+3.8); phenylalanine (+2.8); cysteine/cysteine (+2.5); methionine (+1.9); alanine (+1.8); glycine (-0.4); threonine (-0.7); serine (-0.8); tryptophan (-0.9); tyrosine (-1.3); proline (-1.6); histidine (-3.2); glutamate (-3.5); glutamine (-3.5); aspartate (-3.5); asparagine (-3.5); lysine (-3.9); and arginine (-4.5).
  • the hydrophobic amino acid index is very important in conferring an interactive biological function of a protein. It is a known fact that amino acids having a similar hydrophobicity index must be substituted to retain similar biological activity. When introducing a mutation with reference to the hydrophobicity index, the substitution is made between amino acids that show a difference in the hydrophobicity index, preferably within ⁇ 2, more preferably within ⁇ 1, and even more preferably within ⁇ 0.5.
  • the substitution is made between amino acids exhibiting a difference in the hydrophilicity value within preferably ⁇ 2, more preferably within ⁇ 1, and even more preferably within ⁇ 0.5.
  • Amino acid exchanges in proteins that do not entirely alter the activity of the molecule are known in the art (H. Neurath, R.L. Hill, The Proteins, Academic Press, New York, 1979).
  • the most common exchanges are amino acid residues Ala/Ser, Val/Ile, Asp/Glu, Thr/Ser, Ala/Gly, Ala/Thr, Ser/Asn, Ala/Val, Ser/Gly, Thy/Phe, Ala/ It is an exchange between Pro, Lys/Arg, Asp/Asn, Leu/Ile, Leu/Val, Ala/Glu, Asp/Gly.
  • the polypeptide that specifically binds to testosterone of the present invention has at least 94% sequence homology to the amino acid sequence of SEQ ID NO: 1 (eg, 94%, 95%, 96%, 97, 98). %, or 99%). All integers greater than or equal to 94% and less than or equal to 100%, and prime numbers therebetween, are included within the scope of the present invention with respect to % homology.
  • the polypeptide specifically binding to testosterone of the present invention has at least one amino acid residue among the 11th amino acid residue Q, the 17th amino acid residue S, and the 25th amino acid residue T in the following amino acid sequence substituted with any amino acid residue independently of each other:
  • polypeptide specifically binding to testosterone of the present invention comprises an amino acid sequence having at least 98% sequence homology with the amino acid sequence of SEQ ID NO: 1.
  • the 11th amino acid residue Q, the 17th amino acid residue S, or the 25th amino acid residue T in the following amino acid sequence is substituted with the amino acid residue A and an amino acid sequence that is:
  • polypeptide specifically binding to testosterone of the present invention has any one amino acid sequence selected from the group consisting of SEQ ID Nos: 5 to 7, 9 to 14, 16, and 20 to 22 include
  • polypeptide specifically binding to testosterone of the present invention includes all of the underlined amino acid residues in the following amino acid sequence:
  • VDNKFNKE MVQ A MR EI SY LPNLN HT Q IR AFI WV L F DDPSQSANLLAEAKKLNDAQAPK.
  • the position of the underlined amino acid residue is an amino acid residue at a position that specifically binds to the target in the target binding polypeptide consisting of a 58 amino acid sequence known as an affibody.
  • the amino acid residue at this position functions like a complementarity-determining region (CDR) of an antibody.
  • the affibody can be prepared as a polypeptide that binds to various targets by changing the amino acid residue at the above position among the 58 amino acid sequences.
  • the amino acid sequence other than the amino acid residue at the underlined position serves to maintain the triple helix polypeptide structure of the affibody.
  • the polypeptide specifically binding to testosterone of the present invention consists of another scaffold sequence comprising an amino acid sequence of the same position and type as the underlined amino acid residues, the API contains body molecules.
  • the present invention provides a complex comprising the testosterone-specifically binding polypeptide and at least one angiogenic polypeptide (angiogenic polypeptide).
  • the polypeptide complex is in the form of a multimer in which each polypeptide monomer is linked.
  • each polypeptide is covalently linked to each other, and according to one embodiment of the present invention, the complex may be implemented in the form of a fused protein or a conjugate.
  • the angiogenesis-promoting polypeptide comprises osteopontin or a fragment thereof.
  • the osteopontin fragment comprises the amino acid sequence of SEQ ID NO: 66 (SVVYGLR).
  • the amino acid sequence of SEQ ID NO: 66 (SVVYGLR) is an epitope cleaved by thrombin of osteopontin.
  • the osteopontin fragment may include SVVYGLR (OPN-R), which is an epitope cleaved by thrombin, such as GRGDSVVYGLRS, GRGDSVVYGLR, RGDSVVYGLR, SVVYGLRS, or RGDSVVYGLR.
  • the osteopontin fragment may be OPN-L (SVVYGL) formed by further cleavage of C-terminal arginine by carboxypeptidase B (CPB).
  • angiogenesis-promoting polypeptide included in the complex of the present invention may be any other polypeptide having a suitable angiogenesis-promoting function.
  • an angiogenic polypeptide constituting a complex comprising a polypeptide that specifically binds to testosterone and at least one angiogenic polypeptide (angiogenic polypeptide) ), at the N-terminus and/or C-terminus of the testosterone-binding polypeptide (i.e. affibody molecule), more specifically at the N-terminus or C-terminus, most specifically at the It may be fused to the C-terminus, but is not limited thereto. However, fusion to the C-terminus of the testosterone-binding polypeptide is preferable in terms of angiogenesis promoting effect.
  • the testosterone-binding polypeptide and the angiogenesis-promoting polypeptide may be directly linked or indirectly linked through a linker (eg, an amino acid linker).
  • a linker eg, an amino acid linker
  • linker between the functional moieties to be fused, usually when constructing a fusion protein, and other types of linkers with different properties, for example, flexible amino acid linkers, inflexibility It will be appreciated that there are linkers and cleavable amino acid linkers. Linkers have been used to increase the expression level of the fusion protein, improve biological activity, enable targeting, or change pharmacokinetics, or to increase stability and improve folding of the fusion protein.
  • the complex may further comprise at least one linker, such as at least one linker selected from a flexible amino acid linker, a non-flexible linker, and a cleavable amino acid linker.
  • the linker is arranged between the affibody molecule and the antibody or antigen-binding fragment.
  • the complex may include at least one additional amino acid at the C-terminus and/or at the N-terminus.
  • additional amino acid residues may be added individually or collectively for the purpose of improving, for example, productivity, purification, stabilization in vivo or ex vivo, coupling or detection of complexes.
  • the complex may have a cysteine residue added to the C-terminus and/or the N-terminus of the complex.
  • Additional amino acid residues may also provide a "tag" for purification or detection of the polypeptide, for example for interaction with an antibody specific for that tag, or, in the case of a His6 tag, an immobilized metal A tag such as a His6 tag, (HisGlu)3 tag (“HEHEHE” tag) or “myc” (c-myc) tag or “FLAG” tag may be provided for affinity chromatography (IMAC).
  • a His6 tag His6 tag, (HisGlu)3 tag (“HEHEHE” tag) or “myc” (c-myc) tag or “FLAG” tag
  • IMAC affinity chromatography
  • the additional amino acids as described above are linked by chemical conjugation to a complex of i) a testosterone-binding polypeptide, or ii) a testosterone-binding polypeptide and an angiogenesis-promoting polypeptide as defined herein, or expressed as a fusion protein and may be linked directly or indirectly through a linker (eg, an amino acid linker).
  • a linker eg, an amino acid linker
  • i) testosterone-binding polypeptide and ii) angiogenesis-promoting polypeptide of the complex are linked by at least one linker.
  • the linker may consist of an amino acid sequence represented by the general formula (GnSm)p or (SmGn)p:
  • n, m and p are independently,
  • n is an integer from 1 to 7;
  • n is an integer from 0 to 7;
  • n and m are integer less than or equal to 8.
  • p is an integer from 1 to 7.
  • the linker may be VDGS or ASGS, but is not limited thereto.
  • the present invention provides a nucleic acid molecule comprising a nucleotide sequence encoding a complex comprising the aforementioned i) a testosterone-binding polypeptide, or ii) a testosterone-binding polypeptide and an angiogenesis-promoting polypeptide.
  • nucleic acids has a meaning comprehensively including DNA (gDNA and cDNA) and RNA molecules. also includes modified analogs (Scheit, Nucleotide Analogs, John Wiley, New York (1980); Uhlman and Peyman, Chemical Reviews, 90:543-584 (1990)).
  • nucleotide sequence encoding the polypeptide or the complex of the present invention is a nucleotide sequence encoding an amino acid sequence constituting the polypeptide or the complex, and in any specific nucleotide sequence It is obvious to those skilled in the art that there is no limitation.
  • nucleotide sequence is a functionally equivalent codon or codon encoding the same amino acid (eg, due to codon degeneracy, there are six codons for arginine or serine), or a codon encoding a biologically equivalent amino acid It contains a nucleotide sequence comprising a.
  • nucleic acid molecule encoding the polypeptide or complex of the present invention includes a sequence that exhibits substantial identity to the sequence listed in the sequence listing.
  • the substantial identity is at least 60% or higher when the sequence of the present invention and any other sequences are aligned to the maximum correspondence, and the aligned sequence is analyzed using an algorithm commonly used in the art.
  • homology eg, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, or 69%), more preferably at least 70% or more homology (eg, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, or 79%), even more preferably at least 80% or more (e.g., 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, or 89% homology, most preferably at least 90% (eg, 90%, 91%, 92%, 93%). , 94%, 95%, 96%, 97%, 98%, 99%, or 100%)). All integers greater than or equal to 70% and less than or equal to 100% and prime numbers therebetween are included within the scope of the present invention with respect to % homology.
  • BLAST The NCBI Basic Local Alignment Search Tool (BLAST) (Altschul et al., J. Mol. Biol. 215:403-10(1990)) is accessible from the National Center for Biological Information (NBCI), etc. It can be used in conjunction with sequencing programs such as blastx, tblastn and tblastx. BLAST can be accessed through the BLAST page of the ncbi website. A method for comparing sequence homology using this program can be found on the BLAST help page of the ncbi website.
  • NBCI National Center for Biological Information
  • the present invention provides a recombinant vector comprising a nucleotide sequence encoding the above-described testosterone-binding polypeptide or complex.
  • the present invention provides a host cell comprising the above-described recombinant vector.
  • the vector is operatively linked to a nucleotide sequence encoding the above-described testosterone-binding polypeptide or complex.
  • operatively linked refers to a functional linkage between a nucleic acid expression control sequence (eg, a promoter, signal sequence, or an array of transcriptional regulator binding sites) and another nucleic acid sequence, and By this, the regulatory sequence controls the transcription and/or translation of the other nucleic acid sequence.
  • a nucleic acid expression control sequence eg, a promoter, signal sequence, or an array of transcriptional regulator binding sites
  • the vector system of the present invention can be constructed through various methods known in the art, and specific methods for this are disclosed in Sambrook, et al., Molecular Cloning, A Laboratory Manual, Cold Spring Harbor Laboratory Press (2001). , this document is incorporated herein by reference.
  • the vectors of the present invention can typically be constructed as vectors for cloning or as vectors for expression.
  • the vector of the present invention can be constructed using a prokaryotic cell or a eukaryotic cell as a host.
  • a strong promoter capable of propagating transcription eg, pL ⁇ promoter, trp promoter, lac promoter, T7 promoter, tac promoter, etc.
  • a promoter and operator site of the E. coli tryptophan biosynthetic pathway Yanofsky, C., J. Bacteriol., 158:1018-1024 (1984)
  • the left-handed promoter of phage ⁇ pL
  • the ⁇ promoter Herskowitz, I. and Hagen, D., Ann. Rev. Genet., 14:399-445 (1980)
  • Herskowitz, I. and Hagen, D., Ann. Rev. Genet., 14:399-445 (1980) can be used as a regulatory region.
  • vectors that can be used in the present invention include plasmids (eg, pSK349, pSC101, ColE1, pBR322, pUC8/9, pHC79, pGEX series, pET series and pUC19, etc.), phage (eg, ⁇ gt ⁇ 4B, ⁇ -Charon, ⁇ z1 and M13, etc.) or viruses (eg, SV40, etc.) can be manufactured.
  • plasmids eg, pSK349, pSC101, ColE1, pBR322, pUC8/9, pHC79, pGEX series, pET series and pUC19, etc.
  • phage eg, ⁇ gt ⁇ 4B, ⁇ -Charon, ⁇ z1 and M13, etc.
  • viruses eg, SV40, etc.
  • the vector of the present invention may be fused with other sequences to facilitate purification of the polypeptide expressed therefrom.
  • the sequence to be fused includes, for example, glutathione S-transferase (Pharmacia, USA), maltose binding protein (NEB, USA), FLAG (IBI, USA) and 6x His (hexahistidine; Quiagen, USA). Because of the additional sequences for purification, the protein expressed in the host is rapidly and easily purified via affinity chromatography.
  • the vector of the present invention may include an antibiotic resistance gene commonly used in the art as a selection marker, for example, ampicillin, gentamicin, carbenicillin, chloramphenicol, streptomycin, kanamycin, geneticin, neomycin and a gene for resistance to tetracycline.
  • an antibiotic resistance gene commonly used in the art as a selection marker, for example, ampicillin, gentamicin, carbenicillin, chloramphenicol, streptomycin, kanamycin, geneticin, neomycin and a gene for resistance to tetracycline.
  • a promoter derived from the genome of a mammalian cell eg, a metallotionine promoter
  • a promoter derived from a mammalian virus eg, adeno viral late promoter, vaccinia virus 7.5K promoter, SV40 promoter, cytomegalovirus promoter and tk promoter of HSV
  • a promoter derived from the genome of a mammalian cell eg, a metallotionine promoter
  • a promoter derived from a mammalian virus eg, adeno viral late promoter, vaccinia virus 7.5K promoter, SV40 promoter, cytomegalovirus promoter and tk promoter of HSV
  • the vector may additionally carry genes encoding reporter molecules (eg, luciferase and -glucuronidase).
  • reporter molecules eg, luciferase and -glucuronidase
  • any host cell known in the art may be used, for example, E. coli Origami2, E. coli JM109, E. coli BL21 (DE3 ), E. coli strains such as E. coli RR1, E. coli LE392, E. coli B, E. coli X 1776, E. coli W3110, Bacillus genus strains such as Bacillus subtilis, Bacillus thuringiensis, and Enterobacteriaceae and strains such as Salmonella typhimurium, Serratia marcesens, and various Pseudomonas species.
  • yeast Sacharomyce cerevisiae
  • insect cells and animal cells eg, CHO cell line (Chinese hamster ovary), W138, BHK, COS-7, 293) , HepG2, 3T3, RIN and MDCK cell lines
  • yeast Sacharomyce cerevisiae
  • insect cells and animal cells eg, CHO cell line (Chinese hamster ovary), W138, BHK, COS-7, 293) , HepG2, 3T3, RIN and MDCK cell lines
  • the host cell transformed with the vector of the present invention is E. coli.
  • the host cells transformed with the vector of the present invention are ER2537 E. coli and BL21 (DE3), but are not limited thereto.
  • the method of delivering the vector of the present invention into a host cell is, when the host cell is a prokaryotic cell, the CaCl2 method (Cohen, S.N. et al., Proc. Natl. Acac. Sci. USA, 9:2110-2114 (1973)). , Hana Han method (Cohen, S.N. et al., Proc. Natl. Acac. Sci. USA, 9:2110-2114 (1973); and Hanahan, D., J. Mol. Biol., 166:557-580 ( 1983)) and electroporation methods (Dower, W. J. et al., Nucleic. Acids Res., 16:6127-6145 (1988)).
  • the microinjection method (Capecchi, M.R., Cell, 22:479 (1980)), the calcium phosphate precipitation method (Graham, F.L. et al., Virology, 52:456 (1973)), electroporation (Neumann, E. et al., EMBO J., 1:841 (1982)), liposome-mediated transfection (Wong, T.K. et al., Gene, 10:87 (1980)), DEAE- Dextran treatment (Gopal, Mol. Cell Biol., 5:1188-1190 (1985)), and gene bambadment (Yang et al., Proc. Natl. Acad. Sci., 87:9568-9572 (1990)) ), and the like, to inject the vector into the host cell.
  • the microinjection method Capecchi, M.R., Cell, 22:479 (1980)
  • the calcium phosphate precipitation method Graham, F.L. et al.,
  • the recombinant vector injected into the host cell can express the above-mentioned polypeptide or polypeptide complex recombined in the host cell, and in this case, a large amount of the polypeptide or polypeptide complex is obtained.
  • the expression vector includes the lac promoter
  • the host cell may be treated with IPTG to induce gene expression.
  • the transformed host cell can be cultured by a known host cell culture method or a modified method thereof.
  • a natural medium or a synthetic medium can be used as the medium for culturing the transformed host cell if it contains a carbon source, nitrogen source, inorganic salt, etc. that can be efficiently used by E. coli.
  • Carbon sources that can be used include carbohydrates such as glucose, fructose, sucrose; starch, a hydrolyzate of starch; organic acids such as acetic acid and propionic acid; alcohols such as ethanol, propanol, glycerol, and the like.
  • the nitrogen source is ammonia; ammonium salts of inorganic or organic acids such as ammonium chloride, ammonium sulfate, ammonium acetate and ammonium phosphate; peptone, meat extract, yeast extract, corn steep liquor, casein hydrolyzate, soybean extract, soybean hydrolyzate; various fermented cells and their lysates; and the like.
  • Inorganic salts include potassium dihydrogen phosphate, dipotassium hydrogen phosphate, magnesium phosphate, magnesium sulfate, sodium chloride, manganese sulfate, copper sulfate, calcium carbonate, and the like.
  • the culture is usually carried out under aerobic conditions, such as by shaking culture or rotation by a rotary machine.
  • the culture temperature is preferably in the range of 10 to 40° C., and the culture time is generally 5 hours to 7 days.
  • the pH of the medium is preferably maintained in the range of 3.0 to 9.0 during culture.
  • the pH of the medium can be adjusted with inorganic or organic acids, alkaline solutions, urea, calcium carbonate, ammonia, and the like.
  • antibiotics such as ampicillin, streptomycin, chloramphenicol, kanamycin and tetracycline may be added for maintenance and expression of the recombinant vector.
  • a suitable inducer may be added to the medium.
  • IPTG isopropyl- ⁇ -D-thiogalactopyranoside
  • indoleacrylic acid can be added to the medium.
  • the present invention provides (a) a polypeptide that specifically binds to testosterone; And (b) provides a pharmaceutical composition for stimulating hair growth or treating hair loss, comprising a pharmaceutically acceptable excipient, carrier, or diluent.
  • the present invention provides a complex comprising (a) a polypeptide that specifically binds to testosterone and at least one additional polypeptide; And (b) provides a pharmaceutical composition for stimulating hair growth or treating hair loss, comprising a pharmaceutically acceptable excipient, carrier, or diluent.
  • a cosmetic (cosmetic) composition for stimulating hair growth comprising the above-described polypeptide or the above-described complex specifically binding to testosterone.
  • the present invention provides a cosmetic (cosmetics) composition for stimulating hair growth comprising a complex comprising a polypeptide that specifically binds to testosterone and at least one additional polypeptide.
  • a polypeptide that specifically binds to testosterone as an active ingredient of the pharmaceutical/cosmetic (cosmetics) composition for stimulating hair growth or treating hair loss of the present invention or ii) a complex comprising a polypeptide that specifically binds testosterone and at least one additional polypeptide can be prepared by known means, such as liquid phase and solid phase synthesis (eg, t-Boc solid phase peptide synthesis and BOP-SPPS). can be synthesized by
  • said i) a polypeptide that specifically binds to testosterone; or ii) a pharmaceutically and/or cosmetically acceptable acid or base addition salt of a complex comprising a polypeptide that specifically binds testosterone and at least one additional polypeptide. It will be recognized by the technician.
  • the acids used to prepare the pharmaceutically and/or cosmetically acceptable acid addition salts of the aforementioned base compounds useful in the present invention include non-toxic acid addition salts, i.e., among others, hydrochloride, hydrobromide, hydroiodide, Nitrate, sulfate, bisulfate, phosphate, acid phosphate, acetate, lactate, citrate, acid citrate, tartrate, bitartrate, succinate, maleate , fumarate, gluconate, saccharate, benzoate, methanesulfonate, ethanesulfonate, benzenesulfonate, p-toluenesulfonate and pamoate [i.e., among others, hydrochloride, hydrobromide, hydroiodide, Nitrate, sulfate, bisulfate, phosphate, acid phosphate, acetate, lactate, citrate, acid citrate, tartrate, bitartrate, succinate, male
  • 1,1'-methylene-bis-(2) -hydroxy-3 naphthoate)] salts such as salts containing pharmaceutically and/or cosmetically acceptable anions.
  • Pharmaceutically and/or cosmetically acceptable base addition salts may also be used to generate pharmaceutically and/or cosmetically acceptable salt forms of the polypeptide or complex.
  • polypeptide or complex of the invention may be lyophilized for storage and reconstituted with an appropriate carrier prior to use.
  • the polypeptide or complex is provided in the form of a composition comprising a pharmaceutically acceptable and/or cosmetically acceptable excipient, carrier or diluent selected with respect to the intended route of administration and standard pharmaceutical or cosmetic application.
  • a pharmaceutically acceptable and/or cosmetically acceptable excipient, carrier or diluent selected with respect to the intended route of administration and standard pharmaceutical or cosmetic application.
  • “Pharmaceutically acceptable” means that the formulation is sterile and free of pyrogens. Suitable pharmaceutical carriers are well known in the pharmaceutical art. The carrier(s) must be “acceptable” in the sense of not adversely affecting the efficacy of the active ingredient of the present invention and not harmful to its recipient. Typically, the carrier will be sterile, pyrogen-free water or saline; However, other acceptable carriers may be used. Thus, “pharmaceutically acceptable carrier” and “pharmaceutically acceptable excipient” are merely intended to act as carriers, i.e., not intended to have their own biological activity. compound(s) used to form part of the formulation. Pharmaceutically acceptable carriers or excipients are generally safe and nontoxic. A pharmaceutically acceptable carrier and/or excipient as used herein includes both one or more carriers and/or excipients.
  • cosmetically acceptable is used to denote an agent suitable for use as a cosmetic.
  • Suitable cosmetic carriers are well known in the art, as are commonly used in shampoos, lotions, creams, sprays and other such products.
  • An excipient may be one or more carbohydrates, polymers, lipids and minerals.
  • carbohydrates include lactose, sucrose, mannitol, and cyclodextrins, which are added to the composition to facilitate lyophilization, for example.
  • polymers include starch, cellulose ethers, cellulose carboxymethylcellulose, hydroxypropylmethyl cellulose, hydroxyethyl cellulose, ethylhydroxyethyl cellulose, alginates, carrageenan, hyaluronic acid and derivatives thereof, polyacrylic acid, polysulfonates, polyethylene glycol/polyethylene oxide, polyethylene oxide/polypropylene oxide copolymers, polyvinylalcohol/polyvinylacetate of different degrees of hydrolysis, and polyvinylpyrrolidone of all different molecular weights, which are for example , to control viscosity, to achieve adhesion, or to protect lipids from chemical and proteolytic degradation.
  • lipids are fatty acids, phospholipids, phosphoric acid, mono-, di-, and triglycerides, ceramides, sphingolipids and glycolipids of all different acyl chain lengths and saturation, egg lecithin, soy lecithin, hydrogenated egg and soy lecithin, which are It is added to the composition for reasons similar to those for polymers.
  • minerals are talc, magnesium oxide, zinc oxide and titanium oxide, which are added to the composition to obtain advantages such as reduction of liquid build-up or advantageous pigment properties.
  • diluent is intended to mean an aqueous or non-aqueous solution with the purpose of diluting a peptide in pharmaceutical preparation.
  • the diluent may be one or more of saline, water, polyethylene glycol, propylene glycol, ethanol or an oil (such as safflower oil, corn oil, peanut oil, cottonseed oil or sesame oil).
  • the diluent may also function as a buffer.
  • buffer is intended to mean an aqueous solution containing an acid-base mixture with the purpose of stabilizing the pH.
  • buffers include Trizma, Bicine, Tricine, MOPS, MOPSO, MOBS, Tris, Hepes, HEPBS, MES, phosphate, carbonate, acetate, citrate, glycolate, lactate, borate, ACES, ADA, tartrate , AMP, AMPD, AMPSO, BES, CABS, cacodylate, CHES, DIPSO, EPPS, ethanolamine, glycine, HEPPSO, imidazole, imidazolamic acid, PIPES, SSC, SSPE, POPSO, TAPS, TABS, TAPSO and TES am.
  • the composition may include an adjuvant.
  • adjuvant is intended to mean a compound added to an agent to increase the biological effect of said peptide.
  • Said adjuvant may be one or more zinc, copper or silver salts with different anions, for example fluoride, chloride, bromide, iodide, thiocyanate, sulfite, hydroxide, phosphate, carbonate, lactate, glycol Acetates of, but not limited to, lactates, citrates, borates, tartrates, and other acyl compositions.
  • the pharmaceutical composition of the present invention may also be in the form of biodegradable microspheres.
  • poly(lactic acid) (PLA), poly(glycolic acid) (PGA), a copolymer of PLA and PGA (PLGA) or poly(carprolactone) (poly(carprolactone) ; PCL), and aliphatic polyesters, such as polyanhydrides, have been widely used as biodegradable polymers in the generation of microspheres.
  • the preparation of such microspheres can be found in US 5,851,451 and EP0213303.
  • the pharmaceutical composition of the present invention may also be in the form of a polymer gel, or microneedle made of a polymer, wherein the polymer is starch, cellulose ether, cellulose carboxymethylcellulose, hydroxypropylmethyl cellulose, hydroxyethyl cellulose, ethylhydroxy ethyl cellulose, alginate, carrageenan, hyaluronic acid and its derivatives, polyacrylic acid, polysulfonate, and the like.
  • the testosterone-binding polypeptide or complex may be formulated at various concentrations according to the efficacy or toxicity of the active ingredient used.
  • the composition comprises 1 nM to 1 M, for example 0.1 ⁇ M (micromole) to 1 mM, 1 ⁇ M to 100 ⁇ M, 5 ⁇ M to 50 ⁇ M, 10 ⁇ M to 50 ⁇ M, 20 ⁇ M to 40 ⁇ M and optionally and the testosterone-binding polypeptide or complex at a concentration of about 30 ⁇ M.
  • the composition may include a lower concentration of the testosterone-binding polypeptide or complex, for example, between 0.0025 ⁇ M and 1 ⁇ M.
  • compositions of the present invention may be administered by a variety of routes, for example, topical, subcutaneous, parenteral or oral administration.
  • the composition of the present invention is suitable for topical or intracutaneous administration.
  • the compositions of the present invention may be administered topically to the skin (eg, the scalp).
  • the composition may be provided in the form of an ointment containing the active polypeptide suspended or dissolved in a mixture having, for example, one or more of: mineral oil, liquid petrolatum, white petrolatum, propylene glycols, polyoxyethylene polyoxypropylene compounds, emulsifying waxes and water.
  • the polypeptide may be formulated in a suitable lotion or cream, for example suspended or dissolved in a mixture of one or more of the following: mineral oil, sorbitan monostearate, polyethylene glycol, liquid paraffin, polysorbate 60, cetyl ester wax, cetearyl alcohol, 2-octyldodecanol, benzyl alcohol and water.
  • compositions for topical administration may include a penetration enhancer (eg, Osborne & Henke, 1997, Pharmaceutical Technology, November: 58-82 and the disclosure of which is incorporated herein by reference).
  • a penetration enhancer eg, Osborne & Henke, 1997, Pharmaceutical Technology, November: 58-82 and the disclosure of which is incorporated herein by reference.
  • compositions of the present invention may be administered parenterally, for example intradermally.
  • Such compositions are best used in the form of a sterile aqueous solution which may contain sufficient salt or glucose to make the solution isotonic with other substances, for example, blood.
  • the aqueous solution should be suitably buffered (preferably to pH 3-9), if necessary.
  • the preparation of suitable parenteral preparations under sterile conditions is readily accomplished by standard pharmaceutical techniques well known to those skilled in the art.
  • compositions suitable for parenteral administration include aqueous and non-aqueous sterile injectable solutions which may contain antioxidants, buffers, bacteriostats and solutes which render the preparation isotonic with the blood of the intended recipient; and aqueous and non-aqueous sterile suspensions which may contain suspending and thickening agents.
  • the formulations may be presented in unit-dose or multi-dose containers, such as closed ampoules and vials, requiring only the addition of a sterile liquid carrier, such as water for injection, immediately prior to use. may be stored in a freeze-dried (lyophilized) state.
  • Extemporaneous injection solutions and suspensions may be prepared from sterile powders, granules and tablets of the kind previously described.
  • a sustained release system such as a microsphere formulation.
  • composition may be administered by a surgically implanted device that releases the active polypeptide directly to the desired site (ie, the epidermis).
  • compositions of the present invention may also be delivered transdermally.
  • EPT electroporation therapy
  • iontophoresis systems may be employed for administration of proteins or polypeptides.
  • a device is used to deliver a pulsed electric field to a cell, resulting in increased permeability of the cell membrane for drug and a significant increase in intracellular drug delivery.
  • An alternative transdermal method, electroincorporation utilizes that small particles up to 30 microns in diameter at the surface of the skin experience an electrical pulse identical or similar to that used for electroporation.
  • the particles enter the deeper layers of the skin through the stratum corneum.
  • the particles may be filled or coated with a drug or gene, or simply act as “bullets” that create pores in the skin for the drug to enter.
  • Suitable methods for administration of the polypeptides and compositions of the present invention are well known in the art and are described, for example, in Therapeutic Protein and Peptide Formulation and Delivery, Zahra Shahrokh et al. (Eds), 1997, American Chemical Society, ISBN13: See 9780841235281.
  • the polypeptide composition of the present invention is administered to a subject in an effective amount.
  • a 'therapeutically effective amount', or 'effective amount', or 'therapeutically effective' refers to an amount that provides a stimulating effect on hair growth. This is a predetermined amount of active substance calculated to produce the desired therapeutic effect.
  • the amount of an active ingredient may vary depending on its specific activity. Appropriate dosages may contain a predetermined amount of active substance calculated to produce the desired therapeutic effect in association with the required diluent.
  • a therapeutically effective amount of an active ingredient is provided.
  • a therapeutically effective amount can be determined by one of ordinary skill in the medical or veterinary arts based on patient characteristics, such as age, weight, sex, condition, complications, other diseases, and the like, as is well known in the art.
  • the hair loss is selected from the group consisting of:
  • the hair loss may be androgenetic alopecia.
  • the hair loss may be anagenital alopecia, induced, for example, by radiotherapy and/or chemotherapy (see above).
  • the subject is a mammal such as a human, a chimpanzee, an orangutan, a non-human primate, a dog, a cat, a horse, a hamster, a mouse, a rat, a gerbil, a pig, a sheep, a cow, and most specifically As a human, but is not limited thereto.
  • a mammal such as a human, a chimpanzee, an orangutan, a non-human primate, a dog, a cat, a horse, a hamster, a mouse, a rat, a gerbil, a pig, a sheep, a cow, and most specifically As a human, but is not limited thereto.
  • cosmetic (cosmetic) compositions of the present invention are not limited to medical use, but can also be used as cosmetic agents (in the sense that they do not provide any physical health improvement, but simply provide an aesthetic advantage to mammals). It is recognized by those skilled in the art.
  • the cosmetic (cosmetic) composition may be for stimulating existing pores and/or inducing growth of new pores (or stem cells capable of generating them).
  • the cosmetic composition is used for the treatment or prevention of baldness, which may be associated with receding hairline and/or thinning hair.
  • compositions are not limited to use on the scalp, but can be applied anywhere on the body (including the face to promote growth of beard, eyelashes or eyebrows).
  • compositions of the present invention may be used on their own or in combination with other therapeutic or cosmetic agents.
  • the compositions of the present invention may be used in existing therapies that prevent existing hair loss and/or stimulate new hair growth, such as minoxidil (Regaine RTM., Pharmacia Corp.) and diazoxide. potassium channel openers; 5-alpha-reductase inhibitors such as finasteride (Propecia RTM., Merck &Co.); and in combination therapy with the immunosuppressant cyclosporin A.
  • compositions of the present invention may be used in vivo, ex vivo or in vitro.
  • the composition in addition to being directly applied or administered to a mammal, can be used to stimulate hair growth ex vivo, for example in a skin explant prior to implantation into the skin of a mammal.
  • the composition can be used to grow pores in vitro, for example in cell culture, which can then be implanted into a patient.
  • a further aspect of the invention provides the use of a polypeptide according to the invention for stimulating hair growth in vitro or ex vivo.
  • the polypeptide is used to stimulate the growth of pores (or stem cells capable of producing them, dermal papilla cells).
  • the present invention provides a method for stimulating hair growth or treating hair loss, comprising administering the above-described pharmaceutical composition to a subject in need of treatment.
  • the pharmaceutical composition comprises one of the polypeptides specifically binding to testosterone as an active ingredient, or one of the polypeptides specifically binding to testosterone as described above.
  • a complex including at least one angiogenic polypeptide (angiogenic polypeptide) is included as an active ingredient.
  • the subject of the present invention is a mammal such as a human, a chimpanzee, an orangutan, a primate other than a human, a dog, a cat, a horse, a hamster, a mouse, a rat, a gerbil, a pig, a sheep, a cow, and most specifically a human, It is not limited.
  • the hair growth stimulation or hair loss treatment method of the present invention since it is a method comprising the step of administering the pharmaceutical composition of an aspect of the present invention, the description thereof is omitted to avoid excessive redundancy of the present specification for overlapping contents. .
  • the present invention relates to a testosterone-binding affibody and uses thereof, and specifically, i) a testosterone-binding affibody or ii) a complex of the affibody and an osteopontin fragment; And iii) relates to a pharmaceutical composition for hair growth stimulation or hair loss treatment comprising them as an active ingredient.
  • Affibody of the present invention, or a complex of Affibody and osteopontin fragment is very excellent in preventing hair growth or hair loss, and thus can be usefully used as a hair growth agent or a treatment agent for hair loss.
  • FIG. 1 is a diagram showing alanine scanning results of Affibody clone T26 that specifically binds to testosterone of the present invention.
  • Figure 2 is a diagram showing the binding force with testosterone (T17-G-BSA) of the T26 variant in which the 25th amino acid residue threonine (T) of Affibody T26, which specifically binds to testosterone of the present invention, is substituted with another amino acid residue. .
  • FIG. 3 is a diagram showing the results of SDS-PAGE analysis by purifying the T26 mutant in which the 25th amino acid residue threonine (T) of Affibody T26, which specifically binds to testosterone of the present invention, is substituted with another amino acid residue.
  • T 25th amino acid residue threonine
  • FIG. 4 is a diagram showing the selectivity of the T26 variants to testosterone from the binding to four types of BSA (BSA, T3-CMO-BSA, G-BSA, T17-G-BSA) of the selected T26 variants.
  • BSA BSA, T3-CMO-BSA, G-BSA, T17-G-BSA
  • FIG. 5 is a 4-parameter logistic curve showing ELISA measurement values at various concentrations of affibodies in order to confirm the affinity (EC50) with testosterone (T17-G-BSA) of T26 and T26 variants of the present invention am.
  • T26 and T26-INS001 of the present invention are a result of SDS-PAGE analysis of T26 and T26-INS001 of the present invention.
  • G-BSA glycine-conjugated BSA
  • T3-CMO-BSA T17-G- It is a diagram confirming whether binding with BSA
  • FIG. 8 is a view confirming the affinity for testosterone of T26 and T26-INS001 of different sample storage periods in order to confirm the stability of T26-INS001 of the present invention.
  • the primary production means the T26-INS001 sample produced first
  • the secondary production means the T26-INS001 sample produced after 30 days.
  • 9a and 9b are diagrams showing the in vivo test results for the hair growth or hair loss treatment effect of T26 and T26-INS001 of the present invention.
  • % used to indicate the concentration of a specific substance is (weight/weight) % for solid/solid, (weight/volume) % for solid/liquid, and Liquid/liquid is (volume/volume) %.
  • the 17-beta hydroxyl group of testosterone (TCI, cat. #. T0027) was introduced into an amine group through an esterification reaction with Boc-glycine (GENERAY BIOTECH, cat. #. 0167), and Sulfo-SMCC (sulfosuccinimidyl 4-(N-) maleimidomethyl)cyclohexane-1-carboxylate) (Thermo Fisher, cat. #. 22322) is fixed to BSA (Sigam-Aldrich, cat. #. A7030) using a linker, and has the same structure as BSA-linker-glycine-17beta-hydroxy Testosterone of T17-G-BSA was prepared.
  • G-BSA an antigen in which glycine was immobilized to BSA with a Sulfo-SMCC linker was prepared.
  • G-BSA an antigen in which glycine was immobilized to BSA with a Sulfo-SMCC linker was prepared.
  • T3-CMO Teestosterone-3-(O-carboxymethyl)oxime
  • Sigma-Aldrich cat. #. T8390
  • T3-CMO-BSA the buffer was exchanged using a diafiltration method (sartorius, cat. #. VS2002), and the remaining low molecular weight substances that did not participate in the reaction were removed.
  • Affibodies that specifically bind to testosterone were selected by bio-panning using T17-G-BSA-immobilized magnetic beads (Thermo Fisher, cat. #. 14301).
  • the preparation of magnetic beads immobilized with T17-G-BSA used for bio-panning was as follows: 30 mg (2 X 10 9 ) of magnetic beads were mixed with 2 ml of 0.1 M sodium phosphate buffer (pH). 7.4) was washed three times to prepare. 600 ⁇ g of T17-G-BSA of Example 1 was mixed with 30 mg of washed magnetic beads, and 0.1 M sodium phosphate buffer was added so that the volume of the solution was 600 ⁇ l. To react the epoxy group of the magnetic beads with the amine group of T17-G-BSA, 300 ⁇ l of 3 M ammonium sulfate was added and the reaction was carried out at 37° C. for 24 hours.
  • Bio-panning screening for selection of affibodies that specifically bind to testosterone was performed as follows: The affibody library was rescued in phage form using VCSM13 helper phage and used for panning. The number of library phages binding to the initial antigen was more than 10 13 , and 5 rounds of panning were performed. As a strategy to selectively select phages with high affinity, the amount of antigen (magnetic beads) was reduced as the number of panning rounds increased (50 ⁇ g, 30 ⁇ g, 20 ⁇ g, 20 ⁇ g, 10 ⁇ g in that order) . Washing was performed 3 times with PBST (phosphate buffered saline + 0.05% Tween 20) in the first round, and then 5 times in the subsequent (2-4 rounds).
  • PBST phosphate buffered saline + 0.05% Tween 20
  • the number of phages bound to the target antigen was measured (titration) using ER2537 E. coli as follows: The binder phage obtained in each round of bio-panning was eluted with 0.1 M HCl solution containing 20 mM free testosterone. (elution) was performed. ER2537 E. coli cultured overnight in SB media (MOPS 10 g/L, Bacto YEAST extract 20 g/L, Trypton 30 g/L) was diluted 1/200-fold in fresh SB media and passaged. After that, it was further cultured at 37° C. for 3 hours to reach log phage. 100 ⁇ L of fresh ER2537 E.
  • coli and 10 ⁇ L of the diluted phage were mixed in a 1.5 ml unit tube, incubated for 30 minutes, spread on an LB plate containing ampicillin, and cultured at 37° C. for 16 hours.
  • the number of phages was measured by applying the number of colonies and a dilution factor of the generated ER2537 E. coli.
  • the binder phage obtained in each round of bio-panning was infected with ER2537 E. coli and maintained in the form of a colony, and binding to each antigen was checked by the ELISA method as follows: Binder phage was infected ER2537 E. coli colony obtained by (infection) was inoculated in SB media and cultured at OD 600 until 0.5. For the induction of Affibody expression, 0.5 mM IPTG (LPS solution) was added and cultured with shaking at 30°C for 16 hours. The fraction of the intermembrane space of ER2537 E.
  • coli was extracted using BBS buffer (200 mM Boric acid, 150 mM NaCl, 1 mM EDTA, pH 7.5). Affibody extracted fractions were treated on an ELISA plate coated with T17-G-BSA at a concentration of 0.2 mg/well at room temperature for 1 hour, and then washed three times with TBST (Tris buffered saline + 0.05% Tween 20). Binding of Affibody to antigen was determined by using anti-HA mouse HRP (Roche, cat. #.
  • a competitive ELISA was performed to select an affibody capable of specific binding to free testosterone, which is the object of the present invention.
  • Affibody extracted fractions were pre-treated with 0.1 mM free testosterone at room temperature for 1 hour, and then the above ELISA process was repeated.
  • Affibody (T26) which was confirmed to specifically bind to both T17-G-BSA and free testosterone, was identified, and its phagemid plasmid was obtained and nucleic acid sequence analysis was performed, as shown in Table 1.
  • Alanine screening of the variable region was performed to confirm the site involved in the binding of the selected T26 affibody to testosterone. Based on the selected T-26 sequence, a primer in which the sequence of each variable region can be substituted with alanine was designed. For alanine codon, GCT was used. The alanine sequence substitution method was performed as follows by over-lapping PCR method.
  • variable region amino acid to be mutated Based on the variable region amino acid to be mutated, 4 ⁇ L of template DNA 50 ng, 10 pmol/ ⁇ L concentration of #22 forward primer and variable region reverse primer, respectively, 10X pfu polymerase to generate an N-terminal DNA fragment 10 ⁇ L of the mixture (ELPIS biotech, EBT-1011) was put into a PCR tube, and distilled water was added so that the total reaction volume became 50 ⁇ L, followed by PCR reaction. In addition, based on the variable region amino acid to be mutated, the C-terminal DNA fragment was generated using the variable region forward and #24 reverse primers under the same conditions as above.
  • the two DNA fragments generated by the PCR reaction were loaded on an agarose gel, and then DNA was isolated from the agarose gel using a DNA gel elution kit (iNtRON BIOTECHNOLOGY, cat. #. 17288). Using 50 ng of each of the two isolated DNA fragments as template DNA, 4 ⁇ L of #22 forward and #24 reverse primers at a concentration of 10 pmol/ ⁇ L, and 10 ⁇ L of 10X pfu polymerase mixture (ELPIS, cat. #.
  • EBT-1011 were PCR After putting it in a tube, distilled water was added so that the total reaction volume became 50 ⁇ L, and overlapping PCR was performed to connect the two DNA fragments to prepare a mutant sequence in which the amino acids of each variable region were substituted with alanine. . (Refer to the primer sequences in Table 2)
  • T17-G-BSA in T25A was increased compared to that of the parent clone, and it was determined that there is a possibility that the substitution of the 25th amino acid could increase the affinity of T26 for testosterone.
  • 25th position of T26 Affibodies in which threonine was substituted with other amino acids were prepared as follows. The method of substituting the 26th amino acid threonine with another amino acid based on the selected sequence of T26 was carried out by the over-lapping PCR method using the NNK primer. (Refer to the primer sequences in Table 3)
  • Primer sequence used for T26-T25X mutation Primers Nucleotide sequence (5' to 3') SEQ ID NO: #22 forward gtgtggaattgtgagcggataac 45 #24 reverse atagcccccttattagcgtttgccatc 46 T25NNK-forward CTGCCCAACCTGAACCATNNKCAGATCCGTGCCTTCAT 61 T25-reverse ATGGTTCAGGTTGGGCAG 62
  • the selected affibody genes are PCR amplified (see the primer sequence in Table 4) and treated with NdeI (NEB cat. # R0111L) and XhoI (NEB cat. # R0146L) restriction enzymes, followed by pET21a (Novagen, cat. #. 69740) expression vector was cloned into
  • Primers used for cloning the T26-T25X mutant pET21a Primers Nucleotide sequence (5' to 3') SEQ ID NO: forward AATTCATATGGTGGACAACAAGTTCAACAAGGAG 63 reverse CCGCTCGAGCTTGGGAGCTGGGCGTCGTTC 64
  • Transformed BL21 (DE3) colonies were inoculated in 5 ml 2X YT media (NaCl 5 g/L, Bacto YEAST extract 10 g/L, Trypton 16 g/L) containing 100 ⁇ g/ml of ampicillin and inoculated at 37°C for 16 hours. pre-cultured. 200 ⁇ l of the pre-culture solution was inoculated into 250 ml 2X YT media and cultured at 37° C. OD 600 until 0.5. Affibody expression induction was performed by adding 1 mM IPTG and incubating at 30° C. for 16 hours with shaking.
  • lysis buffer (6 M guanidine, 47 mM Na 2 HPO 4 , 2.65 mM NaH 2 PO 4 , 10 mM Tris, 100 mM NaCl, pH8.0) and then sonicated.
  • Affibodies were purified from the lysate using Ni-NTA beads (Qiagen, cat. #. 30410) and replaced with PBS in the purification buffer using the diafiltration method.
  • Purified affibodies were quantified by measuring absorbance at 280 nm.
  • the purified recombinant protein was analyzed by SDS-PAGE using 4-20% gradient gel (Fig. 3).
  • Each purified Affibody 10 ⁇ g/ml (50 ⁇ l) contains BSA, T3-CMO-BSA, G-BSA. , Binding specificity was confirmed using an ELISA plate coated with T17-G-BSA at a concentration of 100 ng per well. Affibodies were treated at room temperature for 1 hour and then washed 3 times with TBST. Antigen binding of Affibody was checked with anti-6x His mouse HRP (R&D systems, cat. #.
  • each affibody to T17-G-BSA was confirmed by ELISA.
  • the Affibody was serially diluted 5 times at a concentration of 40 ⁇ g/ml 10 times and treated at a minimum concentration of 20.48 pg/ml at room temperature for 1 hour.
  • ELISA was performed.
  • the value of OD 450 which is the color development degree of the TMB solution, was input into the GraphPad Prism program, and the EC 50 value was calculated from a 4-parameter logistic curve (FIG. 5 and Table 5).
  • the EC 50 value of T26 for T17-G-BSA was calculated to be about 0.8 ⁇ g/ml (1 x 10 -7 M), and T26-T25R (9.3 times), T26- T25A (5.6 times) and T26-T25Q (2.0 times) were confirmed.
  • the present inventors prepared a complex linking the T26 affibody and osteopontin protein fragment (SVVYGLR) with a peptide linker (GGGG), and named it T26-INS001.
  • the T26-INS001 was cloned into the pET28a expression vector to which a 6X histidine tag and a thrombin cleavage sequence in between the N-terminal front of T26 for ease of purification were imposed as follows: pET21a vector into which T26 is inserted was used as a PCR amplification template (see the primer sequences in Table 6).
  • Primer used for cloning of animal test samples (T26, T26-INS001) protein expression vector pET28a Primers Nucleotide sequence (5' to 3') SEQ ID NO: Forward AATTCATATGGTGGACAACAAGTTCAACAAGGAG 63 reverse (T26) CCGCTCGAGCTTGGGAGCTGGGCGTCGTTC 64 reverse (T26-INS001) CCGCTCGAGTTAGCGCAGGCCATACACCACGCTGCCGCCGCCGCCCTTGGGAGCCTGGGCGTCG 65
  • the PCR amplification result was inserted into the MCS (multiple cloning site) of pET28a (Novagen, cat. # 69864) after treatment with NdeI (NEB cat. # R0111L) and XhoI (NEB cat. # R0146L) restriction enzymes.
  • NdeI NdeI
  • XhoI NEB cat. # R0146L restriction enzymes.
  • the nucleic acid and amino acid sequences of each protein are shown in Table 7.
  • Transformed BL21 (DE3) colonies were inoculated into 5 ml 2X YT media (NaCl 5 g/L, Bacto YEAST extract 10 g/L, Trypton 16 g/L) containing 50 ⁇ g/ml of Kanamycin and inoculated at 37°C for 16 hours. pre-cultured. 500 ⁇ l of the pre-culture solution was inoculated into 500 ml 2X YT media and cultured at 37° C. OD 600 until 0.5. Expression of T-26 (cloned into pET28 vector) and T26-INS001 was induced by adding 1 mM IPTG and incubating at 25° C. for 24 hours with shaking.
  • T26 and T26-INS001 were purified from the lysate using Ni-NTA beads and replaced with saline (0.9% NaCl) in the purification buffer using diafiltration. Purified T26 and T-26-INS001 were quantified by measuring their absorbance at 280 nm. The purified recombinant protein was analyzed by 15% SDS-PAGE (FIG. 6).
  • T26, T26-INS001 0.1 ⁇ g/ml (50 ⁇ l) was bound using an ELISA plate coated with BSA, T3-CMO-BSA, G-BSA, and T17-G-BSA at a concentration of 100 ng per well. Specificity was confirmed.
  • T26 and T26-INS001 were treated at room temperature for 1 hour and then washed 3 times with TBST.
  • Antigen binding of T26 and T-26-INS001 was checked with anti-6x His mouse HRP as a secondary antibody for 1 hour at room temperature, washed 3 times with TBST, followed by color reaction with TMB solution, and then ELISA reader (Victor) X3 PerkinElmer) was used to measure and confirm the OD 450 value.
  • T26 and T26-INS001 were only bound to testosterone-conjugated antigens, T3-CMO-BSA and T17-G-BSA, but not to BSA and G-BSA ( FIG. 7 ). It was confirmed that the N-terminal peptide of T26 (6X histidine tag, thrombin cleavage sequence) and the C-terminal peptide did not affect the binding specificity of T26.
  • T26 and T26-INS001 The binding affinity of T26 and T26-INS001 to T17-G-BSA was confirmed by ELISA.
  • T26 and T-26-INS001 were serially diluted 3 times at a concentration of 20 ⁇ g/ml (50 ⁇ l) 8 times to a minimum concentration of 9 ng/ml At a concentration of 1 hour at room temperature.
  • ELISA was performed.
  • ELISA was performed on each of the previously prepared samples (primary production) and newly prepared samples (secondary production) with a difference of 30 days.
  • the first produced T26-INS001 sample was stored at 4 °C in a state of dissolving in 0.9% NaCl saline until the production of the second produced T26-INS001 sample.
  • the value of OD 450 which is the degree of color development of the TMB solution, was input into the GraphPad Prism program, and the EC 50 value was calculated from a 4-parameter logistic curve (FIG. 8).
  • the EC 50 value of T26 for T17-G-BSA was calculated to be 0.5 mg/l (6 x 10 -9 M), and it was confirmed that T26-INS001 had an EC 50 value that was two times lower than this.
  • mice Male C57BL/6 mice (7 weeks old) were purchased (biolink for) and then acclimatized to the breeding room environment for 1 week. At 8 weeks of age, the long hairs of the back of the mice were shaved using a depilator, and the hairs were completely removed using a depilatory agent (including 80% thioglycolic acid). Mice with pink skin color and no skin damage at the hair removal site were selected, randomly divided into experimental groups, and stabilized for one day.
  • a depilatory agent including 80% thioglycolic acid
  • the test group was divided into a negative control group (Saline), T26 administration group (0.6 ⁇ M), and T26-INS001 administration group (0.6 ⁇ M) with 4 mice each.
  • the dose of the sample was administered intradermally in 4 places by dividing 100 ⁇ l of the total by 25 ⁇ l, and the dosing frequency was performed once a day at the same time.
  • the duration of the experiment was 29 days. During the test period, pictures were taken every 3 days, and from the 15th day when hair growth started, it was performed every day.
  • the T26 and T26-INS001 administration groups had a distinct effect on hair growth.
  • hair growth was observed in about 60% of the hair removal area in the negative control group at the end of the experiment, but hair growth in the 60% area was observed in the T26 administration group on the 24th day, 5 days earlier.
  • hair growth was observed in 60% of the area on the 21st day, 8 days earlier, and on the end of the experiment, all 4 mice had a similar level of hair to that before hair removal.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • Genetics & Genomics (AREA)
  • Molecular Biology (AREA)
  • Biophysics (AREA)
  • Biochemistry (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Dermatology (AREA)
  • Zoology (AREA)
  • Toxicology (AREA)
  • Immunology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Engineering & Computer Science (AREA)
  • Epidemiology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Endocrinology (AREA)
  • Birds (AREA)
  • Microbiology (AREA)
  • Mycology (AREA)
  • Peptides Or Proteins (AREA)
  • Biomedical Technology (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Biotechnology (AREA)
  • General Engineering & Computer Science (AREA)
  • Wood Science & Technology (AREA)
  • Physics & Mathematics (AREA)
  • Plant Pathology (AREA)

Abstract

본 발명은 테스토스테론에 결합하는 어피바디 및 이의 용도에 관한 것이다. 본 발명의 어피바디, 또는 어피바디와 오스테오폰틴 단편의 복합체는 발모 또는 탈모 방지효과가 매우 우수한 바, 발모제 또는 탈모 치료제로서 유용하게 사용될 수 있다.

Description

테스토스테론-특이적 어피바디 및 이의 용도
본 특허출원은 2020년 10월 13일에 대한민국 특허청에 제출된 대한민국 특허출원 제10-2020-0132203호에 대하여 우선권을 주장하며, 상기 특허출원의 개시사항은 본 명세서에 참조로서 삽입된다.
본 발명은 테스토스테론에 특이적인 어피바디 및 이의 용도에 관한 것이다.
탈모란 유전적 요인, 노화, 스트레스, 영양 불균형, 남성호르몬 등 다양한 원인에 의하여 머리카락 또는 체모가 손실되는 질환을 말한다. 탈모의 종류로는 만성 탈모인 남성형 탈모(androgenic alopecia), 외상성 탈모, 화학적 탈모 등이 있다. 현재까지 미국 식품의약청(FDA)에서 허가된 탈모 치료제로는 미녹시딜(Minoxidil)과 피나스테라이드(Finasteride) 두 종류가 있다. 미녹시딜의 모발성장 기전은 아직 정확히 밝혀지지 않았으나 혈관내피 성장인자(VEGF, vascular
endothelial growth factor)의 발현을 증가시켜 모유두 세포(dermal papilla cell)에 영양분 공급을 촉진하는 효과와 관련이 있는 것으로 알려져 있다. 피나스테라이드는 남성형 탈모와 전립선 비대증의 원인이 되는 DHT (dihydrotestosterone)의 생성을 억제하는 물질로서, 5-alpha-reductase의 기능을 차단하는 역할을 한다. 그러나, 도포용 제제인 미녹시딜과 경구용 치료제인 피나스테라이드는 모두 가임기 여성과 임산부에는 사용할 수 없으며, 특히 피나스테라이드는 경구용 제제로서 피나스테라이드 복용시 테스토스테론의 DHT로의 전환을 전신적으로 억제하여 성기능 저하 등 부작용이 크다는 문제가 있다. 또한, 실질적으로 탈모의 치료를 위해서, 탈모 환자에게는 모유두 세포 주변의 혈관내피 성장인자를 증가시키는 미녹시딜과 5-alpha-reductase를 차단하는 피나스테라이드를 모두 처방하고 있어, 탈모 환자가 두 가지 약물을 별도로 투여하여야 하므로 사용상의 불편함을 겪고 있다. 이에 전신적 부작용이 적으면서도 약물 투여상의 불편함을 개선할 수 있는 새로운 탈모 치료제 개발에 대한 요구가 점차 증가하고 있는 실정이다.
본 명세서 전체에 걸쳐 다수의 논문 및 특허문헌이 참조되고 그 인용이 표시되어 있다. 인용된 논문 및 특허문헌의 개시 내용은 그 전체로서 본 명세서에 참조로 삽입되어 본 발명이 속하는 기술 분야의 수준 및 본 발명의 내용이 보다 명확하게 설명된다.
본 발명자들은 상기와 같은 기존 탈모 치료제의 부작용과 사용상의 불편함을 개선하고 탈모 치료 효과가 우수한 신규한 탈모 치료제를 개발하고자 예의 연구 노력하였다. 그 결과 유리 테스토스테론과 결합하는 신규한 결합 폴리펩타이드 (어피바디, affibody) 및 이를 혈관생성 촉진 폴리펩타이드(pro-angiogenic polypeptide)와 결합한 복합체를 개발하고, 이들의 발모 또는 탈모 치료 효과가 우
수함을 규명함으로써, 본 발명을 완성하게 되었다.
따라서, 본 발명의 목적은 테스토스테론에 특이적으로 결합하는 폴리펩타이드를 제공하는 것이다.
본 발명의 다른 목적은 상기 폴리펩타이드 및 적어도 하나의 혈관생성촉진 폴리펩타이드(pro-angiogenic polypeptide)를 포함하는 복합체를 제공하는 것이다.
본 발명의 또 다른 목적은 상기 폴리펩타이드, 또는 복합체를 유효성분으로 포함하는 모발 성장 자극용 또는 탈모치료용 약제학적 조성물을 제공하는 것이다.
본 발명의 또 다른 목적은 상기 폴리펩타이드, 또는 복합체를 유효성분으로 포함하는 모발 성장 자극용 화장료 조성물을 제공하는 것이다.
본 발명에서 '어피바디(Affibody)' 분자는 황색포도상구균(Staphylococcus aureus)의 단백질 A(Protein A) 중 IgG에 친화성이 있는 부위인 Z-도메인 (Z-domain)으로, 58개의 아미노산 잔기로 이루어진 작은 단백질이다. 이러한 어피바디 분자의 단백질 서열에서 IgG와 결합면을 형성하는 14개의 아미노산은 아미노산 서열에 따라 다양한 타겟 항원에 대한 결합이 가능하며, 무작위적인 배열이 가능하여 라이브러리(library)를 구축할 수 있다. 어피바디 분자는 항체와 유사하게 라이브러리로부터 파아지 디스플레이(phage display), 효모단백질 잡종법(yeast two hybrid, Y2H) 등의 스크리닝 방법을 통해서 다양한 타겟 항원에 대하여 결합할 수 있는 어피바디 분자들을 선별할 수 있다. 타겟 항원과 결합이 가능한 어피바디 분자의 특성을 이용하여 최근 HER2 및 아밀로이드 베타(amyloid-beta)에 특이적으로 결합하는 어피바디가 개발된 바 있다(Orlova et al. 2006, Cancer Res., Gronwall et al., 2007, J. Biotechnol.). 또한, 어피바디는 분자량이 6 kDa으로 매우 작아, 일반적으로 150 kDa의 분자량을 가진 IgG 형태의 항체와 비교하여 인체 투여 시 전신적으로 확산되고, 신장여과로 빠르게 제거되는 특징이 있다. 따라서, 어피바디는 주로 진단시료 연구개발에 응용되고 있다(Goldstein R et al., 2013, Expert Rev Anticancer Ther.). 어피바디는 일반 IgG와 결합된 이중항체의 형태로도 개발되어지고 있다(Yu F et al., 2014, MAbs).
제1 세대 Z 변이체에 기반한 폴리펩타이드 스캐폴드에 관한 발명이 PCT 공개공보 WO95/19374에 개시된 바 있고, 제2 세대 Z 변이체에 기반한 폴리펩타이드 스캐폴드에 관한 발명이 PCT 공개공보 WO2009/080811에 개시된 바 있다.
본 발명의 일 양태에 따르면, 본 발명은 하기 서열번호 1의 아미노산 서열과 적어도 94%의 서열 상동성을 가지는 아미노산 서열을 포함하고, 테스토스테론에 특이적으로 결합하는 폴리펩타이드를 제공한다:
VDNKFNKEMVQAMREISYLPNLNHTQIRAFIWVLFDDPSQSANLLAEAKKLNDAQAPK (서열번호 1).
상기 폴리펩타이드는 상기한 어피바디(Affibody®) 분자로 이루어진다.
본 명세서에서 용어 "친화성(affinity)"은 특정 대상에 대하여 특이적으로 결합하려고 하는 성질 또는 능력을 의미한다. 본 발명과 같은 생물학 분야에서는 특정 물질 간, 예컨대 효소와 기질이 결합하는 능력, 항체가 항원과 결합하는 능력 등 결합력의 강도를 나타내는 용어로 사용된다.
본 명세서에서 용어 "아미노산(amino acid)"은 단백질 분자의 가장 기본적인 구성 단위를 의미한다. 아미노산의 구조를 보면 탄소 원자 1개에 아미노기(-NH2)와 카르복실기(-COOH)가 붙어 있으며 여기에 수소와 R기가 연결되어 있다.
또한, 본 명세서에서 용어 "단백질(protein)"은 모든 생물의 몸을 구성하는 고분자 유기물로서 수많은 아미노산의 연결체이다. 천연 아미노산에는 20여 종류가 있는데, 이 아미노산들이 펩타이드 결합이라고 하는 화학결합으로 서로 연결되어 길게 측쇄형으로 된 것을 폴리펩타이드(polypeptide)라고 한다. 본 발명의 폴리펩타이드는 당 업계에 공지된 합성 방법, 예를 들어 단백질을 발현하는 핵산분자를 포함하는 발현벡터를 숙주세포에 형질전환하여 재조합 단백질을 합성하거나, 고체상 합성 기술(solid-phase synthesis techniques)에 따라 제조될 수 있다(Merrifield, J. Amer. Chem. Soc. 85:2149-54(1963); Stewart, et al., Solid Phase Peptide Synthesis, 2nd. ed., Pierce Chem. Co.: Rockford, 111(1984)).
본 발명의 테스토스테론에 특이적으로 결합하는 폴리펩타이드는 통상의 기술자가 인지하는 바와 같이, 테스토스테론을 특이적으로 인식할 수 있는 범위 내에서 아미노산 서열의 변이체를 포함할 수 있다. 예를 들면, 상기 테스토스테론에 특이적으로 결합하는 폴리펩타이드의 결합 친화도 및/또는 기타 생물학적 특성을 개선시키기 위하여 폴리펩타이드의 아미노산 서열에 변화를 줄 수 있다. 이러한 변형은, 예를 들어 폴리펩타이드의 아미노산 서열 잔기의 결실, 삽입 및/또는 치환을 포함한다.
상기 변이체는 "실질적 유사성"을 가지는 것으로, 2개의 펩타이드 서열이 디폴트 갭 가중치를 사용하는 프로그램 GAP 또는 BESTFIT에 의해서와 같이 최적으로 정렬되는 경우에 적어도 약 90%의 서열 동일성, 더욱 바람직하게는 적어도 약 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% 또는 99%의 서열 동일성을 공유함을 의미한다. 바람직하게는, 동일하지 않은 잔기 위치는 보존적 아미노산 치환에 의해 상이하다. "보존적 아미노산 치환"은 아미노산 잔기가 유사한 화학적 특성(예: 전하 또는 소수성)을 갖는 측쇄(R 기)를 갖는 또 다른 아미노산 잔기에 의해 치환된 것이다. 일반적으로, 보존적 아미노산 치환은 단백질의 기능성을 실질적으로 변화시키지 않는다.
이러한 아미노산 변이는 아미노산 곁사슬 치환체의 상대적 유사성, 예컨대, 소수성, 친수성, 전하, 크기 등에 기초하여 이루어진다. 아미노산 곁사슬 치환체의 크기, 모양 및 종류에 대한 분석에 의하여, 아르기닌, 라이신과 히스티딘은 모두 양전하를 띤 잔기이고; 알라닌, 글라이신과 세린은 유사한 크기를 갖으며; 페닐알라닌, 트립토판과 타이로신은 유사한 모양을 갖는다는 것을 알 수 있다. 따라서, 이러한 고려 사항에 기초하여, 아르기닌, 라이신과 히스티딘; 알라닌, 글라이신과 세린; 그리고 페닐알라닌, 트립토판과 타이로신은 생물학적으로 기능 균등물이라 할 수 있다.
변이를 도입하는 데 있어서, 아미노산의 소수성 인덱스(hydropathic idex)가 고려될 수 있다. 각각의 아미노산은 소수성과 전하에 따라 소수성 인덱스가 부여되어 있다: 아이소루이신(+4.5); 발린(+4.2); 루이신(+3.8); 페닐알라닌(+2.8); 시스테인/시스타인(+2.5); 메티오닌(+1.9); 알라닌(+1.8); 글라이신(-0.4); 쓰레오닌(-0.7); 세린(-0.8); 트립토판(-0.9); 타이로신(-1.3); 프롤린(-1.6); 히스티딘(-3.2); 글루타메이트(-3.5); 글루타민(-3.5); 아스파르테이트(-3.5); 아스파라긴(-3.5); 라이신(-3.9); 및 아르기닌(-4.5).
단백질의 상호적인 생물학적 기능(interactive biological function)을 부여하는 데 있어서 소수성 아미노산 인덱스는 매우 중요하다. 유사한 소수성 인덱스를 가지는 아미노산으로 치환하여야 유사한 생물학적 활성을 보유할 수 있다는 것은 공지된 사실이다. 소수성 인덱스를 참조하여 변이를 도입시키는 경우, 바람직하게는 ± 2 이내, 보다 바람직하게는 ± 1 이내, 보다 더 바람직하게는 ± 0.5 이내의 소수성 인덱스 차이를 나타내는 아미노산 사이에서 치환을 한다.
한편, 유사한 친수성 값(hydrophilicity value)을 가지는 아미노산 사이의 치환이 균등한 생물학적 활성을 갖는 단백질을 초래한다는 것도 잘 알려져 있다. 미국 특허 제4,554,101호에 개시된 바와 같이, 다음의 친수성 값이 각각의 아미노산 잔기에 부여되어 있다: 아르기닌(+3.0); 라이신(+3.0); 아스팔테이트(+3.0± 1); 글루타메이트(+3.0± 1); 세린(+0.3); 아스파라긴(+0.2); 글루타민(+0.2); 글라이신(0); 쓰레오닌(-0.4); 프롤린(-0.5 ± 1); 알라닌(-0.5); 히스티딘(-0.5); 시스테인(-1.0); 메티오닌(-1.3); 발린(-1.5); 루이신(-1.8); 아이소루이신(-1.8); 타이로신(-2.3); 페닐알라닌(-2.5); 트립토판(-3.4).
친수성 값을 참조하여 변이를 도입시키는 경우, 바람직하게는 ± 2 이내, 보다 바람직하게는 ± 1 이내, 보다 더 바람직하게는 ± 0.5 이내의 친수성 값 차이를 나타내는 아미노산 사이에서 치환을 한다.
분자의 활성을 전체적으로 변경시키지 않는 단백질에서의 아미노산 교환은 당해 분야에 공지되어 있다(H. Neurath, R.L.Hill, The Proteins, Academic Press, New York, 1979). 가장 통상적으로 일어나는 교환은 아미노산 잔기 Ala/Ser, Val/Ile, Asp/Glu, Thr/Ser, Ala/Gly, Ala/Thr, Ser/Asn, Ala/Val, Ser/Gly, Thy/Phe, Ala/Pro, Lys/Arg, Asp/Asn, Leu/Ile, Leu/Val, Ala/Glu, Asp/Gly 간의 교환이다.
본 발명의 일 구현예에 있어서, 본 발명의 테스토스테론에 특이적으로 결합하는 폴리펩타이드는 서열번호 1의 아미노산 서열과 적어도 94%의 서열 상동성(예컨대 94%, 95%, 96%, 97, 98%, 또는 99%)을 가지는 서열을 포함한다. 상기 94% 이상 100% 이하의 모든 정수 및 이 사이의 존재하는 소수는 % 상동성과 관련하여 본 발명의 범위 내에 포함된다.
본 발명의 일 구현예에 있어서, 본 발명의 테스토스테론에 특이적으로 결합하는 폴리펩타이드는 하기 아미노산 서열 중 11번째 아미노산 잔기 Q, 17번째 아미노산 잔기 S, 및 25번째 아미노산 잔기 T 중 1 이상의 아미노산 잔기가 서로 독립적으로 임의의 아미노산 잔기로 치환된 것이다:
VDNKFNKEMV Q AMREI S YLPNLNH T QIRAFIWVLFDDPSQSANLLAEAKKLNDAQAPK.
본 발명의 다른 구현예에 있어서, 본 발명의 테스토스테론에 특이적으로 결합하는 폴리펩타이드는 서열번호 1의 아미노산 서열과 적어도 98%의 서열 상동성을 가지는 아미노산 서열을 포함한다.
본 발명의 구체적인 구현예에 있어서, 본 발명의 테스토스테론에 특이적으로 결합하는 폴리펩타이드는 하기 아미노산 서열 중 11번째 아미노산 잔기 Q, 17번째 아미노산 잔기 S, 또는 25번째 아미노산 잔기 T가 아미노산 잔기 A로 치환된 아미노산 서열을 포함한다:
VDNKFNKEMV Q AMREI S YLPNLNH T QIRAFIWVLFDDPSQSANLLAEAKKLNDAQAPK.
본 발명의 다른 구체적인 구현예에 있어서, 본 발명의 테스토스테론에 특이적으로 결합하는 폴리펩타이드는 서열번호 5 내지 7, 9 내지 14, 16, 및 20 내지 22로 이루어진 군으로부터 선택된 어느 하나의 아미노산 서열을 포함한다.
본 발명의 또 다른 구체적인 구현예에 있어서, 본 발명의 테스토스테론에 특이적으로 결합하는 폴리펩타이드는 하기 아미노산 서열 중 밑줄로 표시한 아미노산 잔기를 모두 포함한다:
VDNKFNKE MVQ A MR EI SY LPNLN HT Q IR AFI WV L F DDPSQSANLLAEAKKLNDAQAPK.
상기 밑줄로 표시한 아미노산 잔기의 위치는 어피바디(affibody)로 알려진 58개의 아미노산 서열로 이루어진 타겟 결합 폴리펩타이드에 있어서, 타겟에 특이적으로 결합하는 위치의 아미노산 잔기이다. 상기 위치의 아미노산 잔기는 마치 항체의 상보성 결정부위(CDR, complementarity-determining region)와 같은 역할을 수행한다. 어피바디는 58개의 아미노산 서열 중 상기 위치의 아미노산 잔기를 변경함으로써 다양한 타겟에 결합하는 폴리펩타이드로 제조될 수 있다. 상기 밑줄 친 위치의 아미노산 잔기 외의 아미노산 서열은 어피바디의 세 개의 나선형 폴리펩타이드 구조(triple helix polypetide structure)를 유지하는 역할을 수행한다. 따라서, 본 발명의 일 구현예에 있어서, 본 발명의 테스토스테론에 특이적으로 결합하는 폴리펩타이드는 상기 밑줄로 표시한 아미노산 잔기와 동일한 위치 및 종류의 아미노산 서열을 포함하는 다른 스캐폴드 서열로 이루어진, 어피바디 분자를 포함한다.
본 발명의 다른 일 양태에 따르면, 본 발명은 상기 테스토스테론에 특이적으로 결합하는 폴리펩타이드 및 적어도 하나의 혈관신생촉진 폴리펩타이드(angiogenic polypeptide)를 포함하는 복합체를 제공한다.
이 경우 상기 폴리펩타이드 복합체는 각각의 폴리펩타이드 단량체가 연결된 다량체 형태이다. 상기 본 발명의 폴리펩타이드 복합체에 있어서, 각 폴리펩타이드는 서로 공유결합으로 연결되며, 본 발명의 일 구현예에 따르면, 상기 복합체는 융합 단백질(fused protein) 또는 컨쥬게이트의 형태로 구현될 수 있다.
본 발명의 일 구현예에 있어서, 상기 혈관신생촉진 폴리펩타이드는 오스테오폰틴 또는 이의 단편을 포함한다.
본 발명의 구체적인 구현예에 있어서, 상기 오스테오폰틴의 단편은 서열번호 66의 아미노산 서열(SVVYGLR)을 포함한다. 상기 서열번호 66의 아미노산 서열(SVVYGLR)은 오스테오폰틴의 트롬빈(thrombin)에 의해 절단된 에피토프(cleaved epitope)이다.
본 발명의 다른 구체적인 구현예에 있어서, 상기 오스테오폰틴의 단편은 상기 트롬빈에 의해 절단된 에피토프인 SVVYGLR (OPN-R)을 포함할 수 있으며, 예컨대 GRGDSVVYGLRS, GRGDSVVYGLR, RGDSVVYGLR, SVVYGLRS, 또는 RGDSVVYGLR이다. 본 발명의 또 다른 구체적인 구현예에 있어서, 상기 오스테오폰틴의 단편은 carboxypeptidase B (CPB)에 의해 C-말단의 아르기닌이 추가로 절단되어 형성된 OPN-L (SVVYGL)일 수 있다.
상기 오스테오폰틴의 단편 및 이들의 아미노산 서열은 상술한 혈관신생 촉진 폴리펩타이드의 실례 중 하나로 사용한 것이며, 따라서 범위를 한정하는 것으로 해석되지 않아야 한다. 따라서 본 발명의 복합체에 포함되는 혈관신생 촉진 폴리펩타이드는 적합한 혈관신생 촉진 기능을 가지는 어떤 다른 폴리펩타이드일 수 있다.
본 발명의 일 구현예에 있어서, 테스토스테론에 특이적으로 결합하는 폴리펩타이드 및 적어도 하나의 혈관신생촉진 폴리펩타이드(angiogenic polypeptide)를 포함하는 복합체를 구성하는 혈관신생촉진 폴리펩타이드(예컨대 오스테오폰틴의 단편)는, 상기 테스토스테론-결합 폴리펩타이드(testosterone-binding polypeptide) (i.e. 어피바디 분자)의 N-말단 및/또는 C-말단에, 보다 구체적으로는 N-말단 또는 C-말단에, 가장 구체적으로는 C-말단에 융합되어 연결될 수 있으나 이에 한정되는 것은 아니다. 그러나 테스토스테론-결합 폴리펩타이드의 C-말단에 융합되어 연결되는 것이 혈관신생 촉진효과 면에서 바람직하다.
본 발명의 일 구현예에 있어서, 상기 폴리펩타이드 복합체에서 테스토스테론-결합 폴리펩타이드 및 혈관신생 촉진 폴리펩타이드는 직접적으로 연결되거나, 또는 링커(예컨대 아미노산 링커)를 통해 간접적으로 연결될 수 있다.
통상의 기술자라면, 융합 단백질의 제작 시 보통 융합하고자하는 기능적 일부분(moiety) 사이에 링커를 사용하는 것을 포함할 수 있으며, 서로 다른 특성을 가진 다른 종류의 링커, 예를 들어 유연성 아미노산 링커, 비유연성 링커 및 절단 가능한 아미노산 링커가 있다는 것을 알고 있을 것이다. 링커는 융합단백질의 발현량 증가, 생물학적 활성 향상, 타겟팅을 가능하게 하거나, 약동학을 변경시키기 위한 목적으로, 또는 융합단백질의 안정성을 증가시키고 폴딩을 향상시키기 위해 사용되어 왔다.
따라서 본 발명의 구체적인 구현예에 따르면, 상기 복합체는 적어도 하나의 링커, 예컨대 유연성 아미노산 링커, 비유연성 링커 및 절단 가능한 아미노산 링커로부터 선택되는 적어도 하나의 링커를 더 포함할 수 있다. 본 발명의 가장 구체적인 일 구현예에 따르면, 상기 링커는 상기 어피바디 분자와 상기 항체 또는 항원 결합 단편의 사이에 배열된다.
본 발명의 또 다른 구현예에 따르면, 상기 복합체는 C-말단 및/또는 N-말단에 적어도 하나의 추가적인 아미노산을 포함할 수 있다. 상기의 추가적인 아미노산 잔기는 예를 들어, 생산성, 정제, 생체 내 또는 생체 외에서의 안정화, 복합체의 커플링 또는 검출을 향상시키기 위한 목적으로 개별적 또는 집합적으로 추가될 수 있다. 예컨대 상기 복합체는 상기 복합체의 C-말단 및/또는 N-말단에 시스테인 잔기가 추가될 수 있다. 추가적인 아미노산 잔기는 정제 또는 폴리펩타이드의 검출을 위한 "태그(tag)"를 제공할 수도 있으며, 예를 들어 그 태그에 특이적인 항체와의 상호작용을 위한 것이거나, 또는 His6 태그의 경우 고정화된 금속 친화성 크로마토그래피(IMAC)를 위하여 His6 태그, (HisGlu)3 태그 ("HEHEHE" tag) 또는 "myc"(c-myc) 태그 또는 "FLAG" 태그와 같은 태그를 제공할 수 있다.
상술한 바와 같은 추가적인 아미노산은 본 명세서에서 정의된 i) 테스토스테론-결합 폴리펩타이드, 또는 ii) 테스토스테론-결합 폴리펩타이드와 혈관신생 촉진 폴리펩타이드의 복합체에 화학적 컨쥬게이션에 의해 연결되거나, 또는 융합 단백질로서 발현될 수 있고, 직접적으로 또는 링커(예컨대, 아미노산 링커)를 통해 간접적으로 연결될 수 있다.
본 발명의 일 구현예에 있어서, 상기 복합체의 i) 테스토스테론-결합 폴리펩타이드와 ii) 혈관신생 촉진 폴리펩타이드는 적어도 하나의 링커로 연결된다.
이 경우 상기 링커는 일반식 (GnSm)p 또는 (SmGn)p로 표시되는 아미노산 서열로 이루어질 수 있다:
여기에서 상기 n, m 및 p는 독립적으로,
n은 1 내지 7의 정수이고;
m은 0 내지 7의 정수이며;
n과 m의 합은 8이하의 정수이고; 및
p는 1 내지 7의 정수이다.
본 발명의 다른 구현예에 있어서, 상기 링커는 n = 1 내지 5이고, m = 0 내지 5이다. 또 다른 구현예의 경우, 상기 링커는 GGGGS이다. 또 다른 구체적인 구현예의 경우, 상기 링커는 GGGG이다.
본 발명의 또 다른 구현예에 있어서, 상기 링커는 VDGS 또는 ASGS 등이 될 수 있으나, 이에 한정되는 것은 아니다.
본 발명의 또 다른 일 양태에 따르면, 본 발명은 상기한 i) 테스토스테론-결합 폴리펩타이드, 또는 ii) 테스토스테론-결합 폴리펩타이드와 혈관신생 촉진 폴리펩타이드를 포함하는 복합체를 인코딩하는 뉴클레오타이드 서열로 이루어진 핵산 분자를 제공한다.
본 명세서에서, 용어 "핵산(nucleic acids)"은 DNA(gDNA 및 cDNA) 그리고 RNA 분자를 포괄적으로 포함하는 의미를 가지며, 핵산 분자에서 기본 구성 단위인 뉴클레오타이드는 자연의 뉴클레오타이드 뿐만 아니라, 당 또는 염기 부위가 변형된 유사체(analogue)도 포함한다(Scheit, Nucleotide Analogs, John Wiley, New York(1980); Uhlman 및 Peyman, Chemical Reviews, 90:543-584(1990)).
본 발명의 일 구현예에 있어서, 본 발명의 상기 폴리펩타이드 또는 상기 복합체를 인코딩하는 뉴클레오타이드 서열은 상기 폴리펩타이드 또는 상기 복합체를 구성하는 아미노산 서열을 인코딩하는 뉴클레오타이드 서열인 것으로 충분하며, 어느 특정 뉴클레오타이드 서열에 한정되지 않는다는 것은 당업자에게 자명하다.
이는 뉴클레오티드 서열의 변이가 발생하더라도 변이된 뉴클레오타이드 서열을 단백질로 발현하면 단백질 서열에서 변화를 가져오지 않는 경우도 있기 때문이다. 이를 코돈의 축퇴성이라고 한다. 따라서 상기 뉴클레오타이드 서열은 기능적으로 균등한 코돈 또는 동일한 아미노산을 인코딩하는 코돈 (예를 들어, 코돈의 축퇴성에 의해, 아르기닌 또는 세린에 대한 코돈은 여섯 개이다), 또는 생물학적으로 균등한 아미노산을 인코딩하는 코돈을 포함하는 뉴클레오타이드 서열을 포함한다.
상술한 생물학적 균등 활성을 갖는 변이를 고려한다면, 본 발명의 폴리펩타이드 또는 복합체를 인코딩하는 핵산 분자는 서열목록에 기재된 서열과 실질적인 동일성(substantial identity)을 나타내는 서열도 포함하는 것으로 해석된다. 상기의 실질적인 동일성은, 상기한 본 발명의 서열과 임의의 다른 서열을 최대한 대응되도록 얼라인하고, 당업계에서 통상적으로 이용되는 알고리즘을 이용하여 얼라인된 서열을 분석한 경우에, 적어도 60% 이상의 상동성(예컨대, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 또는 69%), 보다 바람직하게는 적어도 70% 이상의 상동성(예컨대, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 또는 79%), 보다 더 바람직하게는 적어도 80% 이상(예컨대, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 또는 89%)의 상동성, 가장 바람직하게는 90% 이상(예컨대, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 또는 100%)의 상동성을 나타내는 서열을 의미한다. 상기 70% 이상 100% 이하의 모든 정수 및 이 사이의 소수는 % 상동성과 관련하여 본 발명의 범위 내에 포함된다.
서열비교를 위한 얼라인먼트 방법은 당업계에 공지되어 있다. 얼라인먼트에 대한 다양한 방법 및 알고리즘은 Smith and Waterman, Adv. Appl. Math. 2:482(1981); Needleman and Wunsch, J. Mol. Bio. 48:443(1970); Pearson and Lipman, Methods in Mol. Biol. 24: 307-31(1988); Higgins and Sharp, Gene 73:237-44(1988); Higgins and Sharp, CABIOS 5:151-3(1989); Corpet et al., Nuc. Acids Res. 16:10881-90(1988); Huang et al., Comp. Appl. BioSci. 8:155-65(1992) and Pearson et al., Meth. Mol. Biol. 24:307-31(1994)에 개시되어 있다. NCBI Basic Local Alignment Search Tool(BLAST)(Altschul et al., J. Mol. Biol. 215:403-10(1990))은 NBCI(National Center for Biological Information) 등에서 접근 가능하며, 인터넷 상에서 blastp, blastn, blastx, tblastn 및 tblastx와 같은 서열 분석 프로그램과 연동되어 이용할 수 있다. BLAST는 ncbi 웹사이트의 BLAST 페이지를 통하여 접속 가능하다. 이 프로그램을 이용한 서열 상동성 비교 방법은 ncbi 웹사이트의 BLAST help 페이지에서 확인할 수 있다.
본 발명의 또 다른 일 양태에 있어서, 본 발명은 상술한 테스토스테론-결합 폴리펩타이드 또는 복합체를 인코딩하는 뉴클레오타이드 서열을 포함하는 재조합 벡터를 제공한다.
본 발명의 또 다른 일 양태에 있어서, 본 발명은 상술한 재조합 벡터를 포함하는 숙주세포를 제공한다.
본 발명의 일 구현예에 있어서, 상기 벡터는 상술한 테스토스테론-결합 폴리펩타이드 또는 복합체를 인코딩하는 뉴클레오타이드 서열과 작동적으로 결합(operatively linked) 된다.
본 명세서에서 용어 "작동적으로 결합(operatively linked)"은 핵산 발현 조절 서열(예: 프로모터, 시그널 서열, 또는 전사조절인자 결합 위치의 어레이)과 다른 핵산 서열사이의 기능적인 결합을 의미하며, 이에 의해 상기 조절 서열은 상기 다른 핵산 서열의 전사 및/또는 해독(translation)을 조절하게 된다.
본 발명의 벡터 시스템은 당업계에 공지된 다양한 방법을 통해 구축될 수 있으며, 이에 대한 구체적인 방법은 Sambrook, et al., Molecular Cloning, A Laboratory Manual, Cold Spring Harbor Laboratory Press(2001)에 개시되어 있으며, 이 문헌은 본 명세서에 참조로서 삽입된다.
본 발명의 벡터는 전형적으로 클로닝을 위한 벡터 또는 발현을 위한 벡터로서 구축될 수 있다. 또한, 본 발명의 벡터는 원핵 세포 또는 진핵 세포를 숙주로 하여 구축될 수 있다.
예를 들어, 본 발명의 벡터가 발현 벡터이고, 원핵 세포를 숙주로 하는 경우에는, 전사를 진행시킬 수 있는 강력한 프로모터(예컨대, pLλ 프로모터, trp 프로모터, lac 프로모터, T7 프로모터, tac 프로모터 등), 해독의 개시를 위한 라이보좀 결합 자리 및 전사/해독 종결 서열을 포함하는 것이 일반적이다. 숙주 세포로서 E. coli가 이용되는 경우, E. coli 트립토판 생합성 경로의 프로모터 및 오퍼레이터 부위(Yanofsky, C., J. Bacteriol., 158:1018-1024(1984)) 그리고 파아지 λ의 좌향 프로모터(pLλ 프로모터, Herskowitz, I. and Hagen, D., Ann. Rev. Genet., 14:399-445(1980))가 조절 부위로서 이용될 수 있다.
한편, 본 발명에 이용될 수 있는 벡터는 당업계에서 종종 사용되는 플라스미드(예: pSK349, pSC101, ColE1, pBR322, pUC8/9, pHC79, pGEX 시리즈, pET 시리즈 및 pUC19 등), 파지(예: λgt·λ4B, λ-Charon, λ△z1 및 M13 등) 또는 바이러스(예: SV40 등)를 조작하여 제작될 수 있다.
본 발명의 벡터는 그로부터 발현되는 폴리펩타이드의 정제를 용이하게 하기 위하여, 다른 서열과 융합될 수도 있다. 융합되는 서열은 예컨대, 글루타티온 S-트랜스퍼라제(Pharmacia, USA), 말토스 결합 단백질(NEB, USA), FLAG(IBI, USA) 및 6x His(hexahistidine; Quiagen, USA) 등이 있다. 상기 정제를 위한 추가적인 서열 때문에, 숙주에서 발현된 단백질은 친화성 크로마토그래피를 통하여 신속하고, 용이하게 정제된다.
본 발명의 벡터는 선택표지로서, 당업계에서 통상적으로 이용되는 항생제 내성 유전자를 포함할 수 있으며, 예를 들어 암피실린, 겐타마이신, 카베니실린, 클로람페니콜, 스트렙토마이신, 카나마이신, 게네티신, 네오마이신 및 테트라사이클린에 대한 내성 유전자가 있다.
한편, 본 발명의 벡터가 발현 벡터이고, 진핵 세포를 숙주로 하는 경우에는, 포유동물 세포의 지놈으로부터 유래된 프로모터(예: 메탈로티오닌 프로모터) 또는 포유동물 바이러스로부터 유래된 프로모터(예: 아데노바이러스 후기 프로모터, 백시니아 바이러스 7.5K 프로모터, SV40 프로모터, 사이토메갈로바이러스 프로모터 및 HSV의 tk 프로모터)가 이용될 수 있으며, 전사 종결 서열로서 폴리아데닐화 서열을 일반적으로 갖는다.
선택적으로, 상기 벡터는 리포터 분자(예: 루시퍼라아제 및 -글루쿠로니다아제)를 코딩하는 유전자를 추가적으로 운반할 수 있다.
본 발명의 벡터를 안정하게 연속적으로 클로닝 및 발현시킬 수 있는 숙주 세포는 당업계에 공지되어있는 어떠한 숙주 세포도 이용할 수 있으며, 예컨대, E. coli Origami2, E. coli JM109, E. coli BL21(DE3), E. coli RR1, E. coli LE392, E. coli B, E. coli X 1776, E. coli W3110와 같은 E.coli 균주, 바실러스 서브틸리스, 바실러스 츄린겐시스와 같은 바실러스 속 균주, 그리고 살모넬라 티피무리움, 세라티아 마르세슨스 및 다양한 슈도모나스 종과 같은 장내균과 균주 등이 있다.
또한, 본 발명의 벡터를 진핵 세포에 형질전환시키는 경우에는 숙주 세포로서, 이스트(Saccharomyce cerevisiae), 곤충 세포 및 동물 세포(예컨대, CHO 세포주(Chinese hamster ovary), W138, BHK, COS-7, 293, HepG2, 3T3, RIN 및 MDCK 세포주) 등이 이용될 수 있다.
본 발명의 일 구현예에 있어서, 본 발명의 상기 벡터를 형질전환시키는 숙주세포는 E. coli이다. 본 발명의 보다 구체적인 구현예에 있어서, 본 발명의 상기 벡터를 형질전환시키는 숙주세포는 ER2537 E. coli와 BL21(DE3)이나, 이에 한정되는 것은 아니다.
본 발명의 벡터를 숙주 세포 내로 운반하는 방법은, 숙주 세포가 원핵 세포인 경우, CaCl2 방법(Cohen, S.N. et al., Proc. Natl. Acac. Sci. USA, 9:2110-2114(1973)), 하나한 방법(Cohen, S.N. et al., Proc. Natl. Acac. Sci. USA, 9:2110-2114(1973); 및 Hanahan, D., J. Mol. Biol., 166:557-580(1983)) 및 전기 천공 방법(Dower, W.J. et al., Nucleic. Acids Res., 16:6127-6145(1988)) 등에 의해 실시될 수 있다. 또한, 숙주세포가 진핵 세포인 경우에는, 미세 주입법(Capecchi, M.R., Cell, 22:479(1980)), 칼슘 포스페이트 침전법(Graham, F.L. et al., Virology, 52:456(1973)), 전기 천공법(Neumann, E. et al., EMBO J., 1:841(1982)), 리포좀-매개 형질감염법(Wong, T.K. et al., Gene, 10:87(1980)), DEAE-덱스트란 처리법(Gopal, Mol. Cell Biol., 5:1188-1190(1985)), 및 유전자 밤바드먼트(Yang et al., Proc. Natl. Acad. Sci., 87:9568-9572(1990)) 등에 의해 벡터를 숙주 세포 내로 주입할 수 있다.
본 발명에서 숙주세포 내로 주입된 재조합 벡터는 숙주 세포 내에서 재조합된 상기의 폴리펩타이드 또는 폴리펩타이드 복합체를 발현할 수 있으며, 이러한 경우에는 다량의 폴리펩타이드 또는 폴리펩타이드 복합체를 얻게 된다. 예를 들어, 상기 발현 벡터가 lac 프로모터를 포함하는 경우에는 숙주 세포에 IPTG를 처리하여 유전자 발현을 유도할 수 있다.
형질전환된 숙주세포의 배양은 공지된 숙주세포 배양 방법 또는 이를 변형한 방법으로 행할 수 있다. 예를 들어, 숙주세포가 대장균(E.coli)인 경우 형질전환 숙주세포의 배양을 위한 배지는 대장균이 효율적으로 이용할 수 있는 탄소원, 질소원, 무기염 등을 포함한다면 천연 배지 또는 합성 배지를 사용할 수 있다. 사용될 수 있는 탄소원은 글루코오스, 프럭토오스, 수크로오스와 같은 탄수화물; 녹말, 녹말의 가수분해물; 아세트산 및 프로피온산과 같은 유기산; 에탄올, 프로판올, 글리세롤과 같은 알코올 등을 포함한다. 질소원은 암모니아; 염화암모늄, 암모늄설페이트, 암모늄아세테이트 및 암모늄포스페이트와 같은 무기산 또는 유기산의 암모늄염; 펩톤, 고기추출물(meat extract), 이스트추출물, 옥수수 침지액, 카제인 가수분해물, 대두추출물, 대두가수분해물; 다양한 발효된 세포 및 이들의 분해물 등을 포함한다. 무기염은 포타슘디하이드로젠 포스페이트, 다이포타슘하이드로젠 포스페이트, 마그네슘 포스페이트, 마그네슘 설페이트, 소디엄 클로라이드, 망간 설페이트, 구리 설페이트, 칼슘 카보네이트 등을 포함한다.
상기 배양은 통상적으로 진탕배양 또는 회전기에 의한 회전에 의한 것과 같은 호기성 조건하에서 행한다. 배양 온도는 바람직하게는 10 내지 40℃의 범위에서 행하고, 배양시간은 일반적으로 5 시간 내지 7 일간 행한다. 배지의 pH는 배양 중에서 바람직하게는 3.0 내지 9.0의 범위를 유지한다. 배지의 pH는 무기 또는 유기산, 알칼리 용액, 우레아, 칼슘 카보네이트, 암모니아 등으로 조절할 수 있다. 배양 중에는 필요한 경우 재조합 벡터의 유지 및 발현을 위해 암피실린, 스트렙토마이신, 클로람페니콜, 카나마이신 및 테트라사이클린과 같은 항생제를 첨가할 수 있다. 유도(induction) 가능한 프로모터를 갖는 재조합 발현 벡터로 형질전환된 숙주세포를 배양하는 경우 필요하다면 배지에 적합한 유도제(inducer)를 첨가할 수 있다. 예를 들어, 발현 벡터가 lac 프로모터를 함유하는 경우 IPTG (isopropyl-β-D-thiogalactopyranoside)를 첨가하고, trp 프로모터를 포함하는 경우 인돌아크릴산(indoleacrylic acid)을 배지에 첨가할 수 있다.
본 발명의 일 양태에 따르면, 본 발명은 (a) 상기한 테스토스테론에 특이적으로 결합하는 폴리펩타이드; 및 (b) 약제학적으로 허용가능한 부형제, 담체, 또는 희석제를 포함하는 모발 성장 자극용 또는 탈모 치료용 약제학적 조성물을 제공한다.
본 발명의 다른 일 양태에 따르면, 본 발명은 (a) 상기한 테스토스테론에 특이적으로 결합하는 폴리펩타이드 및 적어도 하나의 추가적 폴리펩타이드를 포함하는 복합체; 및 (b) 약제학적으로 허용가능한 부형제, 담체, 또는 희석제를 포함하는 모발 성장 자극용 또는 탈모 치료용 약제학적 조성물을 제공한다.
본 발명의 일 양태에 따르면, 상기한 테스토스테론에 특이적으로 결합하는 폴리펩타이드 또는 상기한 복합체를 포함하는 모발 성장 자극용 화장료(미용용) 조성물을 제공한다.
본 발명의 다른 일 양태에 따르면, 본 발명은 상기한 테스토스테론에 특이적으로 결합하는 폴리펩타이드 및 적어도 하나의 추가적 폴리펩타이드를 포함하는 복합체를 포함하는 모발 성장 자극용 화장료(미용용) 조성물을 제공한다.
상기 본 발명의 모발 성장 자극용 또는 탈모 치료용 약제학적/화장료(미용 용도) 조성물의 유효성분이 되는 i) 테스토스테론에 특이적으로 결합하는 폴리펩타이드; 또는 ii) 테스토스테론에 특이적으로 결합하는 폴리펩타이드 및 적어도 하나의 추가적 폴리펩타이드를 포함하는 복합체는 액체상 및 고체상 합성(예를 들어, t-Boc 고체상 펩타이드 합성 및 BOP-SPPS)과 같은, 알려진 수단에 의해 합성될 수 있다.
또한 상기 i) 테스토스테론에 특이적으로 결합하는 폴리펩타이드; 또는 ii) 테스토스테론에 특이적으로 결합하는 폴리펩타이드 및 적어도 하나의 추가적 폴리펩타이드를 포함하는 복합체의 약제학적으로 및/또는 미용적으로 허용가능한 산 또는 염기 부가 염을 포함한다는 것이 당해 기술 분야의 통상의 기술자에게 인식될 것이다. 본 발명에서 유용한 전술된 염기 화합물의 약제학적으로 및/또는 미용적으로 허용가능한 산 부가 염을 제조하는데 사용되는 산은 무독성 산 부가 염, 즉, 다른 것들 중에서, 특히 염산염, 히드로브로마이드, 히드로아이오디드, 나이트레이트, 설페이트, 바이설페이트(bisulphate), 포스페이트, 인산(acid phosphate), 아세테이트, 락테이트, 시트레이트, 시트르산(acid citrate), 타르타레이트, 비타르타레이트(bitartrate), 숙시네이트, 말레에이트, 푸마레이트, 글루코네이트, 사카레이트(saccharate), 벤조에이트, 메탄설포네이트, 에탄설포네이트, 벤젠설포네이트, p-톨루엔설포네이트 및 파모에이트 [즉, 1,1'-메틸렌-비스-(2-히드록시-3 나프토에이트)] 염과 같은, 약제학적으로 및/또는 미용적으로 허용가능한 음이온을 함유하는 염을 형성하는 것이다. 약제학적으로 및/또는 미용적으로 허용가능한 염기 부가 염은 또한 상기 폴리펩타이드 또는 복합체의 약제학적으로 및/또는 미용적으로 허용가능한 염 형태를 생성하는데 사용될 수 있다.
본 발명의 상기 폴리펩타이드 또는 복합체는 보관을 위해 동결건조(lyophilise)될 수 있고 사용 전 적절한 담체로 재구성될(reconstituted) 수 있다.
상기 폴리펩타이드 또는 복합체는 의도된 투여 경로 및 표준 약제학적 또는 미용적 적용에 관련하여 선택되는, 약제학적으로 허용가능한 및/또는 미용적으로 허용가능한 부형제, 담체 또는 희석제를 포함하는 조성물의 형태로 제공된다(예를 들어, 본 명세서 참조로 포함되는, Remington: The Science and Practice of Pharmacy, 19th edition, 1995, Ed. Alfonso Gennaro, Mack Publishing Company, Pennsylvania, USA 참조).
"약제학적으로 허용가능한(pharmaceutically acceptable)"은 제제가 멸균이고 발열원(pyrogen)이 없는 것이다. 적절한 약제학적 담체는 약제학 분야에서 잘 알려져 있다. 상기 담체(들)은 본 발명의 유효성분의 효능에 악영향을 미치지 않고 그의 수용자(recipient)에게 해롭지 않다는 의미에서 "허용가능(acceptable)"해야 한다. 전형적으로, 상기 담체는 멸균되고 발열원이 없는 물 또는 식염수일 것이다; 그러나, 다른 허용가능한 담체가 사용될 수 있다. 따라서, "약제학적으로 허용가능한 담체(pharmaceutically acceptable carrier)" 및 "약제학적으로 허용가능한 부형제(pharmaceutically acceptable excipient)"는 단순히 담체로서 작용하도록 의도된, 즉, 그 자체의 생물학적 활성을 갖는 것으로 의도되지 않는, 제제의 일부를 형성하는데 사용된 화합물(들)을 포함한다. 약제학적으로 허용가능한 담체 또는 부형제는 일반적으로 안전하고, 무독성이다. 본 명세서에 사용된 것과 같은 약제학적으로 허용가능한 담체 및/또는 부형제는 1 이상의 담체 및/또는 부형제를 모두 포함한다.
마찬가지로, 용어 "미용적으로 허용가능한(cosmetically acceptable)"은 화장품으로서 사용하기에 적절한 제제를 나타내는데 사용된다. 적절한 미용적 담체는 샴푸, 로션, 크림, 스프레이 및 다른 이러한 제품에 일반적으로 사용되는 것과 같이, 당해 기술 분야에서 잘 알려져 있다.
부형제는 하나 이상의 탄수화물, 폴리머, 지질 및 미네랄일 수 있다. 탄수화물의 예는 락토스, 수크로스, 만니톨, 및 시클로덱스트린을 포함하고, 이것은 예를 들여, 동결건조를 가능하게 하기 위해 조성물에 첨가된다. 폴리머의 예는 전분, 셀룰로스 에테르, 셀룰로스 카르복시메틸셀룰로스, 히드록시프로필메틸 셀룰로스, 히드록시에틸 셀룰로스, 에틸히드록시에틸 셀룰로스, 알기네이트, 카라기난, 히알루론산 및 그의 유도체, 폴리아크릴산, 폴리술포네이트, 폴리에틸렌글리콜/폴리에틸렌 옥시드, 폴리에틸렌옥시드/폴리프로필렌 옥시드 코폴리머, 상이한 가수분해도(degree of hydrolysis)의 폴리비닐알콜/폴리비닐아세테이트, 및 모든 상이한 분자량의 폴리비닐피롤리돈이고, 이들은 예를 들어, 점도 조절을 위해, 접착을 이루기 위해, 또는 화학적 및 단백질 분해성 분해로부터 지질을 보호하기 위해 상기 조성물에 첨가된다. 지질의 예는 지방산, 인지질, 인산, 모노-, 다이-, 및 트리글리세리드, 세라마이드, 모든 상이한 아실 사슬 길이 및 포화의 스핑고지질 및 당지질, 달걀 레시틴, 콩 레시틴, 수소화된 달걀 및 콩 레시틴이고, 이들은 폴리머에 대한 이유와 유사한 이유로 조성물에 첨가된다. 미네랄의 예는 탈크, 산화마그네슘, 산화아연 및 산화티타늄이고, 이들은 액체 축적의 감소 또는 유리한 색소 특성과 같은 이점을 수득하기 위해 상기 조성물에 첨가된다.
용어 "희석제(diluent)"는 약제학적 제조에서 펩타이드를 희석할 목적을 갖는 수성 또는 비-수성 용액을 의미하는 것으로 의도된다. 희석제는 하나 이상의 식염수(saline), 물, 폴리에틸렌 글리콜, 프로필렌 글리콜, 에탄올 또는 (홍화유, 옥수수유, 땅콩 기름, 면실유 또는 참기름과 같은) 오일일 수 있다.
희석제는 또한 완충액으로서 기능할 수 있다. 용어 "완충액(buffer)"은 pH를 안정화하는 목적을 갖는 산-염기 혼합물을 함유하는 수성 용액을 의미하는 것으로 의도된다. 완충액의 예는 Trizma, Bicine, Tricine, MOPS, MOPSO, MOBS, Tris, Hepes, HEPBS, MES, 포스페이트, 카르보네이트, 아세테이트, 시트레이트, 글리콜레이트, 락테이트, 보레이트, ACES, ADA, 타르타레이트, AMP, AMPD, AMPSO, BES, CABS, 카코딜레이트, CHES, DIPSO, EPPS, 에탄올아민, 글리신, HEPPSO, 이미다졸, 이미다졸락트산, PIPES, SSC, SSPE, POPSO, TAPS, TABS, TAPSO 및 TES이다.
선택적으로, 상기 조성물을 아쥬반트를 포함할 수 있다. 용어 "아쥬반트(adjuvant)"는 상기 펩타이드의 생물학적 효과를 증가시키기 위해 제제에 첨가된 화합물을 의미하는 것으로 의도된다. 상기 아쥬반트는 상이한 음이온을 갖는 하나 이상의 아연, 구리 또는 은 염일 수 있고, 예를 들어 불화물, 염화물, 브롬화물, 요오드화물, 티오시아네이트, 아황산염, 수산화물, 포스페이트, 카르보네이트, 락테이트, 글리콜레이트, 시트레이트, 보레이트, 타르타레이트, 및 다른 아실 조성의 아세테이트이나 이에 한정되지 않는다.
본 발명의 약제학적 조성물은 또한 생분해성 마이크로스피어(microsphere)의 형태일 수 있다. 폴리(락트산)(poly(lactic acid); PLA), 폴리(글리콜산)(poly(glycolic acid); PGA), PLA와 PGA의 코폴리머(PLGA) 또는 폴리(카르프로락톤)(poly(carprolactone); PCL), 및 폴리안하이드리드와 같은, 지방족 폴리에스테르가 마이크로스피어의 생성에서 생분해성 폴리머로서 널리 사용되어 왔다. 이러한 마이크로스피어의 제조는 US 5,851,451 및 EP0213303에서 확인될 수 있다.
본 발명의 약제학적 조성물은 또한 폴리머 겔, 또는 폴리머로 이루어진 마이크로니들의 형태일 수 있고, 상기 폴리머는 전분, 셀룰로스 에테르, 셀룰로스 카르복시메틸셀룰로스, 히드록시프로필메틸 셀룰로스, 히드록시에틸 셀룰로스, 에틸히드록시에틸 셀룰로스, 알기네이트, 카라기난, 히알루론산 및 그의 유도체, 폴리아크릴산, 폴리술포네이트 등이다.
상기 테스토스테론-결합 폴리펩타이드 또는 복합체는 사용되는 유효성분의 효능 또는 독성에 따라, 다양한 농도로 제제화 될 수 있다. 바람직하게는, 상기 조성물은 1 nM 내지 1 M, 예를 들어 0.1 μM (micromole) 내지 1 mM, 1 μM 내지 100 μM, 5 μM 내지 50 μM, 10 μM 내지 50 μM, 20 μM 내지 40 μM 및 선택적으로 약 30 μM의 농도로 상기 테스토스테론-결합 폴리펩타이드 또는 복합체를 포함한다. 생체 외(ex vivo) 및 시험관 내 적용을 위해, 조성물은 더 낮은 농도, 예를 들어, 0.0025 μM 내지 1 μM의 테스토스테론-결합 폴리펩타이드 또는 복합체를 포함할 수 있다.
본 발명의 조성물은 다양한 경로 예를 들어, 국부, 피하, 비경구 또는 경구 투여로 투여될 수 있다는 것이 당해 기술 분야의 통상의 기술자에게 인식되어 있다.
바람직하게는, 본 발명의 조성물은 국부 투여 또는 피내(intracutaneous) 투여에 적절하다. 따라서, 본 발명의 조성물은 피부(예를 들어, 두피)에 국부적으로 투여될 수 있다. 예를 들어, 상기 조성물은 예를 들어, 하기 중 하나 이상을 갖는 혼합물에 현탁 또는 용해된 활성 폴리펩타이드를 함유하는 연고의 형태로 제공될 수 있다: 미네랄 오일, 액체 페트롤라툼, 백색 페트롤라툼, 프로필렌 글리콜, 폴리옥시에틸렌 폴리옥시프로필렌 화합물, 유화(emulsifying) 왁스 및 물. 대안적으로, 상기 폴리펩타이드는 예를 들어 하기 중 하나 이상의 혼합물에 현탁 또는 용해된, 적절한 로션 또는 크림으로 제제화될 수 있다: 미네랄 오일, 소르비탄 모노스테아레이트, 폴리에틸렌 글리콜, 액체 파라핀, 폴리소르베이트 60, 세틸 에스테르 왁스, 세테아릴 알콜, 2-옥틸도데카놀, 벤질 알콜 및 물.
선택적으로, 국부 투여용 조성물은 투과 증진제(penetration enhancer)를 포함할 수 있다(예를 들어, 그 개시가 본 명세서에 참조로서 포함된, Osborne & Henke, 1997, Pharmaceutical Technology, November: 58-82 and Pathan & Setty, 2009, Tropical Journal of Pharmaceutical Research 8(2): 173-179에 기재된 바와 같음).
대안적으로, 본 발명의 조성물은 비경구적으로, 예를 들어 피내로 투여될 수 있다. 이러한 조성물은 다른 물질, 예를 들어 혈액과 등장성인 용액을 만드는데 충분한 염 또는 글루코스를 함유할 수 있는 멸균 수성 용액의 형태로 가장 잘 사용된다. 상기 수성 용액은 필요하면, 적절하게 (바람직하게는 pH 3 내지 9로) 완충되어야 한다. 멸균 상태 하의 적절한 비경구 제제의 제조는 당해 기술 분야의 통상의 기술자에게 잘 알려진 표준 약제학적 기법에 의해 손쉽게 달성된다.
비경구 투여에 적절한 조성물은 항산화제, 완충액, 세균 발육 억제제(bacteriostat) 및 의도된 수득자의 혈액과 등장성인 제제를 만드는 용질을 함유할 수 있는 수성 및 비-수성 멸균 주사 용액; 및 현탁제 및 점증제를 포함할 수 있는 수성 및 비-수성 멸균 현탁액을 포함한다. 상기 제제는 단위-용량 또는 다회(multi)-용량 용기(container), 예를 들어 밀폐된 앰플 및 바이알로 제공될 수 있고, 사용하기 직전에, 멸균 액체 담체, 예를 들어 주사용수의 첨가만을 요구하는 냉동 건조된(동결건조된) 상태로 보관될 수 있다. 즉석 주사 용액 및 현탁액은 전술된 종류의 멸균 파우더, 과립 및 정제로부터 제조될 수 있다.
상술한 테스토스테론-결합 폴리펩타이드 또는 복합체를 전달하기 위해, 마이크로스피어 제제와 같은, 서방성 시스템을 사용하는 것이 유리할 수 있다.
대안적으로, 조성물은 활성 폴리펩타이드를 요구되는 부위(즉, 표피)에 직접 방출시키는 수술에 의해 이식된 장치에 의해 투여될 수 있다.
본 발명의 조성물은 또한 경피 방법으로 전달될 수 있다.
예를 들어, 전기천공 요법(electroporation therapy; EPT) 및/또는 이온영동(iontophoresis) 시스템이 단백질 또는 폴리펩타이드의 투여를 위해 채용될 수 있다. 이러한 방법에서, 장치가 펄스된 전기장을 세포에 전달하는데 사용되어, 약물에 대한 세포막의 증가된 투과능 및 세포내 약물 전달의 현저한 증가를 야기한다.
대안적인 경피 방법, 전기 결합(electroincorporation)은 피부의 표면에서 직경 30 미크론까지의 작은 입자가 전기 천공에 사용된 것과 동일하거나 유사한 전기 펄스를 경험한다는 것을 이용한다. 상기 입자는 각질층 (stratum corneum)을 통해 피부의 더 깊은 층으로 들어간다. 상기 입자는 약물 또는 유전자로 충진 또는 코팅되거나, 약물이 들어갈 수 있는 피부의 구멍을 만드는 "총알(bullets)"로서 단순히 작용할 수 있다.
추가적인 경피 방법은 또한 PowderJect Pharmaceuticals (현재 Novartis AG에 의해 소유됨)에 의해 개발되었다.
본 발명의 폴리펩타이드 및 조성물의 투여를 위한 적절한 방법은 당해 기술 분야에 잘 알려져 있고, 예를 들어 Therapeutic Protein and Peptide Formulation and Delivery, Zahra Shahrokh et al.(Eds), 1997, American Chemical Society, ISBN13: 9780841235281을 참조한다.
본 발명의 폴리펩타이드 조성물은 유효량으로 대상체(subject)투여된다. 본 명세서에 사용된, '치료적 유효량(therapeutically effective amount)', 또는 '유효량(effective amount)', 또는 '치료적으로 유효한(therapeutically effective)'은 모발 성장에 자극 효과를 제공하는 양을 말한다. 이것은 원하는 치료 효과를 생성하도록 산출된 활성 물질의 미리 결정된 양이다. 당해 기술 분야의 통상의 기술자에게 인식되는 바와 같이, 유효성분의 양은 그의 특이적 활성에 따라 달라질 수 있다. 적절한 용량은 요구되는 희석제와 함께 원하는 치료적 효과를 생성하도록 산출된 활성 물질의 미리 결정된 양을 함유할 수 있다. 본 발명의 조성물의 제조를 위한 방법 및 용도에서, 활성 성분의 치료적 유효량이 제공된다. 치료적 유효량은 당해 기술 분야에 잘 알려진 바와 같이, 연령, 체중, 성별, 상태, 합병증, 기타 질병 등과 같은, 환자 특성에 기초하여 통상의 의료계 또는 수의계 종사자에 의해 결정될 수 있다.
일 구체예에서, 상기 탈모는 하기로 이루어진 군으로부터 선택된다:
(a) 안드로겐 탈모 (안드로겐성 탈모, 알로페시아 안드로게네티카(alopecia androgenetica), 남성형 대머리 또는 여성형 대머리로도 알려짐); (b) 견인성 탈모; (c) 성장기 탈모증; (d) 휴지기 탈모증; (e) 원형 탈모; (f) 전두 탈모; (g) 전신 탈모; (h) 모낭염성 탈모; (i) 점액 탈모; (j) 신생물 탈모; (k) 반흔성 탈모; 및 (l) 흉터형성 탈모.
예를 들어, 상기 탈모는 안드로겐 탈모일 수 있다.
대안적으로, 상기 탈모는 예를 들어 방사선요법 및/또는 화학요법에 의해 유도된, 성장기 탈모증일 수 있다(상기 참조).
본 발명의 일 구현예에 있어서, 상기 대상체는 인간, 침팬지, 오랑우탄, 인간을 제외한 영장류, 개, 고양이, 말, 햄스터, 마우스, 랫트, 저빌, 돼지, 양, 소 등의 포유동물이고, 가장 구체적으로는 인간이나, 이에 한정되는 것은 아니다.
본 발명의 화장료(미용적) 조성물은 의학적 용도에 한정되지 않고 (그들이 어떠한 신체적 건강 개선을 제공하는 것이 아니라, 단순히, 포유동물에 심미적 이점을 제공한다는 의미에서) 미용적 작용제로서도 사용될 수 있다는 것이 당해 기술 분야의 통상의 기술자에게 인식된다.
따라서, 상기 화장료(미용적) 조성물은 기존 모공을 자극하고 및/또는 새로운 모공(또는 이를 생성할 수 있는 줄기 세포)의 성장을 유도하기 위한 것일 수 있다.
일 구체예에서, 상기 미용 조성물은 대머리의 치료 또는 예방을 위해 사용되고, 이것은 후퇴하는 머리선 (receding hairline) 및/또는 숱이 적어지는 머리(thinning hair)와 연관될 수 있다.
이러한 조성물은 두피에 사용하는 것에 한정되지 않고, (수염, 속눈썹 또는 눈썹의 성장을 촉진하기 위해 얼굴을 포함하여) 신체의 어디라도 적용될 수 있다.
본 발명의 조성물은 그 자체로 또는 다른 치료용 또는 미용 작용제와 조합하여 사용될 수 있다는 것이 당해 기술 분야의 통상의 기술자에게 인식될 것이다. 예를 들어, 본 발명의 조성물은 기존 모발 빠짐을 예방하고 및/또는 새로운 모발 성장을 자극하는 기존 치료법, 예를 들어, 미녹시딜(Regaine RTM., Pharmacia Corp.) 및 디아족시드(diazoxide)와 같은 포타슘 채널 개방제(opener); 피나스테리드(finasteride)(Propecia RTM., Merck & Co.)와 같은 5-알파-리덕타제 저해제; 및 면역억제제 시클로스포린 A와의 병용 요법에 사용될 수 있다.
본 발명의 조성물은 생체 내, 생체 외 또는 시험관 내에서 사용될 수 있다는 것이 또한 통상의 기술자에게 인식된다.
따라서, 포유동물에 직접 적용 또는 투여되는 것에 추가하여, 상기 조성물은 생체 외, 예를 들어 포유동물의 피부에 이식하기 전 피부 체외배양조직(explant)에서, 모발 성장을 자극하기 위해 사용될 수 있다.
대안적으로, 상기 조성물은 시험관 내, 예를 들어 세포 배양에서 모공을 성장시키기 위해 사용될 수 있고, 이것은 그 후 환자에게 이식될 수 있다.
따라서, 본 발명의 추가적인 양태를 시험관 내 또는 생체 외 모발 성장을 자극하기 위한 따른 폴리펩타이드의 용도를 제공한다.
일 구체예에서, 상기 폴리펩타이드는 모공(또는 이를 생성할 수 있는 줄기 세포, dermal papilla cell)의 성장을 자극하기 위해 사용된다.
본 발명의 또 다른 일 양태에 따르면, 본 발명은 상술한 약제학적 조성물을 치료가 필요한 대상체에게 투여하는 단계를 포함하는 모발 성장 자극 또는 탈모 치료방법을 제공한다.
본 발명의 일 구현예에 있어서, 상기 약제학적 조성물은 상술한 테스토스테론에 특이적으로 결합하는 폴리펩타이드를 유효성분으로 포함하거나, 또는 상술한 테스토스테론에 특이적으로 결합하는 폴리펩타이드 중 하나의 폴리펩타이드 및 적어도 하나의 혈관신생촉진 폴리펩타이드(angiogenic polypeptide)를 포함하는 복합체를 유효성분으로 포함한다.
본 발명의 상기 대상체는 인간, 침팬지, 오랑우탄, 인간을 제외한 영장류, 개, 고양이, 말, 햄스터, 마우스, 랫트, 저빌, 돼지, 양, 소 등의 포유동물이고, 가장 구체적으로는 인간이나, 이에 한정되는 것은 아니다.
본 발명의 상기 모발 성장 자극 또는 탈모 치료방법은, 본 발명의 일 양태인 약제학적 조성물을 투여하는 단계를 포함하는 방법이므로, 중복되는 내용에 대해서는 본 명세서의 과도한 중복성을 피하기 위하여 그 기재를 생략한다.
본 발명은 테스토스테론에 결합하는 어피바디 및 이의 용도에 관한 것으로, 구체적으로는 i) 테스토스테론에 결합하는 어피바디 또는 ii) 상기 어피바디와 오스테오폰틴 단편의 복합체; 및 iii) 이들을 유효성분으로 포함하는 모발 성장 자극용 또는 탈모치료용 약제학적 조성물에 관한 것이다. 본 발명의 어피바디, 또는 어피바디와 오스테오폰틴 단편의 복합체는 발모 또는 탈모 방지효과가 매우 우수한 바, 발모제 또는 탈모 치료제로서 유용하게 사용될 수 있다.
도 1은 본 발명의 테스토스테론에 특이적으로 결합하는 어피바디 클론 T26의 알라닌 스캐닝 결과를 나타낸 도이다.
도 2는 본 발명의 테스토스테론에 특이적으로 결합하는 어피바디 T26의 25번째 아미노산 잔기 트레오닌(T)를 다른 아미노산 잔기로 치환시킨 T26 변이체의 테스토스테론(T17-G-BSA)과의 결합력을 나타낸 도이다.
도 3은 본 발명의 테스토스테론에 특이적으로 결합하는 어피바디 T26의 25번째 아미노산 잔기 트레오닌(T)를 다른 아미노산 잔기로 치환시킨 T26 변이체를 정제하여 SDS-PAGE 분석 결과를 나타낸 도이다.
도 4는 선별된 T26 변이체들의 4종의 BSA (BSA, T3-CMO-BSA, G-BSA, T17-G-BSA)에 대한 결합 여부로부터 T26 변이체들의 테스토스테론에 대한 선택성을 나타낸 도이다.
도 5는 본 발명의 T26 및 T26 변이체들의 테스토스테론(T17-G-BSA)과의 친화성 (EC50)을 확인하기 위하여, 어피바디들의 다양한 농도에서의 ELISA 측정 값을 4-parameter logistic curve로 나타낸 도이다.
도 6은 본 발명의 T26 및 T26-INS001을 SDS-PAGE 분석한 결과이다.
도 7은 본 발명의 T26 및 T26-INS001의 테스토스테론 결합에 대한 선택성을 확인하기 위하여 BSA와 글리신이 접합된 BSA (G-BSA) 및 테스토스테론이 접합된 BSA (T3-CMO-BSA, T17-G-BSA)들과의 결합 여부를 확인한 도이다.
도 8은 본 발명의 T26-INS001의 안정성을 확인하기 위하여, T26 및 시료보관 기간이 다른 T26-INS001의 테스토스테론에 대한 친화성을 확인한 도이다. 상기 도 8에서 1차 생산은 먼저 생산된 T26-INS001 시료를 의미하고, 2차 생산은 30일 후에 생산된 T26-INS001 시료를 의미한다.
도 9a 및 도 9b는 본 발명의 T26 및 T26-INS001의 발모 또는 탈모 치료 효과에 대한 in vivo 시험 결과를 나타낸 도이다.
이하, 실시예를 통하여 본 발명을 더욱 상세히 설명하고자 한다. 이들 실시예는 오로지 본 발명을 보다 구체적으로 설명하기 위한 것으로, 본 발명의 요지에 따라 본 발명의 범위가 이들 실시예에 의해 제한되지 않는다는 것은 당업계에서 통상의 지식을 가진 자에 있어서 자명할 것이다.
실시예
본 명세서 전체에 걸쳐, 특정 물질의 농도를 나타내기 위하여 사용되는 "%"는 별도의 언급이 없는 경우, 고체/고체는 (중량/중량) %, 고체/액체는 (중량/부피) %, 그리고 액체/액체는 (부피/부피) %이다.
실시예 1: 테스토스테론이 고정된 소혈청 알부민 (BSA, bovine serum albumin) 준비
T17-G-BSA 준비
테스토스테론 (TCI, cat. #. T0027)의 17-beta 하이드록시기는 Boc-글리신 (GENERAY BIOTECH, cat. #. 0167)과 에스테르화 반응을 통해 아민기를 도입하였고 Sulfo-SMCC (sulfosuccinimidyl 4-(N-maleimidomethyl)cyclohexane-1-carboxylate) (Thermo Fisher, cat. #. 22322) 링커를 이용하여 BSA (Sigam-Aldrich, cat. #. A7030)에 고정하여 BSA-linker-glycine-17beta-hydroxy Testosterone 과 같은 구조의 T17-G-BSA를 제조하였다.
대조군으로서, 글리신이 Sulfo-SMCC 링커로 BSA에 고정된 항원을 준비하였다 (G-BSA). T17-G-BSA 및 G-BSA와의 각각의 반응 혼합물들은 투석여과(diafiltration) 방법 (Sartorius, cat. #. VS2002)을 이용하여 완충용액을 교환하였고, 반응에 참가하지 않고 남은 저분자 물질들을 제거하였다.
T3-CMO-BSA 준비
T3-CMO (Testosterone-3-(O-carboxymethyl)oxime) (Sigma-Aldrich, cat. #. T8390)의 BSA에의 고정은 T3-CMO의 카르복실기와 BSA의 1차 아민의 아미드 결합을 유도함으로써 하였다 (T3-CMO-BSA). T3-CMO-BSA 반응 혼합물은 투석여과(diafiltration) 방법 (sartorius, cat. #. VS2002)을 이용하여 완충용액을 교환하였고, 반응에 참가하지 않고 남은 저분자 물질들을 제거하였다.
실시예 2: Testosterone에 특이적인 어피바디 선별
테스토스테론에 특이적으로 결합하는 어피바디는 T17-G-BSA가 고정된 자성 비드(magnetic beads) (Thermo Fisher, cat. #. 14301)를 이용한 바이오패닝(bio-panning) 방법으로 선별하였다.
Bio-panning에 사용한 T17-G-BSA를 고정한 자성 비드(magnetic beads)의 준비는 다음과 같았다: 자성 비드(Magnetic beads) 30 mg (2 X 109)는 2 ml의 0.1 M sodium phosphate buffer (pH 7.4)로 3회 세척하여 준비하였다. 실시예 1의 T17-G-BSA 600 μg를 세척한 30 mg의 자성 비드(Magnetic beads)와 섞어주고 용액의 부피를 600 μl가 되도록 0.1 M sodium phosphate buffer를 첨가하였다. 자성 비드의 에폭시기 (Epoxy group)와 T17-G-BSA의 아민기를 반응시키기 위하여 300 μl의 3 M ammonium sulfate를 첨가 후 37 ℃에서 24시간 동안 반응을 진행하였다.
테스토스테론에 특이적으로 결합하는 어피바디 선별을 위한 바이오패닝(bio-panning) 스크리닝은 다음과 같이 진행하였다: 어피바디 라이브러리는 VCSM13 helper phage를 이용하여 phage 형태로 rescue를 하여 panning에 사용하였다. 최초 항원에 결합시키는 library phage의 수는 1013개 이상으로 사용하였고, 5 round의 panning을 진행하였다. 친화도(Affinity)가 높은 phage를 선택적으로 선별하기 위한 전략으로 panning round 차수가 증가함에 따라 항원 (magnetic beads) 양을 줄여 주었다 (순서대로 50 μg, 30 μg, 20 μg, 20 μg, 10 μg). 세척 횟수는 최초 round에서 PBST (phosphate buffered saline + 0.05% Tween 20)로 3회 진행하였고, 이 후 차수(2~4 rounds)에서는 5회 진행하였다.
표적 항원에 결합한 phage의 수는 ER2537 E. coli를 이용하여 다음과 같이 측정(titration) 하였다: Bio-panning 각 round에서 얻은 binder phage는 20 mM 유리(free) 테스토스테론이 포함된 0.1 M HCl 용액으로 용출(elution)하였다. SB media (MOPS 10 g/L, Bacto YEAST extract 20 g/L, Trypton 30 g/L)에서 하룻밤(overnight) 배양된 ER2537 E. coli를 새로운 SB media에 1/200배로 희석(dilution)하여 계대한 후 3시간 동안 37℃에서 추가 배양하여 log phage에 도달하게 하였다. 신선한 ER2537 E. coli 100 μL 및 상기 희석된 phage 10 μL를 1.5 ml 단위 튜브에서 섞은 다음, 30분 동안 배양(incubation)한 후 ampicillin을 포함하는 LB plate에 도말하여 37℃에서 16시간 동안 배양하였다. Phage 수는 생성된 ER2537 E. coli의 집락(colony) 수와 희석배수(dilution factor)를 적용하여 측정하였다.
Bio-panning 각 round에서 얻은 binder phage는 ER2537 E. coli에 감염(infection) 시켜 집락(colony) 형태로 유지한 상태에서 다음과 같이 ELISA 방법으로 각 항원에 대한 결합여부를 확인하였다: Binder phage를 감염(infection) 시켜 얻은 ER2537 E. coli 집락(colony)을 SB media에 접종하고 OD600에서 0.5가 될 때까지 배양하였다. 어피바디 발현유도는 0.5 mM IPTG (엘피스 솔루션)를 첨가하고 30℃에서 16시간 동안 진탕배양하였다. ER2537 E. coli의 막간공간의 분획은 BBS buffer (200 mM Boric acid, 150 mM NaCl, 1 mM EDTA, pH 7.5)를 이용하여 추출하였다. 어피바디 추출 분획들은 T17-G-BSA가 0.2 mg/well 농도로 코팅된 ELISA plate에 상온에서 1시간 동안 처리 후 TBST (Tris buffered saline + 0.05% Tween 20)로 3회 세척하였다. 어피바디의 항원에 대한 결합여부는 발현된 어피바디 C-말단의 HA(hemagglutinin) tag에 결합하는 anti-HA mouse HRP (Roche, cat. #. 12013819001)를 이차 항체(secondary antibody)로 상온에서 1시간 처리 후 TBST로 3회 세척하고 TMB (3',5,5'-Tetramethylbenzidine) solution으로 발색 후 ELISA reader (Victor X3 PerkinElmer)를 이용하여 OD450 값을 측정하여 확인하였다.
본 발명의 목적인 유리(free) 테스토스테론과 특이적 결합이 가능한 어피바디를 선별하기 위해 competitive ELISA를 수행하였다. 어피바디 추출 분획들은 0.1 mM의 유리 테스토스테론과 상온에서 1시간 전처리 과정 후 위의 ELISA 과정을 반복 수행하였다. T17-G-BSA 및 유리 테스토스테론에 모두 특이적으로 결합하는 것으로 확인된 어피바디 (T26)를 동정하였고 이의 phagemid plasmid를 확보하여 핵산서열 분석을 하여 표 1에 나타내었다.
Bio-Panning으로 선별된 어피바디 및 affinity maturation에 의해 도출된 어피바디들의 서열
Classification Nucleotide sequences Amino acid sequences
T26(Parental) GTGGACAACAAGTTCAACAAGGAGATGGTTCAGGCCATGCGTGAGATTTCTTACCTGCCCAACCTGAACCATACGCAGATCCGTGCCTTCATTTGGGTTCTGTTCGACGACCCTTCCCAGTCCGCCAACCTGCTGGCCGAGGCCAAGAAGCTGAACGACGCCCAGGCTCCCAAG (SEQ ID NO: 23) VDNKFNKEMVQAMREISYLPNLNHTQIRAFIWVLFDDPSQSANLLAEAKKLNDAQAPK (SEQ ID NO: 1)
T26-Q11A GTGGACAACAAGTTCAACAAGGAGATGGTTGCTGCCATGCGTGAGATTTCTTACCTGCCCAACCTGAACCATACGCAGATCCGTGCCTTCATTTGGGTTCTGTTCGACGACCCTTCCCAGTCCGCCAACCTGCTGGCCGAGGCCAAGAAGCTGAACGACGCCCAGGCTCCCAAG (SEQ ID NO: 24) VDNKFNKEMV A AMREISYLPNLNHTQIRAFIWVLFDDPSQSANLLAEAKKLNDAQAPK (SEQ ID NO: 2)
T26-S17A GTGGACAACAAGTTCAACAAGGAGATGGTTCAGGCCATGCGTGAGATTGCTTACCTGCCCAACCTGAACCATACGCAGATCCGTGCCTTCATTTGGGTTCTGTTCGACGACCCTTCCCAGTCCGCCAACCTGCTGGCCGAGGCCAAGAAGCTGAACGACGCCCAGGCTCCCAAG (SEQ ID NO: 25) VDNKFNKEMVQAMREI A YLPNLNHTQIRAFIWVLFDDPSQSANLLAEAKKLNDAQAPK (SEQ ID NO: 3)
T26-T25A GTGGACAACAAGTTCAACAAGGAGATGGTTCAGGCCATGCGTGAGATTTCTTACCTGCCCAACCTGAACCATGCTCAGATCCGTGCCTTCATTTGGGTTCTGTTCGACGACCCTTCCCAGTCCGCCAACCTGCTGGCCGAGGCCAAGAAGCTGAACGACGCCCAGGCTCCCAAG (SEQ ID NO: 26) VDNKFNKEMVQAMREISYLPNLNH A QIRAFIWVLFDDPSQSANLLAEAKKLNDAQAPK (SEQ ID NO: 4)
T26-T25R GTGGACAACAAGTTCAACAAGGAGATGGTTCAGGCCATGCGTGAGATTTCTTACCTGCCCAACCTGAACCATAGGCAGATCCGTGCCTTCATTTGGGTTCTGTTCGACGACCCTTCCCAGTCCGCCAACCTGCTGGCCGAGGCCAAGAAGCTGAACGACGCCCAGGCTCCCAAG (SEQ ID NO: 27) VDNKFNKEMVQAMREISYLPNLNH R QIRAFIWVLFDDPSQSANLLAEAKKLNDAQAPK (SEQ ID NO: 5)
T26-T25H GTGGACAACAAGTTCAACAAGGAGATGGTTCAGGCCATGCGTGAGATTTCTTACCTGCCCAACCTGAACCATCATCAGATCCGTGCCTTCATTTGGGTTCTGTTCGACGACCCTTCCCAGTCCGCCAACCTGCTGGCCGAGGCCAAGAAGCTGAACGACGCCCAGGCTCCCAAG (SEQ ID NO: 28) VDNKFNKEMVQAMREISYLPNLNH H QIRAFIWVLFDDPSQSANLLAEAKKLNDAQAPK (SEQ ID NO: 6)
T26-T25K GTGGACAACAAGTTCAACAAGGAGATGGTTCAGGCCATGCGTGAGATTTCTTACCTGCCCAACCTGAACCATAAGCAGATCCGTGCCTTCATTTGGGTTCTGTTCGACGACCCTTCCCAGTCCGCCAACCTGCTGGCCGAGGCCAAGAAGCTGAACGACGCCCAGGCTCCCAAG (SEQ ID NO: 29) VDNKFNKEMVQAMREISYLPNLNH K QIRAFIWVLFDDPSQSANLLAEAKKLNDAQAPK (SEQ ID NO: 7)
T26-T25D GTGGACAACAAGTTCAACAAGGAGATGGTTCAGGCCATGCGTGAGATTTCTTACCTGCCCAACCTGAACCATGATCAGATCCGTGCCTTCATTTGGGTTCTGTTCGACGACCCTTCCCAGTCCGCCAACCTGCTGGCCGAGGCCAAGAAGCTGAACGACGCCCAGGCTCCCAAG (SEQ ID NO: 30) VDNKFNKEMVQAMREISYLPNLNH D QIRAFIWVLFDDPSQSANLLAEAKKLNDAQAPK (SEQ ID NO: 8)
T26-T25E GTGGACAACAAGTTCAACAAGGAGATGGTTCAGGCCATGCGTGAGATTTCTTACCTGCCCAACCTGAACCATGAGCAGATCCGTGCCTTCATTTGGGTTCTGTTCGACGACCCTTCCCAGTCCGCCAACCTGCTGGCCGAGGCCAAGAAGCTGAACGACGCCCAGGCTCCCAAG (SEQ ID NO: 31) VDNKFNKEMVQAMREISYLPNLNH E QIRAFIWVLFDDPSQSANLLAEAKKLNDAQAPK (SEQ ID NO: 9)
T26-T25S GTGGACAACAAGTTCAACAAGGAGATGGTTCAGGCCATGCGTGAGATTTCTTACCTGCCCAACCTGAACCATAGTCAGATCCGTGCCTTCATTTGGGTTCTGTTCGACGACCCTTCCCAGTCCGCCAACCTGCTGGCCGAGGCCAAGAAGCTGAACGACGCCCAGGCTCCCAAG (SEQ ID NO: 32) VDNKFNKEMVQAMREISYLPNLNH S QIRAFIWVLFDDPSQSANLLAEAKKLNDAQAPK (SEQ ID NO: 10)
T26-T25N GTGGACAACAAGTTCAACAAGGAGATGGTTCAGGCCATGCGTGAGATTTCTTACCTGCCCAACCTGAACCATAATCAGATCCGTGCCTTCATTTGGGTTCTGTTCGACGACCCTTCCCAGTCCGCCAACCTGCTGGCCGAGGCCAAGAAGCTGAACGACGCCCAGGCTCCCAAG (SEQ ID NO: 33) VDNKFNKEMVQAMREISYLPNLNH N QIRAFIWVLFDDPSQSANLLAEAKKLNDAQAPK (SEQ ID NO: 11)
T26-T25Q GTGGACAACAAGTTCAACAAGGAGATGGTTCAGGCCATGCGTGAGATTTCTTACCTGCCCAACCTGAACCATCAGCAGATCCGTGCCTTCATTTGGGTTCTGTTCGACGACCCTTCCCAGTCCGCCAACCTGCTGGCCGAGGCCAAGAAGCTGAACGACGCCCAGGCTCCCAAG (SEQ ID NO: 34) VDNKFNKEMVQAMREISYLPNLNH Q QIRAFIWVLFDDPSQSANLLAEAKKLNDAQAPK (SEQ ID NO: 12)
T26-T25C GTGGACAACAAGTTCAACAAGGAGATGGTTCAGGCCATGCGTGAGATTTCTTACCTGCCCAACCTGAACCATTGTCAGATCCGTGCCTTCATTTGGGTTCTGTTCGACGACCCTTCCCAGTCCGCCAACCTGCTGGCCGAGGCCAAGAAGCTGAACGACGCCCAGGCTCCCAAG (SEQ ID NO: 35) VDNKFNKEMVQAMREISYLPNLNH C QIRAFIWVLFDDPSQSANLLAEAKKLNDAQAPK (SEQ ID NO: 13)
T26-T25G GTGGACAACAAGTTCAACAAGGAGATGGTTCAGGCCATGCGTGAGATTTCTTACCTGCCCAACCTGAACCATGGTCAGATCCGTGCCTTCATTTGGGTTCTGTTCGACGACCCTTCCCAGTCCGCCAACCTGCTGGCCGAGGCCAAGAAGCTGAACGACGCCCAGGCTCCCAAG (SEQ ID NO: 36) VDNKFNKEMVQAMREISYLPNLNH G QIRAFIWVLFDDPSQSANLLAEAKKLNDAQAPK (SEQ ID NO: 14)
T26-T25P GTGGACAACAAGTTCAACAAGGAGATGGTTCAGGCCATGCGTGAGATTTCTTACCTGCCCAACCTGAACCATCCTCAGATCCGTGCCTTCATTTGGGTTCTGTTCGACGACCCTTCCCAGTCCGCCAACCTGCTGGCCGAGGCCAAGAAGCTGAACGACGCCCAGGCTCCCAAG (SEQ ID NO: 37) VDNKFNKEMVQAMREISYLPNLNH P QIRAFIWVLFDDPSQSANLLAEAKKLNDAQAPK (SEQ ID NO: 15)
T26-T25V GTGGACAACAAGTTCAACAAGGAGATGGTTCAGGCCATGCGTGAGATTTCTTACCTGCCCAACCTGAACCATGTGCAGATCCGTGCCTTCATTTGGGTTCTGTTCGACGACCCTTCCCAGTCCGCCAACCTGCTGGCCGAGGCCAAGAAGCTGAACGACGCCCAGGCTCCCAAG (SEQ ID NO: 38) VDNKFNKEMVQAMREISYLPNLNH V QIRAFIWVLFDDPSQSANLLAEAKKLNDAQAPK (SEQ ID NO: 16)
T26-T25I GTGGACAACAAGTTCAACAAGGAGATGGTTCAGGCCATGCGTGAGATTTCTTACCTGCCCAACCTGAACCATATTCAGATCCGTGCCTTCATTTGGGTTCTGTTCGACGACCCTTCCCAGTCCGCCAACCTGCTGGCCGAGGCCAAGAAGCTGAACGACGCCCAGGCTCCCAAG (SEQ ID NO: 39) VDNKFNKEMVQAMREISYLPNLNH I QIRAFIWVLFDDPSQSANLLAEAKKLNDAQAPK (SEQ ID NO: 17)
T26-T25L GTGGACAACAAGTTCAACAAGGAGATGGTTCAGGCCATGCGTGAGATTTCTTACCTGCCCAACCTGAACCATCTTCAGATCCGTGCCTTCATTTGGGTTCTGTTCGACGACCCTTCCCAGTCCGCCAACCTGCTGGCCGAGGCCAAGAAGCTGAACGACGCCCAGGCTCCCAAG (SEQ ID NO: 40) VDNKFNKEMVQAMREISYLPNLNH L QIRAFIWVLFDDPSQSANLLAEAKKLNDAQAPK (SEQ ID NO: 18)
T26-T25F GTGGACAACAAGTTCAACAAGGAGATGGTTCAGGCCATGCGTGAGATTTCTTACCTGCCCAACCTGAACCATTTTCAGATCCGTGCCTTCATTTGGGTTCTGTTCGACGACCCTTCCCAGTCCGCCAACCTGCTGGCCGAGGCCAAGAAGCTGAACGACGCCCAGGCTCCCAAG (SEQ ID NO: 41) VDNKFNKEMVQAMREISYLPNLNH F QIRAFIWVLFDDPSQSANLLAEAKKLNDAQAPK (SEQ ID NO: 19)
T26-T25Y GTGGACAACAAGTTCAACAAGGAGATGGTTCAGGCCATGCGTGAGATTTCTTACCTGCCCAACCTGAACCATTATCAGATCCGTGCCTTCATTTGGGTTCTGTTCGACGACCCTTCCCAGTCCGCCAACCTGCTGGCCGAGGCCAAGAAGCTGAACGACGCCCAGGCTCCCAAG (SEQ ID NO: 42) VDNKFNKEMVQAMREISYLPNLNH Y QIRAFIWVLFDDPSQSANLLAEAKKLNDAQAPK (SEQ ID NO: 20)
T26-T25M GTGGACAACAAGTTCAACAAGGAGATGGTTCAGGCCATGCGTGAGATTTCTTACCTGCCCAACCTGAACCATATGCAGATCCGTGCCTTCATTTGGGTTCTGTTCGACGACCCTTCCCAGTCCGCCAACCTGCTGGCCGAGGCCAAGAAGCTGAACGACGCCCAGGCTCCCAAG (SEQ ID NO: 43) VDNKFNKEMVQAMREISYLPNLNH M QIRAFIWVLFDDPSQSANLLAEAKKLNDAQAPK (SEQ ID NO: 21)
T26-T25W GTGGACAACAAGTTCAACAAGGAGATGGTTCAGGCCATGCGTGAGATTTCTTACCTGCCCAACCTGAACCATTGGCAGATCCGTGCCTTCATTTGGGTTCTGTTCGACGACCCTTCCCAGTCCGCCAACCTGCTGGCCGAGGCCAAGAAGCTGAACGACGCCCAGGCTCCCAAG (SEQ ID NO: 44) VDNKFNKEMVQAMREISYLPNLNH W QIRAFIWVLFDDPSQSANLLAEAKKLNDAQAPK (SEQ ID NO: 22)
실시예 3: T26 친화도 성숙 (Affinity maturation)
선별된 T26 어피바디와 테스토스테론의 결합에 관여하는 부위를 확인하기 위해 가변부위의 알라닌 스크리닝을 수행하였다. 선별된 T-26의 서열을 바탕으로 각 가변부위의 서열이 알라닌으로 치환될 수 있는 프라이머를 디자인하였다. 알라닌 코돈은 GCT를 사용하였다. 알라닌 서열 치환방법은 over-lapping PCR 방법으로 다음과 같이 진행하였다. 돌연변이를 유발하고자 하는 가변부위 아미노산을 기준으로, N-말단 쪽 DNA 절편을 생성하기 위해서 템플레이트 DNA 50 ng, 10 pmol/μL 농도의 #22 forward 프라이머와 가변부위 reverse 프라이머를 각각 4 μL, 10X pfu polymerase mixture (ELPIS biotech, EBT-1011) 10 μL를 PCR 튜브에 넣어준 다음, 총 반응 부피(total reaction volume)가 50 μL가 되도록 증류수를 첨가한 후, PCR 반응을 진행하였다. 또한, 돌연변이를 유발하고자 하는 가변부위 아미노산을 기준으로, C-말단 쪽 DNA 절편은 위와 같은 조건으로 가변부위 forward와 #24 reverse 프라이머를 사용하여 생성하였다. PCR 반응으로 생성된 상기 두 DNA 절편은 아가로즈 겔에 로딩한 후, DNA gel elution kit (iNtRON BIOTECHNOLOGY, cat. #. 17288)을 사용하여 아가로즈 겔로부터 DNA를 분리하였다. 분리된 두 DNA 절편 각각 50 ng을 템플레이트 DNA로 사용하여 10 pmol/μL 농도의 #22 forward와 #24 reverse 프라이머 4 μL, 10X pfu polymerase mixture (ELPIS, cat. #. EBT-1011) 10 μL를 PCR 튜브에 넣어준 다음, 총 반응부피(total reaction volume)가 50 μL가 되도록 증류수를 첨가한 후 두 DNA 절편을 연결하는 오버래핑 PCR을 진행하여 각 가변부위의 아미노산을 알라닌으로 치환한 변이체 서열을 제작하였다. (표 2의 프라이머 서열 참조)
T26 어피바디의 알라닌 스크리닝에 사용된 프라이머 서열
Primers Nucleotide sequence (5' to 3') SEQ ID NO:
#22 forward gtgtggaattgtgagcggataac 45
#24 reverse atagcccccttattagcgtttgccatc 46
M9A-forward CAAGTTCAACAAGGAGGCTGTTCAGGCCATGCGTG 47
V10A-forward GTTCAACAAGGAGATGGCTCAGGCCATGCGTGAGA 48
Q11A-forward CAACAAGGAGATGGTTGCTGCCATGCGTGAGATTTC 49
M13A-forward GGAGATGGTTCAGGCCGCTCGTGAGATTTCTTACC 50
R14A-forward GATGGTTCAGGCCATGGCTGAGATTTCTTACCTGC 51
S17A-forward CAGGCCATGCGTGAGATTGCTTACCTGCCCAACCTGAAC 52
Y18A-forward CATGCGTGAGATTTCTGCTCTGCCCAACCTGAACC 53
H24A-forward CTTACCTGCCCAACCTGAACGCTACTCAGATCCGTGCCTTC 54
T25A-forward CTGCCCAACCTGAACCATGCTCAGATCCGTGCCTTCAT 55
I27A-forward CAACCTGAACCATACTCAGGCTCGTGCCTTCATTTGGGTTC 56
R28A-forward CTGAACCATACTCAGATCGCTGCCTTCATTTGGGTTCTG 57
W32A-forward CAGATCCGTGCCTTCATTGCTGTTCTGTTCGACGACCCTT 58
V33A-forward GATCCGTGCCTTCATTTGGGCTCTGTTCGACGACCCTTCC 59
F35A-forward CCTTCATTTGGGTTCTGGCTGACGACCCTTCCCAGTC 60
각 클론의 막간공간 분획들은 BSA, T17-G-BSA 그리고 G-BSA 항원들에 대한 결합 특이성을 확인하기 위하여 ELISA를 수행하였다. 결과 T26 서열에서 11번째 글루타민 (T26-Q11A), 17번째 세린 (T26-S17A) 25번째 트레오닌 (T26-T25A)을 알라닌으로 치환한 3종 클론들에서 T17-G-BSA와 결합과 특이성이 유지되는 것을 확인하였다 (도 1). T17-G-BSA 결합능이 확인된 클론들의 염기, 아미노산 서열은 표 1에 기술하였다. 특히 T25A에서 T17-G-BSA와의 결합능이 모클론에 비해 증가함을 확인하여 25번째 아미노산의 치환이 T26의 테스토스테론에 대한 친화도를 증가시킬 수 있을 가능성이 있는 것으로 판단하였다.T26의 25번째 자리 트레오닌을 다른 아미노산으로 치환한 어피바디들은 다음과 같이 준비하였다. 선별된 T26의 서열을 바탕으로 26번째 아미노산 트레오닌을 다른 아미노산으로 치환하는 방법은 NNK 프라이머를 사용하여 over-lapping PCR 방법으로 진행하였다. (표 3의 프라이머 서열 참조)
T26-T25X 돌연변에 사용된 프라이머 서열
Primers Nucleotide sequence (5' to 3') SEQ ID NO:
#22 forward gtgtggaattgtgagcggataac 45
#24 reverse atagcccccttattagcgtttgccatc 46
T25NNK-forward CTGCCCAACCTGAACCATNNKCAGATCCGTGCCTTCAT 61
T25-reverse ATGGTTCAGGTTGGGCAG 62
트레오닌을 다른 아미노산으로 치환한 어피바디들의 염기, 아미노산 서열을 표 1에 기술하였다. 각 클론들의 막간공간 분획들은 BSA와 T17-G-BSA를 항원으로 한 ELISA를 수행하였고 (도 2) 친화도를 기준으로 트레오닌 대신 아르지닌 (T26-T25R), 히스티딘 (T26-T25H), 리신 (T26-T25K), 아스파라진 (T26-T25N), 알라닌 (T26-T25A), 발린 (T26-T25V), 메치오닌 (T26-T25M), 타이로신 (T26-T25Y), 트립토판 (T26-T25W), 글루타민 (T26-T25Q)으로 치환된 10 종의 어피바디를 추가 선별하였다. 선별된 어피바디 유전자들은 PCR 증폭하여 (표 4의 프라이머 서열 참조) NdeI (NEB cat. # R0111L)과 XhoI (NEB cat. # R0146L) 제한효소 처리 후 pET21a (Novagen, cat. #. 69740) 발현 벡터에 클로닝하였다.
T26-T25X 돌연변이 pET21a cloning에 사용된 primer
Primers Nucleotide sequence (5' to 3') SEQ ID NO:
forward AATTCATATGGTGGACAACAAGTTCAACAAGGAG 63
reverse CCGCTCGAGCTTGGGAGCCTGGGCGTCGTTC 64
형질전환 BL21 (DE3) colony는 ampicillin 100 μg/ml이 포함된 5 ml 2X YT media (NaCl 5 g/L, Bacto YEAST extract 10 g/L, Trypton 16 g/L)에 접종하고 37 ℃에서 16시간 전배양하였다. 전배양액 200 μl를 250 ml 2X YT media에 접종하고 37℃ OD600에서 0.5가 될 때까지 배양하였다. 어피바디 발현유도는 1 mM IPTG를 첨가하고 30℃에서 16시간 진탕배양으로 하였다. 원심분리로 모은 균은 lysis buffer (6 M guanidine, 47 mM Na2HPO4, 2.65 mM NaH2PO4, 10 mM Tris, 100 mM NaCl, pH8.0)로 현탁 후 초음파 파쇄를 하였다. 어피바디들은 Ni-NTA beads (Qiagen, cat. #. 30410)를 이용하여 파쇄액으로부터 정제하고 diafiltration 방법을 이용하여 정제 완충용액에서 PBS로 교체하였다. 정제된 어피바디들은 흡광도 280 nm에서 흡광도를 측정하여 정량하였다. 정제된 재조합 단백질은 4-20% gradient gel을 이용하여 SDS-PAGE로 분석하였다 (도 3).정제된 각 어피바디 10 μg/ml (50 μl)은 BSA, T3-CMO-BSA, G-BSA, T17-G-BSA가 각각 well 당 100 ng의 농도로 코팅된 ELISA plate를 이용하여 결합 특이성을 확인하였다. 어피바디들은 상온에서 1시간 처리 후 TBST로 3회 세척하였다. 어피바디의 항원 결합여부는 anti-6x His mouse HRP (R&D systems, cat. #. MAB050H)를 secondary antibody로 상온에서 1시간 처리 후 TBST로 3회 세척하고 TMB solution으로 발색 한 다음 ELISA reader (Victor X3 PerkinElmer)를 이용하여 OD450 값을 측정하여 확인하였다. 결과 T26을 포함한 11종의 어피바디들은 테스토스테론이 접합되어 있는 항원인 T3-CMO-BSA와 T17-G-BSA에서만 결합이 확인되었고 BSA와 G-BSA에는 전혀 결합하지 않음을 확인하였다 (도 4).
각 어피바디의 T17-G-BSA에 대한 결합력은 ELISA로 확인하였다. T17-G-BSA가 well 당 100 ng의 농도로 코팅된 ELISA plate에 어피바디를 40 μg/ml의 농도에서 5배씩 10회 연속 희석하여 최소 농도 20.48 pg/ml의 농도로 상온에서 1시간 처리하고 ELISA를 수행하였다. TMB solution의 발색 정도인 OD450의 값은 GraphPad Prism 프로그램에 입력하고 4-parameter logistic curve로부터 EC50 값을 산출하였다 (도 5 및 표 5). 그 결과, T26의 T17-G-BSA에 대한 EC50 값은 약 0.8 μg/ml (1 x 10-7M)로 산출되었고 보다 향상된 친화력을 갖는 어피바디로 T26-T25R (9.3배), T26-T25A (5.6배), T26-T25Q (2.0배)가 확인되었다.
2nd ELISA T26 parental T26-T25R T26-T25H T26-T25K T26-T25N T26-T25A T26-T25V T26-T25M T26-T25Y T26-T25W T26-T25Q
EC50(μg/ml) 0.806 0.087 0.990 1.304 1.013 0.145 0.894 1.100 1.509 0.576 0.400
Affinity 1.0배 9.3배 0.8배 0.6배 0.8배 5.6배 0.9배 0.7배 0.5배 1.4배 2.0배
실시예 4. 어피바디-혈관신생 펩타이드 융합 단백질 생산 및 특성분석
본 발명자들은 상기 T26 어피바디와 오스테오폰틴 단백질의 단편(SVVYGLR)을 펩타이드 링커 (GGGG)로 연결한 복합체를 제조하고, 이를 T26-INS001라고 명명하였다. 상기 T26-INS001은 정제 용이성을 위해 T26의 N-말단 앞으로 6X histidine tag와 그 사이 트롬빈 절단 서열이 부과되는 pET28a 발현 벡터에 다음과 같이 클로닝 하였다: T26이 삽입되어 있는 pET21a vector은 PCR 증폭 템플릿으로 사용하였다 (표 6의 프라이머 서열 참조).
동물 실험 샘플 (T26, T26-INS001) 단백질 발현 벡터 pET28a cloning에 사용된 primer
Primers Nucleotide sequence (5' to 3') SEQ ID NO:
Forward AATTCATATGGTGGACAACAAGTTCAACAAGGAG 63
reverse (T26) CCGCTCGAGCTTGGGAGCCTGGGCGTCGTTC 64
reverse (T26-INS001) CCGCTCGAGTTAGCGCAGGCCATACACCACGCTGCCGCCGCCGCCCTTGGGAGCCTGGGCGTCG 65
PCR 증폭 결과물은 NdeI (NEB cat. # R0111L)과 XhoI (NEB cat. # R0146L) 제한효소 처리 후 pET28a (Novagen, cat. # 69864)의 MCS (multiple cloning site)에 삽입하였다. 각 단백질의 핵산, 아미노산 서열은 표 7에 나타내었다.
동물실험에 사용한 시료의 서열
Classification Nucleotide sequence Amino acid sequence
T26 ATGGGCAGCAGCCATCATCATCATCATCACAGCAGCGGCCTGGTGCCGCGCGGCAGCCATATGGTGGACAACAAGTTCAACAAGGAGATGGTTCAGGCCATGCGTGAGATTTCTTACCTGCCCAACCTGAACCATACGCAGATCCGTGCCTTCATTTGGGTTCTGTTCGACGACCCTTCCCAGTCCGCCAACCTGCTGGCCGAGGCCAAGAAGCTGAACGACGCCCAGGCTCCCAAGTAA (SEQ ID NO: 68) MGSSHHHHHHSSGLVPRGSHMVDNKFNKEMVQAMREISYLPNLNHTQIRAFIWVLFDDPSQSANLLAEAKKLNDAQAPK (SEQ ID NO: 67)
T26-INS001 ATGGGCAGCAGCCATCATCATCATCATCACAGCAGCGGCCTGGTGCCGCGCGGCAGCCATATGGTGGACAACAAGTTCAACAAGGAGATGGTTCAGGCCATGCGTGAGATTTCTTACCTGCCCAACCTGAACCATACGCAGATCCGTGCCTTCATTTGGGTTCTGTTCGACGACCCTTCCCAGTCCGCCAACCTGCTGGCCGAGGCCAAGAAGCTGAACGACGCCCAGGCTCCCAAGGGCGGCGGCGGCAGCGTGGTGTATGGCCTGCGCTAACTCGAGCACCACCACCACCACCACTGAGATCCGGCTGCTAA (SEQ ID NO: 70) MGSSHHHHHHSSGLVPRGSHMVDNKFNKEMVQAMREISYLPNLNHTQIRAFIWVLFDDPSQSANLLAEAKKLNDAQAPKGGGGSVVYGLR (SEQ ID NO: 69)
형질전환 BL21 (DE3) colony는 Kanamycin 50 μg/ml이 포함된 5 ml 2X YT media (NaCl 5 g/L, Bacto YEAST extract 10 g/L, Trypton 16 g/L)에 접종하고 37 ℃에서 16시간 전배양 하였다. 전배양액 500 μl를 500 ml 2X YT media에 접종하고 37 ℃ OD600에서 0.5가 될 때까지 배양하였다. T-26 (pET28 벡터에 클로닝), T26-INS001의 발현유도는 1 mM IPTG를 첨가하고 25 ℃에서 24시간 진탕배양으로 하였다. 원심분리로 모은 균은 lysis buffer (6 M guanidine, 47 mM Na2HPO4, 2.65 mM NaH2PO4, 10 mM Tris, 100 mM NaCl, pH8.0)로 현탁 후 초음파 파쇄를 하였다. T26과 T26-INS001은 Ni-NTA beads를 이용하여 파쇄액으로부터 정제하고 diafiltration 방법을 이용하여 정제 완충용액에서 saline (0.9% NaCl)로 교체하였다. 정제된 T26과 T-26-INS001은 흡광도 280 nm에서 흡광도를 측정하여 정량하였다. 정제된 재조합단백질은 15% SDS-PAGE로 분석하였다 (도 6). 정제된 T26, T26-INS001 0.1 μg/ml (50 μl)은 BSA, T3-CMO-BSA, G-BSA, T17-G-BSA가 각각 well 당 100 ng의 농도로 코팅된 ELISA plate를 이용하여 결합 특이성을 확인하였다. T26, T26-INS001은 상온에서 1시간 처리 후 TBST로 3회 세척하였다. T26과 T-26-INS001의 항원 결합여부는 anti-6x His mouse HRP를 이차 항체(secondary antibody)로 상온에서 1시간 처리 후 TBST로 3회 세척하고 TMB solution으로 발색반응을 한 다음 ELISA reader (Victor X3 PerkinElmer)를 이용하여 OD450 값을 측정하여 확인하였다. 결과 T26와 T26-INS001은 테스토스테론이 접합 되어있는 항원인 T3-CMO-BSA와 T17-G-BSA에서만 결합이 확인되었고 BSA와 G-BSA에는 결합하지 않음을 확인하였다 (도 7). T26의 N-말단 펩타이드 (6X 히스티딘 테그, 트롬빈 절단서열)와 C-말단 펩타이드는 T26의 결합 특이성에는 영향을 미치지 않는 것을 확인하였다.
T26, T26-INS001의 T17-G-BSA에 대한 결합력은 ELISA로 확인하였다. T17-G-BSA가 well 당 100 ng의 농도로 코팅된 ELISA plate에 T26과 T-26-INS001를 20 μg/ml (50 μl)의 농도에서 3배씩 8회 연속 희석하여 최소 농도 9 ng/ml의 농도로 상온에서 1시간 처리하고 ELISA를 수행하였다. T26-INS001의 안정성을 확인하기 위해 30일간의 차이가 있는 기존 준비한 시료(1차 생산)와 새롭게 준비한 시료(2차 생산)에 대하여 ELISA를 각각 수행하였다. 1차 생산된 T26-INS001 시료는 2차 생산된 T26-INS001 시료의 생산 전까지 0.9% NaCl 생리 식염수에 용해된 상태로 4 ℃에서 보관되었다. TMB solution의 발색 정도인 OD450의 값은 GraphPad Prism 프로그램에 입력하고 4-parameter logistic curve로부터 EC50 값을 산출하였다 (도 8). 그 결과, T26의 T17-G-BSA에 대한 EC50 값은 0.5 mg/l (6 x 10-9M)로 산출되었고 T26-INS001은 이보다 2배가량 낮은 EC50 값으로 확인되었다. 이로써 C-말단에 융합된 펩타이드는 T26의 T17-G-BSA에 대한 친화력에 미치는 영향은 크지 않은 것으로 확인되었다. 또한 시료 준비 시기가 다른 T26-INS001 간의 친화력의 차이가 미미한 것으로 T26-INS001의 안정성이 최소 30일간 유지될 수 있음을 확인하였다.
구분 T26 T26-INS (1차 생산) T26-INS (2차 생산)
EC50 0.5081 1.223 0.9548
Affinity 1.0배 0.4배 0.5배
실시예 5. 마우스를 이용한 in vivo 발모효과 검증
본 발명의 T26 및 T26-INS001의 발모 효과를 검증하기 위하여, 수컷 C57BL/6 마우스 (7주령)를 구입(대한 바이오 링크)한 후 1주간 사육실 환경에 적응하도록 하였다. 8주령 차에 마우스의 등 부위를 제모기를 사용하여 긴 털을 깎고 제모제 (80% thioglycolic acid 포함)를 이용하여 털을 완벽하게 제거하였다. 제모 부위에 피부 손상이 없고 피부색이 분홍색인 마우스를 선별하여 무작위로 실험군을 나누었고 하루 동안 안정화를 시켰다.
시험군은 각각 4마리 마우스로 음성대조군 (Saline), T26 투여군 (0.6 μM), T26-INS001 투여군 (0.6 μM)으로 나누었다. 시료의 투여 용량은 총 100 μl를 25 μl씩 나누어 4군데에 피내 주사하였고 투여 빈도는 1일 1회 동일 시간에 진행되었다. 실험기간은 총 29일 진행되었다. 시험기간 중 사진촬영은 3일 간격으로 하였고 발모가 진행되기 시작한 15일차부터는 매일 수행하였다. 도 9a에는 모발 성장 정도를 수치화하기 위하여 전체 제모부위 (피부 주름으로 인한 수치의 비정확성의 이유로 목부위는 제외하였다.)에서 발모가 시작되는 부위를 이미지분석 프로그램 (Image J)으로 구분하여 %로 수치화 하고 4마리 마우스의 평균을 그래프화 하였다 (도 9b).
그 결과, 음성대조군 (Saline)에 비해 T26과 T26-INS001 투여군에서 털이 빨리 자라는 뚜렷한 효과를 관찰할 수 있었다. 수치적 데이터에서도 음성대조군은 실험이 종료되는 시점에 제모면적의 60% 정도에서 발모가 관찰되었으나 T26 투여군은 5일 빠른 24일차에 60% 면적에서 발모가 관찰된다. 특히 T26-INS001 투여군에서는 8일 빠른 21일차에 60% 면적에서 발모가 관찰되며 실험 종료일에 4마리 마우스 모두가 제모 전과 유사한 수준의 털을 보유하게 되었다.
이상으로 본 발명의 특정한 부분을 상세히 기술하였는 바, 당업계의 통상의 지식을 가진 자에게 있어서 이러한 구체적인 기술은 단지 바람직한 구현예일 뿐이며, 이에 본 발명의 범위가 제한되는 것이 아닌 점은 명백하다.

Claims (14)

  1. 하기 서열번호 1의 아미노산 서열과 적어도 94%의 서열 상동성을 가지는 아 미노산 서열을 포함하고, 테스토스테론에 특이적으로 결합하는 폴리펩타이드:
    VDNKFNKEMVQAMREISYLPNLNHTQIRAFIWVLFDDPSQSANLLAEAKKLNDAQAPK (서열번호 1).
  2. 제1항에 있어서, 상기 폴리펩타이드는 하기 아미노산 서열 중 11번째 아미노 산 잔기 Q, 17번째 아미노산 잔기 S, 및 25번째 아미노산 잔기 T 중 1 이상의 아미 노산 잔기가 서로 독립적으로 임의의 아미노산 잔기로 치환된 것인, 폴리펩타이드:
    VDNKFNKEMV Q AMREI S YLPNLNH T QIRAFIWVLFDDPSQSANLLAEAKKLNDAQAPK.
  3. 제1항에 있어서, 서열번호 1의 아미노산 서열과 적어도 98%의 서열 상동성을 가지는 아미노산 서열을 포함하고, 테스토스테론에 특이적으로 결합하는 폴리펩타 이드.
  4. 제1항에 있어서, 하기 아미노산 서열 중 11번째 아미노산 잔기 Q, 17번째 아 미노산 잔기 S, 또는 25번째 아미노산 잔기 T가 아미노산 잔기 A로 치환된 것인, 폴리펩타이드:
    VDNKFNKEMV Q AMREI S YLPNLNH T QIRAFIWVLFDDPSQSANLLAEAKKLNDAQAPK.
  5. 제1항에 있어서, 상기 상기 폴리펩타이드는 서열번호 5 내지 7, 9 내지 14, 16, 및 20 내지 22로 이루어진 군으로부터 선택된 어느 하나의 아미노산 서열을 포 함하는 것인, 폴리펩타이드.
  6. 제1항에 있어서, 상기 폴리펩타이드는 하기 아미노산 서열 중 밑줄로 표시한 아미노산 잔기를 모두 포함하는 것인, 폴리펩타이드:
    VDNKFNKE MVQ A MR EI SY LPNLN HT Q IR AFI WV L F DDPSQSANLLAEAKKLNDAQAPK.
  7. 제1항 내지 제6항 중 어느 한 항의 테스토스테론에 특이적으로 결합하는 폴 리펩타이드 및 적어도 하나의 혈관신생촉진 폴리펩타이드(angiogenic polypeptide)를 포함하는 복합체.
  8. 제7항에 있어서, 상기 혈관신생촉진 폴리펩타이드는 오스테오폰틴 또는 이의 단편인, 복합체.
  9. 제8항에 있어서, 상기 오스테오폰틴의 단편은 서열번호 66의 아미노산 서열을 포함하는 것인, 복합체.
  10. i) 제1항 내지 제6항 중 어느 한 항의 폴리펩타이드, 또는 ii) 제7항의 테스토스테론-결합 폴리펩타이드와 혈관신생 촉진 폴리펩타이드를 포함하는 복합체를 인코딩하는 뉴클레오타이드 서열을 포함하는 핵산 분자.
  11. 제10항의 핵산 분자를 포함하는 재조합 벡터.
  12. 제11항의 재조합 벡터를 포함하는 숙주세포.
  13. (a) 제1항 내지 제6항 중 어느 한 항의 폴리펩타이드, 또는 제7항의 복합체; 및 (b) 약제학적으로 허용가능한 부형제, 담체, 또는 희석제를 포함하는 모발 성장 자극용 또는 탈모치료용 약제학적 조성물.
  14. 제1항 내지 제6항 중 어느 한 항의 폴리펩타이드, 또는 제7항의 복합체를 포함하는 모발 성장 자극용 화장료 조성물.
PCT/KR2021/014103 2020-10-13 2021-10-13 테스토스테론-특이적 어피바디 및 이의 용도 WO2022080851A1 (ko)

Priority Applications (2)

Application Number Priority Date Filing Date Title
EP21880498.7A EP4230651A1 (en) 2020-10-13 2021-10-13 Testosterone-specific affibody and uses thereof
US18/031,467 US20240018233A1 (en) 2020-10-13 2021-10-13 Testosterone-specific affibody and uses thereof

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
KR10-2020-0132203 2020-10-13
KR1020200132203A KR102350655B1 (ko) 2020-10-13 2020-10-13 테스토스테론-특이적 어피바디 및 이의 용도

Publications (1)

Publication Number Publication Date
WO2022080851A1 true WO2022080851A1 (ko) 2022-04-21

Family

ID=79339483

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/KR2021/014103 WO2022080851A1 (ko) 2020-10-13 2021-10-13 테스토스테론-특이적 어피바디 및 이의 용도

Country Status (4)

Country Link
US (1) US20240018233A1 (ko)
EP (1) EP4230651A1 (ko)
KR (1) KR102350655B1 (ko)
WO (1) WO2022080851A1 (ko)

Citations (8)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4554101A (en) 1981-01-09 1985-11-19 New York Blood Center, Inc. Identification and preparation of epitopes on antigens and allergens on the basis of hydrophilicity
EP0213303A2 (en) 1985-07-12 1987-03-11 Bo Magnus Ekman A method for producing small, spherical polymer particles
WO1995019374A1 (en) 1994-01-14 1995-07-20 Pharmacia Ab Bacterial receptor structures
US5851451A (en) 1995-12-15 1998-12-22 Takeda Chemical Industries, Ltd. Production of microspheres
WO2008009960A2 (en) * 2006-07-21 2008-01-24 Haptogen Ltd Anti-testosterone antibodies
WO2009080811A1 (en) 2007-12-21 2009-07-02 Affibody Ab Polypeptide libraries with a predetermined scaffold
WO2013011431A1 (en) * 2011-07-18 2013-01-24 In Fieri S.R.L. A topical composition for the treatment of alopecia
KR20200132203A (ko) 2019-05-16 2020-11-25 최유경 폴리이미드 필름, 이의 제조방법 및 이를 포함하는 연성인쇄회로기판

Patent Citations (8)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4554101A (en) 1981-01-09 1985-11-19 New York Blood Center, Inc. Identification and preparation of epitopes on antigens and allergens on the basis of hydrophilicity
EP0213303A2 (en) 1985-07-12 1987-03-11 Bo Magnus Ekman A method for producing small, spherical polymer particles
WO1995019374A1 (en) 1994-01-14 1995-07-20 Pharmacia Ab Bacterial receptor structures
US5851451A (en) 1995-12-15 1998-12-22 Takeda Chemical Industries, Ltd. Production of microspheres
WO2008009960A2 (en) * 2006-07-21 2008-01-24 Haptogen Ltd Anti-testosterone antibodies
WO2009080811A1 (en) 2007-12-21 2009-07-02 Affibody Ab Polypeptide libraries with a predetermined scaffold
WO2013011431A1 (en) * 2011-07-18 2013-01-24 In Fieri S.R.L. A topical composition for the treatment of alopecia
KR20200132203A (ko) 2019-05-16 2020-11-25 최유경 폴리이미드 필름, 이의 제조방법 및 이를 포함하는 연성인쇄회로기판

Non-Patent Citations (33)

* Cited by examiner, † Cited by third party
Title
"Therapeutic Protein and Peptide Formulation and Delivery", 1997, AMERICAN CHEMICAL SOCIETY
ALTSCHUL ET AL., J. MOL. BIOL., vol. 215, 1990, pages 403 - 584
COHEN, S.N. ET AL., PROC. NATL. ACAC. SCI. USA, vol. 9, 1973, pages 2110 - 2114
CORPET ET AL., NUC. ACIDS RES., vol. 16, 1988, pages 10881 - 90
DATABASE PROTEIN 1 December 2020 (2020-12-01), ANONYMOUS : "Chain E, ZAb3 Affibody dimer", XP055922267, retrieved from NCBI Database accession no. 2OTK_E *
DOWER, W. J. ET AL., NUCLEIC. ACIDS RES., vol. 16, 1988, pages 6127 - 6145
GOLDSTEIN R ET AL., EXPERT REV ANTICANCER THER., 2013
GOPAL, MOL. CELL BIOL., vol. 5, 1985, pages 1188 - 1190
GRAHAM, F.L. ET AL., VIROLOGY, vol. 52, 1973, pages 456
GRONWALL ET AL., J. BIOTECHNOL., 2007
H. NEURATHR.L.HILL: "The Proteins", 1979, ACADEMIC PRESS
HAMADA, Y. NOKIHARA, K. OKAZAKI, M. FUJITANI, W. MATSUMOTO, T. MATSUO, M. UMAKOSHI, Y. TAKAHASHI, J. MATSUURA, N.: "Angiogenic activity of osteopontin-derived peptide SVVYGLR", BIOCHEMICAL AND BIOPHYSICAL RESEARCH COMMUNICATIONS, ELSEVIER, AMSTERDAM NL, vol. 310, no. 1, 10 October 2003 (2003-10-10), Amsterdam NL , pages 153 - 157, XP004457198, ISSN: 0006-291X, DOI: 10.1016/j.bbrc.2003.09.001 *
HANAHAN, D., J. MOL. BIOL., vol. 166, 1983, pages 557 - 580
HERSKOWITZ, IHAGEN, D., ANN. REV. GENET., vol. 14, 1980, pages 399 - 445
HIGGINSSHARP, CABIOS, vol. 5, 1989, pages 151 - 3
HIGGINSSHARP, GENE, vol. 73, 1988, pages 237 - 44
HUANG ET AL., COMP. APPL. BIOSCI., vol. 8, 1992, pages 155 - 65
MERRIFIELD, J. AMER. CHEM. SOC., vol. 85, 1963, pages 2149 - 54
NEEDLEMANWUNSCH, J. MOL. BIO., vol. 48, 1970, pages 443
NEUMANN, E. ET AL., EMBO J., vol. 1, 1982, pages 841
OBANA NORIKO, CHANG CHAWNSHANG, UNO HIDEO: "Inhibition of Hair Growth by Testosterone in the Presence of Dermal Papilla Cells from the Frontal Bald Scalp of the Postpubertal Stumptailed Macaque 1", ENDOCRINOLOGY, THE ENDOCRINE SOCIETY, US, vol. 138, no. 1, 1 January 1997 (1997-01-01), US , pages 356 - 361, XP055922269, ISSN: 0013-7227, DOI: 10.1210/endo.138.1.4890 *
ORLOVA ET AL., CANCER RES., 2006
OSBORNEHENKE, PHARMACEUTICAL TECHNOLOGY, 1997, pages 58 - 82
PATHANSETTY, TROPICAL JOURNAL OF PHARMACEUTICAL RESEARCH, vol. 8, no. 2, 2009, pages 173 - 179
PEARSON ET AL., METH. MOL. BIOL., vol. 24, 1994, pages 307 - 31
PEARSONLIPMAN, METHODS IN MOL. BIOL, vol. 24, 1988, pages 307 - 31
REMINGTON: "The Science and Practice of Pharmacy", 1995, MACK PUBLISHING COMPANY
SAMBROOK ET AL.: "Molecular Cloning, A Laboratory Manual", 2001, COLD SPRING HARBOR LABORATORY PRESS
SMITHWATERMAN: "Adv. Appl. Math.", vol. 2, 1981, pages: 482
WONG, T.K. ET AL., GENE, vol. 10, 1980, pages 87
YANG ET AL., PROC. NATL. ACAD. SCI., vol. 87, 1990, pages 9568 - 9572
YANOFSKY, C., J. BACTERIOL., vol. 158, 1984, pages 1018 - 1024
YU F ET AL., MABS, 2014

Also Published As

Publication number Publication date
EP4230651A1 (en) 2023-08-23
US20240018233A1 (en) 2024-01-18
KR102350655B1 (ko) 2022-01-12

Similar Documents

Publication Publication Date Title
EP1895005B1 (en) Cell-permeable peptide inhibitors of the JNK signal transduction pathway
EP0871730A1 (en) Combination pdgf, kgf, igf and igfbp for wound healing
KR20220123294A (ko) 폴리펩티드, 이의 제조방법 및 용도
WO2014183491A1 (zh) 具有抗肿瘤活性的多肽及其用途
MXPA04005675A (es) Polipeptido modificado.
KR20150124999A (ko) 암 표적화 치료용 알부민-결합 아르기닌 데이미나제를 포함하는 약제학적 조성물
US11225510B2 (en) Modified lantibiotics and methods of making and using the modified lantibiotics
US5736363A (en) IGF-II analogues
WO2022080851A1 (ko) 테스토스테론-특이적 어피바디 및 이의 용도
WO2022005174A1 (ko) 항-lag-3 항체 및 il-2를 포함하는 융합단백질 및 이의 용도
US20220064244A1 (en) A polypeptide molecule and application thereof
US6399584B1 (en) Pharmaceutical composition containing ezrin mutated on tyrosine 353
WO2021194186A1 (ko) Vgll1 펩타이드를 포함하는 암 치료용 조성물
WO2022005117A1 (ko) 항-SARS-CoV-2 S 단백질 항체 또는 그의 항원 결합 단편, 및 이를 포함하는 SARS-CoV-2 감염증의 예방 또는 치료용 약제학적 조성물
WO2018212540A2 (ko) 세포투과능이 향상된 리피바디-항암 단백질 약물 복합체, 그 제조방법 및 용도
WO2022114461A1 (ko) 피부미백용 조성물
WO2023055045A1 (ko) 코일드 코일 융합 단백질
WO2014034922A1 (ja) 血管内皮細胞増殖因子受容体阻害ペプチド
WO2024085280A1 (ko) 신규한 키뉴레니나제 및 이의 용도
WO2023195588A1 (ko) Mcl-1 및 bcl-xl에 동시에 결합하는 단백질 및 이의 용도
US8748568B2 (en) Isolated A-type FHF N-terminal domain peptides and methods of use
WO2022245183A1 (en) Composition for preventing or treating non-alcoholic fatty liver disease or non-alcoholic steatohepatitis comprising growth differentiation factor-15 variant
JP2006515168A5 (ko)
KR20220071315A (ko) 피부미백용 조성물
WO2023086790A1 (en) Method for producing an antibody peptide conjugate

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 21880498

Country of ref document: EP

Kind code of ref document: A1

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2021880498

Country of ref document: EP

Effective date: 20230515