WO2022045481A1 - 포름알데히드로부터의 글리콜알데히드 생성용 조성물 및 상기 조성물을 이용한 포름알데히드로부터의 글리콜산, 에틸렌글리콜 또는 에탄올 아민 제조방법 - Google Patents

포름알데히드로부터의 글리콜알데히드 생성용 조성물 및 상기 조성물을 이용한 포름알데히드로부터의 글리콜산, 에틸렌글리콜 또는 에탄올 아민 제조방법 Download PDF

Info

Publication number
WO2022045481A1
WO2022045481A1 PCT/KR2020/018314 KR2020018314W WO2022045481A1 WO 2022045481 A1 WO2022045481 A1 WO 2022045481A1 KR 2020018314 W KR2020018314 W KR 2020018314W WO 2022045481 A1 WO2022045481 A1 WO 2022045481A1
Authority
WO
WIPO (PCT)
Prior art keywords
gcl
formaldehyde
glycolaldehyde
novel
cat
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/KR2020/018314
Other languages
English (en)
French (fr)
Inventor
김정선
박진병
서필원
김준홍
김지원
조혜진
김채윤
김예나
백윤진
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Ewha Womans University
Industry Foundation of Chonnam National University
Original Assignee
Ewha Womans University
Industry Foundation of Chonnam National University
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Ewha Womans University, Industry Foundation of Chonnam National University filed Critical Ewha Womans University
Publication of WO2022045481A1 publication Critical patent/WO2022045481A1/ko
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Images

Classifications

    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09—Recombinant DNA-technology
    • C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
    • C12N15/52—Genes encoding for enzymes or proenzymes
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09—Recombinant DNA-technology
    • C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/70—Vectors or expression systems specially adapted for E. coli
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/0004—Oxidoreductases (1.)
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/88—Lyases (4.)
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12P—FERMENTATION OR ENZYME-USING PROCESSES TO SYNTHESISE A DESIRED CHEMICAL COMPOUND OR COMPOSITION OR TO SEPARATE OPTICAL ISOMERS FROM A RACEMIC MIXTURE
    • C12P7/00—Preparation of oxygen-containing organic compounds
    • C12P7/02—Preparation of oxygen-containing organic compounds containing a hydroxy group
    • C12P7/04—Preparation of oxygen-containing organic compounds containing a hydroxy group acyclic
    • C12P7/18—Preparation of oxygen-containing organic compounds containing a hydroxy group acyclic polyhydric

Definitions

  • the present invention relates to a technology for producing glycolaldehyde, glycolic acid, ethylene glycol and ethanolamine, and more specifically, a composition for producing glycolaldehyde from formaldehyde using an enzyme that is a biocatalyst while using formaldehyde as a starting material, and It relates to a method for preparing ethylene glycol glycol or ethanolamine from formaldehyde using the composition.
  • Glycolaldehyde, glycolic acid, ethylene glycol and ethanolamine are used as monomers for bioplastics in the textile industry, as monomers for dyes and tanning agents, as flavoring and preservatives and emulsifiers in the food industry, as skin care agents in the pharmaceutical industry, as detergents in industry and at home. Although it is widely used as an adhesive, etc., toxic substances including strong acids are used during the manufacturing process, and the selectivity and yield of the reaction are not high, causing various problems such as emission of pollutants and use of high energy (Appl Microbiol Biotechnol (2019) 103: 2525-2535).
  • GCL glyoxylate carboligase
  • glycolaldehyde composition including GCL and its derivatives, capable of producing glycolaldehyde from formaldehyde in an environmentally friendly manner.
  • Another object of the present invention is a novel GCL having a sequence altered through genetic manipulation to more effectively produce glycolaldehyde from formaldehyde, a nucleic acid molecule encoding the same, a vector containing the nucleic acid molecule, and transformation containing the vector to provide a body.
  • Another object of the present invention is to obtain high yield of glycolaldehyde, glycolic acid, ethylene glycol and ethanolamine from formaldehyde in an environmentally friendly manner by using a glycolaldehyde composition comprising GCL and its derivatives or novel GCL, transformant, etc.
  • a glycolaldehyde composition comprising GCL and its derivatives or novel GCL, transformant, etc.
  • the object of the present invention is not limited to the object mentioned above, and even if not explicitly mentioned, the object of the invention that can be recognized by a person of ordinary skill in the art from the description of the detailed description of the invention to be described later may also be included. .
  • the present invention provides a composition for producing glycolaldehyde comprising glyoxylate carboligase (GCL) and a derivative thereof.
  • GCL glyoxylate carboligase
  • the GCL and its derivatives catalyze a reaction in which two molecules of formaldehyde are condensed into a molecule of glycolaldehyde.
  • the GCL is derived from E. coli.
  • the K M , k cat and k cat /K M values of the GCL are 62 mM, 1.00 s -1 and 16.0 M -1 ⁇ s -1 , respectively.
  • the present invention also provides a novel glyoxylate carboligase (GCL) comprising the amino acid sequence shown in SEQ ID NO: 1.
  • the novel GCL catalyzes the condensation of two molecules of formaldehyde into glycolaldehyde molecules to produce glycolaldehyde.
  • the K M , k cat and k cat /K M values of the novel GCL are 24 mM, 0.8 s -1 and 33.1 M -1 ⁇ s -1 , respectively.
  • the present invention also provides a nucleic acid molecule having a nucleotide sequence encoding the novel GCL described above.
  • the present invention also provides a vector comprising a nucleic acid molecule encoding the novel GCL described above.
  • the present invention provides a transformant comprising the vector described above.
  • the transformant is Escherichia coli.
  • the E. coli is caveolin-1 (CAV1)-mediated endocytosing E. coli (CAV1-mediated endocytosing E. coli ).
  • the transformant further comprises a vector containing a nucleic acid molecule encoding an aminotransferase.
  • the nucleic acid molecule encoding the aminotransferase is a nucleic acid molecule encoding an aminotransferase ( 3HMU ) derived from Ruegeria pomeroyi or an aminotransferase (Af) derived from Agrobacterium fabrum .
  • -AT is a nucleic acid molecule encoding
  • the present invention also provides a method for preparing glycolaldehyde from formaldehyde comprising the step of contacting formaldehyde with any one of the above-mentioned compositions, any one of the above-mentioned novel GCLs, and at least one of the above-mentioned transformants. .
  • the step is carried out at 30°C to 65°C.
  • the K M , k cat and k cat /K M values of GCL which catalyze the reaction in which two molecules of formaldehyde are condensed into glycolaldehyde molecules in the step, are 62 mM, 1.00 s -1 and 16.0, respectively. M -1 ⁇ s -1 or less.
  • the present invention provides a first step of forming glycolaldehyde by contacting formaldehyde with at least one of the above-mentioned composition, any one of the above-mentioned novel GCL, and the above-mentioned transformant; and a second step of adding ⁇ -ketoglutaric semialdehyde dehydrogenase (KGSADH) or ALDH to the reactant obtained in the first step.
  • KGSADH ⁇ -ketoglutaric semialdehyde dehydrogenase
  • ALDH ⁇ -ketoglutaric semialdehyde dehydrogenase
  • the KGSADH is derived from Azospirillum brasilense, and K M , k cat and k cat /K M values are 4 mM, 24 s -1 and 6.1 mM -1 ⁇ s -1 , respectively.
  • KGSADH when added in the second step, more than 70% of the formaldehyde is converted to glycolic acid.
  • the present invention provides a first step of contacting formaldehyde with any one of the above-mentioned compositions, any one of the above-mentioned novel GCLs, and at least one of the above-mentioned transformants to form glycolaldehyde, and the first step obtained in the first step. It provides a method for preparing ethylene glycol comprising a second step of adding 1,3-propanediol dehydrogenase (DhaT) or ADH to a reactant.
  • DhaT 1,3-propanediol dehydrogenase
  • the DhaT is derived from Klebsiella pneumoniae , and K M , k cat and k cat /K M values are 12.5 mM, 1.6 s -1 and 0.13 mM -1 ⁇ s -1 , respectively.
  • the present invention provides a first step of forming glycolaldehyde by contacting formaldehyde with at least one of the above-mentioned composition, any one of the above-mentioned novel GCL, and the above-mentioned transformant; and a second step of adding an aminotransferase and an amine donor to the reactant obtained in the first step; provides a method for preparing ethanolamine comprising.
  • the aminotransferase is an aminotransferase ( 3HMU ) derived from Ruegeria pomeroyi or an aminotransferase (Af-AT) derived from Agrobacterium fabrum .
  • 3HMU aminotransferase
  • Ad-AT aminotransferase
  • the present invention provides a method for preparing ethanolamine from formaldehyde, comprising the step of contacting formaldehyde with at least one of the aforementioned transformants and an amine donor.
  • glycolaldehyde composition of the present invention described above can produce glycolaldehyde from formaldehyde in an environmentally friendly manner, including GCL and its derivatives.
  • novel GCL of the present invention has a sequence altered through genetic manipulation to more effectively produce glycolaldehyde from formaldehyde, and a nucleic acid molecule encoding it, a vector containing the nucleic acid molecule, and transformation containing the vector body can be provided.
  • the production method of the present invention is one of glycolaldehyde, glycolic acid, ethylene glycol and ethanolamine from formaldehyde in an environmentally friendly way using a glycolaldehyde composition including GCL and its derivatives, or novel GCL, transformant, etc. More than that can be produced in high yield.
  • Figure 1a is a photograph of the result of purifying EcGCL expressed in E. coli as a single band by SDS-PAGE
  • Figure 1b is a Hydrogenobacter thermophilus -derived acetolactate synthase (HtALS), Vibrio vulnificus -derived acetolactate synthase (VvALS), Escherichia coli -derived decarboxylyl- (EcOCD), Deinococcus metallilatus-derived GCL (DmGCL), and E. coli -derived GCL (EcGCL) are graphs comparing the carbonization activity.
  • HtALS Hydrogenobacter thermophilus -derived acetolactate synthase
  • VvALS Vibrio vulnificus -derived acetolactate synthase
  • EcOCD Escherichia coli -derived decarboxylyl-
  • DmGCL Deinococcus metallilatus-derived GCL
  • 3 is a graph showing the thermal stability of E. coli-derived GCL.
  • Figure 4a is a schematic diagram showing the comparison of the structures of FLS and two GCLs
  • Figure 4b is a schematic diagram showing that the observed overall structural features of E. coli GCL are well preserved in the structure of D. metallilatus GCL.
  • 5 is a graph showing the result of whole-cell bioconversion from formaldehyde to glycolaldehyde by recombinant E. coli BL21 Star (DE3) co-expressed with caveolin-1 (Cav1) with GCL.
  • 6a and 6b are graphs of results showing the cascade reaction over time in which formaldehyde is converted to glycolic acid and ethylene glycol by KGSADH and DhaT, respectively.
  • FIG. 7 is a graph showing the results of the cascade reaction over time in which formaldehyde is converted to ethanolamine by GCL and Af-TA.
  • FIG. 8 shows a reaction scheme for preparing glycolic acid, ethylene glycol, and ethanolamine after producing glycolaldehyde from formaldehyde using GCL and its derivatives according to the present invention.
  • Figure 9a shows the reaction scheme of the natural substrate catalyzed by GCL, glyoxylate
  • Figure 9b shows the reaction scheme of the natural substrate, 3-hydroxypropanol, catalyzed by KGSADH and DhaT.
  • first, second, etc. may be used to describe various elements, but the elements should not be limited by the terms. The above terms are used only for the purpose of distinguishing one component from another. For example, without departing from the scope of the present invention, a first component may be referred to as a second component, and similarly, a second component may also be referred to as a first component.
  • the technical feature of the present invention is the discovery for the first time that a new use of glyoxylate carboligase (GCL), that is, to catalyze the formation of glycolaldehyde from formaldehyde, is environmentally friendly by using GCL and its derivatives. After producing the aldehyde, glycolic acid, ethylene glycol and ethanolamine are prepared.
  • GCL glyoxylate carboligase
  • composition for producing glycolaldehyde of the present invention includes glyoxylate carboligase (GCL) and its derivatives.
  • glyoxylate carboligase is an enzyme that catalyzes the condensation of two molecules of glyoxylate as shown in the following reaction scheme to give 2-hydroxy-3-oxopropanoate (also called tartronic half aldehyde),
  • GCL and its derivatives catalyze the reaction of condensing two molecules of formaldehyde into glycolaldehyde molecules, and using this, a method for producing glycolaldehyde from formaldehyde was developed. am.
  • GCL and its derivatives included in the composition for producing glycolaldehyde of the present invention are not limited as long as they can catalyze the above-described reaction, and in one embodiment, GCL derived from E. coli and its derivatives may be used.
  • GCL glyoxylate carboligase
  • the K M , k cat and k cat /K M values of GCL and its derivatives included in the composition for producing glycolaldehyde of the present invention are 62 mM, 1.00 s -1 and 16.0 M -1 ⁇ s -1 , respectively.
  • novel glyoxylate carboligase (GCL) of the present invention may be composed of the amino acid sequence described in SEQ ID NO: 1 .
  • the novel GCL is multiplied according to a structure-based strategy of neutralizing the charged surface at the entrance moiety to the active site and narrowing the pathway from the surface to the active site to obtain GCL mutants with superior kinetic parameters than the wild-type enzyme, E. coli-derived GCL.
  • This is the amino acid sequence of the mutant showing the best kinetic parameter characteristics among many GCL mutants obtained by performing the experiment of
  • the novel GCL consisting of the amino acid sequence shown in SEQ ID NO: 1 has a sequence in which Arg484 and Asn283 are substituted with Met484 and Gln283, respectively, compared to the wild-type enzyme by point mutation.
  • the novel GCL also catalyzes the condensation of two molecules of formaldehyde into glycolaldehyde molecules to produce glycolaldehyde.
  • the K M , k cat and k cat /K M values of the novel GCL are 24 mM, 0.8 s -1 and Since 33.1 M ⁇ 1 ⁇ s ⁇ 1 , it can be seen that it has about twice as much superior properties as compared to the above-described wild-type GCL.
  • the novel GCL includes functional equivalents and functional derivatives thereof.
  • “Functional equivalent” of the novel GCL as defined in the present invention refers to a protein that exhibits substantially the same physiological activity as the enzyme consisting of the first sequence of the SEQ ID NO: 1.
  • the term "homogeneous physiological activity” has the ability to catalyze the condensation of two molecules of formaldehyde to perform a reaction to convert it into glycolaldehyde, as shown in FIG. 8, and is at least 50% or more, preferably 70%, More preferably, it refers to having an amino acid sequence homology of 90% or more.
  • “functional equivalent” includes amino acid sequence variants in which some or all of the amino acids of the native protein are substituted, or some of the amino acids are deleted or added. Substitutions of amino acids are preferably conservative substitutions. Examples of conservative substitutions for naturally occurring amino acids are; Aliphatic amino acids (Gly, Ala, Pro), hydrophobic amino acids (Ile, Leu, Val), aromatic amino acids (Phe, Tyr, Trp), acidic amino acids (Asp, Glu), basic amino acids (His, Lys, Arg, Gln, Asn) ) and sulfur-containing amino acids (Cys, Met).
  • “Functional derivative” refers to a novel fragment of GCL, a protein comprising the fragment, or a protein to which modifications are applied to increase or decrease the physicochemical properties of the protein.
  • fragment refers to an amino acid sequence corresponding to a part of a protein, which has a common element of origin, structure and mechanism of action within the scope of the present invention.
  • Derivatives to which GCL is modified to change stability, storage properties, solubility, etc. are also included in the scope of the present invention. Methods for making functional derivatives of such proteins are known.
  • the nucleic acid molecule having a nucleotide sequence encoding the novel GCL of the present invention is meant to comprehensively include DNA (gDNA and cDNA) and RNA molecules. Also includes analogs in which the base region is modified. Accordingly, it preferably has, but is not limited to, a nucleotide sequence encoding the first sequence in SEQ ID NO: 1, as long as it encodes a protein having substantially the same activity, a part of the nucleotide sequence contains a substituted or deleted nucleotide sequence, It can be directly isolated from Thermophilus by a gene cloning method and then chemically synthesized by point mutation or using a DNA synthesizer.
  • the greatest feature of the novel GCL of the present invention is that it has a performance of 24 mM, 0.8 s -1 and 33.1 M -1 ⁇ s -1 of K M , k cat and k cat /K M values, respectively, when performing the reaction. It is clear to those skilled in the art that the novel GCL of the present invention is not limited to the amino acid sequences described in the accompanying sequence listing.
  • the nucleic acid molecule encoding the novel GCL of the present invention can be expressed using any suitable prokaryotic or eukaryotic expression system well known in the art.
  • the vector system of the present invention may be constructed through various methods known in the art, and may be typically constructed as a vector for cloning or a vector for expression.
  • the vector of the present invention can be constructed using a prokaryotic cell or a eukaryotic cell as a host. Since the nucleic acid molecule of the present invention is derived from a prokaryotic cell, it is preferable to use a prokaryotic cell as a host in consideration of the convenience of culture and the like.
  • the expression is E. coli, such as E. coli MV1184, E. coli BL21, E. coli JM109(DE3), E. coli NM522, or yeast such as Saccharomyces cerevisiae , Saccharomyces diastati Curs ( Saccharomyces diastaticus ) and the like may be performed, and preferably performed in E. coli BL21.
  • E. coli MV1184 such as E. coli MV1184, E. coli BL21, E. coli JM109(DE3), E. coli NM522, or yeast such as Saccharomyces cerevisiae , Saccharomyces diastati Curs ( Saccharomyces diastaticus ) and the like may be performed, and preferably performed in E. coli BL21.
  • yeast such as Saccharomyces cerevisiae , Saccharomyces diastati Curs ( Saccharomyces diastaticus ) and the like may
  • the novel GCL gene and caveolin-1 (CAV1) gene are inserted into the hexahistidine-labeled expression vector pET-21a derivative, and the new GCL and keveolin-1 are jointly expressed in CAV1-mediated endo
  • E. coli cytosing CAV1-mediated endocytosing E. coli
  • endocytosing E. coli can be an excellent biocatalyst.
  • a transformant containing a vector containing a nucleic acid molecule encoding a novel GCL and a vector containing a nucleic acid molecule encoding an aminotransferase is prepared, and the novel GCL and aminotransferase are jointly expressed as a biocatalyst. It can be used in the preparation of ethanolamine.
  • the nucleic acid molecule encoding the aminotransferase is a nucleic acid molecule encoding an aminotransferase ( 3HMU ) derived from Ruegeria pomeroyi or an aminotransferase (Af-AT) derived from Agrobacterium fabrum . It may be a nucleic acid molecule that
  • the microbial transformant transformed by the vector that is, the host microorganism containing the desired expression vector
  • the vector is cultured under conditions that maximize the expression of the gene to be expressed and at the same time maintain the optimal growth of the microorganism, followed by culturing.
  • Fresh GCL was recovered and purified from water.
  • the method for producing glycolaldehyde from formaldehyde of the present invention comprises at least one of formaldehyde, any one of the above-mentioned compositions for producing glycolaldehyde, any one of the above-mentioned novel GCL, and any one of the above-mentioned transformants.
  • the K M , k cat and k cat /K M values of GCL which catalyze a reaction in which two molecules of formaldehyde are condensed into glycolaldehyde molecules in the step, are 62 mM, respectively. , 1.00 s ⁇ 1 and 16.0 M ⁇ 1 ⁇ s ⁇ 1 or less, and the above step may be performed at 30° C. to 60° C. This is because GCL and its derivatives have excellent thermal stability, as can be seen from the experimental examples to be described later.
  • one or more of the above-mentioned composition for producing glycolaldehyde, any one of the above-mentioned novel GCL, and any one of the above-mentioned transformants is brought into contact with formaldehyde and glycolaldehyde.
  • KGSADH is derived from Azospirillum brasilense
  • K M , k cat and k cat /K M values are 4 mM, 24 s -1 and 6.1 mM -1 ⁇ s -1 , respectively. and, when KGSADH is added in the second step, more than 70% of the formaldehyde is converted to glycolic acid.
  • one or more of the above-mentioned composition for producing glycolaldehyde, any one of the above-mentioned novel GCL, and any one of the above-mentioned transformants is brought into contact with formaldehyde and glycolaldehyde.
  • DhaT 1,3-propanediol dehydrogenase
  • alcohol dehydrogenase eg, E. coli-derived FucO, YqhD
  • DhaT is derived from Klebsiella pneumoniae , and K M , k cat and k cat /K M values are 12.5 mM, 1.6 s -1 and 0.13 mM -1 s -1 , respectively, and when DhaT is added in the second step, More than 70% of the formaldehyde is converted to ethylene glycol.
  • the ethanolamine production method of the present invention is a method for producing ethanolamine by contacting formaldehyde with one or more of the above-mentioned composition for producing glycolaldehyde, any one of the above-mentioned novel GCL, and any one of the above-mentioned transformants to contact glycolaldehyde.
  • amine donor may be determined depending on the type of aminotransferase used.
  • the method for preparing ethanolamine of the present invention comprises at least one of a transformant containing formaldehyde, a vector containing a nucleic acid molecule encoding a novel GCL and a vector containing a nucleic acid molecule encoding an aminotransferase, and contacting the amine donor.
  • a transformant containing both vectors is used as a biocatalyst
  • glycolaldehyde is formed by the new expressed GCL
  • ethanolamine is formed from the amine donor and glycolaldehyde by the expressed aminotransferase.
  • more than 70% of the formaldehyde can be converted to ethanolamine.
  • GCL mutants with better kinetic parameters than the wild-type enzyme
  • a structure-based strategy was employed that neutralizes the charged surface at the entrance moiety to the active site and narrows the pathway from the surface to the active site. Since the two GCLs are highly conserved not only at the amino acid sequence level but also at the structural level, the generation of GCL derivatives by introduction of point mutations was performed with E. coli GCL.
  • the double mutants replacing Arg484 and Asn283 with Met484 and Gln283 were K M , k cat and k cat /K M with 24 mM, 0.8 s -1 and 33.1 M -1 s -1 , respectively. Enzyme activity with a value was shown.
  • a novel GCL consisting of the amino acid sequence described in SEQ ID NO: 1 was completed.
  • the new GCL which is a variant, has about twice the substrate affinity of that of the wild-type enzyme E. coli GCL, it shows about twice the activity for formaldehyde while maintaining the k cat value. It can be seen that it has better properties when producing glycolaldehyde.
  • acetolactate synthase HtALS
  • VvALS acetolactate synthase
  • EcOCA oxalyl-CoA decarboxylase
  • GCL glyoxylatecarboligase
  • Reaction temperature is one of the main parameters of biotransformation. Therefore, the effect of the reaction temperature on the carboligating activity of E. coli GCL was investigated as follows, and the results are shown in FIG. 2 .
  • the enzyme was added at a concentration of 1 mg/mL in a reaction medium containing 25 mM formaldehyde and sufficient amounts of magnesium (II) ions, thiaminepyrophosphate and flavinadenine dinucleotide. Initial bioconversion rates were determined based on product concentration by HPLC.
  • E. coli GCL has carboligating activity even at a temperature of 50° C. or higher was investigated as follows, and the results are shown in FIG. 3 .
  • the wild-type enzyme, GCL showed K M , k cat and k cat /K M values of 62 mM, 1.00 s -1 and 16.0 M -1 s -1 , respectively. , it can be seen that it shows very good reaction kinetics compared to other known glycolaldehyde producing enzymes (eg, GALS (Nat. Commun. (2019) 26:1378)).
  • the novel GCL composed of the amino acid sequence described in SEQ ID NO: 1 showed that K M , k cat and k cat /K M values were 24 mM, 0.8 s -1 and 33.1 M -1 ⁇ s -1 , respectively.
  • GCL can catalyze the condensation reaction of two glyoxylate molecules to produce tartronate semialdehyde and carbon dioxide through successive decarboxylation and reduction reactions (see FIG. 9a ). So far, only one GCL structure has been reported and shares structural features with the typical pyruvate oxidase family of ThDP enzymes (Nat. Chem. Biol. (2008) 15: 900-906). GCL lacks a conserved Glu residue that interacts with the nitrogen atom of the ThDP moiety, but its absence does not interfere with catalysis. By measuring the crystal structure of GCL from D. metallilatus , which has much less catalytic activity for formaldehyde condensation than E. coli GCL, the structures of FLS and E. coli and D. metallilatus GCL were compared, and schematic diagrams thereof are shown in FIGS. 4A and 4B.
  • E. coli GCL As shown in Fig. 4a, the observed overall structural features of E. coli GCL were D. It is well conserved in the metallilatus GCL structure (mean-squared deviation of 0.805 ⁇ out of 526 aligned residues). The ⁇ -helix (Ala474-Leu494 in E. coli GCL ) provides a residue for interaction with ThDP and magnesium ions in E. coli GCL, presumably due to molecular packing for crystallization and activation of the D. metallilatus GCL structure. It is displaced from the site to a completely different space. These structural properties deplete two cofactors and magnesium ions at the active site of D. metallilatus GCL.
  • a comparison of FLS and two GCL structures reveals changes in the active site with significant differences in regions extending from the intrinsic C-terminus of the three enzymes (C-helix). This C-terminal region contributes to the formation of the active sites of the GCL and FLS enzymes.
  • the spatial orientation between the respective enzyme dipolymers of the three enzymes is the same as EcGCL and DmGCL, but has a large difference from FLS, which is why GCL and FLS show differences and correlations in enzymatic activity is not clear
  • the two GCLs require another cofactor FADH2 for the reduction of the second intermediate.
  • GCL accurately reflects the structural features of ThDP-dependent carboligase enzymes. Therefore, it can be seen that the catalytic mechanism for condensing two formaldehyde molecules of GCL tends to condense formaldehyde molecules of benzaldehyde lyase (FEBS J 272 (23): 6067-6076).
  • GCL can be used in the construction of synthetic methyl feeder cell factories.
  • a GCL-based whole-cell biotransformation system was investigated as follows and the results are shown in FIG. 5 .
  • the first method was to simply overexpress GCL in a soluble form in E. coli BL21 Star (DE3).
  • Another approach has been to use endocytosing E. coli as a biocatalyst that has been reported to be beneficial for biotransformation of toxic and/or hydrophobic reactive substrates (eg fatty acids). That is, for whole-cell bioconversion of formaldehyde to glycolaldehyde by recombinant E.
  • glycolaldehyde is similar to 3-hydroxy propanol.
  • ⁇ -ketoglutaric acid semialdehyde dehydrogenase KGSADH
  • Azospirillum brasilense capable of oxidizing 3-hydroxy propanol to 3-hydroxy propionic acid (KGSADH).
  • DhaT 1,3-propanediol dehydrogenase
  • a cascade reaction of formaldehyde to ethylene glycol via glycolaldehyde was carried out by adding 25 mM formaldehyde to the reaction by GCL and DhaT expressed in E. coli and recovered by affinity chromatography on a Ni-NTA gel matrix. . Since the DhaT enzyme also has a reducing activity for formaldehyde, DhaT was added 1 hour after the initiation of bioconversion by GCL.
  • KGSADH shows K M , k cat and k cat /K M values of 4 mM, 24 s -1 and 6.1 mM -1 s -1 for glycolaldehyde, respectively, so that the catalytic efficiency is GCL for formaldehyde. It can be seen that it is substantially larger than the DhaT exhibited K M , k cat and k cat / K M values of 12.5 mM, 1.6 s -1 and 0.13 mM -1 ⁇ s -1 for glycolaldehyde, respectively.
  • GCL and its derivatives can produce glycolaldehyde from formaldehyde by selectively condensing two molecules of formaldehyde with one molecule of glycolaldehyde, and also dehydrogenation of ⁇ -ketoglutarate semialdehyde from A. brasilense .
  • Enzyme (KGSADH) and coupling with 1,3-propanediol dehydrogenase (DhaT) of K. pneumoniae can be used continuously for two-step biotransformation of formaldehyde via glycolaldehyde to glycolic acid and ethylene glycol.
  • glycolic acid and ethylene glycol can be enzymatically synthesized from formaldehyde through glycolaldehyde in an environmentally friendly manner.
  • aminotransferase (Af-AT) from Agrobacterium fabrum ATU3300 and 3HMU from Ruegeria pomeroyi were selected as candidate enzymes.
  • an E. coli transformant co-expressing GCL and 3HMU can be used instead of the recombinant E. coli BL21 Star (DE3) co-expressing Af-AT with GCL.
  • E. coli transformant was used as a biocatalyst, ethanolamine was accumulated up to 8.1 mM.
  • the first step performed by adding formaldehyde to the E. coli transformant expressing only GCL and the second step adding aminotransferase, that is, Af-AT or 3HMU and an amine donor to the reaction product obtained in the first step Even if the steps are performed, more than 70% of the formaldehyde can be converted to ethanolamine.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Chemical & Material Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Organic Chemistry (AREA)
  • Zoology (AREA)
  • Wood Science & Technology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • General Engineering & Computer Science (AREA)
  • Biomedical Technology (AREA)
  • Biotechnology (AREA)
  • General Health & Medical Sciences (AREA)
  • Biochemistry (AREA)
  • Microbiology (AREA)
  • Molecular Biology (AREA)
  • Physics & Mathematics (AREA)
  • Biophysics (AREA)
  • Plant Pathology (AREA)
  • Medicinal Chemistry (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
  • Enzymes And Modification Thereof (AREA)

Abstract

본 발명은 글리콜알데히드, 글리콜산, 에틸렌글리콜 및 에탄올아민을 생산하는 기술에 관한 것으로, 보다 구체적으로는 포름알데히드를 출발물질로 하면서 생체촉매인 효소를 활용하는 포름알데히드로부터의 글리콜알데히드 생성용 조성물 및 상기 조성물을 이용한 포름알데히드로부터의 글리콜산 에틸렌글리콜 또는 에탄올아민 제조방법에 관한 것이다.

Description

포름알데히드로부터의 글리콜알데히드 생성용 조성물 및 상기 조성물을 이용한 포름알데히드로부터의 글리콜산, 에틸렌글리콜 또는 에탄올 아민 제조방법
본 발명은 글리콜알데히드, 글리콜산, 에틸렌글리콜 및 에탄올아민을 생산하는 기술에 관한 것으로, 보다 구체적으로는 포름알데히드를 출발물질로 하면서 생체촉매인 효소를 활용하는 포름알데히드로부터의 글리콜알데히드 생성용 조성물 및 상기 조성물을 이용한 포름알데히드로부터의 글리콜산 에틸렌글리콜 또는 에탄올아민 제조방법에 관한 것이다.
글리콜알데히드, 글리콜산, 에틸렌글리콜 및 에탄올아민은 섬유산업에서 바이오플라스틱용 모노머, 염료 및 태닝제의 단량체, 식품산업에서 풍미제와 방부제, 유화제, 제약산업에서 피부관리제, 산업 및 가정에서 세정제와 접착제 등으로 널리 사용되고 있으나, 제조 공정 중 강산을 비롯한 유독물질들이 사용되고, 반응의 선택성 및 수율이 높지 않아 오염 물질 배출, 고에너지 사용 등의 다양한 문제가 야기되고 있다 (Appl Microbiol Biotechnol (2019) 103:2525-2535). 대안으로 오탄당과 같은 바이오매스로부터 다단계 효소반응을 통해 생합성하는 바이오공정이 연구개발되고 있으나 낮은 수율과 부산물의 생성 등의 문제를 안고 있다 (Appl Microbiol Biotechnol (2019) 103:2525-2535).
또 다른 방법으로 포름알데히드로부터 효소를 이용한 생합성 연구가 보고되고 있으나 (Nature Chemical Biology (2019) 15:900-906), 포르밀코에이(formyl-coenzyme A (CoA))를 기질로 필요로 하여 경제적인 고수율 생산이 어려운 것으로 판단된다.
따라서, 포름알데히드와 같은 대량 공급이 가능한 화합물로부터 (ACS Catal. 2019, 9, 9575-99588) 글리콜알데히드, 글리콜산, 에틸렌글리콜 및 에탄올아민과 같은 고부가 소재를 고수율로 생성하는 새로운 효소반응 시스템의 개발이 요구되고 있다.
본 발명자들은 다수의 연구결과 포름알데히드로부터 글리콜알데히드 생성을 촉매 하는 글리옥실레이트 카르볼리가제(glyoxylate carboligase: GCL)의 새로운 용도 및 이를 이용하는 글리콜산, 에틸렌글리콜 및 에탄올아민 제조 기술을 개발함으로써 본 발명을 완성하였다
따라서, 본 발명의 목적은 GCL 및 이의 유도체를 포함하여 환경 친화적인 방식으로 포름알데히드로부터 글리콜알데히드를 생성할 수 있는 글리콜알데히드 조성물을 제공하는 것이다.
본 발명의 다른 목적은 보다 효과적으로 포름알데히드로부터 글리콜알데히드를 생성할 수 있도록 유전자 조작을 통해 변경된 서열을 갖는 신규 GCL, 이를 코딩하는 핵산분자, 그 핵산분자를 포함하는 벡터 및 상기 벡터를 포함하는 형질전환체를 제공하는 것이다.
본 발명의 또 다른 목적은 GCL 및 이의 유도체를 포함하는 글리콜알데히드조성물 또는 신규 GCL, 형질전환체 등을 활용하여 환경 친화적인 방식으로 포름알데히드로부터 글리콜알데히드, 글리콜산, 에틸렌글리콜 및 에탄올아민을 고수율로 생산하는 제조방법을 제공하는 것이다.
본 발명의 목적은 이상에서 언급한 목적으로 제한되지 않으며, 명시적으로 언급되지 않았더라도 후술되는 발명의 상세한 설명의 기재로부터 통상의 지식을 가진 자가 인식할 수 있는 발명의 목적 역시 당연히 포함될 수 있을 것이다.
상술된 본 발명의 목적을 달성하기 위해, 본 발명은 글리옥실레이트 카르볼리가제(glyoxylate carboligase: GCL) 및 이의 유도체를 포함하는 글리콜알데히드 생성용 조성물을 제공한다.
바람직한 실시예에 있어서, 상기 GCL 및 이의 유도체는 두 분자의 포름알데히드가 글리콜알데히드 분자 내로 축합되는 반응을 촉매한다.
바람직한 실시예에 있어서, 상기 GCL은 대장균에서 유래된 것이다.
바람직한 실시예에 있어서, 상기 GCL의 K M, k cat 및 k cat/K M 값은 각각 62 mM, 1.00 s -1 및 16.0 M -1·s -1이다.
본 발명은 또한 서열목록 제1서열에 기재된 아미노산 서열로 구성되는 신규글리옥실레이트 카르볼리가제(glyoxylate carboligase: GCL)를 제공한다.
바람직한 실시예에 있어서, 상기 신규 GCL은 두 분자의 포름알데히드가 글리콜알데히드 분자 내로 축합되는 반응을 촉매 하여 글리콜알데히드를 생성하는 것이다.
바람직한 실시예에 있어서, 상기 신규 GCL의 K M, k cat 및 k cat/K M 값은 각각 24 mM, 0.8 s -1 및 33.1 M -1·s -1이다.
또한 본 발명은 상술된 신규 GCL을 코딩하는 뉴클레오타이드 서열을 갖는 핵산분자를 제공한다.
또한 본 발명은 상술된 신규 GCL를 코딩하는 핵산 분자를 포함하는 벡터를 제공한다.
또한, 본 발명은 상술된 벡터를 포함하는 형질전환체를 제공한다.
바람직한 실시예에 있어서, 상기 형질전환체는 대장균이다.
바람직한 실시예에 있어서, 상기 대장균은 카베올린-1(CAV1)- 매개 엔도사이토싱 대장균(CAV1- mediated endocytosing E. coli )이다.
바람직한 실시예에 있어서, 상기 형질전환체는 aminotransferase를 코딩하는 핵산분자를 포함하는 벡터를 더 포함한다.
바람직한 실시예에 있어서, 상기 aminotransferase를 코딩하는 핵산분자는 루게리아 포메로이( Ruegeria pomeroyi)로부터 유래된 aminotransferase(3HMU)를 코딩하는 핵산분자 또는 아그로박테리움 파브럼( Agrobacterium fabrum)으로부터 유래된 aminotransferase(Af-AT)를 코딩하는 핵산분자이다.
또한, 본 발명은 포름알데히드와, 상술된 어느 하나의 조성물, 상술된 어느 하나의 신규 GCL, 상술된 형질전환체 중 하나 이상을 접촉시키는 단계를 포함하는 포름알데히드로부터의 글리콜알데히드 제조방법을 제공한다.
바람직한 실시예에 있어서, 상기 단계는 30℃ 내지 65℃에서 수행된다.
바람직한 실시예에 있어서, 상기 단계에서 두 분자의 포름알데히드가 글리콜알데히드 분자 내로 축합되는 반응을 촉매 하는 GCL의 K M, k cat 및 k cat/K M 값은 각각 62 mM, 1.00 s -1 및 16.0 M -1·s -1 이하이다.
또한, 본 발명은 포름알데히드와, 상술된 어느 하나의 조성물, 상술된 어느 하나의 신규 GCL, 상술된 형질전환체 중 하나 이상을 접촉시켜 글리콜알데히드를 형성하는 제1단계; 및 상기 제1단계에서 얻어진 반응물에 α-ketoglutaric semialdehyde dehydrogenase (KGSADH) 또는 ALDH를 첨가하는 제2단계를 포함하는 글리콜산 제조방법을 제공한다.
바람직한 실시예에 있어서, 상기 KGSADH는 Azospirillum brasilense로부터 유래된 것으로, K M, k cat 및 k cat/K M 값이 각각 4 mM, 24 s -1 및 6.1 mM -1·s -1이다.
바람직한 실시예에 있어서, 상기 제2단계에서 KGSADH를 첨가하면 상기 포름알데히드의 70% 이상이 글리콜산으로 전환된다.
또한, 본 발명은 포름알데히드와, 상술된 어느 하나의 조성물, 상술된 어느 하나의 신규 GCL, 상술된 형질전환체 중 하나 이상을 접촉시켜 글리콜알데히드를 형성하는 제1단계 및 상기 제1단계에서 얻어진 반응물에 1,3-propanediol dehydrogenase (DhaT) 또는 ADH를 첨가하는 제2단계를 포함하는 에틸렌글리콜 제조방법을 제공한다.
바람직한 실시예에 있어서, 상기 DhaT는 Klebsiella pneumoniae로부터 유래된 것으로, K M, k cat 및 k cat/K M 값이 각각 12.5 mM, 1.6 s -1 및 0.13 mM -1·s -1이다.
바람직한 실시예에 있어서, 상기 제2단계에서 DhaT를 첨가하면 상기 포름알데히드의 70% 이상이 에틸렌글리콜로 전환된다.
또한, 본 발명은 포름알데히드와, 상술된 어느 하나의 조성물, 상술된 어느 하나의 신규 GCL, 상술된 형질전환체 중 하나 이상을 접촉시켜 글리콜알데히드를 형성하는 제1단계; 및 상기 제1단계에서 얻어진 반응물에 aminotransferase 및 아민공여체를 첨가하는 제2단계;를 포함하는 에탄올아민 제조방법을 제공한다.
바람직한 실시예에 있어서,상기 aminotransferase는 루게리아 포메로이( Ruegeria pomeroyi )로부터 유래된 aminotransferase(3HMU) 또는 아그로박테리움 파브럼( Agrobacterium fabrum )으로부터 유래된 aminotransferase(Af-AT)이다.
또한, 본 발명은 포름알데히드와, 상술된 어느 하나의 형질전환체 중 하나 이상 및 아민공여체를 접촉시키는 단계를 포함하는 포름알데히드로부터의 에탄올아민 제조방법을 제공한다.
상술된 본 발명의 글리콜알데히드 조성물은 GCL 및 이의 유도체를 포함하여 환경 친화적인 방식으로 포름알데히드로부터 글리콜알데히드를 생성할 수 있다.
또한, 본 발명의 신규 GCL은 보다 효과적으로 포름알데히드로부터 글리콜알데히드를 생성할 수 있도록 유전자 조작을 통해 변경된 서열을 갖고, 이를 코딩하는 핵산분자, 그 핵산분자를 포함하는 벡터 및 상기 벡터를 포함하는 형질전환체를 제공할 수 있다.
또한, 본 발명의 제조방법은 GCL 및 이의 유도체를 포함하는 글리콜알데히드조성물 또는 신규 GCL, 형질전환체 등을 활용하여 환경 친화적인 방식으로 포름알데히드로부터 글리콜알데히드, 글리콜산, 에틸렌글리콜 및 에탄올아민 중 하나 이상을 고수율로 생산할 수 있다.
본 발명의 이러한 기술적 효과들은 이상에서 언급한 범위만으로 제한되지 않으며, 명시적으로 언급되지 않았더라도 후술되는 발명의 실시를 위한 구체적 내용의 기재로부터 통상의 지식을 가진 자가 인식할 수 있는 발명의 효과 역시 당연히 포함된다.
도 1a는 대장균에서 발현된 EcGCL을 SDS-PAGE에서 단일 밴드로 정제한 결과사진이고, 도 1b는 Hydrogenobacter thermophilus 유래 acetolactate synthase (HtALS), Vibrio vulnificus 유래 acetolactate synthase (VvALS), Escherichia coli 유래 oxalyl-CoA decarboxylase (EcOCD), Deinococcus metallilatus 유래 GCL (DmGCL), E. coli 유래 GCL (EcGCL)의 탄화 활성 비교 결과그래프이다.
도 2는 EcGCL의 탄화 작용에 대한 반응 온도의 영향을 나타낸 그래프이다.
도 3은 대장균 유래 GCL의 열안정성을 보여주는 결과그래프이다.
도 4a는 FLS와 두 GCL 구조를 비교하여 나타낸 모식도이고, 도 4b는 대장균 GCL의 관찰된 전체 구조적 특징이 D. metallilatus GCL 구조에서 잘 보존되어 있음을 보여주는 모식도이다.
도 5는 GCL과 함께 카베올린-1(Cav1)이 공동 발현된 재조합 E. coli BL21 Star (DE3)에 의한 포름알데히드로부터 글리콜알데히드로의 전체 세포 생물 전환된 결과를 나타낸 그래프이다.
도 6a 및 도 6b는 각각 포름알데히드가 KGSADH 및 DhaT에 의해 글리콜산 및 에틸렌글리콜로 전환되는 시간경과에 따른 캐스케이드 반응을 보여주는 결과그래프이다.
도 7은 포름알데히드가 GCL과 Af-TA에 의해 에탄올아민으로 전환되는 시간경과에 따른 캐스케이드 반응을 보여주는 결과를 나타낸 그래프이다.
도 8은 본 발명에 따라 GCL 및 이의 유도체를 이용하여 포름알데히드로부터 글리콜알데히드를 생성한 후 글리콜산, 에틸렌글리콜 및 에탄올아민을 제조하는 반응식을 나타낸 것이다.
도 9a는 GCL에 의해 촉매되는 천연 기질, 글리옥실레이트의 반응식을 나타낸 것이고, 도 9b는 KGSADH, DhaT에 의해 촉매되는 천연 기질, 3-하이드록시프로판올의 반응식을 나타낸 것이다.
본 발명에서 사용하는 용어는 단지 특정한 실시예들을 설명하기 위해 사용된 것으로, 본 발명을 한정하려는 의도가 아니다. 단수의 표현은 문맥상 명백하게 다르게 뜻하지 않는 한, 복수의 표현을 포함한다. 본 출원에서, "포함하다" 또는 "가지다" 등의 용어는 발명의 설명에 기재된 특징, 숫자, 단계, 동작, 구성 요소, 부분품 또는 이들을 조합한 것이 존재함을 지정하려는 것이지, 하나 또는 그 이상의 다른 특징들이나 숫자, 단계, 동작, 구성 요소, 부분품 또는 이들을 조합한 것들의 존재 또는 부가 가능성을 미리 배제하지 않는 것으로 이해되어야 한다.
제1, 제2 등의 용어는 다양한 구성 요소들을 설명하는데 사용될 수 있지만, 상기 구성 요소들은 상기 용어들에 의해 한정되어서는 안된다. 상기 용어들은 하나의 구성 요소를 다른 구성 요소로부터 구별하는 목적으로만 사용된다. 예를 들어, 본 발명의 권리 범위를 벗어나지 않으면서 제1 구성 요소는 제2 구성 요소로 명명될 수 있고, 유사하게 제2 구성 요소도 제1 구성 요소로 명명될 수 있다.
다르게 정의되지 않는 한, 기술적이거나 과학적인 용어를 포함해서 여기서 사용되는 모든 용어들은 본 발명이 속하는 기술 분야에서 통상의 지식을 가진 자에 의해 일반적으로 이해되는 것과 동일한 의미를 갖는다. 일반적으로 사용되는 사전에 정의되어 있는 것과 같은 용어들은 관련 기술의 문맥상 가지는 의미와 일치하는 의미를 갖는 것으로 해석되어야 하며, 본 발명에서 명백하게 정의하지 않는 한, 이상적이거나 과도하게 형식적인 의미로 해석되지 않는다.
구성 요소를 해석함에 있어서, 별도의 명시적 기재가 없더라도 오차 범위를 포함하는 것으로 해석한다. 특히, 정도의 용어 "약", "실질적으로" 등이 사용되는 경우 언급된 의미에 고유한 제조 및 물질 허용오차가 제시될 때 그 수치에서 또는 그 수치에 근접한 의미로 사용되는 것으로 해석될 수 있다.
시간 관계에 대한 설명일 경우, 예를 들어, '~후에', '~에 이어서', '~다음에', '~전에' 등으로 시간적 선후관계가 설명되는 경우, '바로' 또는 '직접'이 사용되지 않는 이상 연속적이지 않은 경우도 포함한다.
이하, 첨부한 도면 및 바람직한 실시예들을 참조하여 본 발명의 기술적 구성을 상세하게 설명한다.
그러나, 본 발명은 여기서 설명되는 실시예에 한정되지 않고 다른 형태로 구체화 될 수도 있다. 명세서 전체에 걸쳐 본 발명을 설명하기 위해 사용되는 동일한 참조번호는 동일한 구성요소를 나타낸다.
본 발명의 기술적 특징은 글리옥실레이트 카르볼리가제(glyoxylate carboligase: GCL)의 새로운 용도 즉 포름알데히드로부터 글리콜알데히드 생성을 촉매 한다는 것을 최초로 발견하고, GCL 및 이의 유도체를 이용하여 친환경적으로 포름알데히드로부터 글리콜알데히드를 생성한 후 글리콜산, 에틸렌글리콜 및 에탄올아민을 제조하는 것에 있다.
따라서, 본 발명의 글리콜알데히드 생성용 조성물은 글리옥실레이트 카르볼리가제(glyoxylate carboligase: GCL) 및 이의 유도체를 포함한다.
즉, 글리옥실레이트 카르볼리가제는 하기 반응식과 같이 두 분자의 글리옥실레이트의 축합을 촉매하여 2-히드록시-3-옥소프로파노에이트(타르트론산 반 알데히드라고도 함)를 제공하는 효소로서,
Figure PCTKR2020018314-appb-img-000001
다양한 미생물에서 얻을 수 있는데, 본 발명에서 최초로 GCL 및 이의 유도체가 두 분자의 포름알데히드를 글리콜알데히드 분자 내로 축합시키는 반응을 촉매 하는 것을 밝히고 이를 이용하여 포름알데히드로부터 글리콜알데히드를 생성하는 방법을 개발하였기 때문이다.
여기서, 본 발명의 글리콜알데히드 생성용 조성물에 포함되는 GCL 및 이의 유도체는 상술된 반응을 촉매할 수 있기만 하면 제한되지 않는데, 일 구현예로서 대장균 유래 GCL 및 이의 유도체일 수 있다. 특히, 후술하는 바와 같이 대장균 K-12로부터 얻어진 야생형 효소 글리옥실레이트 카르볼리가제(GCL)가 포름알데히드로부터 가장 많은 양의 글리콜알데히드를 생성하는 것으로 밝혀졌다.
또한, 본 발명의 글리콜알데히드 생성용 조성물에 포함되는 GCL 및 이의 유도체의 K M, k cat 및 k cat/K M 값은 각각 62 mM, 1.00 s -1 및 16.0 M -1·s -1이다.
다음으로, 본 발명의 신규 글리옥실레이트 카르볼리가제(glyoxylate carboligase: GCL)는 서열목록 제1서열에 기재된 아미노산 서열로 구성될 수 있다.
신규 GCL은 야생형 효소인 대장균 유래 GCL 보다 우수한 운동 파라미터를 갖는 GCL 돌연변이체를 수득하기 위해, 입구 부분에서 하전된 표면을 활성 부위로 중화시키고 표면으로부터 활성 부위로 경로를 좁히는 구조-기반 전략에 따라 다수의 실험을 수행하여 얻어진 다수의 GCL돌연변이체 중 가장 우수한 운동 파라미터 특성을 나타낸 돌연변이체의 아미노산 서열이다. 서열목록 제1서열에 기재된 아미노산 서열로 구성되는 신규 GCL은 포인트 뮤테이션에 의해 야생형 효소와 비교하여 Arg484 및 Asn283이 각각 Met484 및 Gln283로 치환된 서열을 갖는다.
신규 GCL 또한 두 분자의 포름알데히드가 글리콜알데히드 분자 내로 축합되는 반응을 촉매 하여 글리콜알데히드를 생성하는데, 신규 GCL의 K M, k cat 및 k cat/K M 값은 각각 24 mM, 0.8 s -1 및 33.1 M -1·s -1이므로, 상술된 야생형 GCL과 비교하면 2배 정도의 우수한 특성을 갖는 것을 알 수 있다.
여기서, 신규 GCL에는 그의 기능적 동등물 및 기능적 유도체가 포함된다. 본 발명의 정의상 신규 GCL의 "기능적 동등물"이란 상기 서열목록 제1서열로 이루어진 효소와 실질적으로 동질의 생리활성을 나타내는 단백질을 말한다. "동질의 생리활성"이란 도 8에 도시된 바와 같이 2분자의 포름알데히드의 축합을 촉매하여 글리콜알데히드로 전환시키는 반응을 수행할 수 있는 능력이 있으며, 적어도 50% 이상의, 바람직하게는 70%, 더욱 바람직하게는 90% 이상의 아미노산 서열 상동성을 갖는 것을 말한다.
또한 "기능적 동등물"에는 천연형 단백질 아미노산 중 일부 또는 전부가 치환되거나, 아미노산의 일부가 결실 또는 부가된 아미노산 서열 변형체가 포함된다. 아미노산의 치환은 바람직하게는 보존적 치환이다. 천연에 존재하는 아미노산의 보존적 치환의 예는 다음과 같다; 지방족 아미노산(Gly, Ala, Pro), 소수성 아미노산(Ile,Leu, Val), 방향족 아미노산(Phe,Tyr, Trp), 산성 아미노산(Asp, Glu), 염기성 아미노산(His, Lys, Arg, Gln,Asn) 및 황함유 아미노산(Cys, Met).
"기능적 유도체" 는 신규 GCL의 단편, 상기 단편을 포함하는 단백질, 또는 단백질의 물리 화학적 성질을 증가 또는 감소시키기 위한 변형을 가한 단백질을 말한다. " 단편" 이란 용어는 단백질의 일부에 해당하는 아미노산 서열로서, 본 발명의 범위내에 속하는 공통의 기원 요소, 구조 및 작용 메카니즘을 가진 것을 말한다. GCL의 안정성, 저장성, 용해도 등을 변경시키기 위한 변형을 가한 유도체도 본 발명의 범위에 포함된다. 상기와 같은 단백질의 기능적 유도체를 만드는 방법은 공지되어 있다.
본 발명의 신규 GCL를 코딩하는 뉴클레오타이드 서열을 갖는 핵산분자는 DNA(gDNA 및 cDNA) 그리고 RNA 분자를 포괄적으로 포함하는 의미가 있으며, 핵산 분자에서 기본 구성 단위인 뉴클레오타이드는 자연의 뉴클레오타이드뿐만 아니라, 당 또는 염기 부위가 변형된 유사체(analogue)도 포함한다. 따라서, 바람직하게는 서열목록 제1서열을 코딩하는 뉴클레오티드 서열을 가지나 이에 제한되는 것은 아니며 실질적으로 동일한 활성을 갖는 단백질을 코드화하는 한 뉴클레오티드 서열의 일부가 치환 또는 삭제된 뉴클레오티드 서열을 포함하고, 공지된 유전자 클로닝 방법으로 직접 써머스 써모필러스로부터 분리한 후 포인트 뮤테이션하거나 DNA 합성기를 사용하여 화학적으로 합성할 수 있다.
따라서, 본 발명의 신규 GCL의 가장 큰 특징은 반응 수행시 K M, k cat 및 k cat/K M 값이 각각 24 mM, 0.8 s -1 및 33.1 M -1·s -1인 수행능력을 갖는다는 전제하에서, 본 발명의 신규 GCL은 첨부한 서열목록에 기재된 아미노산 서열에 한정되지 않는다는 것은 당업자에게 명확하다.
본 발명의 신규 GCL를 코드화하는 핵산분자는 당 분야에 잘 공지된 적당한 원핵 또는 진핵 발현시스템 중 어느 하나를 사용하여 이를 발현시킬 수 있다. 이와 같이 본 발명의 벡터 시스템은 당업계에 공지된 다양한 방법을 통해 구축될 수 있는데, 전형적으로 클로닝을 위한 벡터 또는 발현을 위한 벡터로서 구축될 수 있다. 또한, 본 발명의 벡터는 원핵 세포 또는 진핵 세포를 숙주로 하여 구축될 수 있다. 본 발명의 핵산 분자가 원핵세포 유래이고, 배양의 편의성 등을 고려하여, 원핵세포를 숙주로 하는 것이 바람직하다.
특히, 발현이 대장균 예를 들어, 대장균 MV1184, 대장균 BL21, 대장균 JM109(DE3), 대장균 NM522, 또는 효모, 예를 들어, 사카로 마이세스 세레비지애( Saccharomyces cerevisiae), 사카로마이세스 다이아스타티커스( Saccharomyces diastaticus)등에서 수행되는 될 수 있으며, 대장균 BL21에서 수행하는 것이 바람직하다. 대장균 및 효모에서의 발현을 위해 사용될 수 있는 적당한 벡터들이 다수 공지되어 있는데, 본 발명에서는 신규한 GCL의 유전자를 헥사히스티딘이 표지된 발현 벡터pET-21a 유도체에 삽입하여 사용하였다.
또한, 본 발명에서는 신규한 GCL의 유전자 및 카베올린-1(CAV1) 유전자를 헥사히스티딘이 표지된 발현 벡터 pET-21a 유도체에 삽입하여 신규 GCL과 케베올린-1이 공동으로 발현된 CAV1-매개 엔도사이토싱 대장균(CAV1-mediated endocytosing E. coli )을 사용함으로써, 엔도사이토싱 E. coli가 우수한 생체촉매가 될 수 있음을 확인하였다.
필요한 경우, 본 발명에서는 신규 GCL를 코드화하는 핵산분자를 포함하는 벡터와 aminotransferase를 코딩하는 핵산분자를 포함하는 벡터를 같이 포함하는 형질전환체를 제조하여 신규 GCL과 aminotransferase를 공동으로 발현하는 생촉매로서 에탄올아민제조시 사용할 수 있다. 여기서, aminotransferase를 코딩하는 핵산분자는 루게리아 포메로이( Ruegeria pomeroyi)로부터 유래된 aminotransferase (3HMU)를 코딩하는 핵산분자 또는 아그로박테리움 파브럼( Agrobacterium fabrum)으로부터 유래된 aminotransferase(Af-AT)를 코딩하는 핵산분자일 수 있다.
본 발명에서는 후술하는 바와 같이 벡터에 의해 형질 전환된 미생물 형질전환체 즉 목적 발현 벡터를 함유하는 숙주 미생물은 발현시킬 유전자의 발현을 최대화하는 동시에 미생물의 최적 성장을 유지하는 조건에서 배양한 후, 배양물로부터 신규 GCL을 회수 및 정제하였다.
다음으로, 본 발명의 포름알데히드로부터의 글리콜알데히드 제조방법은 포름알데히드와, 상술된 어느 하나의 글리콜알데히드 생성용 조성물, 상술된 어느 하나의 신규 GCL, 상술된 어느 하나의 형질전환체 중 하나 이상을 접촉시키는 단계를 포함할 수 있는데, 일 구현예로서 상기 단계에서 두 분자의 포름알데히드가 글리콜알데히드 분자 내로 축합되는 반응을 촉매 하는 GCL의 K M, k cat 및 k cat/K M 값은 각각 62 mM, 1.00 s -1 및 16.0 M -1·s -1 이하일 수 있으며, 상기 단계가 30℃ 내지 60℃에서 수행될 수 있다. 이것은 후술하는 실험예에서 알 수 있듯이 GCL 및 그의 유도체가 열적안정성이 우수하기 때문이다.
다음으로, 본 발명의 글리콜산 제조방법은 포름알데히드와, 상술된 어느 하나의 글리콜알데히드 생성용 조성물, 상술된 어느 하나의 신규 GCL, 상술된 어느 하나의 형질전환체 중 하나 이상을 접촉시켜 글리콜알데히드를 형성하는 제1단계 및 상기 제1단계에서 얻어진 반응물에 α-ketoglutaric semialdehyde dehydrogenase (KGSADH) 또는 Aldehyde dehydrogenase (예로 대장균 유래 AldA) 또는 Aldehyde oxidase (예로 Gluconobacter oxydans 유래 Aldehyde oxidase)를 첨가하는 제2단계를 포함할 수 있는데, 일 구현예로서 상기 KGSADH는 Azospirillum brasilense로부터 유래된 것으로, K M, k cat 및 k cat/K M 값이 각각 4 mM, 24 s -1 및 6.1 mM -1·s -1이며, 상기 제2단계에서 KGSADH를 첨가하면 상기 포름알데히드의 70% 이상이 글리콜산으로 전환된다.
다음으로, 본 발명의 에틸렌글리콜 제조방법은 포름알데히드와, 상술된 어느 하나의 글리콜알데히드 생성용 조성물, 상술된 어느 하나의 신규 GCL, 상술된 어느 하나의 형질전환체 중 하나 이상을 접촉시켜 글리콜알데히드를 형성하는 제1단계; 및 상기 제1단계에서 얻어진 반응물에 1,3-propanediol dehydrogenase (DhaT) 또는 Alcohol dehydrogenase, 또는 glycolaldehyde reductase (예로 대장균 유래 FucO, YqhD)를 첨가하는 제2단계를 포함할 수 있는데, 일 구현예로서 상기 DhaT는 Klebsiella pneumoniae로부터 유래된 것으로, K M, k cat 및 k cat/K M 값이 각각 12.5 mM, 1.6 s -1 및 0.13 mM -1·s -1이며, 상기 제2단계에서 DhaT를 첨가하면 상기 포름알데히드의 70%이상이 에틸렌글리콜로 전환된다.
다음으로, 본 발명의 에탄올아민 제조방법은 포름알데히드와, 상술된 어느 하나의 글리콜알데히드 생성용 조성물, 상술된 어느 하나의 신규 GCL, 상술된 어느 하나의 형질전환체 중 하나 이상을 접촉시켜 글리콜알데히드를 형성하는 제1단계; 및 상기 제1단계에서 얻어진 반응물에 aminotransferase 및 아민공여체를 첨가하는 제2단계;를 포함할 수 있는데, 일 구현예로서 aminotransferase는 루게리아 포메로이( Ruegeria pomeroyi )로부터 유래된 aminotransferase(3HMU) 또는 아그로박테리움 파브럼( Agrobacterium fabrum )으로부터 유래된 aminotransferase(Af-AT)일 수 있으며, 아민공여체를 사용되는 aminotransferase의 종류에 따라 결정될 수 있는데, 제2단계가 수행되면 포름알데히드의 70% 이상이 에탄올아민으로 전환된다.
다른 구현예로서, 본 발명의 에탄올아민 제조방법은 포름알데히드와, 신규 GCL를 코드화하는 핵산분자를 포함하는 벡터 및 aminotransferase를 코딩하는 핵산분자를 포함하는 벡터를 같이 포함하는 형질전환체 중 하나 이상 및 아민공여체를 접촉시키는 단계를 포함할 수 있다. 이와 같이 2개의 벡터를 모두 포함하는 형질전환체를 생촉매로 사용하게 되면 발현된 신규 GCL에 의해서 글리콜알데히드가 형성되고, 발현된 aminotransferase에 의해 아민공여체와 글리콜알데히드로부터 에탄올아민이 형성될 수 있는데, 이 경우에도 포름알데히드의 70% 이상이 에탄올아민으로 전환될 수 있다.
실시예 1
다음과 같은 카르볼리가제의 선별 전략을 통해 2 개의 GCL을 선택하였다.
도 8에 도시된 바와 같이 두 분자의 포름알데히드를 글리콜알데히드의 한 분자에 결찰(반응식 1)하기 위한 후보효소를 찾기 위해, DALI 서버(http://www.http://ekhidna2.biocenter.helsinki.fi/dali/) 및 단백질 3차원 구조 데이터 뱅크 (http://www.rcsb.org)에 열거된 단백질에 대한 참조 구조로서 합성 포름알데히드-전환 FLS (PDB ID 4qq8)를 사용하여 구조적 유사성 검색을 수행 하였다.
이 검색은 아세토락테이트신타제(ALS), 옥살릴-CoA 데카르복실라제(OCD) 및 글리옥실레이트카르볼리가제 (GCL)를 포함하여 구조적으로 관련된 여러 효소(Z 점수 30 이상, 3 Å 이하 근사 제곱 편차)를 검색한 것이다. 포름알데히드 및 아세트알데히드에 대한 카르볼리가제의 상대 활성 결과를 나타낸 하기 표 1에 나타난 바와 같이 이들 효소의 대부분은 보고된 촉매활성을 위해 일부효소(예 : FAD)가 다른 보조 인자를 필요로 하지만 ThDP에 의존적이다. 활성 부위 및 기질 특이성에 대한 미세한 구조적 특징을 고려하여, Hydrogenobacter thermophilus와 Vibrio vulnificus에서 2 개의 ALS, E. coli 및 Deinococcus metallilatus에서 각각 2 개의 GCL을 선택했다.
Name Source Activity for formaldehyde Activity for acetaldehyde 비고
EcsucA E. coli - ++ 본 발명
TtMend T. terrenum - - 본 발명
MbsucA M. bovis - + 본 발명
VvsucA V. vulnificus - +++ 본 발명
HtALS H. thermophilus + - 본 발명
VvALS V. vulnificus + - 본 발명
TtTKS T. thermophilus - - 본 발명
HtTKS H. thermophilus - - 본 발명
EcOCD E. coli + - 본 발명
DmGCL D. metallilatus ++ - 본 발명
EcGCL E. coli ++++ - 본 발명
EcGCL R484M/N283Q E. coli ++++++ - 본 발명
GALS P. putida +++ Nat. Commun.(2019)*
* Nat. Commun. (2019) 26:1378
실시예 2
야생형 효소보다 우수한 운동 파라미터를 갖는 GCL 돌연변이체를 수득하기 위해, 입구 부분에서 하전된 표면을 활성 부위로 중화시키고 표면으로부터 활성 부위로 경로를 좁히는 구조-기반 전략이 채택되었다. 2 개의 GCL이 아미노산 서열 수준뿐만 아니라 구조적 수준에서 고도로 보존되기 때문에, 포인트 뮤테이션의 도입에 의한 GCL 유도체의 생성이 E. coli GCL로 수행되었다.
구축된 몇몇 유도체들 중에서, Arg484 및 Asn283을 Met484 및 Gln283로 대체하는 이중 돌연변이체는 각각 24 mM, 0.8 s -1 및 33.1 M -1·s -1인 K M, k cat 및 k cat/K M 값을 가진 효소 활성을 나타냈다. 상기 이중 돌연변이체를 선택하여 서열목록 제1서열에 기재된 아미노산 서열로 구성된 신규 GCL을 완성하였다.
변이체인 신규 GCL은 야생형 효소인 E. coli GCL의 것보다 2배 정도의 기질 친화도를 가지므로, k cat 값을 유지한 채, 포름알데히드에 대한 2배 정도의 활성을 보이게 되어, 포름알데히드로부터의 글리콜알데히드 생성시 보다 우수한 특성을 갖는 것을 알 수 있다.
실험예 1
2 분자의 포름알데히드를 1 분자의 글리콜알데히드로 결찰하기 위한 후보 효소의 촉매 활성을 추정하기 위해, 대장균에서 발현하고 Ni-NTA 겔 매트릭스에서 친화성 크로마토그래피로 정제하여 효소를 제조하고 그 결과를 도 1a에 나타내었으며, Hydrogenobacter thermophilus 유래 acetolactate synthase (HtALS), Vibrio vulnificus 유래 acetolactate synthase (VvALS), Escherichia coli 유래 oxalyl-CoA decarboxylase (EcOCA), Deinococcus metallilatus 유래 GCL (DmGCL), E. coli 유래 GCL (EcGCL)의 탄소-탄소 연결(탄화) 활성을 비교하기 위해 효소를 반응 매질에서 1 mg/mL에 첨가 하였고 그 결과를 도 1b에 나타내었다. 초기 생물 전환율은 HPLC에 확인된 생성물 농도에 기초하여 결정되었다.
도 1a에 도시된 바와 같이 대부분의 효소는 대장균에서 가용성 형태로 발현되었고 SDS-PAGE에서 단일 밴드로 정제되었다. 도 1b에 도시된 바와 같이 시험된 효소 중에서, E. coli K-12의 글리옥실 레이트카르볼리가제 (GCL)는 생물 변형 10 시간 후 포름알데히드로부터 가장 많은 양의 글리콜알데히드를 생성하였으며, GCL
이 포름알데히드의 탄화(carboligation : 탄소-탄소 연결)에 가장 강한 활성을 갖는 것을 나타냈다.
실험예 2
반응 온도는 생체 변형의 주요 매개 변수 중 하나이다. 따라서, E. coli GCL의 탄화 활성(carboligating activity)에 대한 반응 온도의 영향을 다음과 같이 조사하고 그 결과를 도 2에 나타냈다. 효소는 25 mM 포름알데히드 및 충분한 양의 마그네슘 (Ⅱ) 이온, 티아민피로포스페이트 및 플라빈아데닌 디 뉴클레오티드를 함유하는 반응 매질에서 1 mg/mL의 농도로 첨가되었다. 초기 생물 전환율은 HPLC에 의한 생성물 농도에 기초하여 결정되었다.
도 2에 도시된 바와 같이, 특정 글리콜알데히드 형성 속도 및 최종 생성물 농도는 30에서 50℃의 반응 온도로 증가 하였다. 이 결과는 효소가 상당한 열안정성을 갖으며 최적의 반응 온도가 50℃를 초과할 수 있음을 나타낸다.
실험예 3
50℃ 이상의 온도에서도 E. coli GCL이 탄화 활성(carboligating activity)을 갖는지 여부를 다음과 같이 조사하고 그 결과를 도 3에 나타냈다.
도 3의 결과는 효소가 25 mM 포름알데히드 및 충분한 양의 마그네슘 (Ⅱ) 이온, 티아민피로포스페이트 및 플라빈아데닌 디 뉴클레오티드를 함유하는 50 mM potassium phosphate buffer (pH 6)로 된 반응 매질에 1 mg/mL의 농도로 첨가된 후 30℃에서 60℃로 유지하여 얻어진 결과이다.
이와 같이 도 3의 결과는 본 발명의 GCL 및 이의 유도체가 50℃에서도 활성을 유지하는 것을 보여주므로 고온에서도 사용할 수 있어 그 활용도가 높은 것을 보여준다.
실험예 4
포름알데히드의 결찰에 대한 GCL의 반응 특성을 이해하기 위해, 반응 동역학을 조사하고, 그 결과를 표 2에 나타냈다.
Figure PCTKR2020018314-appb-img-000002
* 데이터는 이전 연구 (Nat. Commun. (2019) 26:1378)에서 채택되었다.
표 2에 나타난 바와 같이, 정상 상태 동역학 연구에서 야생형 효소인 GCL은 각각 62 mM, 1.00 s -1 및 16.0 M -1·s -1의 K M, k cat 및 k cat/K M 값을 보여 주었고, 이는 종래 알려진 다른 글리콜알데히드 생성 효소(예를 들어, GALS (Nat. Commun. (2019) 26:1378))와 비교하여 매우 우수한 반응동력학을 보여주는 것을 알 수 있다. 또한 서열목록 제1서열에 기재된 아미노산 서열로 구성된 신규 GCL은 K M, k cat 및 k cat/K M 값이 각각 24 mM, 0.8 s -1 및 33.1 M -1·s -1인 것으로 나타났다.
이것은 포름알데히드가 효소 및 미생물 세포 모두에 매우 독성이 있기 때문에 매우 중요한 특징이다. 더욱이, 포름알데히드는 미생물 세포가 생체 촉매로서 사용될 때 배경 효소에 의해 포름산으로 전환 될 수 있다. 이러한 결과는 GCL 및 이의 유도체가 포름알데히드로부터 글리콜알데히드를 높은 전환 수율로 생산하기 위한 신규하고 유망한 카르볼리가제로 사용될 수 있음을 보여준다.
실험예 5
GCL은 2개의 글리옥실레이트 분자의 축합 반응을 촉매하여 연속적인 탈카르복실화 및 환원 반응을 통해 타르트로네이트 세미알데히드 및 이산화탄소를 생성할 수 있다(도 9a 참조). 지금까지 단 하나의 GCL 구조만 보고되었으며 ThDP 효소의 전형적인 피루베이트 산화효소 계열과 구조적 특징을 공유한다(Nat. Chem. Biol. (2008) 15: 900-906). GCL에는 ThDP 부분의 질소 원자와 상호 작용하는 보존된 Glu 잔기가 없지만, 이의 부재가 촉매 작용을 방해하지는 않는다. 대장균 GCL보다 포름알데히드 축합에 대한 촉매 활성이 훨씬 적은 D. metallilatus로부터 GCL의 결정 구조를 측정하여, FLS와 대장균 및 D. metallilatus GCL 구조를 비교하고 그 모식도를 도 4a 및 도 4b에 나타내었다.
도 4a에 도시된 바와 같이 대장균 GCL의 관찰된 전체 구조적 특징은 D . metallilatus GCL 구조에서 잘 보존되어있다(정렬된 526 개의 잔류물 중 0.805Å의 제곱 평균 편차). α-헬릭스 ( E. coli GCL의 Ala474-Leu494)는 E. coli GCL의 ThDP 및 마그네슘 이온과의 상호 작용을 위한 잔기를 제공하며, 이는 아마도 결정화를 위한 분자 패킹으로 인해 D. metallilatus GCL 구조의 활성 부위에서 완전히 다른 공간으로 이탈되어 있다. 이러한 구조적 특성으로 인하여 D. metallilatus GCL의 활성 부위에서 2 개의 보조 인자와 마그네슘 이온을 고갈시킨다.
도 4b의 B에 도시된 바와 같이, FLS와 2 개의 GCL 구조의 비교는 3 개의 효소의 극한 C- 말단에서 연장 된 영역에서 현저한 차이를 갖는 활성 부위에서의 변화를 나타낸다 (C-헬릭스). 이 C- 말단 영역은 GCL 및 FLS 효소의 활성 부위의 형성에 기여한다. 또한 도 4b의 B에 도시된 바와 같이, 세 개의 효소는 각각의 효소 이중합체 사이의 공간적 배향이 EcGCL과 DmGCL은 같으나, FLS 와는 차이가 크며, 이로 인하여 GCL, FLS가 보이는 효소활성의 차이성과 연관성은 분명하지 않다. 특히, 2 개의 GCL은 제 2 중간체의 환원을 위해 또 다른 보조 인자 FADH2를 필요로 한다. 그럼에도 불구하고, GCL은 ThDP- 의존성 카르볼리가제 효소의 구조적 특징을 정확하게 반영한다. 따라서, GCL의 2 개의 포름알데히드 분자를 축합하기 위한 촉매 메카니즘은 벤즈알데히드리아제(FEBS J 272 (23) : 6067-6076)의 포름알데히드 분자를 축합시키는 경향이 있는 것을 알 수 있다.
실험예 6
GALS로 최근에 입증된 바와 같이, GCL은 합성 메틸 영양 세포 공장의 건설에 사용될 수 있다. 이에 의해, GCL-기반 전 세포 생물 전환 시스템이 다음과 같이 조사되었으며 그 결과는 도 5에 도시되었다. 첫 번째 방법은 대장균 BL21 Star (DE3)에서 GCL을 가용성 형태로 단순히 과발현하는 것이었다. 다른 접근법은 독성 및/또는 소수성 반응기질(예를 들어, 지방산)의 생물 변형에 유리한 것으로 보고된 생체 촉매로서 엔도사이토싱 대장균을 사용하는 것 이었다. 즉 GCL과 함께 카베올린 -1 (Cav1)의 공동 발현된 재조합 E. coli BL21 Star (DE3)에 의한 글리콜알데히드로의 포름알데히드의 전체 세포 생물 전환을 위해 25 mM 포름알데히드를 포타슘 포스페이트 완충액 (pH 6.0)에 첨가하여 정지 성장기 (세포 밀도 : 12g 건조 세포 / L)에서 생체 변형을 개시 하였다.
도 5에 도시된 바와 같이, E. coli BL21 Star (DE3) pET-EcGCL을 생 촉매로 사용했을 때, 25 mM 포름알데히드로부터 6 mM의 글리콜알데히드 만이 생성되었으며 전환 수율은 50 % 미만으로 유지되었다. 하지만, 놀랍게도, E. coli BL21 Star (DE3)에서 EcGCL과 함께 카베 올린-1 (CAV1)의 공동 발현은 CAV1- 매개 엔도사이토싱 E. coli가 67%의 전환율로 약 8.4 mM의 글리콜알데히드를 생산하도록 했다. 또한 포름알데히드 응축 속도는 7.5 mM/h에 도달했는데, 이러한 실험결과는 엔도사이토싱 E. coli가 우수한 생체 촉매가 될 것이라는 것을 보여주었다.
실시예 3
글리콜알데히드의 화학적 구조는 3-하이드록시 프로판올과 유사하다. 이에 의해, 도 9b에 도시된 바와 같이, 3-하이드록시 프로판올을 3-하이드록시 프로피온산으로 산화시킬 수 있는 아조스피릴룸 브라질렌스( Azospirillum brasilense)로부터의 α- 케토글루타르산 세미알데히드 탈수소 효소 (KGSADH)가 후보로서 선택되었다.
따라서, 글리콜알데히드를 통한 포름알데히드의 글리콜산으로의 캐스케이드 반응은 대장균에서 발현되고 Ni-NTA 겔 매트릭스상의 친 화성 크로마토그래피에 의해 회수된 GCL 및 KGSADH에 의해 반응물에 25 mM 포름알데히드를 첨가하여 수행되었다. KGSADH는 효소가 또한 포름알데히드에 대한 산화 활성을 갖기 때문에 GCL에 의한 생물 전환을 1 시간 동안 수행한 후에 첨가되었다.
도 6a에 도시된 바와 같이 EcGCL에 의한 포름알데히드의 글리콜알데히드로의 축합은 t = 1h에서 글리콜알데히드가 9 mM로 형성되게 하였다.
이와 같이 반응 매질에 KGSADH를 첨가하면 글리콜산이 8.8mM까지 축적되어 포름알데히드의 70 %가 표적 생성물로 전환되었음을 나타냈다.
실시예 4
3-하이드록시 프로판올을 1,3- 프로판디올 로 환원시키는 것으로 알려진 클렙시 엘라뉴모니아에의 1,3- 프로판디올 탈수소 효소(DhaT)를 글리콜알데히드로부터 에틸렌글리콜을 생성시키는 후보로 선택하였다.
따라서, 글리콜알데히드를 통해 포름알데히드를 에틸렌글리콜로의 캐스케이드 반응은 대장균에서 발현되고 Ni-NTA 겔 매트릭스상의 친화성 크로마토그래피에 의해 회수된 GCL 및 DhaT에 의해 반응물에 25 mM 포름알데히드를 첨가하여 수행되었다. DhaT 효소도 포름알데히드에 대한 환원 활성을 갖기 때문에 GCL에 의한 생물 전환 개시 1시간 후 DhaT를 첨가 하였다.
도 6b에 도시된 바와 같이 반응 매질에 DhaT를 첨가하면 에틸렌글리콜이 8.8mM로 축적되어 포름알데히드의 70 %가 표적 생성물로 전환되었음을 나타냈다.
실험예 6
실시예3 및 실시예4에서 사용된 KGSADH 및 DhaT의 포름알데히드 및 글리콜알데히드에 대한 반응 동역학을 조사하고, 그 결과를 표 3에 나타냈다.
Figure PCTKR2020018314-appb-img-000003
표 3으로부터, KGSADH는 글리콜알데히드에 대해 각각 4 mM, 24 s -1 및 6.1 mM -1·s -1의 K M, k cat 및 k cat/K M 값을 나타내어 촉매 효율은 포름알데히드에 대한 GCL보다 실질적으로 더 큰 것을 알 수 있다. DhaT는 글리콜알데히드에 대해 각각 12.5 mM, 1.6 s -1 및 0.13 mM -1·s -1의 K M, k cat 및 k cat / K M 값을 나타냈다.
이상의 실험결과들은 GCL 및 이의 유도체가 두 분자의 포름알데히드를 한 분자의 글리콜알데히드로 선택적으로 축합시켜 포름알데히드로부터 글리콜알데히드를 생성할 수 있고, 또한 A. brasilense의 α-케토글루타르산 세미알데히드 탈수소효소 (KGSADH) 및 K. pneumoniae의 1,3-프로판디올 탈수소효소 (DhaT)와의 커플링에 의해 포름알데히드의 글리콜알데히드를 통한 글리콜산 및 에틸렌글리콜로의 2 단계 생물 변형에 연속적으로 사용될 수 있음을 보여준다. 따라서, 본 발명에 의하면 환경 친화적인 방식으로 포름알데히드로부터 글리콜알데히드를 통해 글리콜산 및 에틸렌글리콜을 효소 합성할 수 있다
실시예 5
글리콜알데히드로부터 에탄올아민 생산을 위해 Agrobacterium fabrum ATU3300 유래 aminotransferase (Af-AT)와 Ruegeria pomeroyi 유래 3HMU를 후보 효소로 선택하였다.
따라서, 포름알데히드로부터 글리콜알데히드를 통해 에탄올아민으로의 캐스케이드 반응은 GCL과 Af-AT를 공동으로 발현한 대장균 형질전환체에 25 mM 포름알데히드를 첨가하여 수행되었다. 즉, GCL과 함께 Af-AT를 공동 발현하는 재조합 E. coli BL21 Star (DE3) 배양액에 포름알데히드를 25 mM로 첨가하여 생물전환을 수행 하였다. 아민 공여체로 알라닌을 25 mM로 첨가하여 Af-AT에 의한 아민화 반응을 동시에 수행하였다. 도 7에 도시된 바와 같이 t = 7 h에서 에탄올아민이 8.5 mM까지 축적되어 포름알데히드의 70 %가 표적 생성물로 전환되었다.
구체적으로 제시하지는 않았지만 GCL과 함께 Af-AT를 공동 발현하는 재조합 E. coli BL21 Star (DE3) 대신 GCL과 3HMU를 공동으로 발현한 대장균 형질전환체를 사용할 수 있는데, Af-AT 대신 3HMU를 발현한 대장균 형질전환체을 생촉매로 이용했을 경우 에탄올아민이 8.1 mM까지 축적되었다.
또한, 글리콜알데히드를 형성하기 위해 GCL만을 발현하는 대장균 형질전환체에 포름알데히드를 첨가하여 수행하는 제1단계 및 제1단계에서 얻어진 반응물에 aminotransferase 즉 Af-AT 또는 3HMU 및 아민공여체를 첨가하는 제2단계가 수행되어도 포름알데히드의 70% 이상을 에탄올아민으로 전환시킬 수 있다.
본 발명은 이상에서 살펴본 바와 같이 바람직한 실시 예를 들어 도시하고 설명하였으나, 상기한 실시 예에 한정되지 아니하며 본 발명의 정신을 벗어나지 않는 범위 내에서 당해 발명이 속하는 기술분야에서 통상의 지식을 가진 자에 의해 다양한 변경과 수정이 가능할 것이다.
MSVASRSAERVFLTKFESWKNFPINRGRNKMAKMRAVDAAMYVLEKEGITTAFGVPGAAINPFYSAMRKH
GGIRHILARHVEGASHMAEGYTRATAGNIGVCLGTSGPAGTDMITALYSASADSIPILCITGQAPRARLH
KEDFQAVDIEAIAKPVSKMAVTVREAALVPRVLQQAFHLMRSGRPGPVLVDLPFDVQVAEIEFDPDMYEP
LPVYKPAASRMQIEKAVEMLIQAERPVIVAGGGVINADAAALLQQFAELTSVPVIPTLMGWGCIPDDHEL
MAGMVGLQTAHRYGNATLLASDMVFGIGNRFAQRHTGSVEKYTEGRKIVHIDIEPTQIGRVLCPDLGIVS
DAKAALTLLVEVAQEMQKAGRLPCRKEWVADCQQRKRTLLRKTHFDNVPVKPQRVYEEMNKAFGRDVCYV
TTIGLSQIAAAQMLHVFKDRHWINCGQAGPLGWTIPAALGVCAADPKRNVVAISGDFDFQFLIEELAVGA
QFNIPYIHVLVNNAYLGLIRQSQMAFDMDYCVQLAFENINSSEVNGYGVDHVKVAEGLGCKAIRVFKPED
IAPAFEQAKALMAQYRVPVVVEVILERVTNISMGSELDNVMEFEDIADNAADAPTETCFMHYE

Claims (26)

  1. 글리옥실레이트 카르볼리가제(glyoxylate carboligase: GCL) 및 이의 유도체를 포함하는 글리콜알데히드 생성용 조성물.
  2. 제 1 항에 있어서,
    상기 GCL 및 이의 유도체는 두 분자의 포름알데히드가 글리콜알데히드 분자 내로 축합되는 반응을 촉매 하는 것을 특징으로 하는 글리콜알데히드 생성용 조성물.
  3. 제 2 항에 있어서,
    상기 GCL은 대장균에서 유래된 것을 특징으로 하는 글리콜알데히드 생성용 조성물.
  4. 제 3 항에 있어서,
    상기 GCL의 K M, k cat 및 k cat/K M 값은 각각 62 mM, 1 s -1 및 16.0 M -1·s -1인 것을 특징으로 하는 글리콜알데히드 생성용 조성물.
  5. 서열목록 제1서열에 기재된 아미노산 서열로 구성되는 신규 글리옥실레이트 카르볼리가제(glyoxylate carboligase: GCL).
  6. 제 5 항에 있어서,
    상기 신규 GCL은 두 분자의 포름알데히드가 글리콜알데히드 분자 내로 축합되는 반응을 촉매 하여 글리콜알데히드를 생성하는 것을 특징으로 하는 신규 글리옥실레이트 카르볼리가제.
  7. 제 6 항에 있어서,
    상기 신규 GCL의 K M, k cat 및 k cat/K M 값은 각각 24 mM, 0.8 s -1 및 33.1 M -1·s -1인 것을 특징으로 하는 신규 글리옥실레이트 카르볼리가제.
  8. 제 5 항의 신규 GCL을 코딩하는 뉴클레오타이드 서열을 갖는 핵산분자.
  9. 제 8 항의 신규 GCL를 코딩하는 핵산 분자를 포함하는 벡터.
  10. 제 9 항의 벡터를 포함하는 형질전환체.
  11. 제 10 항에 있어서,
    상기 형질전환체는 대장균인 것을 특징으로 하는 형질전환체.
  12. 제 11 항에 있어서,
    상기 대장균은 카베올린-1(CAV1)- 매개 엔도사이토싱 대장균(CAV1- mediated endocytosing E. coli )인 것을 특징으로 하는 형질전환체.
  13. 제 10 항에 있어서,
    상기 형질전환체는 aminotransferase를 코딩하는 핵산분자를 포함하는 벡터를 더 포함하는 것을 특징으로 하는 형질전환체.
  14. 제 13 항에 있어서,
    상기 aminotransferase를 코딩하는 핵산분자는 루게리아 포메로이( Ruegeria pomeroyi)로부터 유래된 aminotransferase(3HMU)를 코딩하는 핵산분자 또는 아그로박테리움 파브럼( Agrobacterium fabrum)으로부터 유래된 aminotransferase(Af-AT)를 코딩하는 핵산분자인 것을 특징으로 하는 형질전환체.
  15. 포름알데히드와, 제 1 항 내지 제 4 항 중 어느 한 항의 조성물, 제 5 항 내지 제 7 항 중 어느 한 항의 신규 GCL, 제 10 항 또는 제 11 항의 형질전환체 중 하나 이상을 접촉시키는 단계를 포함하는 포름알데히드로부터의 글리콜알데히드 제조방법.
  16. 제 15 항에 있어서,
    상기 단계는 30℃ 내지 60℃에서 수행되는 것을 특징으로 하는 글리콜알데히드 제조방법.
  17. 제 16 항에 있어서,
    상기 단계에서 두 분자의 포름알데히드가 글리콜알데히드 분자 내로 축합되는 반응을 촉매 하는 GCL의 K M, k cat 및 k cat/K M 값은 각각 62 mM, 1.00 s -1 및 16.0 M -1·s -1 이하인 것을 특징으로 하는 글리콜알데히드 제조방법.
  18. 포름알데히드와, 제 1 항 내지 제 4 항 중 어느 한 항의 조성물, 제 5 항 내지 제 7 항 중 어느 한 항의 신규 GCL, 제 10 항 또는 제 11 항의 형질전환체 중 하나 이상을 접촉시켜 글리콜알데히드를 형성하는 제1단계; 및
    상기 제1단계에서 얻어진 반응물에 α-ketoglutaric semialdehyde dehydrogenase (KGSADH) 또는 ALDH를 첨가하는 제2단계;를 포함하는 글리콜산 제조방법.
  19. 제 18 항에 있어서,
    상기 KGSADH는 Azospirillum brasilense로부터 유래된 것으로, K M, k cat 및 k cat/K M 값이 각각 4 mM, 24 s -1 및 6.1 mM -1·s -1인 것을 특징으로 하는 글리콜산 제조방법.
  20. 제 18 항에 있어서,
    상기 제2단계에서 KGSADH를 첨가하면 상기 포름알데히드의 70%이상이 글리콜산으로 전환되는 것을 특징으로 하는 글리콜산 제조방법.
  21. 포름알데히드와, 제 1 항 내지 제 4 항 중 어느 한 항의 조성물, 제 5 항 내지 제 7 항 중 어느 한 항의 신규 GCL, 제 10 항 또는 제 11 항의 형질전환체 중 하나 이상을 접촉시켜 글리콜알데히드를 형성하는 제1단계; 및
    상기 제1단계에서 얻어진 반응물에 1,3-propanediol dehydrogenase (DhaT) 또는 ADH를 첨가하는 제2단계;를 포함하는 에틸렌글리콜 제조방법.
  22. 제 21 항에 있어서,
    상기 DhaT는 Klebsiella pneumoniae로부터 유래된 것으로, K M, k cat 및 k cat/K M 값이 각각 12.5 mM, 1.6 s -1 및 0.13 mM -1·s -1인 것을 특징으로 하는 에틸렌글리콜 제조방법.
  23. 제 22 항에 있어서,
    상기 제2단계에서 DhaT를 첨가하면 상기 포름알데히드의 70% 이상이 에틸렌글리콜로 전환되는 것을 특징으로 하는 에틸렌글리콜 제조방법.
  24. 포름알데히드와, 제 1 항 내지 제 4 항 중 어느 한 항의 조성물, 제 5 항 내지 제 7 항 중 어느 한 항의 신규 GCL, 제 10 항 또는 제 11 항의 형질전환체 중 하나 이상을 접촉시켜 글리콜알데히드를 형성하는 제1단계; 및
    상기 제1단계에서 얻어진 반응물에 aminotransferase 및 아민공여체를 첨가하는 제2단계;를 포함하는 에탄올아민 제조방법.
  25. 제 24 항에 있어서,
    상기 aminotransferase는 루게리아 포메로이( Ruegeria pomeroyi )로부터 유래된 aminotransferase(3HMU) 또는 아그로박테리움 파브럼( Agrobacterium fabrum )으로부터 유래된 aminotransferase(Af-AT)인 것을 특징으로 하는 에탄올아민 제조방법.
  26. 포름알데히드와, 제 13 항 또는 제 14 항의 형질전환체 중 하나 이상 및 아민공여체를 접촉시키는 단계를 포함하는 포름알데히드로부터의 에탄올아민 제조방법.
PCT/KR2020/018314 2020-08-26 2020-12-15 포름알데히드로부터의 글리콜알데히드 생성용 조성물 및 상기 조성물을 이용한 포름알데히드로부터의 글리콜산, 에틸렌글리콜 또는 에탄올 아민 제조방법 Ceased WO2022045481A1 (ko)

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
KR1020200108063A KR102349819B1 (ko) 2020-08-26 2020-08-26 포름알데히드로부터의 글리콜알데히드 생성용 조성물 및 상기 조성물을 이용한 포름알데히드로부터의 글리콜산 또는 에틸렌글리콜 제조방법
KR10-2020-0108063 2020-08-26

Publications (1)

Publication Number Publication Date
WO2022045481A1 true WO2022045481A1 (ko) 2022-03-03

Family

ID=79347539

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/KR2020/018314 Ceased WO2022045481A1 (ko) 2020-08-26 2020-12-15 포름알데히드로부터의 글리콜알데히드 생성용 조성물 및 상기 조성물을 이용한 포름알데히드로부터의 글리콜산, 에틸렌글리콜 또는 에탄올 아민 제조방법

Country Status (2)

Country Link
KR (1) KR102349819B1 (ko)
WO (1) WO2022045481A1 (ko)

Cited By (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN119752868A (zh) * 2024-12-27 2025-04-04 北京化工大学 乙醇醛合成酶突变体蛋白及其应用

Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR20130093481A (ko) * 2010-04-13 2013-08-22 게노마티카 인코포레이티드 에틸렌 글리콜을 생산하기 위한 미생물 및 방법
WO2014004625A1 (en) * 2012-06-26 2014-01-03 Genomatica, Inc. Microorganisms for producing ethylene glycol using synthesis gas

Family Cites Families (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2007140816A1 (en) * 2006-06-09 2007-12-13 Metabolic Explorer Glycolic acid production by fermentation from renewable resources
KR102003374B1 (ko) 2017-05-17 2019-07-24 명지대학교 산학협력단 자일로스로부터 글리콜산의 생산능을 갖는 대장균, 이의 제조방법 및 이를 이용하여 글리콜산을 생산하는 방법

Patent Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR20130093481A (ko) * 2010-04-13 2013-08-22 게노마티카 인코포레이티드 에틸렌 글리콜을 생산하기 위한 미생물 및 방법
WO2014004625A1 (en) * 2012-06-26 2014-01-03 Genomatica, Inc. Microorganisms for producing ethylene glycol using synthesis gas

Non-Patent Citations (3)

* Cited by examiner, † Cited by third party
Title
BOER HARRY, ANDBERG MARTINA, PYLKKÄNEN ROBERT, MAAHEIMO HANNU, KOIVULA ANU: "In vitro reconstitution and characterisation of the oxidative d-xylose pathway for production of organic acids and alcohols", AMB EXPRESS, vol. 9, no. 1, 1 December 2019 (2019-12-01), pages 1 - 13, XP055905772, DOI: 10.1186/s13568-019-0768-7 *
FRANDEN MARY ANN; JAYAKODY LAHIRU N.; LI WING-JIN; WAGNER NEIL J.; CLEVELAND NICHOLAS S.; MICHENER WILLIAM E.; HAUER BERNHARD; BLA: "Engineering Pseudomonas putida KT2440 for efficient ethylene glycol utilization", METABOLIC ENGINEERING, vol. 48, 7 June 2018 (2018-06-07), AMSTERDAM, NL, pages 197 - 207, XP085977744, ISSN: 1096-7176, DOI: 10.1016/j.ymben.2018.06.003 *
SALUSJÄRVI LAURA; HAVUKAINEN SAMI; KOIVISTOINEN OUTI; TOIVARI MERVI: "Biotechnological production of glycolic acid and ethylene glycol: current state and perspectives", APPLIED MICROBIOLOGY AND BIOTECHNOLOGY, vol. 103, no. 6, 1 February 2019 (2019-02-01), Berlin/Heidelberg, pages 2525 - 2535, XP036746619, ISSN: 0175-7598, DOI: 10.1007/s00253-019-09640-2 *

Cited By (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN119752868A (zh) * 2024-12-27 2025-04-04 北京化工大学 乙醇醛合成酶突变体蛋白及其应用

Also Published As

Publication number Publication date
KR102349819B1 (ko) 2022-01-10

Similar Documents

Publication Publication Date Title
JP7527284B2 (ja) 遺伝子操作されたケト還元酵素ポリペプチドとその使用
ES2525549T3 (es) Oxidorreductasas para la reducción estereoselectiva de compuestos cetónicos
CN113201511B (zh) (R)-5-羰基癸酸(酯)还原酶突变体及其在制备(R)-γ/δ-内酯中的应用
CN109825538B (zh) 一种手性2-氨基-1-丁醇的合成方法
KR20100124332A (ko) 글리옥살라아제 ｉｉｉ 활성을 갖는 폴리펩티드, 이를 코딩하는 폴리뉴클레오티드 및 이들의 용도
CN114686451A (zh) 胺脱氢酶突变体及其在制备(s)-5-甲基-2-吡咯烷酮中的应用
WO2013187438A1 (ja) シス－５－ヒドロキシ－ｌ－ピペコリン酸の生物学的な製造方法
WO2022045481A1 (ko) 포름알데히드로부터의 글리콜알데히드 생성용 조성물 및 상기 조성물을 이용한 포름알데히드로부터의 글리콜산, 에틸렌글리콜 또는 에탄올 아민 제조방법
MX2008001927A (es) Produccion de l-ribosa y otros azucares ra
CN113293152B (zh) 短链脱氢酶突变体及其用途
US20190127769A1 (en) Unsaturated amino acids
CN113174377B (zh) 羰基还原酶、突变体及其在制备地尔硫卓中间体中的应用
US10927353B2 (en) Catalyst and use thereof
KR102011415B1 (ko) 로도박터 에스투아리(Rhodobacter aestuarii)에서 유래한 신규 이산화탄소 환원 효소 및 이의 용도
CN111254170B (zh) 一种多酶耦合制备(s)-1,2,3,4-四氢异喹啉-3-甲酸的方法
JP2013132226A (ja) （−）−３ａ，６，６，９ａ−テトラメチルドデカヒドロナフト［２，１−ｂ］フランの製造方法
US12480148B2 (en) Method for preparing (s)-1,2,3,4-tetrahydroisoquinoline-1 carboxylic acid and derivatives thereof
JP2008212144A (ja) アルコール脱水素酵素、これをコードする遺伝子、およびそれを用いた光学活性（ｒ）−３−キヌクリジノールの製造方法
CN114990036B (zh) 一种全细胞催化生产2-吡喃酮-4,6-二羧酸的方法
JP4116349B2 (ja) 補酵素依存型を改変したギ酸脱水素酵素
KR100320269B1 (ko) 신규한2-케토알도네이트환원효소유전자및이를이용한2-케토-엘-글로네이트생산
WO2015046978A1 (ko) 2,3-부탄디올의 생성능이 증강된 재조합 미생물 및 이를 이용한 2,3-부탄디올의 생산 방법
CN119955704B (zh) 一种用于发酵生产d-泛醇的重组菌及其应用
EP4488368A1 (en) Nad(p)h oxidase
KR20240139642A (ko) 알코올 산화 효소 변이체 및 이를 포함하는 알데히드 화합물 생산용 조성물

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 20951711

Country of ref document: EP

Kind code of ref document: A1

NENP Non-entry into the national phase

Ref country code: DE

122 Ep: pct application non-entry in european phase

Ref document number: 20951711

Country of ref document: EP

Kind code of ref document: A1