WO2021251453A1 - 核酸脂質粒子ワクチン - Google Patents
核酸脂質粒子ワクチン Download PDFInfo
- Publication number
- WO2021251453A1 WO2021251453A1 PCT/JP2021/022057 JP2021022057W WO2021251453A1 WO 2021251453 A1 WO2021251453 A1 WO 2021251453A1 JP 2021022057 W JP2021022057 W JP 2021022057W WO 2021251453 A1 WO2021251453 A1 WO 2021251453A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- sequence
- cov
- sars
- protein
- rbd
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Images
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/70—Carbohydrates; Sugars; Derivatives thereof
- A61K31/7088—Compounds having three or more nucleosides or nucleotides
- A61K31/7105—Natural ribonucleic acids, i.e. containing only riboses attached to adenine, guanine, cytosine or uracil and having 3'-5' phosphodiester links
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/12—Viral antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/12—Viral antigens
- A61K39/215—Coronaviridae, e.g. avian infectious bronchitis virus
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/06—Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite
- A61K47/08—Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite containing oxygen, e.g. ethers, acetals, ketones, quinones, aldehydes, peroxides
- A61K47/14—Esters of carboxylic acids, e.g. fatty acid monoglycerides, medium-chain triglycerides, parabens or PEG fatty acid esters
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/06—Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite
- A61K47/16—Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite containing nitrogen, e.g. nitro-, nitroso-, azo-compounds, nitriles, cyanates
- A61K47/18—Amines; Amides; Ureas; Quaternary ammonium compounds; Amino acids; Oligopeptides having up to five amino acids
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/06—Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite
- A61K47/28—Steroids, e.g. cholesterol, bile acids or glycyrrhetinic acid
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K48/00—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K9/00—Medicinal preparations characterised by special physical form
- A61K9/10—Dispersions; Emulsions
- A61K9/107—Emulsions ; Emulsion preconcentrates; Micelles
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K9/00—Medicinal preparations characterised by special physical form
- A61K9/48—Preparations in capsules, e.g. of gelatin, of chocolate
- A61K9/50—Microcapsules having a gas, liquid or semi-solid filling; Solid microparticles or pellets surrounded by a distinct coating layer, e.g. coated microspheres, coated drug crystals
- A61K9/51—Nanocapsules; Nanoparticles
- A61K9/5107—Excipients; Inactive ingredients
- A61K9/5123—Organic compounds, e.g. fats, sugars
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
- A61P31/14—Antivirals for RNA viruses
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/005—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/87—Introduction of foreign genetic material using processes not otherwise provided for, e.g. co-transformation
- C12N15/88—Introduction of foreign genetic material using processes not otherwise provided for, e.g. co-transformation using microencapsulation, e.g. using amphiphile liposome vesicle
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/51—Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
- A61K2039/53—DNA (RNA) vaccination
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/555—Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
- A61K2039/55511—Organic adjuvants
- A61K2039/55555—Liposomes; Vesicles, e.g. nanoparticles; Spheres, e.g. nanospheres; Polymers
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/57—Medicinal preparations containing antigens or antibodies characterised by the type of response, e.g. Th1, Th2
- A61K2039/575—Medicinal preparations containing antigens or antibodies characterised by the type of response, e.g. Th1, Th2 humoral response
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2770/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses positive-sense
- C12N2770/00011—Details
- C12N2770/20011—Coronaviridae
- C12N2770/20022—New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2770/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses positive-sense
- C12N2770/00011—Details
- C12N2770/20011—Coronaviridae
- C12N2770/20034—Use of virus or viral component as vaccine, e.g. live-attenuated or inactivated virus, VLP, viral protein
Definitions
- the present invention relates to a nucleic acid lipid particle vaccine encapsulated with SARS-CoV-2 mRNA.
- the new coronavirus infection (coronavirus disease 2019: COVID-19) is an infectious disease caused by the new coronavirus (severe acute respiratory syndrome coronavirus 2: SARS-CoV-2), and is a pathological condition mainly due to acute respiratory inflammation.
- the pathological condition mainly consisting of inflammation in the lower airway such as invasive pneumonia and acute respiratory distress syndrome in high-risk persons is a burden of the disease (Non-Patent Document 1).
- More than 6 types of coronavirus (CoV) that infect humans and mainly present respiratory symptoms are known.
- SARS-CoV-2 is classified in the genus betacoronavirus and is virologically similar to SARS-CoV and Middle East respiratory syndrome coronavirus (MERS-CoV) that caused outbreaks in the past.
- Spike protein (S) expressed on the surface of SARS-CoV-2 virus particles plays an important role in the initial infection mechanism.
- S forms a trimer with a type I membrane protein composed of two subunits S1 and S2 (about 500 kDa, about 20 nm).
- the receptor-binding domain (RBD) present in S1 interacts with angiotensin-converting enzyme 2 (ACE2) expressed on the host cell surface.
- ACE2 angiotensin-converting enzyme 2
- SARS-CoV-2 S has a 10-20-fold higher affinity for ACE2 and higher thermodynamic stability, suggesting that SARS-CoV-2. It has been suggested that it is involved in the high transmissibility of the disease (Non-Patent Documents 2 and 3).
- Non-Patent Documents 4 and 5 it has been reported that the isolated anti-SARS-CoV-2 RBD monoclonal antibody has neutralizing activity against SARS-CoV-2 (Non-Patent Documents 6 and 7).
- Non-Patent Document 8 Specifically, as a result of analyzing 10-20 COVID-19 patient blood samples, blood anti-SARS-CoV-2 RBD antibody response and SARS-CoV-2 specific CD4 + T cell response were observed in all cases. It was confirmed, and SARS-CoV-2 specific CD8 + T cell response was confirmed in about 70% of cases.
- Non-Patent Document 10 cellular immunopathology and antibody-dependent enhancement (ADE) may be involved as the mechanism of "immune enhancement" in which COVID-19 symptoms become more severe.
- SARS SARS
- Th T-helper
- Non-Patent Document 11 T-helper
- a Th2-dominant immune response to S induces pulmonary immunopathology with an eosinophil-based inflammatory response.
- Non-Patent Document 13 For SARS-CoV-2, there is no direct clinical evidence that antibodies to S are involved in ADE, but risk aversion may require the induction of an appropriate cell-mediated immune response. It has been pointed out (Non-Patent Document 14).
- An object of the present invention is to provide a vaccine for preventing and / or treating infection with a new type of coronavirus (severe acute respiratory syndrome coronavirus 2: SARS-CoV-2).
- the gist of the present invention is as follows. (1) Lipid particles encapsulating a nucleic acid capable of expressing the S protein and / or a fragment thereof of the new type coronavirus (severe acute respiratory syndrome coronavirus 2: SARS-CoV-2), wherein the lipid has a general formula (Ia). ), The particles containing the cationic lipid represented by), or a pharmaceutically acceptable salt thereof.
- R 1 and R 2 independently represents a C 1 -C 3 alkyl group
- L 1 indicates a C 17- C 19 alkenyl group which may have one or more C 2- C 4 alkanoyloxy groups
- L 2 may have one or more C 2- C 4 alkanoyloxy groups, one or more C 10- C 19 alkyl groups, or one or more C 2- C 4 alkanoyloxy groups. Shows good C 10- C 19 alkenyl groups;
- p is 3 or 4.
- L 1 in the general formula (Ia) is a C 17- C 19 alkenyl group which may have one or more acetoxy groups.
- L 2 in the general formula (Ia) may have one or more acetoxy groups C 10- C 12 alkyl groups, or may have one or more acetoxy groups C.
- L 2 in the general formula (Ia) may have one or more acetoxy groups C 10- C 12 alkyl groups, or may have one or more acetoxy groups C. 17- C 19
- L 1 in the general formula (Ia) is (R) -11-acetyloxy-cis-8-heptadecenyl group, cis-8-heptadecenyl group, or (8Z, 11Z) -heptadecadienyl group.
- L 2 in the general formula (Ia) is a decyl group, a cis-7-decenyl group, a dodecyl group, or (R) -11-acetyloxy-cis-8-heptadecenyl group, (1) to The particle according to any one of (7).
- the cationic lipid has the following structural formula: The particle according to (1) represented by.
- the cationic lipid has the following structural formula: The particle according to (1) represented by. (11)
- the cationic lipid has the following structural formula: The particle according to (1) represented by. (12)
- the particle according to (12), wherein the amphipathic lipid is at least one selected from the group consisting of distearoylphosphatidylcholine, distearoylphosphatidylcholine and dioleoylphosphatidylethanolamine.
- the particles according to (12) or (13), wherein the sterols are cholesterol.
- the PEG lipid is 1,2-dimiristoyl-sn-glycerol methoxypolyethylene glycol and / or N- [methoxypoly (ethylene glycol) 2000] carbamoyl] -1,2-dimyristyloxypropyl-3-amine.
- the lipid composition of amphoteric lipids, sterols, cationic lipids, and PEG lipids is 15% or less for amphoteric lipids, 20-55% for sterols, and 40 for cationic lipids in terms of molar amount. 5.
- the lipid composition of the amphoteric lipid, sterols, cationic lipid, and PEG lipid is 5 to 15% for the amphoteric lipid, 35 to 50% for the sterols, and the cationic lipid in molar amount.
- the lipid composition of amphoteric lipids, sterols, cationic lipids, and PEG lipids is 10 to 15% for amphoteric lipids, 35 to 45% for sterols, and cationic lipids in molar amount.
- the lipid composition of amphoteric lipids, sterols, cationic lipids, and PEG lipids is 10 to 15% for amphoteric lipids, 35 to 45% for sterols, and cationic lipids in molar amount.
- SARS-CoV-2 SARS-CoV-2
- the receptor-binding domain in the S protein fragment of the new type coronavirus is one of the amino acids of SEQ ID NO: 25, 29, 33, 37, 94-107.
- a fragment of the S protein of the new type coronavirus (severe acute respiratory syndrome coronavirus 2: SARS-CoV-2) consists of an amino acid sequence having at least 95% identity with the amino acid sequence of SEQ ID NO: 10 (20). Described particles.
- a fragment of the S protein of the new type coronavirus is at least 95% of the amino acid sequence of any of SEQ ID NOs: 24, 28, 32, 36, 80-93.
- the S protein of the new type coronavirus consists of an amino acid sequence having at least 95% identity with the amino acid sequence of SEQ ID NO: 6 (1) to (19). Described particles.
- the receptor-binding domain in the S protein of the new type coronavirus (severe acute respiratory syndrome coronavirus 2: SARS-CoV-2) consists of an amino acid sequence having at least 95% identity with the amino acid sequence of SEQ ID NO: 11 ( 25) The particles described.
- Nucleic acids capable of expressing the S protein of the new coronavirus are the cap structure (Cap), 5'untranslated region (5'-UTR), and the like.
- the nucleic acid capable of expressing the S protein fragment of the new coronavirus is the cap structure (Cap), 5'untranslated region (5'-UTR). ), Leader sequence, translated region of receptor binding domain in S protein, 3'untranslated region (3'-UTR) and polyA tail (polyA).
- the particles described in any of. (9) The particle according to (27), wherein the sequence of the translation region of the S protein consists of a nucleotide sequence having at least 90% identity with the sequence of the translation region of the S protein in the sequence of SEQ ID NO: 5.
- the nucleic acid capable of expressing the S protein of the new type coronavirus (severe acute respiratory syndrome coronavirus 2: SARS-CoV-2) consists of the nucleotide sequence of SEQ ID NO: 5.
- nucleic acid capable of expressing the S protein of the new type coronavirus consists of the nucleotide sequence of SEQ ID NO: 16.
- sequence of the translation region of the receptor-binding domain in the S protein consists of a nucleotide sequence having at least 90% identity with the sequence of the translation region of the receptor-binding domain in the S protein in the sequence of SEQ ID NO: 9.
- the sequence of the translation region of the receptor-binding domain in the S protein consists of a nucleotide sequence having at least 90% identity with the sequence of the translation region of the receptor-binding domain in the S protein in the sequence of SEQ ID NO: 19.
- the particles according to the above. The sequence of the translation region of the receptor-binding domain in the S protein is the translation region of the receptor-binding domain in the S protein in any of the sequences of SEQ ID NOs: 21, 23, 27, 31, 35, 66 to 79.
- the particle according to (27) which comprises a nucleotide sequence having at least 90% identity with the sequence of.
- nucleic acid capable of expressing a fragment of the S protein of the new type coronavirus comprises the nucleotide sequence of SEQ ID NO: 9.
- nucleic acid capable of expressing a fragment of the S protein of the new type coronavirus comprises the nucleotide sequence of SEQ ID NO: 19.
- the particle according to (38), wherein the modified nucleotide comprises at least one of a pyrimidine nucleotide substituted at the 5-position and / or a pseudouridine optionally substituted at the 1-position.
- the modified nucleotide comprises at least one selected from the group consisting of 5-methylcytidine, 5-methoxyuridine, 5-methyluridine, pseudouridine, and 1-alkylpseudouridine.
- composition according to (45) for inducing an immune response against a new type coronavirus (severe acute respiratory syndrome coronavirus 2: SARS-CoV-2).
- composition according to (45) or (46) for preventing and / or treating a new type coronavirus (severe acute respiratory syndrome coronavirus 2: SARS-CoV-2) infection.
- S protein and / or fragments thereof of a new type coronavirus (severe acute respiratory syndrome coronavirus 2: SARS-CoV-2) comprising introducing the composition according to (43) or (44) into cells. Method of expression in vitro.
- S protein of a new type of coronavirus (severe acute respiratory syndrome coronavirus 2: SARS-CoV-2) and /, which comprises administering the composition according to any one of (43) to (47) to a mammal. Or a method for expressing the fragment in vivo.
- a method for inducing an immune response against a new type of coronavirus (severe acute respiratory syndrome coronavirus 2: SARS-CoV-2), which comprises administering the composition according to (45) or (46) to a mammal.
- Prevention and / of Severe acute respiratory syndrome coronavirus 2: SARS-CoV-2 infection comprising administering to a mammal the composition according to any of (45)-(47). Or how to treat.
- Vertical bars indicate the geometric mean and symbols 1-5 indicate individual antibody levels.
- the horizontal bar indicates the geometric mean value, and the circle symbol indicates the individual inhibitory activity level.
- Buffer 10 mM Histidine buffer (pH 6.5) containing 300 mM Sucrose.
- the vertical bar indicates the average value, and the error bar indicates the standard error.
- the DMSO concentration was adjusted to 0.1% (v / v) in all treatment groups. No peptides: Peptide-free group.
- Blood anti-RBD antibody response induced by administration of particles of Example 4, Example 7 or Example 8.
- Buffer 10 mM Histidine buffer (pH 7.0) containing 300 mM Sucrose. Vertical bars indicate the geometric mean and error bars indicate the standard deviation.
- the DMSO concentration was adjusted to 0.1% (v / v) in all treatment groups. No peptides: Peptide-free group. Strain-specific immunogenicity of the mRNA vaccine against SARS-CoV-2 RBD.
- the 16 overlapping peptides were divided into 8 pool peptides as 1 pool peptide.
- Spleen cells were prepared from mouse spleen and reprocessed with pool peptide for 24 hours. IFN- ⁇ levels in the culture supernatant were measured by ELISA.
- Gh The percentage of cytokine-producing CD8 + and CD4 + T cells after treatment of pools 2, 3 and 4 with a protein transport inhibitor for 6 hours is shown in a pie chart.
- PBMC peripheral blood mononuclear cells
- LNP-mRNA-Full 0.4, 2, and 10 ⁇ g / mL in terms of mRNA
- LNP-mRNA Treat with -RBD 0.4, 2, and 10 ⁇ g / mL in terms of mRNA
- HPLC mRNA-RBD
- LNP-mRNA-Full 0.4, 2, and 10 ⁇ g / mL in terms of mRNA
- LNP-mRNA-RBD (b) from bone marrow-derived dendritic cells (BM-DC) of C57BL / 6 mice and BALB / c mice.
- BM-DC bone marrow-derived dendritic cells
- HPLC 0.4, 2, and 10 ⁇ g / mL in terms of mRNA
- mice C57BL / 6 mice were intramuscularly administered with mock, LNP-mRNA-RBD (3 ⁇ g mRNA) or mRNA-RBD (HPLC) (3 ⁇ g mRNA) on days 0 and 14.
- C Two weeks after the second administration, the blood anti-RBD antibody titer was measured by ELISA.
- D and e Popliteal lymph nodes were collected from mice.
- D GC B cells were gated as GL7 + CD38 - CD19 + cells.
- T FH cells were gated as CD185 + PD-1 + CD3 ⁇ + CD4 + T cells.
- Spleen cells were prepared from mouse spleen and treated with pool peptide for 24 hours.
- IFN- ⁇ levels in the culture supernatant were measured by ELISA.
- the percentage of cytokine-producing CD8 + and CD4 + T cells after treatment of peptide pools 3 and 4 with a protein transport inhibitor for 6 hours is shown in a pie chart.
- H, i Representative data of FIGS. 12f, g, 21 and 22 are shown.
- SARS-CoV-2 (2 ⁇ 10 7 PFU) was administered to the conjunctiva, nasal cavity, oral cavity and trachea of cynomolgus monkeys.
- A Viral RNA in swab samples and (b) Viral titers were measured by RT-PCR and cell culture.
- Cd Viral RNA in lung tissue was measured by RT-PCR.
- RU upper right lobe
- RM right middle lobe
- RL lower right lobe
- LU upper left lobe
- LM left middle lobe
- LL lower left lobe.
- ECD Blood anti-spiked protein external domain
- Spleen cells were prepared from mouse spleen and treated with a protein transport inhibitor and pool peptide for 6 hours.
- the proportions of cytokine-producing CD8 + and CD4 + T cells were analyzed by flow cytometry.
- N 4.
- the vertical bar indicates the average value, and the error bar indicates the standard error. * P ⁇ 0.05, ANOVA and Dunn's multiple comparison test was used.
- Spleen cells were prepared from mouse spleen and treated with a protein transport inhibitor and pool peptide for 6 hours.
- the vertical bar indicates the average value and the error bar indicates the standard error. * P ⁇ 0.05, ANOVA and Dunn's multiple comparison test was used. Changes in body temperature before and after SARS-CoV-2 infection.
- SARS-CoV-2 (2.2 ⁇ 10 6 PFU) was administered to the oral cavity, nasal cavity, and trachea of cynomolgus monkeys. Body temperature was recorded using a telemetry transmitter and computer from 2 days before SARS-CoV-2 administration. Chest radiograph after SARS-CoV-2 infection in cynomolgus monkeys treated with mRNA-RBD (HPLC). Blood anti-RBD antibody response induced by Examples 10, 12, 14, 16, 18, and 20.
- N 4. Pre indicates before the administration of Example 10, and Post indicates after the administration of Example 10.
- the vertical bar indicates the geometric mean value, and the circle symbol indicates the individual neutralization activity.
- the present invention is a lipid particle encapsulating a nucleic acid capable of expressing the S protein and / or a fragment thereof of the new type coronavirus (severe acute respiratory syndrome coronavirus 2: SARS-CoV-2), wherein the lipid has a general formula (severe acute respiratory syndrome coronavirus 2: SARS-CoV-2).
- the particles containing the cationic lipid represented by Ia) or a pharmaceutically acceptable salt thereof are provided.
- R 1 and R 2 independently represents a C 1 -C 3 alkyl group
- L 1 indicates a C 17- C 19 alkenyl group which may have one or more C 2- C 4 alkanoyloxy groups
- L 2 may have one or more C 2- C 4 alkanoyloxy groups, one or more C 10- C 19 alkyl groups, or one or more C 2- C 4 alkanoyloxy groups. Shows good C 10- C 19 alkenyl groups; p is 3 or 4.
- R 1 and R 2 in the general formula (Ia) are independently exhibit C 1 -C 3 alkyl group, preferably both a methyl group.
- P in the general formula (Ia) is 3, or 4, but is preferably 3.
- L 1 in the general formula (Ia) represents a C 17- C 19 alkenyl group which may have one or more C 2- C 4 alkanoyloxy groups, preferably one or more acetoxy groups. It is a C 17- C 19 alkenyl group which may have one.
- Specific examples of L 1 include (R) -11-acetyloxy-cis-8-heptadecenyl group, cis-8-heptadecenyl group, (8Z, 11Z) -heptadecadienyl group and the like. can.
- L 2 in the general formula (Ia) is, C 2 -C 4 alkanoyloxy group one or plurality which may have C 10 -C 19 alkyl group, or a C 2 -C 4 alkanoyloxy group one or It shows a C 10- C 19 alkenyl group which may have a plurality of C 10-C 19 alkenyl groups, preferably one or a plurality of C 10- C 12 alkyl groups which may have one or a plurality of acetoxy groups, or one or a plurality of acetoxy groups. It is a C 10- C 19 alkenyl group which may have one.
- L 2 in the general formula (Ia) may have one or more acetoxy groups C 10- C 12 alkyl groups, or may have one or more acetoxy groups C. It is also preferable that it is a 17- C 19 alkenyl group. Specific examples of L 2 include a decyl group, a cis-7-decenyl group, a dodecyl group, and (R) -11-acetyloxy-cis-8-heptadecenyl group.
- cationic lipid which is a component constituting the particles of the present invention
- the following structural formula An example of what is represented by.
- a pharmaceutically acceptable salt means a salt that can be used as a medicine.
- the cationic lipid which is a component constituting the particles of the present invention may be a pharmaceutically acceptable salt, and such a salt is preferably an alkali metal salt such as a sodium salt, a potassium salt or a lithium salt.
- Alkaline earth metal salts such as calcium salt, magnesium salt, metal salts such as aluminum salt, iron salt, zinc salt, copper salt, nickel salt, cobalt salt; inorganic salt such as ammonium salt, t-octylamine salt , Dibenzylamine salt, morpholine salt, glucosamine salt, phenylglycine alkyl ester salt, ethylenediamine salt, N-methylglucamine salt, guanidine salt, diethylamine salt, triethylamine salt, dicyclohexylamine salt, N, N'-dibenzylethylenediamine salt , Chloroprocine salt, prokine salt, diethanolamine salt, N-benzyl-phenethylamine salt, piperazine salt, tetramethylammonium salt, amine salts such as organic salts such as tris (hydroxymethyl) aminomethane salt; Inorganic acid salts such as hydrochlorides, hydrobromates, halogen atomized amine
- Late alcan sulfonates such as acid salts, ethane sulfonates, benzene sulfonates, allyl sulfonates such as p-toluene sulfonates, acetates, apple salts, fumarates, succinates.
- Organic acid salts such as acid salts, citrates, tartrates, oxalates, maleates; and amino acid salts such as glycine salts, lysine salts, arginine salts, ornithine salts, glutamates, asparaginates. Can be done.
- the cationic lipid represented by the general formula (Ia) may be one kind of compound or a combination of two or more kinds of compounds.
- the lipid of the present invention may further contain amphipathic lipids, sterols and PEG lipids.
- the amphipathic lipid is a lipid having an affinity for both polar and non-polar solvents, and specifically, distearoylphosphatidylcholine, distearoylphosphatidylcholine, dioleoylphosphatidylethanolamine, and combinations thereof are used. It can be exemplified.
- the sterols are sterols having a hydroxy group, and specific examples thereof include cholesterol and the like.
- the PEG lipid is a PEG-modified lipid, specifically 1,2-dimlystoyl-sn-glycerol methoxypolyethylene glycol and / or N- [methoxypoly (ethylene glycol) 2000] carbamoyl] -1,2. -Dimyristyloxypropyl-3-amine, combinations thereof, etc. can be exemplified.
- the lipid composition of the amphoteric lipid, sterols, cationic lipid, and PEG lipid is not particularly limited, but the molar amount of the amphoteric lipid is 15% or less and the sterols are 20 to 55%.
- Cationic lipids are 40-65%
- PEG lipids are 1-5%
- the ratio of total lipid weight to nucleic acid weight is preferably 15-30
- the lipid composition of PEG lipids is 5 to 15% for amphoteric lipids, 35 to 50% for sterols, 40 to 55% for cationic lipids, and 1 to 3% for PEG lipids in terms of molar amount.
- the ratio of the total lipid weight to the nucleic acid weight is more preferably 15 to 25, and the lipid composition of the amphoteric lipids, sterols, cationic lipids, and PEG lipids is a molar amount of the amphoteric lipids. 10 to 15%, sterols 35 to 45%, cationic lipids 40 to 50%, PEG lipids 1 to 2%, and the ratio of total lipid weight to nucleic acid weight is 17.5 to 22.5. More preferably, the lipid composition of the amphoteric lipid, sterols, cationic lipid, and PEG lipid is 10 to 15% for the amphoteric lipid and 35 to 45% for the sterols in molar amount. It is even more preferred that the cationic lipid is 45-50%, the PEG lipid is 1.5-2%, and the ratio of total lipid weight to nucleic acid weight is 17.5-22.5.
- the nucleic acid encapsulated in the lipid particles can express the S protein and / or a fragment thereof of the new type coronavirus (severe acute respiratory syndrome coronavirus 2: SARS-CoV-2).
- SARS-CoV-2 severe acute respiratory syndrome coronavirus 2
- NCBIID NC_045512 https://www.ncbi.nlm.nih.gov/nuccore/NC_045512.
- the fragment of the S protein of SARS-CoV-2 may contain a receptor-binding domain (RBD) present in the S protein.
- RBD receptor-binding domain
- a secretory peptide (peptide encoded by the leader sequence) may be added to the receptor binding domain.
- the leader sequence an S protein signal sequence can be exemplified.
- the amino acid sequence of the S protein of SARS-CoV-2 is shown in SEQ ID NO: 6.
- the nucleic acid encapsulated in the lipid particles expresses the SARS-CoV-2 S protein consisting of an amino acid sequence having at least 95%, preferably 96%, more preferably 97% identity with the amino acid sequence of SEQ ID NO: 6. It should be possible.
- the amino acid sequence of the receptor-binding domain present in the S protein of SARS-CoV-2 is shown in SEQ ID NO: 11.
- a secretory peptide eg, S protein signal sequence
- the amino acid sequence of the receptor-binding domain present in the S protein of SARS-CoV-2 with the S protein signal sequence added is shown in SEQ ID NO: 10.
- the nucleic acid encapsulated in the lipid particles is a SARS-CoV-2 S protein consisting of an amino acid sequence having at least 95%, preferably 96%, more preferably 97% identity with the amino acid sequence of SEQ ID NO: 11 or 10. It should be able to express the receptor-binding domain in it.
- identity refers to the relationship between sequences of two or more nucleotide or amino acid sequences, as is known in the art, determined by comparison of sequences.
- identity is also, as the case may be, a sequence between nucleic acid molecules or a polypeptide as determined by matching between two or more nucleotide sequences in a row or between two or more amino acid sequences. It means the degree of relevance.
- Identity is the percentage of the same match between the smaller of two or more arrays and the gap alignment (if any) addressed by a particular mathematical model or computer program (ie, an "algorithm”). Can be evaluated by calculating. Specifically, it can be evaluated by using software such as Clustal W2 provided by European Molecular Biology Laboratory-European Bioinformatics Institute (EMBL-EBI), but it is limited to those used by those skilled in the art. Not done.
- sequence identity in the present invention is calculated using GENETYX-SV / RC (manufactured by Genetics Co., Ltd.), which is sequence analysis software, and this algorithm is usually used in the art.
- the amino acid encoded by the nucleic acid encapsulated in the lipid particles of the present invention is an amino acid mutation (as long as it retains a certain degree of identity with the amino acid sequence and / or fragment thereof of the target SARS-CoV-2 S protein. Substitution), deletion, insertion and / or addition may occur.
- the amino acid encoded by the nucleic acid encapsulated in the lipid particles of the present invention retains the above-mentioned sequence identity and is a number in the amino acid sequence of the target SARS-CoV-2 S protein and / or the amino acid sequence of a fragment thereof.
- One) amino acid may be substituted, deleted, inserted and / or added.
- the amino acid sequence of the receptor-binding domain present in the S protein of SARS-Cov-2 may be deleted, substituted, or added at position 538 (the number is counted from the N-terminal of the S protein).
- Amino acid-deficient sequence for the N-terminal and C-terminal of the full-length sequence of RBD (R319-F541), a sequence in which cysteine is replaced with serine (SEQ ID NO: 25) hereeinafter, also referred to as “C538S type”
- C538S type a sequence in which cysteine is replaced with serine
- SEQ ID NO: 29 a sequence in which amino acids are added to the N-terminal and C-terminal of the full-length sequence of RBD (R319-F541) (SEQ ID NO: 33), and a sequence in which a mutation substituted with a plurality of amino acid residues is introduced (SEQ ID NO: 37).
- a secretory peptide for example, the S protein signal sequence
- the amino acid sequences of SEQ ID NOs: 25, 29, 33 and 37 with the S protein signal sequence added are the amino acid sequences of SEQ ID NOs: 24 and 28, respectively. , 32 and 36.
- the receptor binding domain present in the S protein of SARS-CoV-2 may be derived from a mutant strain, and may be derived from a mutant strain, South African type, British type, Brazilian type, California type, Indian type, South African C538S type, British C538S type, Brazilian C538S. Type, California C538S type, Indian C538S type, combination mutant (1) (see Example 33 below), combination variant (2) (see Example 33 below), combination variant (3) (implemented below).
- the amino acid sequences of the receptor-binding domains of the combination mutant (4) are shown in SEQ ID NOs: 94-107.
- the sequences obtained by adding the S protein signal sequence to the amino acid sequences of SEQ ID NOs: 94 to 107 are shown in SEQ ID NOs: 80 to 93.
- the nucleic acid encapsulated in the lipid particles is at least 95%, preferably 96%, more preferably 97% with the amino acid sequence of SEQ ID NO: 25, 29, 33, 37, 94-107 (not including the S protein signal sequence). It is preferable that the receptor-binding domain in the S protein of SARS-CoV-2, which consists of an amino acid sequence having the same identity as the above, can be expressed.
- the nucleic acid encapsulated in the lipid particles is at least 95%, preferably 96%, more preferably 97% with the amino acid sequence of SEQ ID NO: 24, 28, 32, 36, 80-93 (including the S protein signal sequence). It may be capable of expressing a receptor-binding domain in the S protein of SARS-CoV-2, which consists of an amino acid sequence having the same identity.
- the nucleic acids capable of expressing the S protein of SARS-CoV-2 are the cap structure (Cap), the 5'untranslated region (5'-UTR), the translated region of the S protein, and the 3'untranslated region (3'-. It is preferable that the mRNA contains UTR) and polyA tail (polyA).
- the cap structure (Cap) is a site that is present at the 5'end of many eukaryotic mRNAs and has a 7-methylguanosine structure. Examples of the cap structure include cap0, cap1, cap2, ARCA, and CleanCap (registered trademark), but cap1 or CleanCap is preferable, and CleanCap is more preferable.
- the sequence of the 5'untranslated region is, for example, the sequence of base numbers 19 to 88 in the sequence of SEQ ID NO: 4.
- the sequence of the translation region of the S protein is a sequence capable of expressing all or part of the amino acid sequence of the S protein and may include a start codon and / or a stop codon, for example, in the sequence of SEQ ID NO: 4. It is a sequence of base numbers 89 to 3910. Further, the sequence of the translation region of the S protein may be a nucleotide sequence having at least 90% identity with the sequence of the translation region of the S protein in the sequence of SEQ ID NO: 5.
- the sequence of the 3'untranslated region (3'-UTR) is, for example, the sequence of base numbers 3911 to 4042 in the sequence of SEQ ID NO: 4.
- the sequence of the polyA tail (polyA) is, for example, the sequence of base numbers 4043 to 4142 in the sequence of SEQ ID NO: 4.
- the sequences of the cap structure (Cap), 5'untranslated region (5'-UTR), S protein translation region, 3'untranslated region (3'-UTR) and polyA tail (polyA) have been modified.
- the sequence of nucleic acid capable of expressing the S protein of SARS-CoV-2 may be a nucleotide having at least 90%, preferably 95%, more preferably 97% identity with the sequence of SEQ ID NO: 5.
- nucleic acid codons should be optimized. By optimizing the codons, the efficacy as a vaccine can be improved and side effects can be reduced. It can be optimized according to the codon usage frequency of the target organism.
- the codon optimization may be performed, for example, on the coding sequence, and in the sequence of SEQ ID NO: 16, the codon of the sequence of the translation region of the S protein is optimized.
- the sequence of nucleic acid capable of expressing the S protein of SARS-CoV-2 may consist of a nucleotide sequence having at least 90%, preferably 95%, more preferably 97% identity with the sequence of SEQ ID NO: 16.
- the nucleic acids capable of expressing the S protein fragment of SARS-CoV-2 are cap structure (Cap), 5'untranslated region (5'-UTR), leader sequence (leader sequence), and acceptor in S protein. It is preferable that the mRNA contains the translated region of the binding domain, the 3'untranslated region (3'-UTR), and the polyA tail (polyA).
- the cap structure (Cap) is a site that is present at the 5'end of many eukaryotic mRNAs and has a 7-methylguanosine structure. Examples of the cap structure include cap0, cap1, cap2, ARCA, and CleanCap (registered trademark), but cap1 or CleanCap is preferable, and CleanCap is more preferable.
- the sequence of the 5'untranslated region is, for example, the sequence of base numbers 19 to 88 in the sequence of SEQ ID NO: 8.
- the sequence of the leader sequence is, for example, the sequence of base numbers 89 to 127 in the sequence of SEQ ID NO: 8.
- the sequence of the translation region of the receptor-binding domain in the S protein is a sequence capable of expressing all or part of the amino acid sequence of the receptor-binding domain in the S protein, and contains a start codon and / or an end codon. Also good, for example, is the sequence of base numbers 128 to 799 in the sequence of SEQ ID NO: 8.
- sequence of the translation region of the receptor-binding domain in the S protein is a nucleotide sequence having at least 90% identity with the sequence of the translation region of the receptor-binding domain in the S protein in the sequence of SEQ ID NO: 9. May be good.
- the sequence of the 3'untranslated region (3'-UTR) is, for example, the sequence of base numbers 800 to 931 in the sequence of SEQ ID NO: 8.
- the sequence of the polyA tail (polyA) is, for example, the sequence of base numbers 932 to 1031 in the sequence of SEQ ID NO: 8.
- Cap structure Cap
- 5'untranslated region 5'-UTR
- leader sequence leader sequence
- translation region of receptor binding domain in S protein 3'untranslated region (3'-UTR) and poly
- sequence of the A tail may be modified, and the sequence of the nucleic acid capable of expressing the receptor-binding domain in the S protein of SARS-CoV-2 is at least the sequence of SEQ ID NO: 9. It is preferably composed of a nucleotide sequence having 90%, preferably 95%, more preferably 97% identity, most preferably the nucleotide sequence of SEQ ID NO: 9. Nucleic acid codons should be optimized. By optimizing the codons, the efficacy as a vaccine can be improved and side effects can be reduced.
- the codon optimization may be performed, for example, on the coding sequence, and in the sequence of SEQ ID NO: 19, the codon of the sequence of the translation region of the receptor binding domain in the S protein is optimized.
- the sequence of nucleic acid capable of expressing the receptor-binding domain in the SARS-CoV-2 S protein has at least 90%, preferably 95%, more preferably 97% identity with the sequence of SEQ ID NO: 19. It should consist of a nucleotide sequence.
- the sequence of the translation region of the receptor-binding domain in the S protein is the translation region of the receptor-binding domain in the S protein in any of the sequences of SEQ ID NOs: 21, 23, 27, 31, 35, 66 to 79. It may be a nucleotide sequence having at least 90%, preferably 95%, more preferably 97% identity with the sequence.
- SEQ ID NO: 21 is the nucleotide sequence of the mRNA of Example 11, and the mRNA of Example 11 is an mRNA having the same sequence other than poly A in the sequence of Example 6.
- poly A has 110 adenine nucleotides, whereas in the mRNA of Example 11, there are 50 adenine nucleotides.
- the nucleic acid contained in the lipid particles of the present invention may be mRNA having a relatively short poly A moiety, preferably 30 or more, 40 or more, and more preferably 50 or more.
- the upper limit of poly A is not particularly limited, but is preferably 500 or less, 400 or less, 300 or less, 200 or less, and 110 or less.
- SEQ ID NO: 23 is the nucleotide sequence of the mRNA of Example 13, and the mRNA of Example 13 is an mRNA capable of expressing a sequence in which the cysteine at position 538 (the number is the number counted from the N-terminal of the S protein) is replaced with serine. Is.
- SEQ ID NO: 27 is the nucleotide sequence of the mRNA of Example 15, and the mRNA of Example 15 is an mRNA capable of expressing an amino acid-deficient sequence for the N-terminal and C-terminal of the full-length sequence of RBD (R319-F541). be.
- SEQ ID NO: 31 is the nucleotide sequence of the mRNA of Example 17, and the mRNA of Example 17 is an mRNA capable of expressing a sequence in which amino acids are added to the N-terminal and C-terminal of the full-length sequence of RBD (R319-F541). ..
- SEQ ID NO: 35 is the nucleotide sequence of the mRNA of Example 19, and the mRNA of Example 19 is an mRNA capable of expressing a sequence in which the substitution of an amino acid residue occurs at a plurality of positions in the sequence of Example 6.
- SEQ ID NOs: 66 to 79 are South African type, British type, Brazilian type, California type, Indian type, South African C538S type, British C538S type, Brazilian C538S type, California C538S type, Indian C538S type, combination mutant type (1) (described later). 33), combination variant (2) (see Example 33 below), combination variant (3) (see Example 33 below), combination variant (4) (see Example 33 below). ) Is a nucleotide sequence of an mRNA capable of expressing the amino acid sequence of the receptor binding domain.
- the nucleic acid encapsulated in the lipid particles may be in any form as long as it is a nucleic acid capable of expressing the SA protein of SARS-CoV-2 and / or a fragment thereof.
- single-stranded DNA single-stranded RNA (eg, mRNA), single-stranded polynucleotide in which DNA and RNA are mixed, double-stranded DNA, double-stranded RNA, hybrid polynucleotide of DNA-RNA, DNA and RNA.
- mRNA single-stranded polynucleotide in which DNA and RNA are mixed
- double-stranded DNA double-stranded RNA
- hybrid polynucleotide of DNA-RNA DNA and RNA.
- Examples thereof include double-stranded polynucleotides composed of two types of polynucleotides in which the above is mixed, and mRNA is preferable.
- the nucleotides constituting the nucleic acid encapsulated in the lipid particles may be natural or modified nucleotides, but may contain at least one modified nucleotide.
- the modified nucleotide may be one in which any part of the base, sugar and phosphodiester bond is modified.
- the modification site may be one site or two or more sites.
- base modifications include cytosine 5-methylation, 5-fluoromation, N4-methylation, uracil 5-methylation (thymine), 5-fluorolation, adenine N6-methylation, and guanine N2. -Methylation can be mentioned.
- sugar modification is 2'-O-methylation of D-ribofuranose.
- An example of modification of a phosphate diester bond is a phosphorothioate bond.
- the modified nucleotide is preferably one in which the base portion is modified, and is preferably, for example, a pyrimidine nucleotide substituted at the 5-position and a pseudouridine optionally substituted at the 1-position, specifically, 5-methylcytidine. Examples thereof include 5-methoxyuridine, 5-methyluridine, pseudouridine, and 1-alkyl pseudouridine.
- the 1-alkyl pseudouridine may be 1- (C1-C6 alkyl) pseudouridine, preferably 1-methylseudouridine or 1-ethylsudouridine.
- Modified nucleotides with modified base moieties may be used alone or in combination in place of native nucleotides.
- Combinations of modified nucleotides with modified bases include, for example, a combination of 5-methylcytidine and 5-methyluridine, a combination of 5-methylcytidine and pseudouridine, or a combination of 5-methylcytidine and 1-methylpseudouridine. It may be, preferably a combination of 5-methylcytidine and 5-methyluridine.
- the nucleic acid capable of expressing the S protein of SARS-CoV-2 of the present invention and / or a fragment thereof can be produced by an in vitro transcription reaction from DNA having a desired base sequence.
- Enzymes required for in-vitro transcription, buffer, and nucleoside-5'-triphosphate mixture (adenosine-5'-triphosphate (ATP), guanosine-5'-triphosphate (GTP), cytidine-5'-triphosphate) Acids (CTP) and uridine-5'-triphosphate (UTP) are commercially available (eg, AmpliScribeT7 High YieldTranscription Kit (Epicentre), mMESSAGE mMACHINE T7 Ultra Kit (Life thechnologies), etc.).
- the DNA used to produce the single-stranded RNA is cloned DNA, such as plasmid DNA or DNA fragment.
- the plasmid DNA or DNA fragment may be commercially available or can be produced by a method generally known in the art (eg, Sambrook, J. et al., Molecular Cloning a Laboratory). Manual second edition (1989), Rashtchian, A., Current Opinion in Biotechnology, 1995, 6 (1), 30-36, Gibson D. G. et al., Science, 2008, 319 (5867), 1215-1220 Method of description etc.).
- a cap structure (Cap0 structure described above) can be introduced into the 5'end of mRNA by a method using a capping enzyme after an in vitro transcription reaction. Further, Cap0 can be converted to Cap1 by a method of allowing 2'-O-methyltransferase to act on mRNA having Cap0.
- Commercially available products can be used for the capping enzyme and 2'-O-methyltransferase (for example, Vaccinia Capping System, M2080; mRNA Cap 2'-O-Methyltransferase, M0366, both manufactured by New England Biolab).
- mRNA having a cap structure can be produced according to the protocol attached to the product.
- the cap structure at the 5'end of mRNA can also be introduced by a method other than that using an enzyme.
- ARCA or CleanCap registered trademark
- the structure of the cap analog possessed by ARCA or the Cap1 structure derived from CleanCap registered trademark
- Commercially available products can be used for ARCA and CleanCap (registered trademark) (ARCA, N-7003; CleanCap Reagent AG, N-7113, both manufactured by TriLink BioTechnologies).
- ARCA and CleanCap registered trademark
- mRNA having a cap structure can be produced according to the protocol attached to the product.
- the nucleic acid encapsulated in the lipid particles may be purified by a method such as desalting, reverse phase column, gel filtration, HPLC, or PAGE.
- a method such as desalting, reverse phase column, gel filtration, HPLC, or PAGE.
- dsRNA double-stranded RNA
- the amount of dsRNA contained in the nucleic acid encapsulated in the lipid particles is preferably 10% or less, more preferably 7.5% or less, still more preferably 5% or less, and particularly preferably 3% or less in terms of mass percentage.
- the nucleic acid-encapsulated lipid particles of the present invention are produced by a thin film method, a reverse phase evaporation method, an ethanol injection method, an ether injection method, a dehydration-rehydration method, a surfactant dialysis method, a hydration method, a freeze-thaw method, or the like. can do.
- nucleic acid-encapsulated lipid particles can be produced by the method described in International Publication No. 2015/005253 pamphlet.
- the particles of the present invention preferably have an average particle diameter of 30 nm to 300 nm, preferably 30 to 200 nm, more preferably 30 to 150 nm, and even more preferably 30 to 100 nm.
- the average particle size can be obtained by measuring the volume average particle size based on the principle of dynamic light scattering using a device such as Zeta Potential / Particle Sizer NICOMP (registered trademark) 380ZLS (PARTICLE SIZING SYSTEMS). can.
- the particles of the present invention can be used to produce a composition for preventing and / or treating infection with a new type of coronavirus (severe acute respiratory syndrome coronavirus 2: SARS-CoV-2).
- SARS-CoV-2 severe acute respiratory syndrome coronavirus 2
- the strain of SARS-CoV-2 is not particularly limited, but the Wuhan strain is preferable.
- the present invention provides a method for expressing SARS-CoV-2 S protein and / or a fragment thereof in vitro, which comprises introducing a composition containing the above particles into cells.
- the present invention also provides a method for expressing SARS-CoV-2 S protein and / or a fragment thereof in vivo, which comprises administering a composition containing the above particles to a mammal.
- the present invention provides a method for inducing an immune response against SARS-CoV-2, which comprises administering a composition containing the above particles to a mammal.
- the present invention also provides a method for preventing and / or treating SARS-CoV-2 infection, which comprises administering a composition containing the above particles to a mammal.
- the particles of the present invention can be used as pharmaceuticals and as experimental reagents.
- the particles of the present invention are usually added to a carrier such as water, buffer, saline, etc., and the formulation (composition) can be introduced into cells (in vivo) or administered to mammals (in vitro). vivo).
- the carrier When administered to a mammal, the carrier may be a pharmaceutically acceptable carrier (eg, saline).
- the particles of the present invention are creams and pastes based on fat, fatty oil, lanolin, petrolatum, paraffin, wax, resin, plastic, glycols, higher alcohols, glycerin, water, emulsifiers, suspending agents and the like. , Ointment, gel, lotion, etc. may be formulated.
- the particles of the present invention are orally or intramuscularly or intravenously administered to mammals such as humans, mice, rats, hamsters, guinea pigs, rabbits, pigs, monkeys, cats, dogs, horses, goats, sheep and cows.
- Parenteral administration can be performed by methods such as administration, rectal administration, transdermal administration, transmucosal administration, subcutaneous administration, and intradermal administration.
- the amount of mRNA per adult is about 0.001 to 1 mg, preferably 0.01 to 0.2 mg, once or several times, intramuscular injection, subcutaneously. Injection, intradermal injection, intravenous drip injection, or intravenous injection may be performed, but the dose and frequency of administration may be appropriately changed depending on the type of disease, symptoms, age, administration method, and the like.
- cells in which the particles of the present invention are to express the S protein of SARS-CoV-2 and / or a fragment thereof for example, HEK293 cells and their derivative cells (HEK293T cells, FreeStyle293 cells and Expi293 cells)).
- CHO cells, C2C12 mouse myoblasts, immortalized mouse dendritic cells (MutuDC1940)), and SARS-CoV-2 S protein and / or fragments thereof can be expressed in vitro.
- Expression of SARS-CoV-2 S protein and / or fragment thereof can be detected by Western blotting for SARS-CoV-2 S protein and / or fragment thereof, or SARS-CoV-2 S protein.
- / or a peptide fragment specific to the fragment can be detected by mass spectrometry.
- treatment is an infection caused by a virus or a bacterium, or a disease caused by the infection (for example, pneumonia), in which the clinical symptoms of these diseases are recovered, ameliorated, alleviated and / or treated. It means a delay in deterioration.
- prevention means reducing the incidence of diseases due to infectious diseases such as viruses or bacteria. Prevention includes reducing the risk of disease progression due to infections such as viruses or bacteria, or reducing the aggravation of those diseases. Since the particles of the present invention induce a protective immune response, they are effective in the prevention and / or treatment of the above-mentioned diseases.
- Example 1 Preparation of SARS-CoV-2 S full mRNA-001 (1) Preparation of template DNA for SARS-CoV-2 S full in vitro translation (IVT) Amplification of SARS-CoV-2 S full DNA by PCR to prepare template DNA for use in In vitro translation (IVT). It was post-purified.
- a DNA fragment containing a sequence in which the T7 promoter sequence, the 5'-UTR sequence of human ⁇ -globin, the KOZAK sequence, the SARS-CoV-2 S full, and the 3'-UTR sequence of human ⁇ -globin are linked in order (SEQ ID NO: 1).
- Nuclease-free water (849.6 ⁇ L) in which 6 ng of the plasmid was lysed. 2 (120 ⁇ L, Toyobo Co., Ltd. catalog # KOD-211), 2 mM dNTP mix (120 ⁇ L, Toyobo Co., Ltd.
- RQ1 RNase-Free DNase 25 ⁇ L, Promega catalog # M6101
- An 8M LiCl solution 500 ⁇ L, Sigma-Aldrich catalog # L7026
- the obtained residue was dissolved in Nuclease-free water and then purified using RNeasy Maxi kit (Qiagen catalog # 75162) according to the attached manual.
- the obtained eluate (5.8 mL, 4906 ⁇ g in UV conversion), Nuclease-free water (419 ⁇ L), rApid Alkaline Phosphatase (Roche catalyst # 04 898 141001) buffer solution (800 ⁇ L) and enzyme (800 ⁇ L). , 37 ° C. for 30 minutes and then 75 ° C. for 3 minutes.
- An 8M LiCl solution (8000 ⁇ L) was mixed and allowed to stand at ⁇ 20 ° C. overnight.
- the obtained residue was dissolved in Nuclease-free water and then purified using RNeasy Maxi kit according to the attached manual to obtain the desired mRNA.
- the obtained mRNA has the sequence of SEQ ID NO: 5. It was analyzed by LabChip GX Touch Standard RNA Reagent Kit (PerkinElmer catalog # CLS960010), and it was confirmed that the length was the desired length.
- Example 2 Preparation of SARS-CoV-2 RBD mRNA-002
- ITT in vitro translation
- the SARS-CoV-2 RBD DNA is amplified and purified by PCR to prepare a template DNA for use in In vitro translation (IVT). did.
- the T7 promoter sequence, the 5'-UTR sequence of human ⁇ -globin, the KOZAK sequence, the signal sequence of the SARS-CoV-2 S protein, the SARS-CoV-2 RBD, and the 3'-UTR sequence of human ⁇ -globin were linked in this order.
- a DNA fragment containing the sequence (SEQ ID NO: 7) was introduced into the plasmid (pUC57mini-RBD). 10 ⁇ Buffer for KOD-Plus-Ver. In Nuclease-free water (849.6 ⁇ L) in which 6 ng of the plasmid was lysed. 2 (120 ⁇ L, Toyobo Co., Ltd. catalog # KOD-211), 2 mM dNTP mix (120 ⁇ L, Toyobo Co., Ltd. catalog # KOD-211), 25 mM ⁇ 4 (72 ⁇ L, Toyobo Co., Ltd.
- Example 2- (1) Preparation of SARS-CoV-2 RBD mRNA-002 by in vitro translation Using the template DNA obtained in Example 2- (1) instead of the template DNA obtained in Example 1- (1). MRNA was obtained in the same manner as in Example 1- (2). The obtained mRNA has the sequence of SEQ ID NO: 9. Analysis was performed by the LabChip GX Touch Standard RNA Reagent Kit, and it was confirmed that the length was the desired length.
- Example 3 Preparation of mRNA-encapsulated nucleic acid lipid particles using the SARS-CoV-2 S full mRNA described in Example 1.
- DSPC Distearoylphosphatidylcholine (1,2-Distearoyl-sn-glycero-3-phosphatidylne: hereinafter referred to as DSPC, NOF CORPORATION), cholesterol (Colesterol: hereinafter referred to as Chol, Sigma-Aldrich, Inc.), diacetic acid (7R, 9Z, 26Z, 29R) -18-( ⁇ [3- (dimethylamino) propoxy] carbonyl ⁇ oxy) pentatria contour-9,26-diene-7,29-diyl (WO2015) / 005253 compound according to Example 23) (hereinafter referred to as LP), and 1,2-distearoyl-sn-glycerol methoxypolyethylene
- lipid solution and mRNA solution were mixed in a microchannel using NanoAssemblr BenchTop (Precision Nanosystems Inc.) so that the volume ratio was 1: 3, and a crude dispersion of nucleic acid lipid particles was obtained.
- LP was synthesized according to the method described in Example 23 of WO2015 / 005253.
- the amount of each lipid in the dispersion of nucleic acid lipid particles was measured by reverse phase chromatography (System: DIONEX UltiMate 3000, Volume: XSelect CSH C18 (150 mm ⁇ 3 mm, 3.5 ⁇ m, 130 ⁇ ) (Waters catalog # 186005263).
- Buffet A 0.2% formic acid
- Buffet B 0.2% formic acid
- methanol (B%): 75-100% (0-6 min), 100% (6-15 min)
- Flow Rate 0.45 mL / min
- Temperature 50 ° C.
- Detection Corona CAD (Charged Aerosol Detector)
- the ratio of total lipid amount to mRNA was calculated by the following formula. [Total lipid concentration] / [mRNA concentration] (wt / wt)
- Example 4 Preparation of mRNA-encapsulated nucleic acid lipid particles using the SARS-CoV-2 RBD mRNA described in Example 2 mRNA-encapsulated nucleic acid lipid using the mRNA described in Example 2 in the same manner as in Example 3. Particles were prepared and their characteristics were evaluated. The results are shown in Table 1. (Table 1) From the above results, it was clarified that 90% or more of the mRNA of these nucleic acid lipid particles is encapsulated in the lipid particles and has an average particle diameter of about 100 nm to about 130 nm.
- SARS-CoV-2 S full optimized mRNA-003 (1) Preparation of template DNA for SARS-CoV-2 S full optimized (IVT) T7 promoter sequence, human ⁇ -glob A DNA fragment (SEQ ID NO: 12) containing a sequence in which the 5'-UTR sequence, the KOZAK sequence, the SARS-CoV-2 S full optimized, and the 3'-UTR sequence of human ⁇ -globin were sequentially linked was artificially synthesized into a plasmid. Introduced (S_opt2 EcoRI).
- SARS-CoV-2 S full-optimized SEQ ID NO: 15
- the template DNA was cleaved with restriction enzymes NheI and HindIII, and then introduced into a plasmid cleaved with the restriction enzymes to prepare a template plasmid (pUCKIVT1 S full optimized). After cleaving the plasmid with the restriction enzyme BspQI, DNA was purified by isopropanol precipitation to prepare linear plasmid DNA.
- SARS-CoV-2 RBD optimized mRNA-004 (1) Preparation of template DNA for SARS-CoV-2 RBD optimized in vitro translation (IVT) T7 promoter sequence, human ⁇ -globin 5 A DNA fragment (SEQ ID NO: 17) containing a sequence in which the'-UTR sequence, KOZAK sequence, SARS-CoV-2 RBD optimized, and human ⁇ -globin 3'-UTR sequence were sequentially linked was artificially synthesized and introduced into a plasmid (SEQ ID NO: 17). S_RBD_opt2 EcoRI).
- Nuclease-free water (69 ⁇ L) in which 1 ng of the plasmid was lysed, 5 ⁇ SuperFi Green Buffer (20 ⁇ L, ThermoFisher Scientific catalyst # 12357-010), 2 mM dNTP mix (8 ⁇ L), 2 mM dNTP mix (8 ⁇ L), and 2 mM dNTP mix (8 ⁇ L).
- SARS-CoV-2 RBD-optimized DNA SEQ ID NO: 18
- the template DNA was cleaved with restriction enzymes NheI and HindIII, and then introduced into a plasmid cleaved with the restriction enzymes to prepare a template plasmid (pUCKIVT1-RBD optimized). After cleaving the plasmid with the restriction enzyme BspQI, DNA was purified by isopropanol precipitation to prepare linear plasmid DNA.
- Example 7 Preparation of mRNA-encapsulated nucleic acid lipid particles using the SARS-CoV-2 S full optimized mRNA described in Example 5 mRNA encapsulation using the mRNA described in Example 5 in the same manner as in Example 3. Nucleic acid lipid particles were prepared and their characteristics were evaluated. However, dialysis was performed using 300 mM sucrose and 10 mM histidine buffer (pH 7.0) instead of 300 mM sucrose and 10 mM histidine buffer (pH 6.5) to obtain a dispersion of mRNA-encapsulated nucleic acid lipid particles. The results are shown in Table 2.
- Example 8 Preparation of mRNA-encapsulated nucleic acid lipid particles using the SARS-CoV-2 RBD optimized mRNA described in Example 6 mRNA-encapsulated nucleic acid using the mRNA described in Example 6 in the same manner as in Example 3. Lipid particles were prepared and their characteristics were evaluated. However, dialysis was performed using 300 mM sucrose and 10 mM histidine buffer (pH 7.0) instead of 300 mM sucrose and 10 mM histidine buffer (pH 6.5) to obtain a dispersion of mRNA-encapsulated nucleic acid lipid particles. The results are shown in Table 2.
- Example 9 HPLC purification of SARS-CoV-2 RBD optimized mRNA-004
- the mRNA obtained by the method described in Example 6- (2) was subjected to reverse phase chromatography (YMC-Triart Bio C4 (YMC catalog # TB30S05)). -1510WT), 5% acetonitrile, 400 mM triethylamine acetate (pH 7.0) / 25% acetonitrile, 400 mM triethylamine acetate (pH 7.0), 75 ° C.).
- Example 10 Preparation of mRNA-encapsulated nucleic acid lipid particles using the SARS-CoV-2 RBD optimized mRNA described in Example 6 Using the mRNA described in Example 9 in the same manner as in Example 8. The mRNA-encapsulated nucleic acid lipid particles were prepared and their characteristics were evaluated. The results are shown in Table 2. (Table 2) From the above results, it was clarified that 90% or more of the mRNA of these nucleic acid lipid particles is encapsulated in the lipid particles and has an average particle diameter of about 90 nm to about 130 nm.
- Example 11 Preparation of SARS-CoV-2 RBD S2000 mRNA (1) Preparation of template DNA for in vitro translation (IVT) of SARS-CoV-2 RBD S2000 A plasmid was constructed to prepare a template DNA for use in in vitro translation (IVT).
- GCTAGC (NheI site), T7 promoter sequence, human ⁇ -globin 5'-UTR sequence, KOZAK sequence, SARS-CoV-2 S protein signal sequence, SARS-CoV-2 RBD translation region, human ⁇ -globin A plasmid (pUC57-S2000) was prepared into which a DNA fragment (SEQ ID NO: 20) containing a sequence in which a 3'-UTR sequence, a poly A tail, and a GAAGAGC (BspQI site) were sequentially linked was introduced.
- Nuclease-freewater (860 ⁇ L, Thermo Fisher, catalog # AM9937) lysed with plasmid (100 ⁇ g) with 10X NEB Buffer 3.1 (100 ⁇ L, New England Biolabs, Biolabs, biolabs, callo) # R0712) was added, and after incubation at 50 ° C. for 1 hour, isopropanol (1400 ⁇ L) was added, and the mixture was allowed to stand at ⁇ 80 ° C. overnight.
- Example 12 Preparation of mRNA-encapsulated nucleic acid lipid particles using SARS-CoV-2 RBD S2000 mRNA described in Example 11 Using the mRNA described in Example 11 in the same manner as in Example 8. The mRNA-encapsulated nucleic acid lipid particles were prepared and their characteristics were evaluated. However, the amount of mRNA was measured by the following method. The nucleic acid lipid particle dispersion was diluted and dissolved in 90% methanol, and the amount of mRNA in the nucleic acid lipid particles was measured with an ultraviolet-visible spectrophotometer (LAMBDA TM 465 manufactured by PerkinElmer). The mRNA concentration was calculated by the following formula.
- LAMBDA TM 465 ultraviolet-visible spectrophotometer
- GCTAGC (NheI site), T7 promoter sequence, human ⁇ -globin 5'-UTR sequence, KOZAK sequence, SARS-CoV-2 S protein signal sequence, SARS-CoV-2 RBD translation region, human ⁇ -globin A plasmid (pUC57-S2001) was prepared into which a DNA fragment (SEQ ID NO: 22) containing a sequence in which a 3'-UTR sequence, a poly A tail, and a GAAGAGC (BspQI site) were sequentially linked was introduced.
- Nuclease-freewater (860 ⁇ L, Thermo Fisher, catalog # AM9937) lysed with plasmid (100 ⁇ g) with 10X NEB Buffer 3.1 (100 ⁇ L, New England Biolabs, Biolabs, biolabs, callo) # R0712) was added, and after incubation at 50 ° C. for 1 hour, isopropanol (1400 ⁇ L) was added, and the mixture was allowed to stand at ⁇ 80 ° C. overnight.
- Example 14 Preparation of mRNA-encapsulated nucleic acid lipid particles using the SARS-CoV-2 RBD S2001 mRNA described in Example 13 mRNA-encapsulated nucleic acid using the mRNA described in Example 13 in the same manner as in Example 12. Lipid particles were prepared and their characteristics were evaluated. The results are shown in Table 3. From the results of the property evaluation, it was clarified that 95% or more of the mRNA of this nucleic acid lipid particle is encapsulated in the lipid particle and has an average particle diameter of about 140 nm.
- Example 15 Preparation of SARS-CoV-2 RBD S2002 mRNA (1) Preparation of template DNA for in vitro translation (IVT) of SARS-CoV-2 RBD S2002 A plasmid was constructed to prepare a template DNA for use in in vitro translation (IVT).
- GCTAGC (NheI site), T7 promoter sequence, human ⁇ -globin 5'-UTR sequence, KOZAK sequence, SARS-CoV-2 S protein signal sequence, SARS-CoV-2 RBD translation region, human ⁇ -globin A plasmid (pUC57-S2002) was prepared into which a DNA fragment (SEQ ID NO: 26) containing a sequence in which a 3'-UTR sequence, a poly A tail, and a GAAGAGC (BspQI site) were sequentially linked was introduced.
- Nuclease-freewater (860 ⁇ L, Thermo Fisher, catalog # AM9937) lysed with plasmid (100 ⁇ g) with 10X NEB Buffer 3.1 (100 ⁇ L, New England Biolabs, Biolabs, biolabs, callo) # R0712) was added, and after incubation at 50 ° C. for 1 hour, isopropanol (1400 ⁇ L) was added, and the mixture was allowed to stand at ⁇ 80 ° C. overnight.
- Example 16 Preparation of mRNA-encapsulated nucleic acid lipid particles using the SARS-CoV-2 RBD S2002 mRNA described in Example 15 mRNA-encapsulated nucleic acid using the mRNA described in Example 15 in the same manner as in Example 12. Lipid particles were prepared and their characteristics were evaluated. The results are shown in Table 3. From the results of the property evaluation, it was clarified that 95% or more of the mRNA of this nucleic acid lipid particle is encapsulated in the lipid particle and has an average particle diameter of about 140 nm.
- GCTAGC (NheI site), T7 promoter sequence, human ⁇ -globin 5'-UTR sequence, KOZAK sequence, SARS-CoV-2 S protein signal sequence, SARS-CoV-2 RBD translation region, human ⁇ -globin A plasmid (pCC1-S2003) was prepared into which a DNA fragment (SEQ ID NO: 30) containing a sequence in which a 3'-UTR sequence, a poly A tail, and a GAAGAGC (BspQI site) were sequentially linked was introduced.
- Nuclease-freewater (860 ⁇ L, Thermo Fisher, catalog # AM9937) lysed with plasmid (100 ⁇ g) with 10X NEB Buffer 3.1 (100 ⁇ L, New England Biolabs, Biolabs, biolabs, callo) # R0712) was added, and after incubation at 50 ° C. for 1 hour, isopropanol (1400 ⁇ L) was added, and the mixture was allowed to stand at ⁇ 80 ° C. overnight.
- Example 18 Preparation of mRNA-encapsulated nucleic acid lipid particles using SARS-CoV-2 RBD S2003 mRNA described in Example 17 mRNA-encapsulated nucleic acid using mRNA described in Example 17 in the same manner as in Example 12. Lipid particles were prepared and their characteristics were evaluated. The results are shown in Table 3. From the results of the property evaluation, it was clarified that 95% or more of the mRNA of this nucleic acid lipid particle is encapsulated in the lipid particle and has an average particle diameter of about 140 nm.
- GCTAGC (NheI site), T7 promoter sequence, human ⁇ -globin 5'-UTR sequence, KOZAK sequence, SARS-CoV-2 S protein signal sequence, SARS-CoV-2 RBD translation region, human ⁇ -globin A plasmid (pCC1-S2004) was prepared into which a DNA fragment (SEQ ID NO: 34) containing a sequence in which a 3'-UTR sequence, a poly A tail, and a GAAGAGC (BspQI site) were sequentially linked was introduced.
- Nuclease-freewater (860 ⁇ L, Thermo Fisher, catalog # AM9937) lysed with plasmid (100 ⁇ g) with 10X NEB Buffer 3.1 (100 ⁇ L, New England Biolabs, Biolabs, biolabs, callo) # R0712) was added, and after incubation at 50 ° C. for 1 hour, isopropanol (1400 ⁇ L) was added, and the mixture was allowed to stand at ⁇ 80 ° C. overnight.
- Example 20 Preparation of mRNA-encapsulated nucleic acid lipid particles using SARS-CoV-2 RBD S2004 mRNA described in Example 19 mRNA-encapsulated nucleic acid using mRNA described in Example 19 in the same manner as in Example 12. Lipid particles were prepared and their characteristics were evaluated. The results are shown in Table 3. From the results of the property evaluation, it was clarified that 95% or more of the mRNA of this nucleic acid lipid particle is encapsulated in the lipid particle and has an average particle diameter of about 180 nm.
- Example 21 to 30 Preparation of mRNA-encapsulated nucleic acid lipid particles using the mRNA described in Example 6 (1) Preparation of mRNA-encapsulated nucleic acid lipid particles Distearoylphosphatidylcholine (DSPC), cholesterol, diacetic acid (7R, 9Z, 26Z) , 29R) -18-( ⁇ [3- (dimethylamino) propoxy] carbonyl ⁇ oxy) pentatria contour-9,26-diene-7,29-diyl (LP), and polyethylene glycol molecular weight of about 2000 1, 1, 2-Dimiristyl-sn-glycerol methoxypolyethylene glycol (PEG-DMG) was dissolved in ethanol at the molar ratios shown in Table 4 to a total lipid concentration of 5 mM.
- DSPC Distearoylphosphatidylcholine
- LP diacetic acid
- LP diacetic acid
- LP diacetic acid
- LP
- the mRNA obtained in Example 6 was diluted and prepared with a citrate buffer (pH 4.0).
- the mixture was mixed in the room to obtain a crude dispersion of nucleic acid lipid particles.
- Ethanol was removed by dialysis (Float-A-Lyzer G2, MWCO: 1,000 kD, Spectra / Por) of the dispersion of nucleic acid lipid particles with a buffer solution of about 25 to 50 times the amount for 12 to 18 hours.
- a dispersion of purified mRNA-encapsulated nucleic acid lipid particles was obtained.
- Characteristic evaluation of mRNA-encapsulated nucleic acid lipid particles The characteristics of the dispersion containing the nucleic acid lipid particles prepared in (1) were evaluated. Each characteristic evaluation method will be described.
- (2-1) Encapsulation rate of mRNA The encapsulation rate of mRNA was measured using a Quant-iT RiboGreen RNA Assay kit (Invitrogen) according to the package insert. That is, mRNA in the dispersion liquid of nucleic acid lipid particles was quantified in the presence and absence of 0.015% Triton X-100 surfactant, and the encapsulation rate was calculated by the following formula.
- the ratio of total lipid amount to mRNA was calculated by the following formula. [Total lipid concentration] / [mRNA concentration] (wt / wt) (2-3) Average particle size The particle size of the nucleic acid lipid particles was measured by Zeta Potential / Solid Sizer NICOMPTM 380ZLS (PARTICLE SIZING SYSTEMS).
- the average particle size in the table represents the volume average particle size, and ⁇ or less represents the deviation.
- the results of the characteristic evaluation are shown in Table 5. It was revealed that 95% or more of these nucleic acid lipid particles are encapsulated in the lipid particles and have an average particle diameter of about 90 nm to about 140 nm.
- Example 31 Preparation of mutant SARS-CoV-2 RBD mRNA
- SARS-CoV-2 RBD mRNA was prepared.
- the symbols after the example numbers in Table 7 correspond to the respective variants as shown in Table 6.
- Example 32-a represents a nucleic acid lipid particle encapsulated in an mRNA having a South African type mutation obtained in Example 32.
- IVT in vitro translation
- IVT template DNA for in vitro translation
- T7 promoter sequence human ⁇ -globin 5'-UTR sequence, KOZAK sequence, SARS-CoV-2 S protein signal sequence, mutant SARS-CoV-2 RBD, human ⁇ -globin 3'-UTR sequence in order.
- a DNA fragment containing the ligated sequence (SEQ ID NO: 38) was introduced into the plasmid (pUC57mini-mutant RBD).
- the template DNA (SEQ ID NO: 52) was purified by Wizard SV Gel and PCR Clean-Up System (Promega catalog # A9281).
- the template DNAs of SEQ ID NOs: 53 to 55, 57, 62 to 65 are obtained by the same method using the DNA fragments of SEQ ID NOs: 39 to 41, 43 and 48 to 51 instead of the DNA fragment (SEQ ID NO: 38), respectively. rice field.
- (2) Preparation of mutant SARS-CoV-2 RBD mRNA by in vitro translation The template DNA obtained in Example 31- (1) instead of the template DNA obtained in Example 1- (1) (SEQ ID NO:). 52) was used to obtain mRNA in the same manner as in Example 1- (2).
- the resulting mRNA has the sequence of SEQ ID NO: 66.
- the mRNAs of SEQ ID NOs: 67 to 69, 71, 76 to 79 were obtained by the same method using the template DNAs of SEQ ID NOs: 53 to 55, 57 and 62 to 65 instead of the template DNA (SEQ ID NO: 52), respectively. ..
- Example 32 Preparation of mRNA-encapsulated nucleic acid lipid particles using the SARS-CoV-2 RBD mRNA described in Example 31 mRNA-encapsulated nucleic acid lipid using the mRNA described in Example 31 in the same manner as in Example 8. Particles were prepared and their characteristics were evaluated. The results are shown in Table 7. From the results of the property evaluation, it was clarified that 95% or more of these nucleic acid lipid particles are encapsulated in the lipid particles and have an average particle diameter of about 110 nm to about 130 nm.
- Example 33 Preparation of mRNA-encapsulated nucleic acid lipid particles using the SARS-CoV-2 RBD mRNA described in Example 6 mRNA-encapsulated nucleic acid lipid using the mRNA described in Example 6 in the same manner as in Example 8. Particles were prepared and their characteristics were evaluated. The results are shown in Table 7. From the results of the property evaluation, it was clarified that 95% or more of the mRNA of this nucleic acid lipid particle is encapsulated in the lipid particle and has an average particle diameter of about 110 nm.
- Fig. 2-Fig. 4 The test substance was administered to the hind limb abdomen of mice under 1 to 4% (v / v) vaporized isoflurane anesthesia. The 3-dose study was additionally administered 7 days and 21 days after the first dose (1st dose: right hind limb, 2nd dose: left hind limb, 3rd dose: right hind limb), and the 2-dose study was the first dose. Additional administration was performed 13 days after the operation (first administration: right hind limb, second administration: left hind limb). The test substance was administered with 3 ⁇ g mRNA / 20 ⁇ L / body or 1 ⁇ g mRNA / 20 ⁇ L / body at a time (in FIG. 2-FIG.
- Example 3_3 in FIG. 2-Fig. 4 means that the particles of Example 3 were administered with 3 ⁇ g mRNA / 20 ⁇ L / body).
- the buffer for preparing the administration solution 10 mM Histidine buffer containing 300 mM Sucrose and pH 6.5 were used.
- the S1 protein (Sino Biological, Cat # 40591-V08H) supplemented with a commercially available saponin adjuvant (Quil-A Adjuvant, Invivogen, Cat # vac-quil) was set as a positive control group for the anti-RBD antibody response (S1 / Quil-). Group A).
- S1 protein and Quil-A 1 ⁇ g S1 and 10 ⁇ g Quil-A / 20 ⁇ L / body were administered at a time.
- spleen was collected from mice hemolyzed under isoflurane anesthesia, a cell suspension was prepared using a cell strainer (CORNING, Cat # 352350), and then an ACK solution (Lysing Buffer, BD, Cat # 555899) was applied. Hemolysis treatment was performed using the spleen cells.
- Example 3 or 4 Particles of Example 3 or 4 were added to Expi293F cells (Thermo Fisher Scientific, Cat # A14527) so that the mRNA concentration in the protein expression analysis medium was 10 ⁇ g / mL. Further, as a negative control, an amount of Buffer equal to the amount of the particles added in Example 4 was added. Culture supernatants and cell pellets were collected 3 days after addition. Cell pellets were lysed with M-PER (Thermo Fisher Scientific, Cat # 78501) supplemented with a 1 x Protease / Phosphatase inhibitor (Thermo Fisher Scientific, Cat # 78443) and centrifuged (9100 x g, 4 ° C., The cytolytic solution was collected in 10 minutes).
- M-PER Thermo Fisher Scientific, Cat # 78501
- a 1 x Protease / Phosphatase inhibitor Thermo Fisher Scientific, Cat # 78443
- the culture supernatant diluted 810 times and 2430 times with D-PBS and the cytolytic solution diluted 10 times and 30 times were immobilized on a 96 half well plate (Coaster, Cat # 3690), and an anti-RBD antibody (Sino Biological) was immobilized. , Cat # 40592-T62) was used to detect the protein expressed by the particles of Example 3 or 4 by the Enzyme-Linked Immunosorbent Assay (ELISA) method.
- ELISA Enzyme-Linked Immunosorbent Assay
- Blood anti-RBD antibody titer (Fig. 2-Fig. 4) Recombinant RBD protein (Sino Biological, Cat # 40592-V08H) was added to a Ni plate (QIAGEN, Cat # 35061) in a blocking solution (1% BSA, PBS containing 0.05% Tween 20) at 0.25 ⁇ g / mL (50 ⁇ L /). Well), allowed to stand at room temperature for 2 hours, and then washed 3 times with 300 ⁇ L / well of washing solution (PBS containing 0.05% Tween 20). Sample dilution series were prepared in 8 steps with 4-fold dilution from the highest concentration of 100-fold diluted serum using blocking solution.
- Standard serum dilution series were prepared in 8 steps with 3-fold dilution from the highest concentration of 2 DS UNIT / mL using blocking solution.
- a sample diluted solution and a standard serum diluted solution were added (50 ⁇ L / well), allowed to stand at room temperature for 1 hour, and then washed 3 times with a washing solution.
- HRP-labeled anti-mouse IgG antibody (Southern Biotech, Cat # 1030-05) was diluted 4000-fold with a blocking solution, added to a plate (50 ⁇ L / well), and then allowed to stand at room temperature for 1 hour.
- TMB Microwell Peroxidase Substrate System (SERACARE Life Sciences, Cat # 5120-0047) was added (50 ⁇ L / well), and the mixture was allowed to stand for 10 minutes.
- TMB Stop Solution (SERACARE Life Sciences, Cat # 5150-0021, 50 ⁇ L / well) was used as the reaction stop solution.
- the absorbance at a wavelength of 450 nm was measured using a plate reader, and the corrected absorbance (Delta) obtained by subtracting the absorbance measured at 540 nm from the absorbance measured at 450 nm was used for the analysis.
- a calibration curve was prepared using Nonlinear Regression: 4 Parameter from the anti-RBD antibody concentration and Delta of standard serum.
- the anti-RBD antibody concentration of the sample was calculated from the calibration curve, the dilution ratio of the measurement sample, and Delta.
- the average value of the antibody concentration of the well with Delta of 0.5 to 1.5 was calculated as the anti-RBD antibody concentration of the measurement sample.
- 20 DS UNIT / mL was substituted and used as data.
- RBD-hACE2 binding inhibitory activity 96 half well plate (Coaster, Cat # 3690) was added with 10 ⁇ g / mL Streptavidin (Thermo Fisher Scientific, Cat # 21125, dissolved in PBS) and allowed to stand overnight at 4 ° C. It was washed 3 times with a washing solution (PBS containing 0.05% Tween 20). A blocking solution (1% BSA, PBS containing 0.05% Tween 20) was added, the mixture was allowed to stand at room temperature for 1 hour, and then washed 3 times with a washing solution.
- a 0.2 ⁇ g / mL recombinant RBD protein (Acro Biosystems, Cat # SPD-C82E9) solution prepared as a blocking solution was added to the plate, allowed to stand at room temperature for 1 hour, and then washed 3 times with a washing solution.
- Mouse serum diluted 20-fold with a blocking solution was added to the plate, allowed to stand at room temperature for 1 hour, and then washed 3 times with a washing solution.
- a 1 ⁇ g / mL recombinant hACE2 protein (Acro Biosystems, Cat # AC2-H5257) solution prepared with a blocking solution was added to the plate, allowed to stand at room temperature for 1 hour, and then washed 3 times with a washing solution.
- HRP-labeled anti-human IgG1 antibody (CYGNUS TECHNOLOGIES, Cat # IM50) was diluted 500-fold with a blocking solution, added to a plate, and then allowed to stand at room temperature for 1 hour. After washing 3 times with a washing solution, TMB Microwell Peroxidase Substrate System (SERACARE Life Sciences, Cat # 5120-0047) was added and allowed to stand for 10 minutes. TMB Stop Solution (SERACARE Life Sciences, Cat # 5150-0021) was used as the reaction stop solution. The absorbance at a wavelength of 450 nm was measured and analyzed using a plate reader.
- DMSO dimethyl sulfoxide
- the commercially available epitope peptide pool covering the entire S length of SARS-CoV-2 (JPT, Cat # PM-WCPV-S-1, 2 vials, and the peptide pool covering the N-terminal region covers the JPT-N and C-terminal regions.
- the peptide pool covered was JPT-C) dissolved in 40 ⁇ L DMSO per vial.
- RBD-specific cell-mediated immune response Contains RPMI Complete medium (10% FBS [Sigma-Aldrich, Cat # 172012-500ML], 1% PS [Penicilin-Streptomycin Mixed Solution, Nacalai Tesque, Cat # 26253-84], 1mM Sodium Pyruvate [Thermo Fisher Scientific, Cat # 11360-070], 10 mM HEPES [Thermo Fisher Scientific, Cat # 15630080], 1 ⁇ StemSure [Fuji Film Wako Junyaku, Cat # 195-15791], 1 ⁇ MEM Non- It was prepared at 1 ⁇ 107 cells / mL with Essential Amino Acids Solution [Thermo Fisher Scientific, Cat # 11140-050] and seeded on a U-bottom 96 well plate.
- Epitope peptide pool Euro1-3 solution prepared to a final concentration of 0.1% (v / v) in RPMI Complete medium and commercially available epitope peptide pool JPT-N prepared to a final concentration of 0.025% (v / v).
- JPT-C was added to spleen cells and cultured at 37 ° C. under 5% CO 2 conditions for 48 hours.
- the amount of IFN- ⁇ and IL-13 cytokines in the cell culture supernatant was measured using Mouse IFN- ⁇ DuoSet ELISA (R & D Systems, Cat # DY485) and Mouse IL-13 Duoset ELISA (R & D systems, Cat # DY413). ..
- the absorbance at a wavelength of 450 nm was measured using a plate reader, and the corrected absorbance (Delta), which was obtained by subtracting the absorbance measured at 540 nm from the absorbance at 450 nm, was used for the analysis.
- a calibration curve was prepared from the cytokine concentration and Delta value of the standard solution using Nonlinear Regression: 4 Parameter, and the cytokine concentration of the measurement sample was calculated from the calibration curve. When the IL-13 concentration was less than 0.000 ( ⁇ 0.000), the cutoff value 0.005 was substituted for the data.
- mice Fig. 5-Fig. 9, Fig. 25-Fig. 28
- mice Under 1-4% (v / v) vaporized isoflurane anesthesia, twice at 2-week intervals (Fig. 5) or twice at 3-week intervals (Fig. 6-9, Fig. 25, Fig. 26, and Fig. 28)
- the test substance was administered to the hind limb abdomen of BALB / c mice (FIG. 5-FIG. 8, FIG. 25, FIG. 26, and FIG. 28) or C57BL / 6 mice (FIG. 9).
- FIG. 27 the test substance was administered only once to the hind limb abdomen of BALB / c mice.
- the test substance was administered 0.03, 0.3, or 3 ⁇ g mRNA / 20 ⁇ L / body at a time (for example, the description of Example 8_0.03 in FIG. 5 is 0.03 ⁇ g mRNA / 20 ⁇ L / of the particles of Example 8). It means that it is a body-administered group).
- 2 ⁇ g mRNA / 20 ⁇ L / body was administered at a time
- 3 ⁇ g mRNA / 20 ⁇ L / body was administered at a time.
- As the buffer for preparing the administration solution 10 mM Histidine buffer containing 300 mM Sucrose and pH 7.0 were used.
- Example 10 was administered to the deltoid muscle of the brachial arm of cynomolgus monkey three times at two-week intervals. In Example 10, 50 ⁇ g mRNA / 200 ⁇ L / body was administered at one time.
- As the buffer for preparing the administration solution 10 mM Histidine buffer containing 300 mM Sucrose and pH 7.0 were used.
- Blood anti-RBD antibody titer (FIGS. 5, 6, 9, and 25-27) A solid phase solution of Streptavidin (Thermo Fisher Scientific Inc.) was added to an ELISA plate at 25 ⁇ L / well, and the mixture was allowed to stand overnight in a refrigerator set at 4 ° C. Wash 3 times (180 ⁇ L / well) with Wash Buffer using a plate washer (AMW-96SX, Biotech Co., Ltd.), add 1% BSA / PBST (150 ⁇ L / well), and leave at room temperature for 1 hour or more. Blocking was performed by placing it.
- Streptavidin Thermo Fisher Scientific Inc.
- TMB Stop Solution (SERACARE Life Sciences, Cat # 5150-0021, 30 ⁇ L / well) was used as the reaction stop solution.
- the absorbance at a wavelength of 450 nm (control wavelength 540 nm) was measured using a plate reader, and the corrected absorbance (Delta) obtained by subtracting the absorbance measured at 540 nm from the absorbance measured at 450 nm was used for the analysis.
- a calibration curve was prepared using Nonlinear Regression: 4 Parameter from the anti-RBD antibody concentration and Delta of standard serum. The anti-RBD antibody concentration of the sample was calculated from the calibration curve, the dilution ratio of the measurement sample, and Delta.
- VeroE6 cells Blood anti-SARS-CoV-2 neutralizing activity (Figs. 7 and 8) VeroE6 cells were seeded on plates and cultured overnight in an incubator with a CO 2 concentration setting of 37 ⁇ 2 ° C and 5 ⁇ 1%.
- a diluted series of mouse serum and SARS-CoV-2 WA1 / 2020 strain were mixed and allowed to stand in an incubator with a CO 2 concentration setting of 37 ⁇ 2 ° C. and 5 ⁇ 1% for 2 to 2.5 hours.
- a mixed solution of mouse serum and SARS-CoV-2 WA1 / 2020 strain was added to VeroE6 cells and cultured in an incubator at 37 ⁇ 2 ° C. and a CO 2 concentration setting of 5 ⁇ 1% for 72 ⁇ 8 hours.
- the amount of viable cells was measured using CellTiter-Glo (Promega), and the anti-SARS-CoV-2 neutralization activity titer of mouse serum was calculated.
- RBD-specific cell-mediated immune response (Fig. 10) Spleen cells were prepared in RPMI Complete medium at 1 ⁇ 10 7 cells / mL and seeded on a U-bottom 96 well plate. MHC class II of RBD prepared to a final concentration of 0.1% (v / v) in RPMI Complete medium Epitope peptide pools were added to spleen cells and cultured at 37 ° C. under 5% CO 2 conditions for 48 hours. The amount of IFN- ⁇ and IL-13 cytokines in the cell culture supernatant was measured using Mouse IFN- ⁇ DuoSet ELISA and Mouse IL-13 Duoset ELISA.
- the absorbance at a wavelength of 450 nm was measured using a plate reader, and the value obtained by subtracting the absorbance measured at 540 nm from the absorbance at 450 nm was used for the analysis.
- a calibration curve was prepared using Nonlinear Regression: 4 Parameter from the cytokine concentration and measured value of the standard solution, and the cytokine concentration of the measured sample was calculated from the calibration curve.
- the Steel test was performed using the Buffer group as a comparative control.
- the Wilcoxon test was performed for the comparison between the two groups in Fig. 8.
- the Steel test was performed using the Buffer group as a comparative control.
- the Steel-Dwass test was performed on the RBD-specific cell-mediated immunity shown in FIG. SAS ver. 9.2 was used for all analyzes.
- RBD-hACE2 binding inhibitory activity (Fig. 28) An anti-His tag antibody (Wako Pure Chemical Industries, Cat # 017-23211) was added to a 96 half well plate, and the mixture was allowed to stand overnight at 4 ° C. and then washed 3 times with a washing solution (PBS containing 0.05% Tween 20). .. A blocking solution (1% BSA, PBS containing 0.05% Tween 20) was added, the mixture was allowed to stand at room temperature for 1 hour, and then washed 3 times with a washing solution.
- the mouse serum dilution series diluted with the blocking solution was added to the plate, allowed to stand at room temperature for 1 hour, and then washed 3 times with a washing solution.
- a 1 ⁇ g / mL recombinant hACE2 protein (Acro Biosystems, Cat # AC2-H5257) solution prepared with a blocking solution was added to the plate, allowed to stand at room temperature for 1 hour, and then washed 3 times with a washing solution.
- HRP-labeled anti-human IgG1 antibody (CYGNUS TECHNOLOGIES, Cat # IM50) was diluted 500-fold with a blocking solution, added to a plate, and then allowed to stand at room temperature for 1 hour.
- TMB Microwell Peroxidase Substrate System (SERACARE Life Sciences, Cat # 5120-0047) was added and allowed to stand for 10 minutes.
- TMB Stop Solution (SERACARE Life Sciences, Cat # 5150-0021) was used as the reaction stop solution.
- the absorbance at a wavelength of 450 nm was measured using a plate reader, and the corrected absorbance (Delta) obtained by subtracting the absorbance measured at 540 nm from the absorbance measured at 450 nm was used for the analysis.
- the data show mouse dilutions showing 50% inhibition (IC 50 ).
- Vero-TMPRSS2 cells Blood anti-SARS-CoV-2 neutralizing activity (Fig. 29) Vero-TMPRSS2 cells were seeded on a plate. Diluted series of monkey plasma and SARS-CoV-2 strain of 100 TCID 50 (D614G: HP095, B.1.1.7 strain: QHN001, P.1 strain: TY7-501, B.1.351 strain: TY8-612) was mixed and allowed to stand in a CO 2 incubator. Then, a mixed solution of monkey plasma and SARS-CoV-2 was added to Vero-TMPRSS2 cells, and the cells were cultured in a CO 2 incubator for 3 days. After that, the maximum dilution ratio at which the cytopathic effect (CPE) was not observed was calculated as the neutralizing antibody titer.
- CPE cytopathic effect
- the mechanism of action of the nucleic acid-lipid particle vaccine of the present invention is that an antigen protein is produced from an mRNA encoding an antigen gene after administration in vivo to induce a specific immune response against the antigen. It is suggested that. It is assumed that the medicinal efficacy of the nucleic acid lipid particle vaccine of the present invention is important for the delivery of mRNA, which is an active ingredient, into tissues and cells and the translation from mRNA. For the purpose of comprehensively evaluating this series of factors, the titer was evaluated using the ability to induce the expression of the antigen protein using cultured cells as an index.
- Example 3 The particles of Example 3, the particles of Example 4, or Buffer were added to Expi293F cells, and the RBD protein expressed in the culture supernatant and in the cells after 3 days was quantified by the ELISA method. The results are shown in FIG. The RBD protein expressed by the particles of Example 4 was observed in the culture supernatant and in the cells. The S full-length protein expressed by the particles of Example 3 was observed only intracellularly.
- Blood anti-RBD antibody response The blood anti-RBD antibody response induced by administration of the particles of Example 3 or Example 4 was evaluated. The results are shown in FIG.
- RBD-specific cell-mediated immune response Spleen cells were prepared and evaluated for RBD-specific cell-mediated immune response from cultured spleen cells. The results are shown in FIG. Compared to the S1 / Quil-A group, Example 4 had higher levels of IFN- ⁇ production for treatment with Euro2 and JPT-N epitope peptide pools covering RBD (P ⁇ 0.001). On the other hand, the IL-13 production level for Euro2 and JPT-N epitope peptide pool treatment was lower in the Example 4 group than in the S1 / Quil-A group (P ⁇ 0.005). From this result, it was found that the nucleic acid lipid particle vaccine of the present invention induces an immune response in which Th1 type is dominant.
- Blood anti-RBD antibody response in C57BL / 6 mice The blood anti-RBD antibody response induced by administration of the particles of Example 8 or Example 10 was evaluated. The results are shown in FIG. At each dose of 3 ⁇ g mRNA / body and 10 ⁇ g mRNA / body, blood anti-RBD antibody titers were higher in Example 8 and Example 10 compared to the Buffer group (both doses of Example 10 were P ⁇ 0.05). ..
- RBD-specific cell-mediated immune response Spleen cells were prepared and evaluated for RBD-specific cell-mediated immune response from cultured spleen cells. The results are shown in Figure 10A.
- the group receiving Example 10 of 3 ⁇ g / body showed higher IFN- ⁇ induction compared to the group receiving 100 ⁇ g / body of Alum adjuvant to 0.1 ⁇ g / body of RBD protein (P ⁇ 0.05). ..
- the group receiving Example 10 of 0.03 ⁇ g / body and 3 ⁇ g / body produced higher IFN- ⁇ induction compared to the group in which 100 ⁇ g / body of Alam adjuvant was added to 1.0 ⁇ g / body of RBD protein. Shown (both P ⁇ 0.05).
- Example 10 To evaluate the Th cell profile of Example 10, the IFN- ⁇ level / IL-5 level ratio and the IFN- ⁇ level / IL-13 level ratio were analyzed. The results are shown in Figure 10B.
- Example 10 showed a higher IFN- ⁇ level / IL-13 level ratio compared to the Alum-adjuvant-added RBD protein group (all three groups of Example 10 against the two groups of Alum-adjuvant-added RBD protein). P ⁇ 0.05). From this result, it was found that the nucleic acid lipid particle vaccine of the present invention induces an immune response in which Th1 type is dominant.
- Blood anti-RBD antibody response in BALB / c mice (FIGS. 25-27) The blood anti-RBD antibody response induced by administration of the particles of Example 10, 12, 14, 16, 18, or Example 20 was evaluated. The results are shown in FIG. Both showed higher blood anti-RBD antibody levels compared to the Buffer group. The blood anti-RBD antibody response induced by administration of the particles of Example 10 or Example 21-30 was evaluated. The results are shown in FIG. Higher blood anti-RBD antibody titers were observed in all the particles as compared with the Buffer group. The blood anti-RBD antibody response induced by administration of the particles of Example 10, 32a, 32b, 32c, 32d, 32f, or Example 33 was evaluated. The results are shown in FIG. Examples 10, 32b, 32c, 32d, 32f, and Example 33 showed higher blood anti-RBD antibody levels as compared to Example 32a.
- RBD-hACE2 binding inhibitory activity (Fig. 28) The RBD-hACE2 binding inhibitory activity induced by the particles of Example 10 was evaluated. The results are shown in FIG. Binding of hACE2 to the RBD, K417N, E484K, N501Y, or K417N / E484K / N501Y RBD mutants of Original compared to Control RBD was to the same extent inhibited by the serum of Example 10.
- FIG. 29 Blood anti-SARS-CoV-2 neutralizing activity
- the anti-SARS-CoV-2 neutralizing activity in blood induced by the particles of Example 10 was evaluated. The results are shown in FIG. Infection of Vero-TMPRSS2 cells of the D614G strain, the B.1.1.7 strain, the P.1 strain, and the B.1.351 strain was neutralized to the same extent by the sera of the 10th group of Examples.
- LNP-mRNA-RBD mRNA vaccine candidate
- RBD receptor-binding domain
- mice 6 to 8 week old C57BL / 6 mice or BALB / c mice were intramuscularly administered with 3 ⁇ g of LNP-mRNA-RBD in terms of mRNA twice at 2-week intervals to obtain a blood anti-RBD antibody reaction. evaluated.
- BALB / c mice showed higher blood anti-RBD antibody response compared to C57BL / 6 mice (Fig. 11a, Fig. 15).
- the T FH and GC B cells in LNP-mRNA-RBD administered mice popliteal lymph nodes (PLN) by flow cytometry It was analyzed (Fig. 16).
- T FH CD4 + CD185 + PD-1 + cells
- GC B cells CD38 - GL7 + CD19 + cells
- a peptide library of spike proteins was designed to analyze antigen-specific CD8 + and CD4 + T cells induced by LNP-mRNA-RBD.
- This peptide library consists of 128 20-amino acid peptides designed to overlap 10 amino acids.
- This peptide library was divided into a total of 8 pool peptides, with 16 peptides as one pool peptide (Fig. 11f).
- spleen cells prepared from LNP-mRNA-RBD-administered mice were treated with pool peptides 3 and 4, C57BL / 6 mouse spleen cells induced IFN- ⁇ production, and BALB / c mouse spleen cells were treated with peptide pool 3.
- the production of IFN- ⁇ was confirmed in (Figs.
- FIGS. 17a and b show that IL-13 did not induce spleen cells in either C57BL / 6 or BALB / c mice (FIGS. 17c and d).
- spleen cells were treated with pool peptides 2, 3, or 4 and three cytokines (IL-2, IFN- ⁇ , and TNF-). T cells that produced ⁇ ) were analyzed by flow cytokinemetry.
- IL-2, IFN- ⁇ , and TNF- T cells that produced ⁇
- T cells that produced ⁇ were analyzed by flow cytokinemetry.
- spike antigen-specific multifunctional CD8 + and CD4 + T cells were found in BALB / c mouse spleen cells treated with pool peptides 3 and 4 (FIGS. 11h, 18b and 19b).
- C57BL / 6 mouse spleen cells showed multifunctional CD8 + T cell and weak CD4 + T cell responses (FIGS. 11g, 18a and 19a). These data suggest that BALB / c mice treated with LNP-mRNA-RBD may induce higher B-cell and T-cell responses compared to C57BL / 6 mice.
- Nucleic acid vaccines have been reported to act as an endogenous adjuvant of DNA or RNA (14-16).
- mRNA has been reported to be recognized by toll-like receptors (TLRs) 3, TLR7, TLR8, RIG-I, or MDA5 and act as an endogenous adjuvant (17).
- TLRs toll-like receptors
- Kariko et al. Use methylated bases and other modified bases (eg, pseudouridine) to control innate immune activation and improve the expression efficiency of antigenic proteins (18,19).
- Other studies have shown that LNP-mRNA-induced type I IFNs affect CD8 + T cell response and antigenic protein expression efficiency (20,21,22).
- LNP-mRNA-Full was the first because the LNP-mRNA-RBD group had a higher frequency of side reactions than the LNP-mRNA-Full group, which encodes the full length of the spike. It was evaluated and launched in a phase III clinical trial (13). The reason for the difference in the frequency of side reactions is unknown, but we believe that the innate immune activation effect of LNP-mRNA may be involved (13).
- LNP-mRNA-RBD In order to analyze the innate immune activation effect of LNP-mRNA, the level of type I IFN production from human PBMC treated with LNP-mRNA-RBD was measured by ELISA. As a result, LNP-mRNA-RBD showed higher IFN- ⁇ -inducing ability in PBMC of 3 healthy subjects as compared with LNP-mRNA-Full (Fig. 12a). Next, similar experiments were performed using bone marrow-derived dendritic cells (BM-DCs) of C57BL / 6 mice or BALB / c mice.
- BM-DCs bone marrow-derived dendritic cells
- BM-DCs in C57BL / 6 mice treated with LNP-mRNA-full or LNP-mRNA-RBD showed higher IFN- ⁇ production compared to BM-DCs in BALB / c mice (Fig. 12b).
- the process of producing mRNA encapsulated in LNP-mRNA contains RNA as a contaminant, such as double-stranded RNA as a TLR3 ligand, which has been shown to activate innate immunity (22). Therefore, in order to remove impurities caused by RNA production, mRNA was purified by HPLC, and LNP-mRNA (mRNA-RBD (HPLC)) in which the mRNA purified by HPLC was encapsulated was prepared.
- type I IFN production from human PBMC and mouse BM-DC treated with mRNA-RBD (HPLC) was significantly reduced compared to LNP-mRNA-RBD (FIGS. 12a and b).
- MRNA-RBD (HPLC) was administered to C57BL / 6 or BALB / c mice to evaluate their immunogenicity.
- the mRNA-RBD (HPLC) group enhanced blood anti-RBD IgG1 titer, IgG2 titer, and total IgG titer in both BALB / c mice and C57BL / 6 mice (FIGS. 12c and 20a).
- pLN in C57BL / 6 mice treated with mRNA-RBD (HPLC) induced more GC B cells (Figs. 12d and e).
- the mRNA-RND (HPLC) group has more multifunctional CD8 + and CD4 + T cells that produce RBD-specific IFN- ⁇ and other type I cytokines. It was induced (Fig. 12f-i and Fig. 20b-e, 21, 22).
- a non-human primate (NHP) cynomolgus monkey model the protective effect of the mRNA-RBD (HPLC) vaccine against SARS-CoV-2 was evaluated.
- mRNA-RBD (HPLC) was intramuscularly administered to 4 monkeys with 2 monkeys as a negative control group.
- the mRNA-RBD (HPLC) group showed a higher anti-RBD antibody response compared to the negative control group (Fig. 13b).
- the mRNA-RBD (HPLC) group also showed anti-SARS-CoV-2 neutralizing activity in blood (Fig. 13c).
- the mRNA-RBD (HPLC) group showed higher anti-RBD IgG responses in the conjunctival, nasal, oral, tracheal, and rectal mucosal tissues compared to the negative control group (Fig. 13d).
- the mRNA-RBD (HPLC) group dramatically reduced SARS-CoV-2 (Fig. 14a) and viral RNA (Fig. 14b) in swabs on day 1 after SARS-Co-2 infection.
- the mRNA-RBD (HPLC) group also reduced viral RNA in the trachea, bronchi, and lungs (Fig. 14c, Fig. 25).
- the negative control group showed fever and pneumonia after SARS-CoV-2 infection (Figs. 23, 24). Histological analysis of lungs after SARS-CoV-2 infection revealed infiltration of lymphocytes and neutrophils in the negative control group, thickening of the alveolar wall and viral antigens, and mRNA-RBD (HPLC).
- mice 6-8 week old C57BL / 6 and BALB / c mice were purchased from CLEA in Japan. Mice were bred under conditions free of specific pathogens. All mouse tests were approved by the Animal Care and Use Committee of the Institute of Medical Science, University of Tokyo.
- Cynomolgus monkey Born at Shiga University of Medical Science we used female cynomolgus monkeys aged 7 to 10 years, native to the Philippines, Vietnam and China. All procedures were performed under ketamine and xylazine anesthesia and efforts were made to minimize pain. After recovery from anesthesia, CMK-2 (CLEA Japan Co., Ltd., Tokyo, Japan) food pellets were given once a day, and drinking water was taken freely. Animals were single-headed in cages under light-controlled conditions (12-hour light / 12-hour dark cycle, lit at 8 am).
- SARS-CoV-2 (2 x 10 7 PFU / 7 mL) with pipette and catheter into conjunctiva (0.05 mL x 2), nostrils (0.5 mL x 2), oral cavity (0.9 mL) and trachea (5 mL) under ketamine / xylazine anesthesia HBSS) was inoculated into monkeys. Under ketamine / xylazine anesthesia, two cotton swabs (Eiken Kagaku Co., Ltd., Tokyo, Japan) were used to collect body fluid samples from the condyle, nasal cavity, oral cavity and trachea, followed by 0.1% bovine serum albumin (BSA).
- BSA bovine serum albumin
- DMEM Dulbecco's modified Eagle's medium
- the mRNA-encapsulated nucleic acid lipid particles of Example 10 of the LNP-mRNA vaccine were used.
- Reagent Spike Protein Overlap 20-aa peptide was synthesized and purchased from Eurofins Genomics (Ebersberg, Germany). SARS-CoV-2 spike protein (ECD) and RBD were purchased from GenScript (Piscataway, NJ, USA).
- Opti-MEM I Invitrogen, Carlsbad, CA, USA
- BSA bovine serum albumin
- TPCK L-1-tosylamide-2-phenylethylchloromethylketone
- ECD and RBD-specific antibody titers were measured by ELISA. Briefly, half-area 96-well plates were coated with ECD (1 ⁇ g / mL) or RBD (1 ⁇ g / mL) in bicarbonate buffer at 4 ° C. The plate was blocked with PBS containing 1% BSA at room temperature for 60 minutes. The plates were washed 3 times with PBST and diluted plasma or swab samples were incubated for 120 minutes at room temperature. The plates were washed 3 times with PBST and incubated with HRP-labeled goat anti-mouse IgG, IgG1, IgG2a, IgG2c, or mouse anti-monkey IgG for 120 minutes at room temperature.
- OD values at 450 nm and 540 or 560 nm were measured using a spectrophotometer. The inverse value of plasma dilution with OD 450 -OD 540 or OD 450 -OD 560 of 0.2 was taken as the antibody titer.
- a single cell suspension of immunized mouse spleen cells was stimulated with peptide pools 1-8, ECD, and RBD protein for 24 hours. IFN- ⁇ and IL-13 levels in the supernatant were measured by ELISA (R & D).
- anti-CD8a 53-6.7
- anti-CD4 RM4-5: Invitrogen
- anti-TCR ⁇ H57-597
- anti-F4 / 80 RM8
- anti-TER-119 TER-119
- anti-CD11b Cells were stained with M1 / 70
- anti-CD19 6D5
- anti-CD11c N418)
- anti-NK-1.1 PK136
- anti-CD45R / B220 RA3-6B220
- PBMC peripheral blood mononuclear cells
- LNP-mRNA-Full 0.4, 2, 10 ⁇ g / mL
- LNP-mRNA-RBD 0.4, 2, 10 ⁇ g / mL
- LNP-mRNA-RBD 0.4, 2, 10 ⁇ g / mL Stimulation was performed with HPLC) (0.4, 2, 10 ⁇ g / mL) for 24 hours, and IFN- ⁇ levels in the culture supernatant were measured using ELISA (Mabtech, Sweden).
- Bone marrow-derived dendritic cells and stimulated bone marrow-derived dendritic cells were cultured and differentiated in mouse GM-CSF for 7 days.
- Cells LNP-mRNA-Full (0.4, 2, 10 ⁇ g / mL), LNP-mRNA-RBD (0.4, 2, 10 ⁇ g / mL), or LNP-mRNA-RBD (HPLC) (0.4, 2, 10 ⁇ g) After stimulation with / mL) for 24 hours, IFN- ⁇ in the culture supernatant was measured using ELISA (Invitrogen).
- Neutralizing antibody titer 35 microliters of virus (140 tissue culture infection dose 50) were incubated with 35 ⁇ L of 2-fold serially diluted serum for 1 hour at room temperature, and 50 ⁇ L of the mixture was added to confluent Vero E6 / TMPRS2 cells in 96-well plates. The cells were incubated at 37 ° C. for 1 hour. After adding 50 ⁇ L of DMEM containing 5% FCS, the cells were further incubated at 37 ° C for 3 days. Viral cell pathological effects (CPE) were observed under an inverted microscope and the virus neutralizing titer was determined as the reciprocal of the highest serum dilution that completely prevented CPE (24).
- CPE Viral cell pathological effects
- VeroE6 / TMPRSS2 for SARS-CoV-2
- VeroE6 cell line expressing TMPRSS2 JCRB Cell Bank, Japan
- DMEM containing 0.1% BSA for 3 days (25).
- Virus titers were monitored under a microscope and calculated using the Reed-Muench method.
- Viral RNA from swab samples and tissues (20 mg) was collected using the QIAmp virus RNA Mini kit and R Easy Mini kit, respectively.
- Viral RNA is real-time RT-PCR (2019-nCoV_N1-F, 2019-nCoV_N1-R, 2019-nCoV_N1-P, TaqMan Fast Virus 1-step) using CFX-96 (Bio-Rad, Hercules, CA, USA). It was measured by Master Mix).
- X-ray X-rays of the lungs were taken with the I-PACS system (Comica Minolta) and PX-20BT (Kenko Tokina).
- the present invention can be used for the prevention and / or treatment of infection caused by SARS-CoV-2.
- ⁇ SEQ ID NO: 1> (DNA fragment containing SARS-CoV-2 S full) GTAATACGACTCACTATAAGGAGACCCAAGCTACATTTGCTTCTGACACAACTGTGTTCACTAGCAACCTCAAACAGACACCGCCACCATGTTTGTTTCTTGTTTTATTGCCACTAGTCTCTAGTCAGTGTGTTAATCTTACAACCAGAACTCAATTACCCCCTGCATACACTAATTCTTTCACACGTGGTGTTTATTACCCTGACAAAGTTTTCAGATCCTCAGTTTTACATTCAACTCAGGACTTGTTCTTACCTTTCTTCCAATGTTACTTGGTTCCATGCTATACATGTCTCTGGGACCAATGGTACTAAGAGGTTTGATAACCCTGTCCTACCATTTAATGATGGTGTTTATTTTGCTTCCACTGAGAAGTCTAACATAATAAGAGGCTGGATTTTTGGTACTACTTTAGATTCGAAGACCCAGTCCCTACTTATTGTTAATAACGCTACTAATGTTGTTATTAAAGTCTGTGAATTTCAATTTTGTAAA
- T7 promoter base numbers 1-18 A : Transcription start point: Base number 19 5'-UTR (including transcription initiation site and KOZAK sequence with base numbers 89-94): base numbers 19-88 Spike protein full-length sequence: base numbers 89 to 3910 3'-UTR: Base numbers 3911-4042 polyA sequence (A100): Base numbers 4043-4142 ⁇ SEQ ID NO: 5> (SARS-CoV-2 S-full mRNA-001) GUAAUACGACUCACUAUAAGGAGACCCAAGCUACAUUUGCUUCUGACACAACUGUGUUCACUAGCAACCUCAAACAGACACCGCCACCAUGUUUGUUUUCUUGUUUAUUGCCACUAGUCUCUAGUCAGUGUGUGUGUUAAUCUUACAACCAGAACUCAAUUACCCCCUGCAUACACUAAUUCUUUCACACGUGGUGUUUAUUACCCUGACAAAGUUUUCAGAUCCUCAGUUUUACAUUCAACUCAGGACUUGU
- ⁇ SEQ ID NO: 6> (amino acid sequence of SARS-CoV-2 S-full) MFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFT
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Animal Behavior & Ethology (AREA)
- Pharmacology & Pharmacy (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Engineering & Computer Science (AREA)
- Epidemiology (AREA)
- Virology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Genetics & Genomics (AREA)
- Organic Chemistry (AREA)
- Molecular Biology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Biomedical Technology (AREA)
- Microbiology (AREA)
- Communicable Diseases (AREA)
- Biotechnology (AREA)
- Physics & Mathematics (AREA)
- Biochemistry (AREA)
- Mycology (AREA)
- Immunology (AREA)
- Oncology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Wood Science & Technology (AREA)
- General Engineering & Computer Science (AREA)
- Zoology (AREA)
- Oil, Petroleum & Natural Gas (AREA)
- Optics & Photonics (AREA)
- Nanotechnology (AREA)
- Biophysics (AREA)
- Pulmonology (AREA)
- Plant Pathology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Dispersion Chemistry (AREA)
- Gastroenterology & Hepatology (AREA)
Priority Applications (6)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| KR1020227040351A KR20230024261A (ko) | 2020-06-11 | 2021-06-10 | 핵산 지질 입자 백신 |
| CN202180035477.1A CN115605221A (zh) | 2020-06-11 | 2021-06-10 | 核酸脂质粒子疫苗 |
| JP2022530615A JP7672657B2 (ja) | 2020-06-11 | 2021-06-10 | 核酸脂質粒子ワクチン |
| EP21821552.3A EP4166158A4 (en) | 2020-06-11 | 2021-06-10 | NUCLEIC ACID LIPID PARTICLE VACCINE |
| US18/009,111 US20230248819A1 (en) | 2020-06-11 | 2021-06-10 | Nucleic acid lipid particle vaccine |
| JP2025044691A JP2025094115A (ja) | 2020-06-11 | 2025-03-19 | 核酸脂質粒子ワクチン |
Applications Claiming Priority (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| JP2020101420 | 2020-06-11 | ||
| JP2020-101420 | 2020-06-11 | ||
| JP2021-033278 | 2021-03-03 | ||
| JP2021033278 | 2021-03-03 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2021251453A1 true WO2021251453A1 (ja) | 2021-12-16 |
Family
ID=78846062
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/JP2021/022057 Ceased WO2021251453A1 (ja) | 2020-06-11 | 2021-06-10 | 核酸脂質粒子ワクチン |
Country Status (7)
| Country | Link |
|---|---|
| US (1) | US20230248819A1 (https=) |
| EP (1) | EP4166158A4 (https=) |
| JP (2) | JP7672657B2 (https=) |
| KR (1) | KR20230024261A (https=) |
| CN (1) | CN115605221A (https=) |
| TW (1) | TWI907439B (https=) |
| WO (1) | WO2021251453A1 (https=) |
Cited By (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2023126343A1 (en) * | 2021-12-30 | 2023-07-06 | Fondo Ricerca Medica S.R.L. | Mrna vaccine against variants of sars-cov-2 |
| WO2023130089A1 (en) * | 2021-12-31 | 2023-07-06 | Boost Biopharma, Inc. | Recombinant polypeptides containing at least one immunogenic fragment and antibody fc region and uses thereof |
| US12409219B2 (en) | 2020-06-30 | 2025-09-09 | Boost Biopharma, Inc. | Recombinant polypeptides containing at least one immunogenic fragment and uses thereof |
Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2015005253A1 (ja) | 2013-07-08 | 2015-01-15 | 第一三共株式会社 | 新規脂質 |
| JP2020101420A (ja) | 2018-12-21 | 2020-07-02 | パナソニックIpマネジメント株式会社 | 透過度検知装置 |
| JP2021033278A (ja) | 2019-08-16 | 2021-03-01 | エーエーシー オプティックス ソリューションズ ピーティーイー リミテッド | 撮像光学レンズ |
Family Cites Families (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| PL4023249T3 (pl) * | 2014-04-23 | 2025-03-10 | Modernatx, Inc. | Szczepionki z kwasem nukleinowym |
| US20210228707A1 (en) * | 2020-01-28 | 2021-07-29 | Modernatx, Inc. | Coronavirus rna vaccines |
-
2021
- 2021-06-10 TW TW110121263A patent/TWI907439B/zh active
- 2021-06-10 CN CN202180035477.1A patent/CN115605221A/zh active Pending
- 2021-06-10 KR KR1020227040351A patent/KR20230024261A/ko active Pending
- 2021-06-10 JP JP2022530615A patent/JP7672657B2/ja active Active
- 2021-06-10 WO PCT/JP2021/022057 patent/WO2021251453A1/ja not_active Ceased
- 2021-06-10 US US18/009,111 patent/US20230248819A1/en active Pending
- 2021-06-10 EP EP21821552.3A patent/EP4166158A4/en active Pending
-
2025
- 2025-03-19 JP JP2025044691A patent/JP2025094115A/ja active Pending
Patent Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2015005253A1 (ja) | 2013-07-08 | 2015-01-15 | 第一三共株式会社 | 新規脂質 |
| JP2020101420A (ja) | 2018-12-21 | 2020-07-02 | パナソニックIpマネジメント株式会社 | 透過度検知装置 |
| JP2021033278A (ja) | 2019-08-16 | 2021-03-01 | エーエーシー オプティックス ソリューションズ ピーティーイー リミテッド | 撮像光学レンズ |
Non-Patent Citations (42)
| Title |
|---|
| ANDERSON, E. J ET AL.: "Safety and Immunogenicity of SARS-CoV-2 mRNA-1273 Vaccine in Older Adults", N ENGL J MED, vol. 383, 2020, pages 2427 - 2438 |
| ANONYMOUS: "BNT162 COVID-19 Vaccine", BIONTECH, 23 April 2020 (2020-04-23), pages 1 - 15, XP055885355, Retrieved from the Internet <URL:https://investors.biontech.de/static-files/398d9bd8-e2cb-49ca-9d6d-7dfd01c66b8a> [retrieved on 20220131] * |
| BADEN, L. R ET AL.: "Efficacy and Safety of the mRNA-1273 SARS-CoV-2 Vaccine", N ENGL J MED, 2020 |
| COBAN, C ET AL.: "Novel strategies to improve DNA vaccine immunogenicity", CURR GENE THER, vol. 11, 2011, pages 479 - 484 |
| CORBETT, K. S ET AL.: "Evaluation of the mRNA-1273 Vaccine against SARS-CoV-2 in Nonhuman Primates", N ENGL J MED, vol. 383, 2020, pages 1544 - 1555, XP055949061, DOI: 10.1056/NEJMoa2024671 |
| DE BEUCKELAER, A ET AL.: "Type I Interferons Interfere with the Capacity of mRNA Lipoplex Vaccines to Elicit Cytolytic T Cell Responses", MOL THER, vol. 24, 2016, pages 2012 - 2020 |
| DESMET, C. JISHII, K. J: "Nucleic acid sensing at the interface between innate and adaptive immunity in vaccination", NAT REV IMMUNOL, vol. 12, 2012, pages 479 - 491, XP037923168, DOI: 10.1038/nri3247 |
| ELIA, U ET AL.: "Design of SARS-CoV-2 RBD mRNA Vaccine Using Novel Ionizable Lipids", BIORXIV, 2020.2010.2015.341537, 2020 |
| FUZHOU WANG, RICHARD M. KREAM, GEORGE B. STEFANO: "An Evidence Based Perspective on mRNA-SARS-CoV-2 Vaccine Development", MEDICAL SCIENCE MONITOR, WARSAW, POLAND : MEDICAL SCIENCE INTERNATIONAL, PL, vol. 26, 5 May 2020 (2020-05-05), PL , pages e924700 - e924700-8, XP055735156, ISSN: 1234-1010, DOI: 10.12659/MSM.924700 * |
| IAVARONE, C.O'HAGAN D, T.YU, D.DELAHAYE, N. FULMER, J. B: "Mechanism of action of mRNA-based vaccines", EXPERT REV VACCINES, vol. 16, 2017, pages 871 - 881 |
| IMAI, M ET AL.: "Syrian hamsters as a small animal model for SARS-CoV-2 infection and countermeasure development", PROC NATL ACAD SCI U S A, vol. 117, pages 16587 - 16595 |
| ISHIGAKI, H. ET AL.: "Neutralizing antibody-dependent and -independent immune responses against SARS-CoV-2 in cynomolgus macaques", VIROLOGY, vol. 554, 2021, pages 97 - 105, XP086447536, DOI: 10.1016/j.virol.2020.12.013 |
| J IMMUNOL, vol. 181, 2008, pages 5490 |
| JACKSON, L. A ET AL.: "An mRNA Vaccine against SARS-CoV-2 - Preliminary Report", N ENGL J MED, vol. 383, 2020, pages 1920 - 1931 |
| KARIKO, K. ET AL.: "Incorporation of pseudouridine into mRNA yields superior nonimmunogenic vector with increased translational capacity and biological stability", MOL THER, vol. 16, 2008, pages 1833 - 1840, XP055920956, DOI: 10.1038/mt.2008.200 |
| KARIKO, K.BUCKSTEIN, M.NI, H.WEISSMAN, D: "Suppression of RNA recognition by Toll-like receptors: the impact of nucleoside modification and the evolutionary origin of RNA", IMMUNITY, vol. 23, 2005, pages 165 - 175 |
| KARIKO, K.MURAMATSU, H.LUDWIG, JWEISSMAN, D: "Generating the optimal mRNA for therapy: HPLC purification eliminates immune activation and improves translation of nucleoside-modified, protein-encoding mRNA", NUCLEIC ACIDS RES, vol. 39, 2011, pages 42 |
| KORMANN, M., NATURE BIOTECHNOLOGY, vol. 29, 2011, pages 154 - 157 |
| LAN, J ET AL.: "Structure of the SARS-CoV-2 spike receptor-binding domain bound to the ACE2 receptor", NATURE, vol. 581, 2020, pages 215 - 220, XP037182122, DOI: 10.1038/s41586-020-2180-5 |
| LEDERER, K ET AL.: "SARS-CoV-2 mRNA Vaccines Foster Potent Antigen-Specific Germinal Center Responses Associated with Neutralizing Antibody Generation", IMMUNITY, vol. 53, 2020, pages 1281 - 1295 |
| LINARES-FERNANDEZ, S.LACROIX, C.EXPOSITO, J. YVERRIER, B: "Tailoring mRNA Vaccine to Balance Innate/Adaptive Immune Response", TRENDS MOL MED, vol. 26, 2020, pages 311 - 323, XP086072330, DOI: 10.1016/j.molmed.2019.10.002 |
| MCKAY PAUL F., HU KAI, BLAKNEY ANNA K., SAMNUAN KARNYART, BOUTON CLÉMENT R., ROGERS PAUL, POLRA KRUNAL, LIN PAULO J.C., BARBOSA CH: "Self-amplifying RNA SARS-CoV-2 lipid nanoparticle vaccine induces equivalent preclinical antibody titers and viral neutralization to recovered COVID-19 patients", BIORXIV, 25 April 2020 (2020-04-25), pages 1 - 14, XP055885357, DOI: 10.1101/2020.04.22.055608 * |
| MCMAHAN, K ET AL.: "Correlates of protection against SARS-CoV-2 in rhesus macaques", NATURE, 2020 |
| NAT COMMUN, vol. 11, 2020, pages 2251 |
| NAT MED, vol. 26, 2020, pages 1033 |
| NAT REV IMMUNOL, vol. 20, 2020, pages 347 |
| PARDI, N.HOGAN, M. J.PORTER, F. WWEISSMAN, D: "mRNA vaccines - a new era in vaccinology", NAT REV DRUG DISCOV, vol. 17, 2018, pages 261 - 279, XP037134891, DOI: 10.1038/nrd.2017.243 |
| PLOS ONE, vol. 7, 2012, pages e35421 |
| PNAS, vol. 117, 2020, pages 8218 |
| POLACK, F. P ET AL.: "Safety and Efficacy of the BNT162b2 mRNA Covid-19 Vaccine", N ENGL J MED, vol. 383, 2020, pages 2603 - 2615, XP055820495, DOI: 10.1056/NEJMoa2034577 |
| RYDYZNSKI MODERBACHER, C ET AL.: "Antigen-Specific Adaptive Immunity to SARS-CoV-2 in Acute COVID-19 and Associations with Age and Disease Severity", CELL, vol. 183, 2020, pages 996 - 1012 |
| SCIENCE, vol. 367, 2020, pages 1260 |
| See also references of EP4166158A4 |
| TAI, W ET AL.: "A novel receptor-binding domain (RBD)-based mRNA vaccine against SARS-CoV-2", CELL RES, vol. 30, 2020, pages 932 - 935, XP037260927, DOI: 10.1038/s41422-020-0387-5 |
| VACCINE, vol. 25, 2007, pages 2832 |
| VIROL J, vol. 7, 2010, pages 299 |
| VIROLOGY, vol. 12, 2020, pages 372 |
| VIROLOGY, vol. 334, 2005, pages 74 |
| VIRUSES, vol. 12, 2020, pages 428 |
| VOGEL, A. B ET AL.: "BNT162b vaccines are immunogenic and protect non-human primates against SARS-CoV-2", BIORXIV, 2020.2012.2011.421008, 2020 |
| WALSH, E. E ET AL.: "Safety and Immunogenicity of Two RNA-Based Covid-19 Vaccine Candidates", N ENGL J MED, vol. 383, 2020, pages 2439 - 2450 |
| ZHOU, P ET AL.: "A pneumonia outbreak associated with a new coronavirus of probable bat origin", NATURE, vol. 579, 2020, pages 270 - 273, XP037296454, DOI: 10.1038/s41586-020-2012-7 |
Cited By (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US12409219B2 (en) | 2020-06-30 | 2025-09-09 | Boost Biopharma, Inc. | Recombinant polypeptides containing at least one immunogenic fragment and uses thereof |
| WO2023126343A1 (en) * | 2021-12-30 | 2023-07-06 | Fondo Ricerca Medica S.R.L. | Mrna vaccine against variants of sars-cov-2 |
| WO2023130089A1 (en) * | 2021-12-31 | 2023-07-06 | Boost Biopharma, Inc. | Recombinant polypeptides containing at least one immunogenic fragment and antibody fc region and uses thereof |
Also Published As
| Publication number | Publication date |
|---|---|
| TWI907439B (zh) | 2025-12-11 |
| JP2025094115A (ja) | 2025-06-24 |
| EP4166158A1 (en) | 2023-04-19 |
| KR20230024261A (ko) | 2023-02-20 |
| JPWO2021251453A1 (https=) | 2021-12-16 |
| CN115605221A (zh) | 2023-01-13 |
| EP4166158A4 (en) | 2025-07-16 |
| JP7672657B2 (ja) | 2025-05-08 |
| TW202214296A (zh) | 2022-04-16 |
| US20230248819A1 (en) | 2023-08-10 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| Liu et al. | A novel STING agonist-adjuvanted pan-sarbecovirus vaccine elicits potent and durable neutralizing antibody and T cell responses in mice, rabbits and NHPs | |
| CN110381994B (zh) | 用于诱导针对寨卡病毒的免疫应答的核苷修饰的rna | |
| JP2024545152A (ja) | 単純ヘルペスウイルスmRNAワクチン | |
| JP2025094115A (ja) | 核酸脂質粒子ワクチン | |
| JP2023526495A (ja) | SARS-CoV-2ワクチン | |
| US11028397B2 (en) | 5′-triphosphate oligoribonucleotides | |
| Jiang et al. | Hantavirus Gc induces long-term immune protection via LAMP-targeting DNA vaccine strategy | |
| EP4059515A1 (en) | Nucleic acid lipid particle vaccine encapsulating hpv mrna | |
| JP2026503718A (ja) | エプスタイン・バーウイルスmRNAワクチン | |
| WO2021206638A1 (en) | Vaccine and/or antibody for viral infection | |
| KR102714014B1 (ko) | 사스-코로나바이러스-2 델타 감염증 치료용 항체 mRNA 및 이를 포함한 조성물 | |
| KR20240109241A (ko) | Piv5-기반 코로나바이러스 백신 및 이의 사용 방법 | |
| KR102714027B1 (ko) | 사스-코로나바이러스-2 델타 감염증 치료용 항체 mRNA 및 이를 포함한 조성물 | |
| US12397051B2 (en) | Vaccine for use against coronavirus and variants thereof | |
| CN118356486A (zh) | CpG佐剂在制备新型冠状病毒疫苗中的应用 | |
| AU2023224417A1 (en) | Rhinovirus vaccine | |
| CN117642179A (zh) | 流感病毒核酸脂质颗粒疫苗 | |
| Adam et al. | A modified porous silicon microparticle promotes mucosal delivery of SARS-CoV-2 antigen and induction of potent and durable systemic and mucosal T helper 1 skewed protective immunity | |
| HK40087016A (en) | Nucleic acid lipid particle vaccine | |
| WO2025149032A1 (en) | Respiratory syncytial virus vaccine compositions and their use | |
| JP2024537847A (ja) | COVID19 mRNAワクチン | |
| HK40074627A (en) | Nucleic acid lipid particle vaccine encapsulating hpv mrna | |
| CN114796476A (zh) | 一种亚单位疫苗新型核酸佐剂系统及其应用 | |
| CN118632708A (zh) | 基于piv5的冠状病毒疫苗及其使用方法 | |
| KR20260052229A (ko) | 백신 보조제 |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 21821552 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 2022530615 Country of ref document: JP Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2021821552 Country of ref document: EP Effective date: 20230111 |