WO2021222587A1 - Protéines anti-cd26 et leurs utilisations - Google Patents
Protéines anti-cd26 et leurs utilisations Download PDFInfo
- Publication number
- WO2021222587A1 WO2021222587A1 PCT/US2021/029920 US2021029920W WO2021222587A1 WO 2021222587 A1 WO2021222587 A1 WO 2021222587A1 US 2021029920 W US2021029920 W US 2021029920W WO 2021222587 A1 WO2021222587 A1 WO 2021222587A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- amino acids
- seq
- chain variable
- variable domain
- protein
- Prior art date
Links
- 108090000623 proteins and genes Proteins 0.000 title claims abstract description 228
- 102000004169 proteins and genes Human genes 0.000 title claims abstract description 223
- 230000027455 binding Effects 0.000 claims abstract description 183
- 239000000427 antigen Substances 0.000 claims abstract description 117
- 108091007433 antigens Proteins 0.000 claims abstract description 117
- 102000036639 antigens Human genes 0.000 claims abstract description 117
- 238000000034 method Methods 0.000 claims abstract description 101
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 claims abstract description 40
- 201000010099 disease Diseases 0.000 claims abstract description 34
- 230000032683 aging Effects 0.000 claims abstract description 21
- 208000027866 inflammatory disease Diseases 0.000 claims abstract description 16
- 101000908391 Homo sapiens Dipeptidyl peptidase 4 Proteins 0.000 claims description 196
- 102100025012 Dipeptidyl peptidase 4 Human genes 0.000 claims description 188
- 210000004027 cell Anatomy 0.000 claims description 103
- 108090000765 processed proteins & peptides Proteins 0.000 claims description 99
- 102000004196 processed proteins & peptides Human genes 0.000 claims description 97
- 229920001184 polypeptide Polymers 0.000 claims description 86
- 210000003289 regulatory T cell Anatomy 0.000 claims description 75
- 210000000822 natural killer cell Anatomy 0.000 claims description 72
- 108010000499 Thromboplastin Proteins 0.000 claims description 71
- 102000039446 nucleic acids Human genes 0.000 claims description 53
- 108020004707 nucleic acids Proteins 0.000 claims description 53
- 150000007523 nucleic acids Chemical class 0.000 claims description 53
- 108010019670 Chimeric Antigen Receptors Proteins 0.000 claims description 46
- 239000003795 chemical substances by application Substances 0.000 claims description 38
- 230000003213 activating effect Effects 0.000 claims description 37
- 239000008194 pharmaceutical composition Substances 0.000 claims description 35
- 206010028980 Neoplasm Diseases 0.000 claims description 22
- 210000001519 tissue Anatomy 0.000 claims description 21
- 210000001744 T-lymphocyte Anatomy 0.000 claims description 20
- 239000013598 vector Substances 0.000 claims description 19
- 108010005094 Advanced Glycation End Products Proteins 0.000 claims description 18
- 201000011510 cancer Diseases 0.000 claims description 17
- 239000001963 growth medium Substances 0.000 claims description 17
- 239000003112 inhibitor Substances 0.000 claims description 17
- 238000009630 liquid culture Methods 0.000 claims description 17
- 210000002865 immune cell Anatomy 0.000 claims description 16
- 238000012258 culturing Methods 0.000 claims description 14
- 208000015181 infectious disease Diseases 0.000 claims description 11
- 208000019425 cirrhosis of liver Diseases 0.000 claims description 10
- 108010045374 CD36 Antigens Proteins 0.000 claims description 9
- 208000035473 Communicable disease Diseases 0.000 claims description 9
- 230000035755 proliferation Effects 0.000 claims description 8
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 claims description 7
- 208000018737 Parkinson disease Diseases 0.000 claims description 7
- 230000000735 allogeneic effect Effects 0.000 claims description 7
- 201000008482 osteoarthritis Diseases 0.000 claims description 7
- 208000024893 Acute lymphoblastic leukemia Diseases 0.000 claims description 6
- 208000014697 Acute lymphocytic leukaemia Diseases 0.000 claims description 6
- 208000024827 Alzheimer disease Diseases 0.000 claims description 6
- 208000032791 BCR-ABL1 positive chronic myelogenous leukemia Diseases 0.000 claims description 6
- 208000010833 Chronic myeloid leukaemia Diseases 0.000 claims description 6
- 201000009794 Idiopathic Pulmonary Fibrosis Diseases 0.000 claims description 6
- 208000022559 Inflammatory bowel disease Diseases 0.000 claims description 6
- 201000003793 Myelodysplastic syndrome Diseases 0.000 claims description 6
- 208000033761 Myelogenous Chronic BCR-ABL Positive Leukemia Diseases 0.000 claims description 6
- 208000006664 Precursor Cell Lymphoblastic Leukemia-Lymphoma Diseases 0.000 claims description 6
- 208000005718 Stomach Neoplasms Diseases 0.000 claims description 6
- 206010002026 amyotrophic lateral sclerosis Diseases 0.000 claims description 6
- 208000035475 disorder Diseases 0.000 claims description 6
- 210000004700 fetal blood Anatomy 0.000 claims description 6
- 206010017758 gastric cancer Diseases 0.000 claims description 6
- 206010073071 hepatocellular carcinoma Diseases 0.000 claims description 6
- 231100000844 hepatocellular carcinoma Toxicity 0.000 claims description 6
- 208000036971 interstitial lung disease 2 Diseases 0.000 claims description 6
- 208000002780 macular degeneration Diseases 0.000 claims description 6
- 201000006417 multiple sclerosis Diseases 0.000 claims description 6
- 208000008338 non-alcoholic fatty liver disease Diseases 0.000 claims description 6
- 201000008968 osteosarcoma Diseases 0.000 claims description 6
- 210000005259 peripheral blood Anatomy 0.000 claims description 6
- 239000011886 peripheral blood Substances 0.000 claims description 6
- 230000001105 regulatory effect Effects 0.000 claims description 6
- 201000011549 stomach cancer Diseases 0.000 claims description 6
- 206010006187 Breast cancer Diseases 0.000 claims description 5
- 208000026310 Breast neoplasm Diseases 0.000 claims description 5
- 206010009944 Colon cancer Diseases 0.000 claims description 5
- 208000001333 Colorectal Neoplasms Diseases 0.000 claims description 5
- 208000034578 Multiple myelomas Diseases 0.000 claims description 5
- 206010035226 Plasma cell myeloma Diseases 0.000 claims description 5
- 208000037976 chronic inflammation Diseases 0.000 claims description 5
- 230000006020 chronic inflammation Effects 0.000 claims description 5
- 239000003937 drug carrier Substances 0.000 claims description 5
- 230000002496 gastric effect Effects 0.000 claims description 5
- 201000001441 melanoma Diseases 0.000 claims description 5
- 206010016654 Fibrosis Diseases 0.000 claims description 4
- 206010020880 Hypertrophy Diseases 0.000 claims description 4
- 108010021625 Immunoglobulin Fragments Proteins 0.000 claims description 4
- 102000008394 Immunoglobulin Fragments Human genes 0.000 claims description 4
- 206010058467 Lung neoplasm malignant Diseases 0.000 claims description 4
- 208000027418 Wounds and injury Diseases 0.000 claims description 4
- 210000003719 b-lymphocyte Anatomy 0.000 claims description 4
- 230000004761 fibrosis Effects 0.000 claims description 4
- 230000007380 inflammaging Effects 0.000 claims description 4
- 201000005202 lung cancer Diseases 0.000 claims description 4
- 208000020816 lung neoplasm Diseases 0.000 claims description 4
- 230000029663 wound healing Effects 0.000 claims description 4
- 208000031261 Acute myeloid leukaemia Diseases 0.000 claims description 3
- 201000004384 Alopecia Diseases 0.000 claims description 3
- 206010002329 Aneurysm Diseases 0.000 claims description 3
- 108010078286 Ataxins Proteins 0.000 claims description 3
- 102000014461 Ataxins Human genes 0.000 claims description 3
- 201000001320 Atherosclerosis Diseases 0.000 claims description 3
- 206010003694 Atrophy Diseases 0.000 claims description 3
- 208000010839 B-cell chronic lymphocytic leukemia Diseases 0.000 claims description 3
- 208000003950 B-cell lymphoma Diseases 0.000 claims description 3
- 208000012526 B-cell neoplasm Diseases 0.000 claims description 3
- 208000028564 B-cell non-Hodgkin lymphoma Diseases 0.000 claims description 3
- 206010006895 Cachexia Diseases 0.000 claims description 3
- 208000002177 Cataract Diseases 0.000 claims description 3
- 206010008025 Cerebellar ataxia Diseases 0.000 claims description 3
- 206010008342 Cervix carcinoma Diseases 0.000 claims description 3
- 208000006545 Chronic Obstructive Pulmonary Disease Diseases 0.000 claims description 3
- 206010009900 Colitis ulcerative Diseases 0.000 claims description 3
- 208000011231 Crohn disease Diseases 0.000 claims description 3
- 201000003883 Cystic fibrosis Diseases 0.000 claims description 3
- 206010012289 Dementia Diseases 0.000 claims description 3
- 208000007342 Diabetic Nephropathies Diseases 0.000 claims description 3
- 108010067722 Dipeptidyl Peptidase 4 Proteins 0.000 claims description 3
- 206010014733 Endometrial cancer Diseases 0.000 claims description 3
- 206010014759 Endometrial neoplasm Diseases 0.000 claims description 3
- 208000000461 Esophageal Neoplasms Diseases 0.000 claims description 3
- 208000006168 Ewing Sarcoma Diseases 0.000 claims description 3
- 208000010412 Glaucoma Diseases 0.000 claims description 3
- 208000003807 Graves Disease Diseases 0.000 claims description 3
- 208000015023 Graves' disease Diseases 0.000 claims description 3
- 208000035895 Guillain-Barré syndrome Diseases 0.000 claims description 3
- 208000017604 Hodgkin disease Diseases 0.000 claims description 3
- 208000021519 Hodgkin lymphoma Diseases 0.000 claims description 3
- 208000010747 Hodgkins lymphoma Diseases 0.000 claims description 3
- 208000023105 Huntington disease Diseases 0.000 claims description 3
- 206010020772 Hypertension Diseases 0.000 claims description 3
- 206010061246 Intervertebral disc degeneration Diseases 0.000 claims description 3
- 206010049287 Lipodystrophy acquired Diseases 0.000 claims description 3
- 208000005777 Lupus Nephritis Diseases 0.000 claims description 3
- 206010049567 Miller Fisher syndrome Diseases 0.000 claims description 3
- 208000019022 Mood disease Diseases 0.000 claims description 3
- 206010029260 Neuroblastoma Diseases 0.000 claims description 3
- 206010030155 Oesophageal carcinoma Diseases 0.000 claims description 3
- 208000001132 Osteoporosis Diseases 0.000 claims description 3
- 206010033128 Ovarian cancer Diseases 0.000 claims description 3
- 206010061535 Ovarian neoplasm Diseases 0.000 claims description 3
- 206010061902 Pancreatic neoplasm Diseases 0.000 claims description 3
- 206010033645 Pancreatitis Diseases 0.000 claims description 3
- 206010060862 Prostate cancer Diseases 0.000 claims description 3
- 208000000236 Prostatic Neoplasms Diseases 0.000 claims description 3
- 201000004681 Psoriasis Diseases 0.000 claims description 3
- 208000006265 Renal cell carcinoma Diseases 0.000 claims description 3
- 201000000582 Retinoblastoma Diseases 0.000 claims description 3
- 206010039491 Sarcoma Diseases 0.000 claims description 3
- 208000009415 Spinocerebellar Ataxias Diseases 0.000 claims description 3
- 208000006011 Stroke Diseases 0.000 claims description 3
- 208000031673 T-Cell Cutaneous Lymphoma Diseases 0.000 claims description 3
- 206010060872 Transplant failure Diseases 0.000 claims description 3
- 201000006704 Ulcerative Colitis Diseases 0.000 claims description 3
- 208000006105 Uterine Cervical Neoplasms Diseases 0.000 claims description 3
- 231100000360 alopecia Toxicity 0.000 claims description 3
- 230000037444 atrophy Effects 0.000 claims description 3
- 201000004562 autosomal dominant cerebellar ataxia Diseases 0.000 claims description 3
- 210000000988 bone and bone Anatomy 0.000 claims description 3
- 210000004413 cardiac myocyte Anatomy 0.000 claims description 3
- 201000010881 cervical cancer Diseases 0.000 claims description 3
- 201000007241 cutaneous T cell lymphoma Diseases 0.000 claims description 3
- 230000006378 damage Effects 0.000 claims description 3
- 208000018180 degenerative disc disease Diseases 0.000 claims description 3
- 208000033679 diabetic kidney disease Diseases 0.000 claims description 3
- 201000004101 esophageal cancer Diseases 0.000 claims description 3
- 208000005017 glioblastoma Diseases 0.000 claims description 3
- 206010061989 glomerulosclerosis Diseases 0.000 claims description 3
- 201000003911 head and neck carcinoma Diseases 0.000 claims description 3
- 208000019691 hematopoietic and lymphoid cell neoplasm Diseases 0.000 claims description 3
- 208000014674 injury Diseases 0.000 claims description 3
- 208000021600 intervertebral disc degenerative disease Diseases 0.000 claims description 3
- 210000003734 kidney Anatomy 0.000 claims description 3
- 208000006132 lipodystrophy Diseases 0.000 claims description 3
- 201000007270 liver cancer Diseases 0.000 claims description 3
- 208000014018 liver neoplasm Diseases 0.000 claims description 3
- 210000004072 lung Anatomy 0.000 claims description 3
- 206010025135 lupus erythematosus Diseases 0.000 claims description 3
- 208000015486 malignant pancreatic neoplasm Diseases 0.000 claims description 3
- 201000005962 mycosis fungoides Diseases 0.000 claims description 3
- 208000010125 myocardial infarction Diseases 0.000 claims description 3
- 230000004770 neurodegeneration Effects 0.000 claims description 3
- 206010053219 non-alcoholic steatohepatitis Diseases 0.000 claims description 3
- 208000002154 non-small cell lung carcinoma Diseases 0.000 claims description 3
- 201000002528 pancreatic cancer Diseases 0.000 claims description 3
- 208000008443 pancreatic carcinoma Diseases 0.000 claims description 3
- 208000025638 primary cutaneous T-cell non-Hodgkin lymphoma Diseases 0.000 claims description 3
- 230000008085 renal dysfunction Effects 0.000 claims description 3
- 201000009410 rhabdomyosarcoma Diseases 0.000 claims description 3
- 206010039073 rheumatoid arthritis Diseases 0.000 claims description 3
- 208000001076 sarcopenia Diseases 0.000 claims description 3
- 206010044412 transitional cell carcinoma Diseases 0.000 claims description 3
- 208000001072 type 2 diabetes mellitus Diseases 0.000 claims description 3
- 208000023747 urothelial carcinoma Diseases 0.000 claims description 3
- 208000019553 vascular disease Diseases 0.000 claims description 3
- 102000002262 Thromboplastin Human genes 0.000 claims 3
- 102000049320 CD36 Human genes 0.000 claims 2
- 102000016622 Dipeptidyl Peptidase 4 Human genes 0.000 claims 1
- 235000001014 amino acid Nutrition 0.000 description 1190
- 229940024606 amino acid Drugs 0.000 description 1182
- 150000001413 amino acids Chemical class 0.000 description 1175
- 230000007423 decrease Effects 0.000 description 414
- 235000018102 proteins Nutrition 0.000 description 126
- 102100030859 Tissue factor Human genes 0.000 description 69
- 102000005962 receptors Human genes 0.000 description 24
- 108020003175 receptors Proteins 0.000 description 24
- GOJUJUVQIVIZAV-UHFFFAOYSA-N 2-amino-4,6-dichloropyrimidine-5-carbaldehyde Chemical group NC1=NC(Cl)=C(C=O)C(Cl)=N1 GOJUJUVQIVIZAV-UHFFFAOYSA-N 0.000 description 22
- 239000012634 fragment Substances 0.000 description 22
- 239000003446 ligand Substances 0.000 description 21
- 125000003275 alpha amino acid group Chemical group 0.000 description 16
- 230000000694 effects Effects 0.000 description 16
- 239000000758 substrate Substances 0.000 description 16
- 101000635804 Homo sapiens Tissue factor Proteins 0.000 description 15
- 230000004913 activation Effects 0.000 description 15
- 230000003993 interaction Effects 0.000 description 15
- 239000012528 membrane Substances 0.000 description 15
- 102000055025 Adenosine deaminases Human genes 0.000 description 14
- 101710169336 5'-deoxyadenosine deaminase Proteins 0.000 description 13
- 230000009758 senescence Effects 0.000 description 13
- 230000011664 signaling Effects 0.000 description 13
- OIRDTQYFTABQOQ-KQYNXXCUSA-N adenosine Chemical compound C1=NC=2C(N)=NC=NC=2N1[C@@H]1O[C@H](CO)[C@@H](O)[C@H]1O OIRDTQYFTABQOQ-KQYNXXCUSA-N 0.000 description 12
- 239000000203 mixture Substances 0.000 description 12
- 101000914514 Homo sapiens T-cell-specific surface glycoprotein CD28 Proteins 0.000 description 11
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 11
- 102100027213 T-cell-specific surface glycoprotein CD28 Human genes 0.000 description 11
- 102000045598 human DPP4 Human genes 0.000 description 10
- 230000001404 mediated effect Effects 0.000 description 10
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 9
- 230000014509 gene expression Effects 0.000 description 9
- 108010012236 Chemokines Proteins 0.000 description 8
- 102000019034 Chemokines Human genes 0.000 description 8
- 108010076504 Protein Sorting Signals Proteins 0.000 description 8
- 230000010094 cellular senescence Effects 0.000 description 8
- 102000017420 CD3 protein, epsilon/gamma/delta subunit Human genes 0.000 description 7
- 108050005493 CD3 protein, epsilon/gamma/delta subunit Proteins 0.000 description 7
- 102000053028 CD36 Antigens Human genes 0.000 description 7
- 102100025064 Cellular tumor antigen p53 Human genes 0.000 description 7
- 102100024458 Cyclin-dependent kinase inhibitor 2A Human genes 0.000 description 7
- 101000721661 Homo sapiens Cellular tumor antigen p53 Proteins 0.000 description 7
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 7
- 230000010056 antibody-dependent cellular cytotoxicity Effects 0.000 description 7
- 239000011324 bead Substances 0.000 description 7
- 230000006870 function Effects 0.000 description 7
- 239000002126 C01EB10 - Adenosine Substances 0.000 description 6
- 229960005305 adenosine Drugs 0.000 description 6
- 235000004279 alanine Nutrition 0.000 description 6
- 125000000539 amino acid group Chemical group 0.000 description 6
- 210000004899 c-terminal region Anatomy 0.000 description 6
- 210000004978 chinese hamster ovary cell Anatomy 0.000 description 6
- 238000003776 cleavage reaction Methods 0.000 description 6
- 230000001086 cytosolic effect Effects 0.000 description 6
- 230000001419 dependent effect Effects 0.000 description 6
- 210000002950 fibroblast Anatomy 0.000 description 6
- 230000003834 intracellular effect Effects 0.000 description 6
- 230000035772 mutation Effects 0.000 description 6
- 230000007017 scission Effects 0.000 description 6
- 208000024891 symptom Diseases 0.000 description 6
- MTCFGRXMJLQNBG-REOHCLBHSA-N (2S)-2-Amino-3-hydroxypropansäure Chemical compound OC[C@H](N)C(O)=O MTCFGRXMJLQNBG-REOHCLBHSA-N 0.000 description 5
- 102000004127 Cytokines Human genes 0.000 description 5
- 108090000695 Cytokines Proteins 0.000 description 5
- 238000002965 ELISA Methods 0.000 description 5
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 5
- 208000025370 Middle East respiratory syndrome Diseases 0.000 description 5
- 230000006044 T cell activation Effects 0.000 description 5
- 230000000903 blocking effect Effects 0.000 description 5
- 230000003197 catalytic effect Effects 0.000 description 5
- 230000000139 costimulatory effect Effects 0.000 description 5
- 230000002255 enzymatic effect Effects 0.000 description 5
- 239000000859 incretin Substances 0.000 description 5
- MGXWVYUBJRZYPE-YUGYIWNOSA-N incretin Chemical class C([C@@H](C(=O)N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC=1NC=NC=1)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC=1NC=NC=1)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCC(N)=O)C(O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CC=1C=CC(O)=CC=1)[C@@H](C)O)[C@@H](C)CC)C1=CC=C(O)C=C1 MGXWVYUBJRZYPE-YUGYIWNOSA-N 0.000 description 5
- 230000002757 inflammatory effect Effects 0.000 description 5
- 230000000670 limiting effect Effects 0.000 description 5
- 210000002540 macrophage Anatomy 0.000 description 5
- 230000002797 proteolythic effect Effects 0.000 description 5
- 210000000130 stem cell Anatomy 0.000 description 5
- 238000006467 substitution reaction Methods 0.000 description 5
- 230000004614 tumor growth Effects 0.000 description 5
- 101800000407 Brain natriuretic peptide 32 Proteins 0.000 description 4
- YNXLOPYTAAFMTN-SBUIBGKBSA-N C([C@H](N)C(=O)N1CCC[C@H]1C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCCCN)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(=O)N1[C@@H](CCC1)C(=O)NCC(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CO)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N[C@@H](C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC=1NC=NC=1)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(N)=O)C1=CC=C(O)C=C1 Chemical compound C([C@H](N)C(=O)N1CCC[C@H]1C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCCCN)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(=O)N1[C@@H](CCC1)C(=O)NCC(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CO)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N[C@@H](C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC=1NC=NC=1)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(N)=O)C1=CC=C(O)C=C1 YNXLOPYTAAFMTN-SBUIBGKBSA-N 0.000 description 4
- 102100028990 C-X-C chemokine receptor type 3 Human genes 0.000 description 4
- -1 Ca2+ ion Chemical class 0.000 description 4
- 241000283707 Capra Species 0.000 description 4
- 208000001528 Coronaviridae Infections Diseases 0.000 description 4
- 108010016626 Dipeptides Proteins 0.000 description 4
- 102000003951 Erythropoietin Human genes 0.000 description 4
- 108090000394 Erythropoietin Proteins 0.000 description 4
- 108010004460 Gastric Inhibitory Polypeptide Proteins 0.000 description 4
- 102100039994 Gastric inhibitory polypeptide Human genes 0.000 description 4
- 108010088406 Glucagon-Like Peptides Proteins 0.000 description 4
- 239000004471 Glycine Substances 0.000 description 4
- 101000916050 Homo sapiens C-X-C chemokine receptor type 3 Proteins 0.000 description 4
- 108090001007 Interleukin-8 Proteins 0.000 description 4
- 102000004890 Interleukin-8 Human genes 0.000 description 4
- 102000035195 Peptidases Human genes 0.000 description 4
- 108091005804 Peptidases Proteins 0.000 description 4
- 102100029909 Peptide YY Human genes 0.000 description 4
- 108010088847 Peptide YY Proteins 0.000 description 4
- 102100040918 Pro-glucagon Human genes 0.000 description 4
- 208000036142 Viral infection Diseases 0.000 description 4
- 210000000612 antigen-presenting cell Anatomy 0.000 description 4
- 230000015572 biosynthetic process Effects 0.000 description 4
- 239000000872 buffer Substances 0.000 description 4
- 229940105423 erythropoietin Drugs 0.000 description 4
- 210000000987 immune system Anatomy 0.000 description 4
- 238000002955 isolation Methods 0.000 description 4
- 238000004519 manufacturing process Methods 0.000 description 4
- OXCMYAYHXIHQOA-UHFFFAOYSA-N potassium;[2-butyl-5-chloro-3-[[4-[2-(1,2,4-triaza-3-azanidacyclopenta-1,4-dien-5-yl)phenyl]phenyl]methyl]imidazol-4-yl]methanol Chemical compound [K+].CCCCC1=NC(Cl)=C(CO)N1CC1=CC=C(C=2C(=CC=CC=2)C2=N[N-]N=N2)C=C1 OXCMYAYHXIHQOA-UHFFFAOYSA-N 0.000 description 4
- 241000894007 species Species 0.000 description 4
- 230000009385 viral infection Effects 0.000 description 4
- HKZAAJSTFUZYTO-LURJTMIESA-N (2s)-2-[[2-[[2-[[2-[(2-aminoacetyl)amino]acetyl]amino]acetyl]amino]acetyl]amino]-3-hydroxypropanoic acid Chemical compound NCC(=O)NCC(=O)NCC(=O)NCC(=O)N[C@@H](CO)C(O)=O HKZAAJSTFUZYTO-LURJTMIESA-N 0.000 description 3
- 102000014914 Carrier Proteins Human genes 0.000 description 3
- 230000005778 DNA damage Effects 0.000 description 3
- 231100000277 DNA damage Toxicity 0.000 description 3
- 102100037642 Elongation factor G, mitochondrial Human genes 0.000 description 3
- 102000010834 Extracellular Matrix Proteins Human genes 0.000 description 3
- 108010037362 Extracellular Matrix Proteins Proteins 0.000 description 3
- 102100037362 Fibronectin Human genes 0.000 description 3
- 108010067306 Fibronectins Proteins 0.000 description 3
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 3
- 101100166600 Homo sapiens CD28 gene Proteins 0.000 description 3
- 101000880344 Homo sapiens Elongation factor G, mitochondrial Proteins 0.000 description 3
- 101001014223 Homo sapiens MAPK/MAK/MRK overlapping kinase Proteins 0.000 description 3
- 101001109501 Homo sapiens NKG2-D type II integral membrane protein Proteins 0.000 description 3
- 101000733249 Homo sapiens Tumor suppressor ARF Proteins 0.000 description 3
- 108060003951 Immunoglobulin Proteins 0.000 description 3
- 102000000589 Interleukin-1 Human genes 0.000 description 3
- 108010002352 Interleukin-1 Proteins 0.000 description 3
- 102000003812 Interleukin-15 Human genes 0.000 description 3
- 108090000172 Interleukin-15 Proteins 0.000 description 3
- 108010002386 Interleukin-3 Proteins 0.000 description 3
- 102000000646 Interleukin-3 Human genes 0.000 description 3
- 102000004889 Interleukin-6 Human genes 0.000 description 3
- 108090001005 Interleukin-6 Proteins 0.000 description 3
- 102000015696 Interleukins Human genes 0.000 description 3
- 108010063738 Interleukins Proteins 0.000 description 3
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 description 3
- COLNVLDHVKWLRT-QMMMGPOBSA-N L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=CC=C1 COLNVLDHVKWLRT-QMMMGPOBSA-N 0.000 description 3
- 241000124008 Mammalia Species 0.000 description 3
- 101710151321 Melanostatin Proteins 0.000 description 3
- 241000699666 Mus <mouse, genus> Species 0.000 description 3
- 101000635833 Mus musculus Tissue factor Proteins 0.000 description 3
- 241000699670 Mus sp. Species 0.000 description 3
- 102100022680 NKG2-D type II integral membrane protein Human genes 0.000 description 3
- 102400000064 Neuropeptide Y Human genes 0.000 description 3
- ONIBWKKTOPOVIA-UHFFFAOYSA-N Proline Natural products OC(=O)C1CCCN1 ONIBWKKTOPOVIA-UHFFFAOYSA-N 0.000 description 3
- 101000635831 Rattus norvegicus Tissue factor Proteins 0.000 description 3
- 230000006052 T cell proliferation Effects 0.000 description 3
- 238000009825 accumulation Methods 0.000 description 3
- 230000003024 amidolytic effect Effects 0.000 description 3
- 230000000259 anti-tumor effect Effects 0.000 description 3
- 125000003118 aryl group Chemical group 0.000 description 3
- 210000000227 basophil cell of anterior lobe of hypophysis Anatomy 0.000 description 3
- 108091008324 binding proteins Proteins 0.000 description 3
- 229960000074 biopharmaceutical Drugs 0.000 description 3
- 210000004369 blood Anatomy 0.000 description 3
- 239000008280 blood Substances 0.000 description 3
- 210000003169 central nervous system Anatomy 0.000 description 3
- 239000013078 crystal Substances 0.000 description 3
- 229940090124 dipeptidyl peptidase 4 (dpp-4) inhibitors for blood glucose lowering Drugs 0.000 description 3
- 239000012636 effector Substances 0.000 description 3
- 230000002708 enhancing effect Effects 0.000 description 3
- 210000002744 extracellular matrix Anatomy 0.000 description 3
- 108020001507 fusion proteins Proteins 0.000 description 3
- 102000037865 fusion proteins Human genes 0.000 description 3
- 239000008103 glucose Substances 0.000 description 3
- 230000013595 glycosylation Effects 0.000 description 3
- 238000006206 glycosylation reaction Methods 0.000 description 3
- 230000012010 growth Effects 0.000 description 3
- 102000049409 human MOK Human genes 0.000 description 3
- 102000018358 immunoglobulin Human genes 0.000 description 3
- 210000004185 liver Anatomy 0.000 description 3
- 239000000463 material Substances 0.000 description 3
- 230000004065 mitochondrial dysfunction Effects 0.000 description 3
- URPYMXQQVHTUDU-OFGSCBOVSA-N nucleopeptide y Chemical compound C([C@@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(N)=O)NC(=O)[C@H](CC=1NC=NC=1)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)[C@H]1N(CCC1)C(=O)[C@H](C)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)CNC(=O)[C@H]1N(CCC1)C(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H]1N(CCC1)C(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)[C@H]1N(CCC1)C(=O)[C@@H](N)CC=1C=CC(O)=CC=1)C1=CC=C(O)C=C1 URPYMXQQVHTUDU-OFGSCBOVSA-N 0.000 description 3
- 230000007170 pathology Effects 0.000 description 3
- 230000000291 postprandial effect Effects 0.000 description 3
- 230000000770 proinflammatory effect Effects 0.000 description 3
- 230000001737 promoting effect Effects 0.000 description 3
- 230000028327 secretion Effects 0.000 description 3
- 229960001153 serine Drugs 0.000 description 3
- 229960004034 sitagliptin Drugs 0.000 description 3
- MFFMDFFZMYYVKS-SECBINFHSA-N sitagliptin Chemical compound C([C@H](CC(=O)N1CC=2N(C(=NN=2)C(F)(F)F)CC1)N)C1=CC(F)=C(F)C=C1F MFFMDFFZMYYVKS-SECBINFHSA-N 0.000 description 3
- 239000002904 solvent Substances 0.000 description 3
- 230000005760 tumorsuppression Effects 0.000 description 3
- QDZOEBFLNHCSSF-PFFBOGFISA-N (2S)-2-[[(2R)-2-[[(2S)-1-[(2S)-6-amino-2-[[(2S)-1-[(2R)-2-amino-5-carbamimidamidopentanoyl]pyrrolidine-2-carbonyl]amino]hexanoyl]pyrrolidine-2-carbonyl]amino]-3-(1H-indol-3-yl)propanoyl]amino]-N-[(2R)-1-[[(2S)-1-[[(2R)-1-[[(2S)-1-[[(2S)-1-amino-4-methyl-1-oxopentan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-3-(1H-indol-3-yl)-1-oxopropan-2-yl]amino]-1-oxo-3-phenylpropan-2-yl]amino]-3-(1H-indol-3-yl)-1-oxopropan-2-yl]pentanediamide Chemical compound C([C@@H](C(=O)N[C@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(N)=O)NC(=O)[C@@H](CC=1C2=CC=CC=C2NC=1)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](CC=1C2=CC=CC=C2NC=1)NC(=O)[C@H]1N(CCC1)C(=O)[C@H](CCCCN)NC(=O)[C@H]1N(CCC1)C(=O)[C@H](N)CCCNC(N)=N)C1=CC=CC=C1 QDZOEBFLNHCSSF-PFFBOGFISA-N 0.000 description 2
- 102000009346 Adenosine receptors Human genes 0.000 description 2
- 108050000203 Adenosine receptors Proteins 0.000 description 2
- 102000004400 Aminopeptidases Human genes 0.000 description 2
- 108090000915 Aminopeptidases Proteins 0.000 description 2
- 210000002237 B-cell of pancreatic islet Anatomy 0.000 description 2
- 102400000667 Brain natriuretic peptide 32 Human genes 0.000 description 2
- 101800002247 Brain natriuretic peptide 45 Proteins 0.000 description 2
- 102100036845 C-C motif chemokine 22 Human genes 0.000 description 2
- 102100038077 CD226 antigen Human genes 0.000 description 2
- 208000025721 COVID-19 Diseases 0.000 description 2
- 108010061299 CXCR4 Receptors Proteins 0.000 description 2
- 102000012000 CXCR4 Receptors Human genes 0.000 description 2
- 241000282465 Canis Species 0.000 description 2
- 102100025475 Carcinoembryonic antigen-related cell adhesion molecule 5 Human genes 0.000 description 2
- 102000003727 Caveolin 1 Human genes 0.000 description 2
- 108090000026 Caveolin 1 Proteins 0.000 description 2
- 108010083701 Chemokine CCL22 Proteins 0.000 description 2
- 108010008978 Chemokine CXCL10 Proteins 0.000 description 2
- 102000006579 Chemokine CXCL10 Human genes 0.000 description 2
- 108010077544 Chromatin Proteins 0.000 description 2
- 102000008186 Collagen Human genes 0.000 description 2
- 108010035532 Collagen Proteins 0.000 description 2
- 241000711573 Coronaviridae Species 0.000 description 2
- 102100024462 Cyclin-dependent kinase 4 inhibitor B Human genes 0.000 description 2
- 102000004190 Enzymes Human genes 0.000 description 2
- 108090000790 Enzymes Proteins 0.000 description 2
- 101710139422 Eotaxin Proteins 0.000 description 2
- 102100023688 Eotaxin Human genes 0.000 description 2
- 241000283073 Equus caballus Species 0.000 description 2
- 108010087819 Fc receptors Proteins 0.000 description 2
- 102000009109 Fc receptors Human genes 0.000 description 2
- 102000002090 Fibronectin type III Human genes 0.000 description 2
- 108050009401 Fibronectin type III Proteins 0.000 description 2
- 102000051325 Glucagon Human genes 0.000 description 2
- 108060003199 Glucagon Proteins 0.000 description 2
- 108010017080 Granulocyte Colony-Stimulating Factor Proteins 0.000 description 2
- 102000004269 Granulocyte Colony-Stimulating Factor Human genes 0.000 description 2
- 108010017213 Granulocyte-Macrophage Colony-Stimulating Factor Proteins 0.000 description 2
- 102100039620 Granulocyte-macrophage colony-stimulating factor Human genes 0.000 description 2
- 239000000095 Growth Hormone-Releasing Hormone Substances 0.000 description 2
- 108091016366 Histone-lysine N-methyltransferase EHMT1 Proteins 0.000 description 2
- 241000282412 Homo Species 0.000 description 2
- 101000929495 Homo sapiens Adenosine deaminase Proteins 0.000 description 2
- 101000884298 Homo sapiens CD226 antigen Proteins 0.000 description 2
- 101000914324 Homo sapiens Carcinoembryonic antigen-related cell adhesion molecule 5 Proteins 0.000 description 2
- 101000991061 Homo sapiens MHC class I polypeptide-related sequence B Proteins 0.000 description 2
- 101000589305 Homo sapiens Natural cytotoxicity triggering receptor 2 Proteins 0.000 description 2
- 101001039966 Homo sapiens Pro-glucagon Proteins 0.000 description 2
- 101000738771 Homo sapiens Receptor-type tyrosine-protein phosphatase C Proteins 0.000 description 2
- 101000607320 Homo sapiens UL16-binding protein 2 Proteins 0.000 description 2
- 108010054477 Immunoglobulin Fab Fragments Proteins 0.000 description 2
- 102000001706 Immunoglobulin Fab Fragments Human genes 0.000 description 2
- 108010067060 Immunoglobulin Variable Region Proteins 0.000 description 2
- 102000017727 Immunoglobulin Variable Region Human genes 0.000 description 2
- 108010034143 Inflammasomes Proteins 0.000 description 2
- 206010061218 Inflammation Diseases 0.000 description 2
- 102000003814 Interleukin-10 Human genes 0.000 description 2
- 108090000174 Interleukin-10 Proteins 0.000 description 2
- 108010002350 Interleukin-2 Proteins 0.000 description 2
- 102000000588 Interleukin-2 Human genes 0.000 description 2
- ONIBWKKTOPOVIA-BYPYZUCNSA-N L-Proline Chemical compound OC(=O)[C@@H]1CCCN1 ONIBWKKTOPOVIA-BYPYZUCNSA-N 0.000 description 2
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 2
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 2
- 102100030300 MHC class I polypeptide-related sequence B Human genes 0.000 description 2
- 241000127282 Middle East respiratory syndrome-related coronavirus Species 0.000 description 2
- 108010057466 NF-kappa B Proteins 0.000 description 2
- 102000003945 NF-kappa B Human genes 0.000 description 2
- 102100032851 Natural cytotoxicity triggering receptor 2 Human genes 0.000 description 2
- 208000037273 Pathologic Processes Diseases 0.000 description 2
- 241000288906 Primates Species 0.000 description 2
- 239000004365 Protease Substances 0.000 description 2
- 102100037422 Receptor-type tyrosine-protein phosphatase C Human genes 0.000 description 2
- 108091006649 SLC9A3 Proteins 0.000 description 2
- 102100035899 Secretory carrier-associated membrane protein 4 Human genes 0.000 description 2
- 101710153941 Secretory carrier-associated membrane protein 4 Proteins 0.000 description 2
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 2
- 102000046061 Sodium-Hydrogen Exchanger 3 Human genes 0.000 description 2
- 101710142969 Somatoliberin Proteins 0.000 description 2
- 102100022831 Somatoliberin Human genes 0.000 description 2
- 102400000096 Substance P Human genes 0.000 description 2
- 101800003906 Substance P Proteins 0.000 description 2
- 102100023935 Transmembrane glycoprotein NMB Human genes 0.000 description 2
- 102100039989 UL16-binding protein 2 Human genes 0.000 description 2
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Natural products CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 description 2
- 230000009471 action Effects 0.000 description 2
- 230000007172 age related pathology Effects 0.000 description 2
- 238000004458 analytical method Methods 0.000 description 2
- 230000005809 anti-tumor immunity Effects 0.000 description 2
- 230000006907 apoptotic process Effects 0.000 description 2
- OHDRQQURAXLVGJ-HLVWOLMTSA-N azane;(2e)-3-ethyl-2-[(e)-(3-ethyl-6-sulfo-1,3-benzothiazol-2-ylidene)hydrazinylidene]-1,3-benzothiazole-6-sulfonic acid Chemical compound [NH4+].[NH4+].S/1C2=CC(S([O-])(=O)=O)=CC=C2N(CC)C\1=N/N=C1/SC2=CC(S([O-])(=O)=O)=CC=C2N1CC OHDRQQURAXLVGJ-HLVWOLMTSA-N 0.000 description 2
- 230000008827 biological function Effects 0.000 description 2
- 230000020411 cell activation Effects 0.000 description 2
- 230000003915 cell function Effects 0.000 description 2
- 210000000170 cell membrane Anatomy 0.000 description 2
- 230000012292 cell migration Effects 0.000 description 2
- 230000004663 cell proliferation Effects 0.000 description 2
- 210000003483 chromatin Anatomy 0.000 description 2
- 230000001684 chronic effect Effects 0.000 description 2
- 230000015271 coagulation Effects 0.000 description 2
- 238000005345 coagulation Methods 0.000 description 2
- 229920001436 collagen Polymers 0.000 description 2
- 201000010989 colorectal carcinoma Diseases 0.000 description 2
- 239000002299 complementary DNA Substances 0.000 description 2
- 235000018417 cysteine Nutrition 0.000 description 2
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 2
- 102000003675 cytokine receptors Human genes 0.000 description 2
- 108010057085 cytokine receptors Proteins 0.000 description 2
- 230000002950 deficient Effects 0.000 description 2
- 238000011161 development Methods 0.000 description 2
- 230000018109 developmental process Effects 0.000 description 2
- 206010012601 diabetes mellitus Diseases 0.000 description 2
- 230000004069 differentiation Effects 0.000 description 2
- 239000000539 dimer Substances 0.000 description 2
- 238000000375 direct analysis in real time Methods 0.000 description 2
- 238000010494 dissociation reaction Methods 0.000 description 2
- 230000005593 dissociations Effects 0.000 description 2
- 229940079593 drug Drugs 0.000 description 2
- 239000003814 drug Substances 0.000 description 2
- 238000009509 drug development Methods 0.000 description 2
- 230000009977 dual effect Effects 0.000 description 2
- 238000012063 dual-affinity re-targeting Methods 0.000 description 2
- 210000003989 endothelium vascular Anatomy 0.000 description 2
- 229940088598 enzyme Drugs 0.000 description 2
- 210000003979 eosinophil Anatomy 0.000 description 2
- 239000013604 expression vector Substances 0.000 description 2
- 210000001703 glandular epithelial cell Anatomy 0.000 description 2
- MASNOZXLGMXCHN-ZLPAWPGGSA-N glucagon Chemical compound C([C@@H](C(=O)N[C@H](C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(O)=O)C(C)C)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](C)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CO)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CC=1NC=NC=1)[C@@H](C)O)[C@@H](C)O)C1=CC=CC=C1 MASNOZXLGMXCHN-ZLPAWPGGSA-N 0.000 description 2
- 229960004666 glucagon Drugs 0.000 description 2
- 230000004153 glucose metabolism Effects 0.000 description 2
- 239000000710 homodimer Substances 0.000 description 2
- 230000005746 immune checkpoint blockade Effects 0.000 description 2
- 238000009169 immunotherapy Methods 0.000 description 2
- 230000006872 improvement Effects 0.000 description 2
- 238000001727 in vivo Methods 0.000 description 2
- 230000006698 induction Effects 0.000 description 2
- 230000004054 inflammatory process Effects 0.000 description 2
- NOESYZHRGYRDHS-UHFFFAOYSA-N insulin Chemical compound N1C(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(NC(=O)CN)C(C)CC)CSSCC(C(NC(CO)C(=O)NC(CC(C)C)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CCC(N)=O)C(=O)NC(CC(C)C)C(=O)NC(CCC(O)=O)C(=O)NC(CC(N)=O)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CSSCC(NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2C=CC(O)=CC=2)NC(=O)C(CC(C)C)NC(=O)C(C)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2NC=NC=2)NC(=O)C(CO)NC(=O)CNC2=O)C(=O)NCC(=O)NC(CCC(O)=O)C(=O)NC(CCCNC(N)=N)C(=O)NCC(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC(O)=CC=3)C(=O)NC(C(C)O)C(=O)N3C(CCC3)C(=O)NC(CCCCN)C(=O)NC(C)C(O)=O)C(=O)NC(CC(N)=O)C(O)=O)=O)NC(=O)C(C(C)CC)NC(=O)C(CO)NC(=O)C(C(C)O)NC(=O)C1CSSCC2NC(=O)C(CC(C)C)NC(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CC(N)=O)NC(=O)C(NC(=O)C(N)CC=1C=CC=CC=1)C(C)C)CC1=CN=CN1 NOESYZHRGYRDHS-UHFFFAOYSA-N 0.000 description 2
- 230000003914 insulin secretion Effects 0.000 description 2
- 230000000968 intestinal effect Effects 0.000 description 2
- 230000004068 intracellular signaling Effects 0.000 description 2
- 210000004698 lymphocyte Anatomy 0.000 description 2
- 239000011159 matrix material Substances 0.000 description 2
- 230000007246 mechanism Effects 0.000 description 2
- 210000004379 membrane Anatomy 0.000 description 2
- 208000030159 metabolic disease Diseases 0.000 description 2
- 210000000110 microvilli Anatomy 0.000 description 2
- 230000005012 migration Effects 0.000 description 2
- 238000013508 migration Methods 0.000 description 2
- 238000010172 mouse model Methods 0.000 description 2
- 230000000869 mutational effect Effects 0.000 description 2
- HPNRHPKXQZSDFX-OAQDCNSJSA-N nesiritide Chemical compound C([C@H]1C(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@H](C(N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](CSSC[C@@H](C(=O)N1)NC(=O)CNC(=O)[C@H](CO)NC(=O)CNC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](NC(=O)[C@H](CCSC)NC(=O)[C@H](CCCCN)NC(=O)[C@H]1N(CCC1)C(=O)[C@@H](N)CO)C(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC=1N=CNC=1)C(O)=O)=O)[C@@H](C)CC)C1=CC=CC=C1 HPNRHPKXQZSDFX-OAQDCNSJSA-N 0.000 description 2
- 210000000496 pancreas Anatomy 0.000 description 2
- 230000009054 pathological process Effects 0.000 description 2
- 230000037361 pathway Effects 0.000 description 2
- 125000001151 peptidyl group Chemical group 0.000 description 2
- 230000000144 pharmacologic effect Effects 0.000 description 2
- 150000003904 phospholipids Chemical class 0.000 description 2
- 230000026731 phosphorylation Effects 0.000 description 2
- 238000006366 phosphorylation reaction Methods 0.000 description 2
- 230000035790 physiological processes and functions Effects 0.000 description 2
- 230000001323 posttranslational effect Effects 0.000 description 2
- 230000008569 process Effects 0.000 description 2
- 235000019833 protease Nutrition 0.000 description 2
- 235000019419 proteases Nutrition 0.000 description 2
- 108020001580 protein domains Proteins 0.000 description 2
- 230000002829 reductive effect Effects 0.000 description 2
- 231100000205 reproductive and developmental toxicity Toxicity 0.000 description 2
- 238000012216 screening Methods 0.000 description 2
- 230000003248 secreting effect Effects 0.000 description 2
- 230000003068 static effect Effects 0.000 description 2
- 210000002536 stromal cell Anatomy 0.000 description 2
- 239000006228 supernatant Substances 0.000 description 2
- 230000001629 suppression Effects 0.000 description 2
- 238000002198 surface plasmon resonance spectroscopy Methods 0.000 description 2
- 230000017423 tissue regeneration Effects 0.000 description 2
- 108091007466 transmembrane glycoproteins Proteins 0.000 description 2
- 230000003827 upregulation Effects 0.000 description 2
- KJTLQQUUPVSXIM-ZCFIWIBFSA-M (R)-mevalonate Chemical compound OCC[C@](O)(C)CC([O-])=O KJTLQQUUPVSXIM-ZCFIWIBFSA-M 0.000 description 1
- VKUYLANQOAKALN-UHFFFAOYSA-N 2-[benzyl-(4-methoxyphenyl)sulfonylamino]-n-hydroxy-4-methylpentanamide Chemical compound C1=CC(OC)=CC=C1S(=O)(=O)N(C(CC(C)C)C(=O)NO)CC1=CC=CC=C1 VKUYLANQOAKALN-UHFFFAOYSA-N 0.000 description 1
- BGFTWECWAICPDG-UHFFFAOYSA-N 2-[bis(4-chlorophenyl)methyl]-4-n-[3-[bis(4-chlorophenyl)methyl]-4-(dimethylamino)phenyl]-1-n,1-n-dimethylbenzene-1,4-diamine Chemical compound C1=C(C(C=2C=CC(Cl)=CC=2)C=2C=CC(Cl)=CC=2)C(N(C)C)=CC=C1NC(C=1)=CC=C(N(C)C)C=1C(C=1C=CC(Cl)=CC=1)C1=CC=C(Cl)C=C1 BGFTWECWAICPDG-UHFFFAOYSA-N 0.000 description 1
- ZVEUWSJUXREOBK-DKWTVANSSA-N 2-aminoacetic acid;(2s)-2-amino-3-hydroxypropanoic acid Chemical group NCC(O)=O.OC[C@H](N)C(O)=O ZVEUWSJUXREOBK-DKWTVANSSA-N 0.000 description 1
- 102100036009 5'-AMP-activated protein kinase catalytic subunit alpha-2 Human genes 0.000 description 1
- 102100022464 5'-nucleotidase Human genes 0.000 description 1
- 102100023990 60S ribosomal protein L17 Human genes 0.000 description 1
- 102000000872 ATM Human genes 0.000 description 1
- 241000251468 Actinopterygii Species 0.000 description 1
- 101100067974 Arabidopsis thaliana POP2 gene Proteins 0.000 description 1
- 239000004475 Arginine Substances 0.000 description 1
- 101150065175 Atm gene Proteins 0.000 description 1
- 108010008014 B-Cell Maturation Antigen Proteins 0.000 description 1
- 102000006942 B-Cell Maturation Antigen Human genes 0.000 description 1
- 102100038080 B-cell receptor CD22 Human genes 0.000 description 1
- 102100024222 B-lymphocyte antigen CD19 Human genes 0.000 description 1
- 241000193738 Bacillus anthracis Species 0.000 description 1
- 102100026189 Beta-galactosidase Human genes 0.000 description 1
- 241000283690 Bos taurus Species 0.000 description 1
- 208000003508 Botulism Diseases 0.000 description 1
- 206010006500 Brucellosis Diseases 0.000 description 1
- 102100038078 CD276 antigen Human genes 0.000 description 1
- 229940126074 CDK kinase inhibitor Drugs 0.000 description 1
- 108091007914 CDKs Proteins 0.000 description 1
- 102000000905 Cadherin Human genes 0.000 description 1
- 108050007957 Cadherin Proteins 0.000 description 1
- 101100463133 Caenorhabditis elegans pdl-1 gene Proteins 0.000 description 1
- 206010051226 Campylobacter infection Diseases 0.000 description 1
- 208000005623 Carcinogenesis Diseases 0.000 description 1
- 102100024965 Caspase recruitment domain-containing protein 11 Human genes 0.000 description 1
- 241000700199 Cavia porcellus Species 0.000 description 1
- 241000282693 Cercopithecidae Species 0.000 description 1
- 206010008631 Cholera Diseases 0.000 description 1
- RYGMFSIKBFXOCR-UHFFFAOYSA-N Copper Chemical compound [Cu] RYGMFSIKBFXOCR-UHFFFAOYSA-N 0.000 description 1
- 241000699800 Cricetinae Species 0.000 description 1
- 241000699802 Cricetulus griseus Species 0.000 description 1
- 108010025464 Cyclin-Dependent Kinase 4 Proteins 0.000 description 1
- 108010025468 Cyclin-Dependent Kinase 6 Proteins 0.000 description 1
- 108010009356 Cyclin-Dependent Kinase Inhibitor p15 Proteins 0.000 description 1
- 108010009392 Cyclin-Dependent Kinase Inhibitor p16 Proteins 0.000 description 1
- 102100036252 Cyclin-dependent kinase 4 Human genes 0.000 description 1
- 102100026804 Cyclin-dependent kinase 6 Human genes 0.000 description 1
- 102100033270 Cyclin-dependent kinase inhibitor 1 Human genes 0.000 description 1
- 102100034770 Cyclin-dependent kinase inhibitor 3 Human genes 0.000 description 1
- 108090000266 Cyclin-dependent kinases Proteins 0.000 description 1
- 102000003903 Cyclin-dependent kinases Human genes 0.000 description 1
- 102100039498 Cytotoxic T-lymphocyte protein 4 Human genes 0.000 description 1
- SNPQGCDJHZAVOB-SOMABOLJSA-N D-glucosyl-N-tetracosanoylsphinganine Chemical compound CCCCCCCCCCCCCCCCCCCCCCCC(=O)N[C@H]([C@H](O)CCCCCCCCCCCCCCC)COC1O[C@H](CO)[C@@H](O)[C@H](O)[C@H]1O SNPQGCDJHZAVOB-SOMABOLJSA-N 0.000 description 1
- KJTLQQUUPVSXIM-UHFFFAOYSA-N DL-mevalonic acid Natural products OCCC(O)(C)CC(O)=O KJTLQQUUPVSXIM-UHFFFAOYSA-N 0.000 description 1
- 108020004414 DNA Proteins 0.000 description 1
- 238000001712 DNA sequencing Methods 0.000 description 1
- 206010011968 Decreased immune responsiveness Diseases 0.000 description 1
- 102100033553 Delta-like protein 4 Human genes 0.000 description 1
- 206010012310 Dengue fever Diseases 0.000 description 1
- 241000702421 Dependoparvovirus Species 0.000 description 1
- 102000001301 EGF receptor Human genes 0.000 description 1
- 102000012804 EPCAM Human genes 0.000 description 1
- 101150084967 EPCAM gene Proteins 0.000 description 1
- 102100029722 Ectonucleoside triphosphate diphosphohydrolase 1 Human genes 0.000 description 1
- 108010062466 Enzyme Precursors Proteins 0.000 description 1
- 102000010911 Enzyme Precursors Human genes 0.000 description 1
- 108050001049 Extracellular proteins Proteins 0.000 description 1
- 108010054265 Factor VIIa Proteins 0.000 description 1
- 108010014173 Factor X Proteins 0.000 description 1
- 108010074860 Factor Xa Proteins 0.000 description 1
- 241000282324 Felis Species 0.000 description 1
- 241000282326 Felis catus Species 0.000 description 1
- 108090000852 Forkhead Transcription Factors Proteins 0.000 description 1
- 102000004315 Forkhead Transcription Factors Human genes 0.000 description 1
- 102100035416 Forkhead box protein O4 Human genes 0.000 description 1
- 241001251094 Formica Species 0.000 description 1
- 230000010190 G1 phase Effects 0.000 description 1
- 208000032612 Glial tumor Diseases 0.000 description 1
- 206010018338 Glioma Diseases 0.000 description 1
- 102100041003 Glutamate carboxypeptidase 2 Human genes 0.000 description 1
- 101710114810 Glycoprotein Proteins 0.000 description 1
- 206010018612 Gonorrhoea Diseases 0.000 description 1
- 241000282575 Gorilla Species 0.000 description 1
- 208000031886 HIV Infections Diseases 0.000 description 1
- 208000037357 HIV infectious disease Diseases 0.000 description 1
- 102000006354 HLA-DR Antigens Human genes 0.000 description 1
- 108010058597 HLA-DR Antigens Proteins 0.000 description 1
- 208000008913 Hantavirus Infections Diseases 0.000 description 1
- 102100034458 Hepatitis A virus cellular receptor 2 Human genes 0.000 description 1
- 108010034791 Heterochromatin Proteins 0.000 description 1
- 108010033040 Histones Proteins 0.000 description 1
- 101000783681 Homo sapiens 5'-AMP-activated protein kinase catalytic subunit alpha-2 Proteins 0.000 description 1
- 101000678236 Homo sapiens 5'-nucleotidase Proteins 0.000 description 1
- 101000884305 Homo sapiens B-cell receptor CD22 Proteins 0.000 description 1
- 101000980825 Homo sapiens B-lymphocyte antigen CD19 Proteins 0.000 description 1
- 101000884279 Homo sapiens CD276 antigen Proteins 0.000 description 1
- 101100005713 Homo sapiens CD4 gene Proteins 0.000 description 1
- 101000914321 Homo sapiens Carcinoembryonic antigen-related cell adhesion molecule 7 Proteins 0.000 description 1
- 101000761179 Homo sapiens Caspase recruitment domain-containing protein 11 Proteins 0.000 description 1
- 101000944380 Homo sapiens Cyclin-dependent kinase inhibitor 1 Proteins 0.000 description 1
- 101000945639 Homo sapiens Cyclin-dependent kinase inhibitor 3 Proteins 0.000 description 1
- 101000889276 Homo sapiens Cytotoxic T-lymphocyte protein 4 Proteins 0.000 description 1
- 101000872077 Homo sapiens Delta-like protein 4 Proteins 0.000 description 1
- 101100118549 Homo sapiens EGFR gene Proteins 0.000 description 1
- 101001012447 Homo sapiens Ectonucleoside triphosphate diphosphohydrolase 1 Proteins 0.000 description 1
- 101000877683 Homo sapiens Forkhead box protein O4 Proteins 0.000 description 1
- 101000892862 Homo sapiens Glutamate carboxypeptidase 2 Proteins 0.000 description 1
- 101001068133 Homo sapiens Hepatitis A virus cellular receptor 2 Proteins 0.000 description 1
- 101001057504 Homo sapiens Interferon-stimulated gene 20 kDa protein Proteins 0.000 description 1
- 101001055144 Homo sapiens Interleukin-2 receptor subunit alpha Proteins 0.000 description 1
- 101000998120 Homo sapiens Interleukin-3 receptor subunit alpha Proteins 0.000 description 1
- 101000917858 Homo sapiens Low affinity immunoglobulin gamma Fc region receptor III-A Proteins 0.000 description 1
- 101000972282 Homo sapiens Mucin-5AC Proteins 0.000 description 1
- 101000934338 Homo sapiens Myeloid cell surface antigen CD33 Proteins 0.000 description 1
- 101000589301 Homo sapiens Natural cytotoxicity triggering receptor 1 Proteins 0.000 description 1
- 101001098352 Homo sapiens OX-2 membrane glycoprotein Proteins 0.000 description 1
- 101000617725 Homo sapiens Pregnancy-specific beta-1-glycoprotein 2 Proteins 0.000 description 1
- 101100101727 Homo sapiens RAET1L gene Proteins 0.000 description 1
- 101001012157 Homo sapiens Receptor tyrosine-protein kinase erbB-2 Proteins 0.000 description 1
- 101001132524 Homo sapiens Retinoic acid early transcript 1E Proteins 0.000 description 1
- 101000719024 Homo sapiens Ribosome-releasing factor 2, mitochondrial Proteins 0.000 description 1
- 101000831007 Homo sapiens T-cell immunoreceptor with Ig and ITIM domains Proteins 0.000 description 1
- 101000851376 Homo sapiens Tumor necrosis factor receptor superfamily member 8 Proteins 0.000 description 1
- 101001052849 Homo sapiens Tyrosine-protein kinase Fer Proteins 0.000 description 1
- 101000606129 Homo sapiens Tyrosine-protein kinase receptor TYRO3 Proteins 0.000 description 1
- 101000807561 Homo sapiens Tyrosine-protein kinase receptor UFO Proteins 0.000 description 1
- 101000607316 Homo sapiens UL-16 binding protein 5 Proteins 0.000 description 1
- 101000607306 Homo sapiens UL16-binding protein 1 Proteins 0.000 description 1
- 101000607318 Homo sapiens UL16-binding protein 3 Proteins 0.000 description 1
- 241000713772 Human immunodeficiency virus 1 Species 0.000 description 1
- 241000282620 Hylobates sp. Species 0.000 description 1
- 208000013016 Hypoglycemia Diseases 0.000 description 1
- 229930010555 Inosine Natural products 0.000 description 1
- UGQMRVRMYYASKQ-KQYNXXCUSA-N Inosine Chemical compound O[C@@H]1[C@H](O)[C@@H](CO)O[C@H]1N1C2=NC=NC(O)=C2N=C1 UGQMRVRMYYASKQ-KQYNXXCUSA-N 0.000 description 1
- 102000004877 Insulin Human genes 0.000 description 1
- 108090001061 Insulin Proteins 0.000 description 1
- 206010022489 Insulin Resistance Diseases 0.000 description 1
- 102100037850 Interferon gamma Human genes 0.000 description 1
- 108010074328 Interferon-gamma Proteins 0.000 description 1
- 102100027268 Interferon-stimulated gene 20 kDa protein Human genes 0.000 description 1
- 108010072621 Interleukin-1 Receptor-Associated Kinases Proteins 0.000 description 1
- 102100036342 Interleukin-1 receptor-associated kinase 1 Human genes 0.000 description 1
- 108050003558 Interleukin-17 Proteins 0.000 description 1
- 102000013691 Interleukin-17 Human genes 0.000 description 1
- 102000003810 Interleukin-18 Human genes 0.000 description 1
- 108090000171 Interleukin-18 Proteins 0.000 description 1
- 102100033493 Interleukin-3 receptor subunit alpha Human genes 0.000 description 1
- 108090000978 Interleukin-4 Proteins 0.000 description 1
- 102000004388 Interleukin-4 Human genes 0.000 description 1
- 102100037792 Interleukin-6 receptor subunit alpha Human genes 0.000 description 1
- 102000000704 Interleukin-7 Human genes 0.000 description 1
- 108010002586 Interleukin-7 Proteins 0.000 description 1
- 108020003285 Isocitrate lyase Proteins 0.000 description 1
- QIVBCDIJIAJPQS-VIFPVBQESA-N L-tryptophane Chemical compound C1=CC=C2C(C[C@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-VIFPVBQESA-N 0.000 description 1
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 description 1
- 102100026517 Lamin-B1 Human genes 0.000 description 1
- 208000004023 Legionellosis Diseases 0.000 description 1
- 241000713666 Lentivirus Species 0.000 description 1
- 206010024229 Leprosy Diseases 0.000 description 1
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 1
- LTXREWYXXSTFRX-QGZVFWFLSA-N Linagliptin Chemical compound N=1C=2N(C)C(=O)N(CC=3N=C4C=CC=CC4=C(C)N=3)C(=O)C=2N(CC#CC)C=1N1CCC[C@@H](N)C1 LTXREWYXXSTFRX-QGZVFWFLSA-N 0.000 description 1
- 206010024641 Listeriosis Diseases 0.000 description 1
- 102100029193 Low affinity immunoglobulin gamma Fc region receptor III-A Human genes 0.000 description 1
- 208000016604 Lyme disease Diseases 0.000 description 1
- 239000004472 Lysine Substances 0.000 description 1
- 102100030301 MHC class I polypeptide-related sequence A Human genes 0.000 description 1
- 102000002274 Matrix Metalloproteinases Human genes 0.000 description 1
- 108010000684 Matrix Metalloproteinases Proteins 0.000 description 1
- 108010015302 Matrix metalloproteinase-9 Proteins 0.000 description 1
- 102100030412 Matrix metalloproteinase-9 Human genes 0.000 description 1
- 201000005505 Measles Diseases 0.000 description 1
- 206010027476 Metastases Diseases 0.000 description 1
- 102100022496 Mucin-5AC Human genes 0.000 description 1
- 241001529936 Murinae Species 0.000 description 1
- 101100193649 Mus musculus Ager gene Proteins 0.000 description 1
- 102100025243 Myeloid cell surface antigen CD33 Human genes 0.000 description 1
- BAWFJGJZGIEFAR-NNYOXOHSSA-O NAD(+) Chemical compound NC(=O)C1=CC=C[N+]([C@H]2[C@@H]([C@H](O)[C@@H](COP(O)(=O)OP(O)(=O)OC[C@@H]3[C@H]([C@@H](O)[C@@H](O3)N3C4=NC=NC(N)=C4N=C3)O)O2)O)=C1 BAWFJGJZGIEFAR-NNYOXOHSSA-O 0.000 description 1
- 108010004217 Natural Cytotoxicity Triggering Receptor 1 Proteins 0.000 description 1
- 108010004222 Natural Cytotoxicity Triggering Receptor 3 Proteins 0.000 description 1
- 102100032870 Natural cytotoxicity triggering receptor 1 Human genes 0.000 description 1
- 102100032852 Natural cytotoxicity triggering receptor 3 Human genes 0.000 description 1
- 108091005461 Nucleic proteins Proteins 0.000 description 1
- 102100037589 OX-2 membrane glycoprotein Human genes 0.000 description 1
- 208000008589 Obesity Diseases 0.000 description 1
- 108700020796 Oncogene Proteins 0.000 description 1
- 241000282577 Pan troglodytes Species 0.000 description 1
- 241001504519 Papio ursinus Species 0.000 description 1
- 201000005702 Pertussis Diseases 0.000 description 1
- 108091000080 Phosphotransferase Proteins 0.000 description 1
- 102000013566 Plasminogen Human genes 0.000 description 1
- 108010051456 Plasminogen Proteins 0.000 description 1
- 208000035109 Pneumococcal Infections Diseases 0.000 description 1
- 241000282405 Pongo abelii Species 0.000 description 1
- 101710089372 Programmed cell death protein 1 Proteins 0.000 description 1
- 108010076181 Proinsulin Proteins 0.000 description 1
- 102000002020 Protease-activated receptors Human genes 0.000 description 1
- 108050009310 Protease-activated receptors Proteins 0.000 description 1
- 229940096437 Protein S Drugs 0.000 description 1
- 102000029301 Protein S Human genes 0.000 description 1
- 101710149951 Protein Tat Proteins 0.000 description 1
- 102100030086 Receptor tyrosine-protein kinase erbB-2 Human genes 0.000 description 1
- 102100029986 Receptor tyrosine-protein kinase erbB-3 Human genes 0.000 description 1
- 101710100969 Receptor tyrosine-protein kinase erbB-3 Proteins 0.000 description 1
- 108050002653 Retinoblastoma protein Proteins 0.000 description 1
- 102100033964 Retinoic acid early transcript 1E Human genes 0.000 description 1
- 102100025784 Ribosome-releasing factor 2, mitochondrial Human genes 0.000 description 1
- 241000283984 Rodentia Species 0.000 description 1
- 102000044437 S1 domains Human genes 0.000 description 1
- 108700036684 S1 domains Proteins 0.000 description 1
- 101100123851 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) HER1 gene Proteins 0.000 description 1
- 206010039438 Salmonella Infections Diseases 0.000 description 1
- 206010039509 Scab Diseases 0.000 description 1
- 238000012300 Sequence Analysis Methods 0.000 description 1
- 102000012479 Serine Proteases Human genes 0.000 description 1
- 108010022999 Serine Proteases Proteins 0.000 description 1
- 101710167605 Spike glycoprotein Proteins 0.000 description 1
- 101710198474 Spike protein Proteins 0.000 description 1
- 108010023197 Streptokinase Proteins 0.000 description 1
- ZSJLQEPLLKMAKR-UHFFFAOYSA-N Streptozotocin Natural products O=NN(C)C(=O)NC1C(O)OC(CO)C(O)C1O ZSJLQEPLLKMAKR-UHFFFAOYSA-N 0.000 description 1
- 102100030416 Stromelysin-1 Human genes 0.000 description 1
- 101710108790 Stromelysin-1 Proteins 0.000 description 1
- 101100226845 Strongylocentrotus purpuratus EGF2 gene Proteins 0.000 description 1
- 230000020385 T cell costimulation Effects 0.000 description 1
- 102100024834 T-cell immunoreceptor with Ig and ITIM domains Human genes 0.000 description 1
- 101150057140 TACSTD1 gene Proteins 0.000 description 1
- 108091005735 TGF-beta receptors Proteins 0.000 description 1
- 206010043376 Tetanus Diseases 0.000 description 1
- 210000000447 Th1 cell Anatomy 0.000 description 1
- 210000000068 Th17 cell Anatomy 0.000 description 1
- 210000004241 Th2 cell Anatomy 0.000 description 1
- 102000004887 Transforming Growth Factor beta Human genes 0.000 description 1
- 108090001012 Transforming Growth Factor beta Proteins 0.000 description 1
- 102000016715 Transforming Growth Factor beta Receptors Human genes 0.000 description 1
- QIVBCDIJIAJPQS-UHFFFAOYSA-N Tryptophan Natural products C1=CC=C2C(CC(N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-UHFFFAOYSA-N 0.000 description 1
- 108060008682 Tumor Necrosis Factor Proteins 0.000 description 1
- 102000000852 Tumor Necrosis Factor-alpha Human genes 0.000 description 1
- 102100036857 Tumor necrosis factor receptor superfamily member 8 Human genes 0.000 description 1
- 101710102803 Tumor suppressor ARF Proteins 0.000 description 1
- 102100024537 Tyrosine-protein kinase Fer Human genes 0.000 description 1
- 102100039127 Tyrosine-protein kinase receptor TYRO3 Human genes 0.000 description 1
- 102100037236 Tyrosine-protein kinase receptor UFO Human genes 0.000 description 1
- 102100040010 UL-16 binding protein 5 Human genes 0.000 description 1
- 101150042088 UL16 gene Proteins 0.000 description 1
- 102100040012 UL16-binding protein 1 Human genes 0.000 description 1
- 102100040011 UL16-binding protein 3 Human genes 0.000 description 1
- 102100040013 UL16-binding protein 6 Human genes 0.000 description 1
- 241000700647 Variola virus Species 0.000 description 1
- 102000005789 Vascular Endothelial Growth Factors Human genes 0.000 description 1
- 108010019530 Vascular Endothelial Growth Factors Proteins 0.000 description 1
- 208000028227 Viral hemorrhagic fever Diseases 0.000 description 1
- 241000700605 Viruses Species 0.000 description 1
- 206010052428 Wound Diseases 0.000 description 1
- 208000001455 Zika Virus Infection Diseases 0.000 description 1
- 201000004296 Zika fever Diseases 0.000 description 1
- 208000035332 Zika virus disease Diseases 0.000 description 1
- 208000020329 Zika virus infectious disease Diseases 0.000 description 1
- 230000001594 aberrant effect Effects 0.000 description 1
- 230000001154 acute effect Effects 0.000 description 1
- 125000003295 alanine group Chemical group N[C@@H](C)C(=O)* 0.000 description 1
- 238000012867 alanine scanning Methods 0.000 description 1
- 230000003281 allosteric effect Effects 0.000 description 1
- 230000008841 allosteric interaction Effects 0.000 description 1
- 229960001667 alogliptin Drugs 0.000 description 1
- ZSBOMTDTBDDKMP-OAHLLOKOSA-N alogliptin Chemical compound C=1C=CC=C(C#N)C=1CN1C(=O)N(C)C(=O)C=C1N1CCC[C@@H](N)C1 ZSBOMTDTBDDKMP-OAHLLOKOSA-N 0.000 description 1
- 208000006730 anaplasmosis Diseases 0.000 description 1
- 238000004873 anchoring Methods 0.000 description 1
- 238000010171 animal model Methods 0.000 description 1
- 230000002424 anti-apoptotic effect Effects 0.000 description 1
- 229940127003 anti-diabetic drug Drugs 0.000 description 1
- 239000003472 antidiabetic agent Substances 0.000 description 1
- 239000002246 antineoplastic agent Substances 0.000 description 1
- 238000013459 approach Methods 0.000 description 1
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 1
- 235000003704 aspartic acid Nutrition 0.000 description 1
- 230000008003 autocrine effect Effects 0.000 description 1
- 201000008680 babesiosis Diseases 0.000 description 1
- 230000008901 benefit Effects 0.000 description 1
- 108010005774 beta-Galactosidase Proteins 0.000 description 1
- OQFSQFPPLPISGP-UHFFFAOYSA-N beta-carboxyaspartic acid Natural products OC(=O)C(N)C(C(O)=O)C(O)=O OQFSQFPPLPISGP-UHFFFAOYSA-N 0.000 description 1
- 238000012575 bio-layer interferometry Methods 0.000 description 1
- 230000033228 biological regulation Effects 0.000 description 1
- 230000023555 blood coagulation Effects 0.000 description 1
- 201000004927 campylobacteriosis Diseases 0.000 description 1
- 230000036952 cancer formation Effects 0.000 description 1
- UHBYWPGGCSDKFX-UHFFFAOYSA-N carboxyglutamic acid Chemical group OC(=O)C(N)CC(C(O)=O)C(O)=O UHBYWPGGCSDKFX-UHFFFAOYSA-N 0.000 description 1
- 150000007942 carboxylates Chemical class 0.000 description 1
- 231100000504 carcinogenesis Toxicity 0.000 description 1
- 230000001364 causal effect Effects 0.000 description 1
- 230000000453 cell autonomous effect Effects 0.000 description 1
- 230000025084 cell cycle arrest Effects 0.000 description 1
- 230000006369 cell cycle progression Effects 0.000 description 1
- 230000006727 cell loss Effects 0.000 description 1
- 239000002771 cell marker Substances 0.000 description 1
- 239000002975 chemoattractant Substances 0.000 description 1
- 230000035605 chemotaxis Effects 0.000 description 1
- 230000012085 chronic inflammatory response Effects 0.000 description 1
- 201000006901 congenital syphilis Diseases 0.000 description 1
- 239000002875 cyclin dependent kinase inhibitor Substances 0.000 description 1
- 229940043378 cyclin-dependent kinase inhibitor Drugs 0.000 description 1
- 230000001461 cytolytic effect Effects 0.000 description 1
- 210000005220 cytoplasmic tail Anatomy 0.000 description 1
- 229940127089 cytotoxic agent Drugs 0.000 description 1
- 230000034994 death Effects 0.000 description 1
- 238000012217 deletion Methods 0.000 description 1
- 230000037430 deletion Effects 0.000 description 1
- 210000004443 dendritic cell Anatomy 0.000 description 1
- 208000025729 dengue disease Diseases 0.000 description 1
- 230000008021 deposition Effects 0.000 description 1
- 238000013461 design Methods 0.000 description 1
- 238000001514 detection method Methods 0.000 description 1
- 206010013023 diphtheria Diseases 0.000 description 1
- LOKCTEFSRHRXRJ-UHFFFAOYSA-I dipotassium trisodium dihydrogen phosphate hydrogen phosphate dichloride Chemical compound P(=O)(O)(O)[O-].[K+].P(=O)(O)([O-])[O-].[Na+].[Na+].[Cl-].[K+].[Cl-].[Na+] LOKCTEFSRHRXRJ-UHFFFAOYSA-I 0.000 description 1
- 229940042399 direct acting antivirals protease inhibitors Drugs 0.000 description 1
- 231100000673 dose–response relationship Toxicity 0.000 description 1
- 230000003828 downregulation Effects 0.000 description 1
- 238000007876 drug discovery Methods 0.000 description 1
- 230000004064 dysfunction Effects 0.000 description 1
- 230000005014 ectopic expression Effects 0.000 description 1
- 208000000292 ehrlichiosis Diseases 0.000 description 1
- 210000005168 endometrial cell Anatomy 0.000 description 1
- 210000004696 endometrium Anatomy 0.000 description 1
- 238000005516 engineering process Methods 0.000 description 1
- 102000052116 epidermal growth factor receptor activity proteins Human genes 0.000 description 1
- 108700015053 epidermal growth factor receptor activity proteins Proteins 0.000 description 1
- 229940012414 factor viia Drugs 0.000 description 1
- 238000000684 flow cytometry Methods 0.000 description 1
- UHBYWPGGCSDKFX-VKHMYHEASA-N gamma-carboxy-L-glutamic acid Chemical compound OC(=O)[C@@H](N)CC(C(O)=O)C(O)=O UHBYWPGGCSDKFX-VKHMYHEASA-N 0.000 description 1
- 231100000024 genotoxic Toxicity 0.000 description 1
- 230000001738 genotoxic effect Effects 0.000 description 1
- 125000003712 glycosamine group Chemical group 0.000 description 1
- 125000003630 glycyl group Chemical group [H]N([H])C([H])([H])C(*)=O 0.000 description 1
- 208000001786 gonorrhea Diseases 0.000 description 1
- 239000003102 growth factor Substances 0.000 description 1
- 230000010005 growth-factor like effect Effects 0.000 description 1
- 208000029629 hantavirus infectious disease Diseases 0.000 description 1
- 230000035876 healing Effects 0.000 description 1
- 230000036541 health Effects 0.000 description 1
- 210000002443 helper t lymphocyte Anatomy 0.000 description 1
- 201000005787 hematologic cancer Diseases 0.000 description 1
- 208000024200 hematopoietic and lymphoid system neoplasm Diseases 0.000 description 1
- 230000023597 hemostasis Effects 0.000 description 1
- 208000006454 hepatitis Diseases 0.000 description 1
- 231100000283 hepatitis Toxicity 0.000 description 1
- 210000004458 heterochromatin Anatomy 0.000 description 1
- 230000013632 homeostatic process Effects 0.000 description 1
- 102000043395 human ADA Human genes 0.000 description 1
- 210000005260 human cell Anatomy 0.000 description 1
- 208000033519 human immunodeficiency virus infectious disease Diseases 0.000 description 1
- 230000007062 hydrolysis Effects 0.000 description 1
- 238000006460 hydrolysis reaction Methods 0.000 description 1
- 230000002209 hydrophobic effect Effects 0.000 description 1
- 201000001421 hyperglycemia Diseases 0.000 description 1
- 230000002218 hypoglycaemic effect Effects 0.000 description 1
- 230000009848 hypophosphorylation Effects 0.000 description 1
- 230000007124 immune defense Effects 0.000 description 1
- 230000037451 immune surveillance Effects 0.000 description 1
- 230000002998 immunogenetic effect Effects 0.000 description 1
- 229940072221 immunoglobulins Drugs 0.000 description 1
- 210000000428 immunological synapse Anatomy 0.000 description 1
- 230000008274 immunosurveillance mechanism Effects 0.000 description 1
- 238000000338 in vitro Methods 0.000 description 1
- 239000000411 inducer Substances 0.000 description 1
- 230000004968 inflammatory condition Effects 0.000 description 1
- 230000002401 inhibitory effect Effects 0.000 description 1
- 230000005764 inhibitory process Effects 0.000 description 1
- 229960003786 inosine Drugs 0.000 description 1
- 229940125396 insulin Drugs 0.000 description 1
- 230000002452 interceptive effect Effects 0.000 description 1
- 230000014828 interferon-gamma production Effects 0.000 description 1
- 102000002467 interleukin receptors Human genes 0.000 description 1
- 108010093036 interleukin receptors Proteins 0.000 description 1
- 108040006732 interleukin-1 receptor activity proteins Proteins 0.000 description 1
- 102000014909 interleukin-1 receptor activity proteins Human genes 0.000 description 1
- 230000031261 interleukin-10 production Effects 0.000 description 1
- 108010074108 interleukin-21 Proteins 0.000 description 1
- 108040006858 interleukin-6 receptor activity proteins Proteins 0.000 description 1
- 238000007918 intramuscular administration Methods 0.000 description 1
- 230000002601 intratumoral effect Effects 0.000 description 1
- 238000001990 intravenous administration Methods 0.000 description 1
- 230000002427 irreversible effect Effects 0.000 description 1
- 210000004153 islets of langerhan Anatomy 0.000 description 1
- AGPKZVBTJJNPAG-UHFFFAOYSA-N isoleucine Natural products CCC(C)C(N)C(O)=O AGPKZVBTJJNPAG-UHFFFAOYSA-N 0.000 description 1
- 229960000310 isoleucine Drugs 0.000 description 1
- 230000002147 killing effect Effects 0.000 description 1
- 108010052263 lamin B1 Proteins 0.000 description 1
- 229960002397 linagliptin Drugs 0.000 description 1
- 230000002132 lysosomal effect Effects 0.000 description 1
- 201000004792 malaria Diseases 0.000 description 1
- 230000036210 malignancy Effects 0.000 description 1
- 208000006178 malignant mesothelioma Diseases 0.000 description 1
- 201000005282 malignant pleural mesothelioma Diseases 0.000 description 1
- 239000003550 marker Substances 0.000 description 1
- 241001515942 marmosets Species 0.000 description 1
- 238000004949 mass spectrometry Methods 0.000 description 1
- 208000037941 meningococcal disease Diseases 0.000 description 1
- 230000004060 metabolic process Effects 0.000 description 1
- 230000009401 metastasis Effects 0.000 description 1
- 239000010445 mica Substances 0.000 description 1
- 229910052618 mica group Inorganic materials 0.000 description 1
- 210000001616 monocyte Anatomy 0.000 description 1
- YOHYSYJDKVYCJI-UHFFFAOYSA-N n-[3-[[6-[3-(trifluoromethyl)anilino]pyrimidin-4-yl]amino]phenyl]cyclopropanecarboxamide Chemical compound FC(F)(F)C1=CC=CC(NC=2N=CN=C(NC=3C=C(NC(=O)C4CC4)C=CC=3)C=2)=C1 YOHYSYJDKVYCJI-UHFFFAOYSA-N 0.000 description 1
- 230000031942 natural killer cell mediated cytotoxicity Effects 0.000 description 1
- 239000013642 negative control Substances 0.000 description 1
- 230000025020 negative regulation of T cell proliferation Effects 0.000 description 1
- 210000000440 neutrophil Anatomy 0.000 description 1
- 229930027945 nicotinamide-adenine dinucleotide Natural products 0.000 description 1
- BOPGDPNILDQYTO-NNYOXOHSSA-N nicotinamide-adenine dinucleotide Chemical compound C1=CCC(C(=O)N)=CN1[C@H]1[C@H](O)[C@H](O)[C@@H](COP(O)(=O)OP(O)(=O)OC[C@@H]2[C@H]([C@@H](O)[C@@H](O2)N2C3=NC=NC(N)=C3N=C2)O)O1 BOPGDPNILDQYTO-NNYOXOHSSA-N 0.000 description 1
- 235000020824 obesity Nutrition 0.000 description 1
- 230000005853 oncogenic activation Effects 0.000 description 1
- 238000011275 oncology therapy Methods 0.000 description 1
- 230000008520 organization Effects 0.000 description 1
- 210000001672 ovary Anatomy 0.000 description 1
- 230000001590 oxidative effect Effects 0.000 description 1
- 238000012856 packing Methods 0.000 description 1
- 230000026792 palmitoylation Effects 0.000 description 1
- 230000003076 paracrine Effects 0.000 description 1
- 239000000137 peptide hydrolase inhibitor Substances 0.000 description 1
- 230000002093 peripheral effect Effects 0.000 description 1
- 230000002085 persistent effect Effects 0.000 description 1
- COLNVLDHVKWLRT-UHFFFAOYSA-N phenylalanine Natural products OC(=O)C(N)CC1=CC=CC=C1 COLNVLDHVKWLRT-UHFFFAOYSA-N 0.000 description 1
- 239000002953 phosphate buffered saline Substances 0.000 description 1
- 102000020233 phosphotransferase Human genes 0.000 description 1
- 230000001766 physiological effect Effects 0.000 description 1
- 230000010287 polarization Effects 0.000 description 1
- 229920001481 poly(stearyl methacrylate) Polymers 0.000 description 1
- 239000013641 positive control Substances 0.000 description 1
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 1
- 230000002035 prolonged effect Effects 0.000 description 1
- 125000001500 prolyl group Chemical group [H]N1C([H])(C(=O)[*])C([H])([H])C([H])([H])C1([H])[H] 0.000 description 1
- 230000017854 proteolysis Effects 0.000 description 1
- 230000006337 proteolytic cleavage Effects 0.000 description 1
- 230000009467 reduction Effects 0.000 description 1
- 238000011069 regeneration method Methods 0.000 description 1
- 238000007634 remodeling Methods 0.000 description 1
- 238000011160 research Methods 0.000 description 1
- 230000000241 respiratory effect Effects 0.000 description 1
- 230000028617 response to DNA damage stimulus Effects 0.000 description 1
- 230000003938 response to stress Effects 0.000 description 1
- 238000012552 review Methods 0.000 description 1
- 201000005404 rubella Diseases 0.000 description 1
- 206010039447 salmonellosis Diseases 0.000 description 1
- 229960004937 saxagliptin Drugs 0.000 description 1
- 108010033693 saxagliptin Proteins 0.000 description 1
- QGJUIPDUBHWZPV-SGTAVMJGSA-N saxagliptin Chemical compound C1C(C2)CC(C3)CC2(O)CC13[C@H](N)C(=O)N1[C@H](C#N)C[C@@H]2C[C@@H]21 QGJUIPDUBHWZPV-SGTAVMJGSA-N 0.000 description 1
- 102000014452 scavenger receptors Human genes 0.000 description 1
- 108010078070 scavenger receptors Proteins 0.000 description 1
- 230000009327 senolytic effect Effects 0.000 description 1
- 238000012163 sequencing technique Methods 0.000 description 1
- 230000009919 sequestration Effects 0.000 description 1
- 238000013207 serial dilution Methods 0.000 description 1
- 125000003607 serino group Chemical group [H]N([H])[C@]([H])(C(=O)[*])C(O[H])([H])[H] 0.000 description 1
- 230000019491 signal transduction Effects 0.000 description 1
- 210000001057 smooth muscle myoblast Anatomy 0.000 description 1
- 210000004988 splenocyte Anatomy 0.000 description 1
- 238000010186 staining Methods 0.000 description 1
- 230000004936 stimulating effect Effects 0.000 description 1
- 230000000638 stimulation Effects 0.000 description 1
- 229960005202 streptokinase Drugs 0.000 description 1
- ZSJLQEPLLKMAKR-GKHCUFPYSA-N streptozocin Chemical compound O=NN(C)C(=O)N[C@H]1[C@@H](O)O[C@H](CO)[C@@H](O)[C@@H]1O ZSJLQEPLLKMAKR-GKHCUFPYSA-N 0.000 description 1
- 229960001052 streptozocin Drugs 0.000 description 1
- 230000035882 stress Effects 0.000 description 1
- 238000007920 subcutaneous administration Methods 0.000 description 1
- 230000008685 targeting Effects 0.000 description 1
- 108091035539 telomere Proteins 0.000 description 1
- 102000055501 telomere Human genes 0.000 description 1
- 210000003411 telomere Anatomy 0.000 description 1
- 238000012360 testing method Methods 0.000 description 1
- ZRKFYGHZFMAOKI-QMGMOQQFSA-N tgfbeta Chemical compound C([C@H](NC(=O)[C@H](C(C)C)NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CC(C)C)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](N)CCSC)C(C)C)[C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](C)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(=O)N1[C@@H](CCC1)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(O)=O)C1=CC=C(O)C=C1 ZRKFYGHZFMAOKI-QMGMOQQFSA-N 0.000 description 1
- 230000001225 therapeutic effect Effects 0.000 description 1
- 230000030968 tissue homeostasis Effects 0.000 description 1
- 101150062121 tollip gene Proteins 0.000 description 1
- 238000013518 transcription Methods 0.000 description 1
- 230000035897 transcription Effects 0.000 description 1
- 230000009466 transformation Effects 0.000 description 1
- 238000012301 transgenic model Methods 0.000 description 1
- 230000001052 transient effect Effects 0.000 description 1
- 238000013519 translation Methods 0.000 description 1
- 230000014616 translation Effects 0.000 description 1
- 102000035160 transmembrane proteins Human genes 0.000 description 1
- 108091005703 transmembrane proteins Proteins 0.000 description 1
- 201000008827 tuberculosis Diseases 0.000 description 1
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 1
- 241001430294 unidentified retrovirus Species 0.000 description 1
- 239000004474 valine Substances 0.000 description 1
- 229960001254 vildagliptin Drugs 0.000 description 1
- SYOKIDBDQMKNDQ-XWTIBIIYSA-N vildagliptin Chemical compound C1C(O)(C2)CC(C3)CC1CC32NCC(=O)N1CCC[C@H]1C#N SYOKIDBDQMKNDQ-XWTIBIIYSA-N 0.000 description 1
- 230000007501 viral attachment Effects 0.000 description 1
- 239000013603 viral vector Substances 0.000 description 1
- 230000003612 virological effect Effects 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2896—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against molecules with a "CD"-designation, not provided for elsewhere
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K35/00—Medicinal preparations containing materials or reaction products thereof with undetermined constitution
- A61K35/12—Materials from mammals; Compositions comprising non-specified tissues or cells; Compositions comprising non-embryonic stem cells; Genetically modified cells
- A61K35/14—Blood; Artificial blood
- A61K35/17—Lymphocytes; B-cells; T-cells; Natural killer cells; Interferon-activated or cytokine-activated lymphocytes
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/177—Receptors; Cell surface antigens; Cell surface determinants
- A61K38/1774—Immunoglobulin superfamily (e.g. CD2, CD4, CD8, ICAM molecules, B7 molecules, Fc-receptors, MHC-molecules)
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0011—Cancer antigens
- A61K39/001154—Enzymes
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K45/00—Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
- A61K45/06—Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/40—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against enzymes
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/21—Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
- C07K2317/62—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
- C07K2317/622—Single chain antibody (scFv)
Definitions
- BACKGROUND CD26 (DPP4, also known as Dipeptidyl-peptidase-4, DDP4) is a transmembrane glycoprotein, anchored to the membrane by its signal peptide, that forms a homodimer or tetramer on the plasma membrane.
- CD26 is an amino peptidase that primarily cleaves N- terminal dipeptides from peptides or small proteins (e.g., below 80-100 amino acid residues) with proline or alanine as the penultimate amino acid.
- CD26 is expressed in numerous tissues including intestinal and renal brush border membranes, vascular endothelium, liver and pancreas, glandular epithelial cells, and by cells of the immune system (Gutschmidt et al., Histochemistry 73(2):285-304, 1982; Gorrell et al., Cell. Immunol.134(1):205-215, 1991; Tanaka et al., J. Immunol.
- CD26 was also found to function as a binding site for the chemokine CXCR4 receptor, the T-cell differentiation antigen CD45, and the sodium- hydrogen exchanger-3 (Mentlein et al., Regul.
- CD26 can be viewed as a multi- functional protein with a variety of actions which go beyond its role as a proteinase. Its role as a receptor or ligand for a variety of different molecules, either alone or in combination with its enzymatic activity, enable it to affect physiological processes such as the interaction between cells and the extracellular matrix involved in cell migration, activation, and proliferation. CD26 also plays a major role in glucose metabolism.
- Incretin peptides such as gastric inhibitory polypeptide (GIP) and glucagon-like peptide (GLP-1) are responsible for the modulation of postprandial blood glucose by promoting insulin secretion from pancreatic ⁇ cells and via glucagon static effects. These peptides are rapidly inactivated by CD26 resulting in a short half-life. Besides incretin peptides, CD26 also cleaves a number of other proteins.
- the physiologic targets include GLP1, GLP2, brain natriuretic peptide, peptide YY, stromal-cell-derived factor, erythropoietin, granulocyte colony- stimulating factor, and substance P.
- Pharmacological targets include gastric-releasing peptide, growth-hormone-releasing factor, macrophage derived chemokine, eotaxin, IFN- ⁇ -induced protein-10, granulocyte-macrophage colony-stimulating factor, erythropoietin, IL-3, neuropeptide Y, B-type natriuretic peptide, and peptide YY (Mulvihill et al., Endocr. Rev.35(6):992-1019, 2014).
- CD26 is known to modulate the functionality of chemokines, such as CXCR3, through post-translational cleavage of X- Pro or X-Ala motifs, which leads to amino-terminal dipeptide truncation of chemokines and altered biological functions (Broxmeyer et al., Stem Cells Dev.25(8):575-585, 2016).
- CD26 also mediates amino-terminal cleavage of the chemokine CXCL10, limiting the migration of CXCR3 natural killer (NK) and T cells and diminution of anti-tumor immunity in preclinical models of melanoma and colorectal carcinoma (Barreira et al., Nat. Immunol.16(8):850-858, 2015).
- CD26 exerts its physiological roles either via its enzymatic activity by regulating many peptides or via its interactions with a variety of binding partners. Consequently, altered expression, and/or activity of CD26 have been implicated in several pathological processes, including inflammation, viral infection, immune-mediated diseases, tumor growth, cellular senescence, and metabolic diseases (Mentlein et al., Regul.
- CD26 is a cell-surface targetable protein for drug development to treat a variety of diseases including viral infections and aging-related pathologies SUMMARY
- the anti-CD26 antigen-binding domain comprises: (a) a heavy chain variable domain comprising a CDR1 comprising SEQ ID NO: 1, a CDR2 comprising SEQ ID NO: 2, and a CDR3 comprising SEQ ID NO: 3, and a light chain variable domain comprising a CDR1 comprising SEQ ID NO: 4, a CDR2 comprising SEQ ID NO: 5, and a CDR3 comprising SEQ ID NO: 6; (b) a heavy chain variable domain comprising a CDR1 comprising SEQ ID NO: 7, a CDR2 comprising SEQ ID NO: 8, and a CDR3 comprising SEQ ID NO: 9, and a light chain variable domain comprising a CDR1 comprising SEQ ID NO: 10, a CDR2 comprising S
- the antigen-binding domain comprises a heavy chain variable domain comprising a CDR1 comprising SEQ ID NO: 1, a CDR2 comprising SEQ ID NO: 2, and a CDR3 comprising SEQ ID NO: 3, and a light chain variable domain comprising a CDR1 comprising SEQ ID NO: 4, a CDR2 comprising SEQ ID NO: 5, and a CDR3 comprising SEQ ID NO: 6.
- the heavy chain variable domain comprises a sequence that is at least 80% identical to SEQ ID NO: 61. In some embodiments, the heavy chain variable domain comprises a sequence that is at least 90% identical to SEQ ID NO: 61.
- the heavy chain variable domain comprises a sequence that is at least 95% identical to SEQ ID NO: 61. In some embodiments, the light chain variable domain comprises a sequence that is at least 80% identical to SEQ ID NO: 62. In some embodiments, the light chain variable domain comprises a sequence that is at least 90% identical to SEQ ID NO: 62. In some embodiments, the light chain variable domain comprises a sequence that is at least 95% identical to SEQ ID NO: 62.
- the antigen-binding domain comprises a heavy chain variable domain comprising a CDR1 comprising SEQ ID NO: 7, a CDR2 comprising SEQ ID NO: 8, and a CDR3 comprising SEQ ID NO: 9, and a light chain variable domain comprising a CDR1 comprising SEQ ID NO: 10, a CDR2 comprising SEQ ID NO: 11, and a CDR3 comprising SEQ ID NO: 12.
- the heavy chain variable domain comprises a sequence that is at least 80% identical to SEQ ID NO: 63. In some embodiments, the heavy chain variable domain comprises a sequence that is at least 90% identical to SEQ ID NO: 63.
- the heavy chain variable domain comprises a sequence that is at least 95% identical to SEQ ID NO: 63. In some embodiments, the light chain variable domain comprises a sequence that is at least 80% identical to SEQ ID NO: 64. In some embodiments, the light chain variable domain comprises a sequence that is at least 90% identical to SEQ ID NO: 64. In some embodiments, the light chain variable domain comprises a sequence that is at least 95% identical to SEQ ID NO: 64.
- the antigen-binding domain comprises a heavy chain variable domain comprising a CDR1 comprising SEQ ID NO: 13, a CDR2 comprising SEQ ID NO: 14, and a CDR3 comprising SEQ ID NO: 15, and a light chain variable domain comprising a CDR1 comprising SEQ ID NO: 16, a CDR2 comprising SEQ ID NO: 17, and a CDR3 comprising SEQ ID NO: 18.
- the heavy chain variable domain comprises a sequence that is at least 80% identical to SEQ ID NO: 65. In some embodiments, the heavy chain variable domain comprises a sequence that is at least 90% identical to SEQ ID NO: 65.
- the heavy chain variable domain comprises a sequence that is at least 95% identical to SEQ ID NO: 65. In some embodiments, the light chain variable domain comprises a sequence that is at least 80% identical to SEQ ID NO: 66. In some embodiments, the light chain variable domain comprises a sequence that is at least 90% identical to SEQ ID NO: 66. In some embodiments, the light chain variable domain comprises a sequence that is at least 95% identical to SEQ ID NO: 66.
- the antigen-binding domain comprises a heavy chain variable domain comprising a CDR1 comprising SEQ ID NO: 19, a CDR2 comprising SEQ ID NO: 20, and a CDR3 comprising SEQ ID NO: 21, and a light chain variable domain comprising a CDR1 comprising SEQ ID NO: 22, a CDR2 comprising SEQ ID NO: 23, and a CDR3 comprising SEQ ID NO: 24.
- the heavy chain variable domain comprises a sequence that is at least 80% identical to SEQ ID NO: 67. In some embodiments, the heavy chain variable domain comprises a sequence that is at least 90% identical to SEQ ID NO: 67.
- the heavy chain variable domain comprises a sequence that is at least 95% identical to SEQ ID NO: 67. In some embodiments, the light chain variable domain comprises a sequence that is at least 80% identical to SEQ ID NO: 68. In some embodiments, the light chain variable domain comprises a sequence that is at least 90% identical to SEQ ID NO: 68. In some embodiments, the light chain variable domain comprises a sequence that is at least 95% identical to SEQ ID NO: 68.
- the antigen-binding domain comprises a heavy chain variable domain comprising a CDR1 comprising SEQ ID NO: 25, a CDR2 comprising SEQ ID NO: 26, and a CDR3 comprising SEQ ID NO: 27, and a light chain variable domain comprising a CDR1 comprising SEQ ID NO: 28, a CDR2 comprising SEQ ID NO: 29, and a CDR3 comprising SEQ ID NO: 30.
- the heavy chain variable domain comprises a sequence that is at least 80% identical to SEQ ID NO: 69. In some embodiments, the heavy chain variable domain comprises a sequence that is at least 90% identical to SEQ ID NO: 69.
- the heavy chain variable domain comprises a sequence that is at least 95% identical to SEQ ID NO: 69. In some embodiments, the light chain variable domain comprises a sequence that is at least 80% identical to SEQ ID NO: 70. In some embodiments, the light chain variable domain comprises a sequence that is at least 90% identical to SEQ ID NO: 70. In some embodiments, the light chain variable domain comprises a sequence that is at least 95% identical to SEQ ID NO: 70.
- the antigen-binding domain comprises a heavy chain variable domain comprising a CDR1 comprising SEQ ID NO: 31, a CDR2 comprising SEQ ID NO: 32, and a CDR3 comprising SEQ ID NO: 33, and a light chain variable domain comprising a CDR1 comprising SEQ ID NO: 34, a CDR2 comprising SEQ ID NO: 35, and a CDR3 comprising SEQ ID NO: 36.
- the heavy chain variable domain comprises a sequence that is at least 80% identical to SEQ ID NO: 71.
- the heavy chain variable domain comprises a sequence that is at least 90% identical to SEQ ID NO: 71.
- the heavy chain variable domain comprises a sequence that is at least 95% identical to SEQ ID NO: 71. In some embodiments, the light chain variable domain comprises a sequence that is at least 80% identical to SEQ ID NO: 72. In some embodiments, the light chain variable domain comprises a sequence that is at least 90% identical to SEQ ID NO: 72. In some embodiments, the light chain variable domain comprises a sequence that is at least 95% identical to SEQ ID NO: 72.
- the antigen-binding domain comprises a heavy chain variable domain comprising a CDR1 comprising SEQ ID NO: 37, a CDR2 comprising SEQ ID NO: 38, and a CDR3 comprising SEQ ID NO: 39, and a light chain variable domain comprising a CDR1 comprising SEQ ID NO: 40, a CDR2 comprising SEQ ID NO: 41, and a CDR3 comprising SEQ ID NO: 42.
- the heavy chain variable domain comprises a sequence that is at least 80% identical to SEQ ID NO: 73. In some embodiments, the heavy chain variable domain comprises a sequence that is at least 90% identical to SEQ ID NO: 73.
- the heavy chain variable domain comprises a sequence that is at least 95% identical to SEQ ID NO: 73. In some embodiments, the light chain variable domain comprises a sequence that is at least 80% identical to SEQ ID NO: 74. In some embodiments, the light chain variable domain comprises a sequence that is at least 90% identical to SEQ ID NO: 74. In some embodiments, the light chain variable domain comprises a sequence that is at least 95% identical to SEQ ID NO: 74.
- the antigen-binding domain comprises a heavy chain variable domain comprising a CDR1 comprising SEQ ID NO: 43, a CDR2 comprising SEQ ID NO: 44, and a CDR3 comprising SEQ ID NO: 45, and a light chain variable domain comprising a CDR1 comprising SEQ ID NO: 46, a CDR2 comprising SEQ ID NO: 47, and a CDR3 comprising SEQ ID NO: 48.
- the heavy chain variable domain comprises a sequence that is at least 80% identical to SEQ ID NO: 75. In some embodiments, the heavy chain variable domain comprises a sequence that is at least 90% identical to SEQ ID NO: 75.
- the heavy chain variable domain comprises a sequence that is at least 95% identical to SEQ ID NO: 75. In some embodiments, the light chain variable domain comprises a sequence that is at least 80% identical to SEQ ID NO: 76. In some embodiments, the light chain variable domain comprises a sequence that is at least 90% identical to SEQ ID NO: 76. In some embodiments, the light chain variable domain comprises a sequence that is at least 95% identical to SEQ ID NO: 76.
- the antigen-binding domain comprises a heavy chain variable domain comprising a CDR1 comprising SEQ ID NO: 49, a CDR2 comprising SEQ ID NO: 50, and a CDR3 comprising SEQ ID NO: 51, and a light chain variable domain comprising a CDR1 comprising SEQ ID NO: 52, a CDR2 comprising SEQ ID NO: 53, and a CDR3 comprising SEQ ID NO: 54.
- the heavy chain variable domain comprises a sequence that is at least 80% identical to SEQ ID NO: 77. In some embodiments, the heavy chain variable domain comprises a sequence that is at least 90% identical to SEQ ID NO: 77.
- the heavy chain variable domain comprises a sequence that is at least 95% identical to SEQ ID NO: 77. In some embodiments, the light chain variable domain comprises a sequence that is at least 80% identical to SEQ ID NO: 78. In some embodiments, the light chain variable domain comprises a sequence that is at least 90% identical to SEQ ID NO: 78. In some embodiments, the light chain variable domain comprises a sequence that is at least 95% identical to SEQ ID NO: 78.
- the antigen-binding domain comprises a heavy chain variable domain comprising a CDR1 comprising SEQ ID NO: 55, a CDR2 comprising SEQ ID NO: 56, and a CDR3 comprising SEQ ID NO: 57, and a light chain variable domain comprising a CDR1 comprising SEQ ID NO: 58, a CDR2 comprising SEQ ID NO: 59, and a CDR3 comprising SEQ ID NO: 60.
- the heavy chain variable domain comprises a sequence that is at least 80% identical to SEQ ID NO: 79.
- the heavy chain variable domain comprises a sequence that is at least 90% identical to SEQ ID NO: 79.
- the heavy chain variable domain comprises a sequence that is at least 95% identical to SEQ ID NO: 79. In some embodiments, the light chain variable domain comprises a sequence that is at least 80% identical to SEQ ID NO: 80. In some embodiments, the light chain variable domain comprises a sequence that is at least 90% identical to SEQ ID NO: 80. In some embodiments, the light chain variable domain comprises a sequence that is at least 95% identical to SEQ ID NO: 80. In some embodiments, the protein is a multi-chain protein. In some embodiments, the protein is a single-chain protein. In some embodiments, the protein is an antibody or an antigen-binding antibody fragment.
- the antibody is an IgG1 antibody, an IgG2 antibody, an IgG3 antibody, or an IgG4 antibody. In some embodiments, the antibody is humanized. In some embodiments, the antibody is human. In some embodiments, the protein is a scFv. In some embodiments, the protein is a chimeric antigen receptor (CAR). Also provided herein are pharmaceutical compositions comprising any one of the proteins described herein and a pharmaceutically acceptable carrier. Also provided herein are kits comprising any one of the pharmaceutical compositions described herein. Also provided herein are nucleic acids encoding any one of the proteins described herein. Also provided herein are vectors comprising any one of the nucleic acids described herein.
- kits comprising any one of the pharmaceutical compositions described herein.
- cells comprising any one of the nucleic acids described herein or any one of the vectors described herein.
- the cell is an immune cell.
- the immune cell is a T cell, a B cell, or a natural killer (NK) cell.
- the immune cell is a regulatory T (Treg) cell.
- the immune cell is an autologous cell.
- the immune cell is an allogeneic cell.
- kits comprising any one of the pharmaceutical compositions described herein.
- methods of treating an age-related disease or an inflammatory disease in a subject that include administering to the subject a therapeutically effective amount of any one of the proteins described herein or any one of the pharmaceutical compositions described herein.
- methods of treating an aging- related disease or an inflammatory disease in a subject that include administering to the subject a therapeutically effective amount of any one of the nucleic acids described herein, any one of the vectors described herein, or any one of the pharmaceutical compositions described herein.
- the aging-related disease is inflamm-aging related.
- the subject is further administered (i) a therapeutically effective amount of an NK cell activating agent and/or an NK cell and/or a monoclonal antibody; and/or (ii) a therapeutically effective amount of a Treg cell activating agent and/or a Treg cell and/or a monoclonal antibody and/or an advanced glycation end product (AGE) inhibitor.
- AGE advanced glycation end product
- the method comprises administering a therapeutically effective amount of an NK cell to the subject.
- the NK cell is an autologous, haploidentical or allogeneic NK cell isolated from peripheral blood, umbilical cord blood, or isolated and differentiated from iPSC.
- the method further comprises: isolating the NK cell from the subject; culturing the isolated NK cell in a liquid culture medium under conditions sufficient to induce or increase proliferation of the NK cell, wherein following the isolating and culturing steps, the NK cell is administered to the subject.
- the liquid culture medium comprises a multi-chain chimeric polypeptide.
- the NK cell comprises a chimeric antigen receptor.
- the protein is any one of the chimeric antigen receptors described herein.
- the method comprises administering a therapeutically effective amount of an NK cell activating agent and/or monoclonal antibody to the subject.
- the NK cell activating agent is one or more multi-chain chimeric polypeptide(s).
- the monoclonal antibody is any one of the anti-tissue factor antibodies or antibodies described herein.
- the NK cell activating agent comprises one or more multi-chain chimeric polypeptide(s) and the monoclonal antibody comprises one or more of any one of the anti-tissue factor antibodies and/or antibodies described herein.
- the method comprises administering a therapeutically effective amount of a Treg cell to the subject.
- the Treg cell is an autologous Treg cell, a haploidentical Treg cell, or an allogeneic Treg cell isolated from peripheral blood or umbilical cord blood.
- the method further comprises: isolating the Treg cell from the subject; culturing the isolated Treg cell in a liquid culture medium under conditions sufficient to induce or increase proliferation of the Treg cell, wherein following the isolating and culturing steps, the Treg cell is administered to the subject.
- the liquid culture medium comprises one or more single-chain chimeric polypeptide(s).
- the Treg cell comprises a chimeric antigen receptor.
- the chimeric antigen receptor comprises an extracellular domain that binds specifically to tissue factor, CD26 (e.g., any of the anti-CD26 antigen-binding domains described herein), or CD36.
- the method comprises administering a therapeutically effective amount of a Treg cell activating agent and/or monoclonal antibody and/or AGE inhibitor to the subject.
- the Treg cell activating agent is one or more single-chain chimeric polypeptide(s).
- the monoclonal antibody is one or both of an anti-tissue factor antibody, an anti-CD26 antibody (e.g., any of the anti- CD26 antibodies described herein), and/or an anti-CD36 antibody.
- the AGE inhibitor is a soluble RAGE trap.
- the Treg cell activating agent comprises one or more single-chain chimeric polypeptide(s)
- the monoclonal antibody comprises one or more of an anti-tissue factor antibody, an anti- CD26 antibody (e.g., any of the anti-CD26 antibodies described herein), and/or an anti- CD36 antibody
- the AGE inhibitor comprises one or more soluble RAGE trap.
- the multi-chain chimeric polypeptide comprises: (a) a first chimeric polypeptide comprising: (i) a first target-binding domain; (ii) a soluble tissue factor domain; and (iii) a first domain of a pair of affinity domains; (b) a second chimeric polypeptide comprising: (i) a second domain of a pair of affinity domains; and (ii) a second target-binding domain, wherein the first chimeric polypeptide and the second chimeric polypeptide associate through the binding of the first domain and the second domain of the pair of affinity domains.
- the single-chain chimeric polypeptide comprises: (i) a first target-binding domain; (ii) a soluble tissue factor domain; and (iii) a second target- binding domain.
- the aging-related disorder is selected from the group of: Alzheimer’s disease, aneurysm, cystic fibrosis, fibrosis in pancreatitis, glaucoma, hypertension, idiopathic pulmonary fibrosis, inflammatory bowel disease, intervertebral disc degeneration, macular degeneration, osteoarthritis, type 2 diabetes mellitus, adipose atrophy, lipodystrophy, atherosclerosis, cataracts, COPD, idiopathic pulmonary fibrosis, kidney transplant failure, liver fibrosis, loss of bone mass, myocardial infarction, sarcopenia, wound healing, alopecia, cardiomyocyte hypertrophy, osteoarthritis, Parkinson’s disease, age-associated loss of lung
- the inflammatory disease is selected from the group of: rheumatoid arthritis, inflammatory bowel disease, lupus erythematosus, lupus nephritis, diabetic nephropathy, CNS injury, Alzheimer’s disease, Parkinson’s disease, amyotrophic lateral sclerosis, Crohn’s disease, multiple sclerosis, Guillain-Barre syndrome, psoriasis, Grave’s disease, ulcerative colitis, nonalcoholic steatohepatitis, and mood disorders.
- the age-related disease is a cancer selected from the group of: solid tumor, hematological tumor, sarcoma, osteosarcoma, glioblastoma, neuroblastoma, melanoma, rhabdomyosarcoma, Ewing sarcoma, osteosarcoma, B-cell neoplasms, multiple myeloma, B-cell lymphoma, B-cell non-Hodgkin’s lymphoma, Hodgkin’s lymphoma, chronic lymphocytic leukemia (CLL), acute myeloid leukemia (AML), chronic myeloid leukemia (CML), acute lymphocytic leukemia (ALL), myelodysplastic syndromes (MDS), cutaneous T-cell lymphoma, retinoblastoma, stomach cancer, urothelial carcinoma, lung cancer, renal cell carcinoma, gastric and esophageal cancer, pancreatic cancer, prostate cancer, breast cancer, breast cancer,
- an “antigen-binding domain” is one or more protein domain(s) (e.g., formed from amino acids from a single polypeptide or formed from amino acids from two or more polypeptides (e.g., the same or different polypeptides) that is capable of specifically binding to an antigen.
- an antigen-binding domain can bind to an antigen or epitope with specificity and affinity similar to that of naturally-occurring antibodies.
- the antigen-binding domain can be an antibody or a fragment thereof.
- an antigen-binding domain can include an alternative scaffold. Non-limiting examples of antigen-binding domains are described herein. Additional examples of antigen-binding domains are known in the art.
- antibody is used herein in its broadest sense and includes certain types of immunoglobulin molecules that include one or more antigen-binding domains that specifically bind to an antigen or epitope.
- An antibody specifically includes, e.g., intact antibodies (e.g., intact immunoglobulins, e.g., human IgG (e.g., human IgG1, human IgG2, human IgG3, human IgG4)), antibody fragments, and multi-specific antibodies.
- an antigen-binding domain is an antigen-binding domain formed by a VH -VL dimer. Additional examples of an antibody are described herein. Additional examples of an antibody are known in the art.
- affinity refers to the strength of the sum total of non-covalent interactions between an antigen-binding site and its binding partner (e.g., an antigen or epitope). Unless indicated otherwise, as used herein, “affinity” refers to intrinsic binding affinity, which reflects a 1:1 interaction between members of an antigen-binding domain and an antigen or epitope.
- the affinity of a molecule X for its partner Y can be represented by the dissociation equilibrium constant (K D ). The kinetic components that contribute to the dissociation equilibrium constant are described in more detail below. Affinity can be measured by common methods known in the art, including those described herein.
- Affinity can be determined, for example, using surface plasmon resonance (SPR) technology (e.g., BIACORE®) or biolayer interferometry (e.g., FORTEBIO®). Additional methods for determining the affinity for an antigen-binding domain and its corresponding antigen or epitope are known in the art.
- SPR surface plasmon resonance
- FORTEBIO® biolayer interferometry
- the term “pair of affinity domains” is two different protein domain(s) that bind specifically to each other with a KD of less than of less than 1 x 10 -7 M (e.g., less than 1 x 10 -8 M, less than 1 x 10 -9 M, less than 1 x 10 -10 M, or less than 1 x 10 -11 M).
- a pair of affinity domains can be a pair of naturally-occurring proteins. In some embodiments, a pair of affinity domains can be a pair of synthetic proteins. Non- limiting examples of pairs of affinity domains are described herein.
- the term “epitope” means a portion of an antigen that specifically binds to an antigen-binding domain. Epitopes can, e.g., consist of surface-accessible amino acid residues and/or sugar side chains and may have specific three-dimensional structural characteristics, as well as specific charge characteristics. Conformational and non- conformational epitopes are distinguished in that the binding to the former but not the latter may be lost in the presence of denaturing solvents.
- An epitope may comprise amino acid residues that are directly involved in the binding, and other amino acid residues, which are not directly involved in the binding.
- Methods for identifying an epitope to which an antigen-binding domain binds are known in the art.
- the term “treatment” means to ameliorate at least one symptom of a disorder.
- the disorder being treated is cancer and to ameliorate at least one symptom of cancer includes reducing aberrant proliferation, gene expression, signaling, translation, and/or secretion of factors.
- the methods of treatment include administering a therapeutically effective amount of composition that reduces at least one symptom of a disorder to a subject who is in need of, or who has been determined to be in need of such treatment.
- Figure 1 shows ELISA binding analysis of selected scFv clones, where a plate of scFv clones were tested and their binding to CD26, Fc, and proA/L were tested, and DNA was prepared for scFv constructs then sent for DNA sequencing to determine LC/HC variable domain sequences.
- Figure 2 shows sequence analysis of five unique scFv binding clones, where the unique clones were identified and sequencing results indicate that their LC and HC variable domains are intact and the sequences of CDR-L1, CDR-L2, CDR-L3, CDR-H1, CDR-H2, and CDR-H3 are unique from each other.
- Figure 3 shows the binding of scFv supernatants to CD26 with serial dilution of scFv supernatants.
- Figure 4 shows binding of scFvs with CD26 corrected for concentration, where the concentration of the scFvs was determined and the ELISA binding data was corrected for concentration.
- Figure 5 shows the screening of CD26-binding scFvs, where clone CD26-03G and CD26-04E are shown in circled spots.
- Figure 6 shows screening of CD26-binding scFvs in a YCM screen, where scFv clones CD26-01F, CD26-01G, and CD26-07H are shown in circled spots.
- Figure 7 shows the sequences of selected scFvs.
- Figure 8 shows human CD26-binding activity of anti-CD26 monoclonal antibodies.
- Anti-CD26 IgG1kappa monoclonal antibodies were constructed based on the selected scFv sequences.
- the CD26-binding of purified anti-CD26 monoclonal antibodies was determined with ELISA using (A) human CD26-Fc fusion protein-coated or (B) goat anti-human IgG-coated 96-well Maxisorp plates. The plates were blocked with blocking buffer. Purified anti-CD26 monoclonal antibodies were diluted in blocking buffer and added in the wells of CD26-Fc or goat anti-human IgG-coated plates.
- the anti-CD26 monoclonal antibodies were probed with goat anti-human kappa-HRP/ABTS and read by an ELISA plate reader at 405 nM.
- the results show that CD26Ab-01D and CD26Ab-04A are able to bind to CD26 and CD26Ab-01D has a better binding activity than CD26Ab-04A.
- CD26Ab-12D and CD26Ab-03B have weak CD26-binding activity.
- CD26Ab-10B has no significant CD26-binding activity.
- Figure 9 shows human CD26-binding activity of anti-CD26 monoclonal antibodies.
- Human CD26-transfected CHO cells were stained with (A) five different anti-CD26 monoclonal antibodies at 50 nM or (B) five different biotinylated anti-CD26 antibodies at 1 ⁇ g/test (26Ab-10B had very low production and was not biotinylated) and then probed using goat anti-human IgG-PE for unbiotinylated antibodies or using streptavidin-PE for the biotinylated antibodies.
- the data was analyzed by BD FACSCelesta with BD FACSDiva Software.
- Anti-tissue factor antibody (anti-TF Ab) was used as a negative control and PE-conjugated anti-CD26 (BioLegend) was used as a positive control.
- FIG. 10 shows ADCC activity of different anti-CD26 monoclonal antibodies.
- Human CD26-transfected CHO cells (CHO26) were labeled with CellTrace Violet and used as target cells, and fresh human NK cells (left: donor-1 and right: donor-2) were used as effector cells.
- the effector cells were plated with violet-labelled target cells at the indicated effector:target (E:T) ratios with 26Ab-01D or 26Ab-04A at a 5 nM concentration.
- Anti-tissue factor antibody (anti-TF Ab) was used as a control.
- Target cell inhibition (%) was calculated using a formula: (1-[viable CHO26 cell number in experimental sample/viable CHO26 cell number in the sample without splenocytes]) x 100 on day 2 as assessed by flow cytometry and represents anti-CD26 antibody-mediated ADCC.
- the results show CD26Ab-01D- and CD26Ab-04A-dependent and NK cell- mediated cytotoxicity against CD26-positive CHO cells.
- Figure 11 shows interaction of human CD26 and adenosine deaminase (ADA). Human CD26-Fc fusion protein was used to coat 96-well Maxisorp plate. The plate was blocked with blocking buffer.
- FIG. 12 is a schematic of a nucleic acid encoding an anti-CD26 CAR in a lentiviral vector.
- Figure 13 is a set of images showing total Treg cells and anti-CD26 CAR Treg cells stimulated with the specific antigen (CD26/beads), non-specific antigen (TF/beads), or TCR (CD3/CD28/beads) for 3 days.
- Figure 14 is a graph showing the fold-expansion of anti-CD26 CAR Treg cells after three days of stimulation with the specific antigen (CD26/beads), non-specific antigen (TF/beads), or TCR (CD3/CD28/beads).
- Figure 15 is a set of fluorescence-assisted cell sorting (FACS) data showing the staining of anti-CD26 CAR Treg cells with CD26-Fc or tissue factor (TF).
- FACS fluorescence-assisted cell sorting
- Figure 16 is a graph showing cell marker expression in anti-CD26 CAR Treg cells and un-transduced Treg cells.
- Figure 17 is a graph of the suppression activity of anti-CD26 CAR Treg cells and un-transduced Treg cells.
- Figure 18 is a graph showing the suppression of IFNg production by Tresp cells with anti-CD26 CAR Treg cells or untransducted Treg cells.
- Figure 19 is a graph showing the IL-10 production by anti-CD26 CAR Treg cells and untransduced Treg cells.
- CD26 CD26 (DPP4, also known as Dipeptidyl-peptidase-4, DDP4) is a transmembrane glycoprotein, anchored to the membrane by its signal peptide, that forms a homodimer or tetramer on the plasma membrane.
- CD26 is an amino peptidase that primarily cleaves N- terminal dipeptides from peptides or small proteins (below 80-100 amino acid residues) with proline or alanine as the penultimate amino acid. Protein substrates with glycine, serine, valine, or leucine can also be cleaved but at a slower rate. The enzyme is unable to cleave substrates with proline at position three.
- CD26 is expressed in numerous tissues including intestinal and renal brush border membranes, vascular endothelium, liver and pancreas, glandular epithelial cells, and by cells of the immune system (Gutschmidt et al., Histochemistry 73(2):285-304, 1981; Gorrell et al., Cell Immunol.134(1):205-215, 1991; Tanaka et al., J. Immunol. 149(2):481-486, 1992; Abbott et al., Immunogenetics 40(5):331-338, 1994; Buhling et al., Immunol. Lett.45(1-2):47-51, 1995; Dikov et al., Cell. Mol.
- CD26 The primary structure of CD26 consists of a six-amino acid cytoplasmic domain, a 22-amino acid transmembrane domain, and a 738- amino acid extracellular portion.
- the extracellular portion is comprised of the C-terminal catalytic region with the catalytic active site triad Ser 630 , Asp 708 , and His 740 , a cysteine- rich area, and a large glycosylation-rich region linked by a flexible stalk to the transmembrane segment (Klemann et al., Clin. Exp. Immunol.185(1):1-21, 2016).
- the crystal structure of human CD26 reveals two domains: an eight-bladed propeller and an ⁇ / ⁇ -hydrolase domain (Engel et al., Proc. Natl. Acad. Sci. U.S.A.100(9):5063-5068, 2003).
- the propeller is open and consists of subdomains made up of blades II-V and VI- VIII for the glycosylation-rich and cysteine-rich regions, respectively.
- Adenosine deaminase (ADA) and cavelolin-1 bind to the glycosylation-rich domain of human CD26, and collagen, fibronectin, plasminogen, and streptokinase bind to the cysteine-rich region (Klemann et al., Clin. Exp. Immunol.185(1):1-21, 2016).
- CD26 substrate neuropeptide Y was found to enter CD26 at the side opening (Aertgeerts et al., Protein Sci.13(2):412-421, 2004). CD26 was also found to function as binding sites for the chemokine CXCR4 receptor, the T-cell differentiation antigen CD45, and the sodium-hydrogen exchanger-3 (Mentlein et al., Regul. Pept.85(1):9-24, 1999; Lambeir et al., Crit. Rev. Clin. Lab. Sci.40(3):209-294, 2003).
- CD26 can be viewed as a multi-functional protein with a variety of actions which go beyond its role as a proteinase. Its role as a receptor or ligand for a variety of different molecules, either alone or in combination with its enzymatic activity, enable it to affect physiological processes, such as the interaction between cells and the extracellular matrix involved in cell migration, activation, and proliferation.
- CD26 plays a major role in glucose metabolism. Incretin peptides, such as gastric inhibitory polypeptide (GIP) and glucagon-like peptide (GLP-1), are responsible for the modulation of postprandial blood glucose by promoting insulin secretion from pancreatic ⁇ cells and via glucagon static effects.
- GIP gastric inhibitory polypeptide
- GLP-1 glucagon-like peptide
- CD26 -/- mice are protected from the development of diet- induced obesity and demonstrate improved postprandial glucose control due to the prolonged half-life of the incretin peptides.
- CD26 -/- mice also demonstrate improved insulin sensitivity, reduced pancreatic islet hypertrophy, and protection against streptozotocin-induced ⁇ cell loss and hyperglycemia (Marguet et al., Proc. Natl. Acad. Sci. U.S.A.97(12):6874-6879, 2000; Conarello et al., Proc. Natl. Acad. Sci. U.S.A.
- CD26 inhibitors approved by the US FDA as antidiabetic drugs, such as sitagliptin, saxagliptin, linagliptin, vildagliptin, and alogliptin. Most clinical trials with CD26 inhibitors show approximately a 0.6-0.8% lowering of HbA1C in patients with a baseline level around 8% (Inzucchi et al., Circulation 117(4):574-584, 2008).
- the physiologic targets include GLP1, GLP2, brain natriuretic peptide, peptide YY, stromal- cell-derived factor, erythropoietin, granulocyte colony-stimulating factor, and substance P.
- Pharmacological targets include gastric-releasing peptide, growth-hormone-releasing factor, macrophage derived chemokine, eotaxin, IFN- ⁇ -induced protein-10, granulocyte- macrophage colony-stimulating factor, erythropoietin, IL-3, neuropeptide Y, B-type natriuretic peptide, and peptide YY (Mulvihill et al., Endocr.
- CD26 is known to modulate the functionality of chemokines, such as CXCR3, through post-translational cleavage of X-Pro or X-Ala motifs, which leads to amino- terminal dipeptide truncation of chemokines and altered biological function (Broxmeyer et al., Stem Cells Dev.25(8):575-585, 2016). CD26 also mediates amino-terminal cleavage of the chemokine CXCL10, limiting the migration of CXCR3 natural killer (NK) and T cells and diminution of anti-tumor immunity in preclinical models of melanoma and colorectal carcinoma (Barreira da Silva et al., Nat.
- CD26 interacts also with a range of ligands. By interacting with these ligands, CD26 plays a role in a variety of processes such as enhancing T-cell activation and functional modulation of antigen presenting cells (APCs).
- APCs antigen presenting cells
- CD26 is able to trigger direct T cell activation and proliferation via CARMA1-mediated nuclear factor NF- ⁇ B in T cells (Ohnuma et al., J. Immunol.167(12):6745-6755, 2001; Ohnuma et al., Proc. Natl. Acad. Sci. U.S.A.101(39):14186-14191, 2004).
- CD26 on T cells interacts directly with APCs via caveolin-1. Upon linkage, Tollip and interleukin-1-receptor associated kinase 1 (1RAK-1) disengage from caveolin-1 leading to subsequent 1RAK-1 phosphorylation (Ohnuma et al., Mol. Cell.
- Interaction between CD26 and ADA also facilitate T-cell activation by providing a suitable microenvironment for T-cell proliferation.
- Extracellular ATP or ADP is initially converted to AMP by CD39 and CD73 to produce adenosine (Deaglio et al., J. Exp. Med.204(6):1257-1265, 2007).
- Adenosine is then processed by ADA and converted to inosine (Resta et al., Immunol. Rev.161:95-109, 1998).
- Adenosine has multiple physiological effects both within the central nervous system, immune system, and on peripheral tissues that are mediated by the G-protein coupled adenosine receptors identified as A1, A2A, A2B, and A3 (Borea et al., Physiol. Rev.98(3):1591-1625, 2018).
- ADA G-protein coupled adenosine receptors identified as A1, A2A, A2B, and A3
- Jurkat cells expressing a CD26 mutant devoid of ADA binding activity are sensitive to adenosine- mediated inhibition of T-cell proliferation (Dong et al., J. Immunol.159(12):6070-6076, 1997).
- Cells expressing ADA and CD26 on the surface are much more resistant to the inhibitory effect of adenosine (Dong et al., J. Immunol.156(4):1349-1355, 1996; Dong et al., J. Immunol.159(12):6070-6076, 1997; Zhong et al., Diabetes 62(1):149-157, 2013).
- ADA co-localizing with adenosine receptors on dendritic cells and interacts with CD26 that is expressed on lymphocytes (Moreno et al., Front. Pharmacol.9:106, 2018).
- This capacity of ADA functions as a costimulatory signal that potentiates T-cell activation and induces the production of the T-helper cell (Th1) pro- inflammatory cytokines.
- CD26 binds multiple components of extracellular matrix such as collagen, fibronectin, and HIV-1 Tat protein (Loster et al., Biochem. Biophys. Res. Comm. 217(1):341-348, 1995; Zhong et al., Diabetes 62(1):149-157, 2013).
- CD26 A humanized monoclonal antibody to CD26 showed promising antitumor efficacy and was well tolerated in a recently reported Phase I clinical study in patients with advanced malignant pleural mesothelioma (Takeda et al., Lung Cancer 137:64-70, 2019). CD26 is also implicated in cellular senescence, a hallmark of aging. Senescent cell accumulation in tissues is strongly linked to age-associated pathologies (Childs et al., Nat. Rev. Drug Discov.16(10):718-735, 2017; Kirkland et al., EBioMedicine 21:21-28, 2017).
- CD26 was upregulated on the surface of human senescent diploid fibroblasts (Kim et al., Genes Dev.31(15):1529-1534, 2017). Increased CD26 expression on senescent, but not dividing, fibroblasts sensitized the fibroblasts to NK-mediated ADCC by anti-CD26 antibody (Kim et al., Genes Dev. 31(15):1529-1534, 2017). Senescence is a form of irreversible growth arrest accompanied by phenotypic changes, resistance to apoptosis and activation of damage-sensing signaling pathways.
- Senescence was first described in cultured human fibroblast cells that lost their ability to proliferate, reaching permanent arrest after about 50 population doublings (referred to as the Hayflick limit). Senescence is considered a stress response that can be induced by a wide range of intrinsic and extrinsic insults, including oxidative and genotoxic stress, DNA damage, telomere attrition, oncogenic activation, mitochondrial dysfunction, or chemotherapeutic agents. Senescent cells remain metabolically active and can influence the tissue hemostasis, disease and aging through their secretory phenotype. Senescence is considered as a physiologic process and is important in promoting wound healing, tissue homeostasis, regeneration, and fibrosis regulation.
- transient induction of senescent cells is observed during would healing and contributes to wound resolution.
- Perhaps one of the most important roles of senescence is its role in tumor suppression.
- the senescent phenotype also can trigger chronic inflammatory responses and consequently augment chronic inflammatory conditions to promote tumor growth.
- the connection between senescence and aging was initially based on observations that senescent cells accumulate in aged tissue.
- the use of transgenic models has enabled the detection of senescent cells systematically in many age-related pathologies. Strategies to selectively eliminate senescent cells have demonstrated that senescent cells can indeed play a causal role in aging and related pathologies.
- Senescent cells display important and unique properties which include changes in morphology, chromatin organization, gene expression, and metabolism.
- biochemical and functional properties associated with cellular senescence such as (i) increased expression of p16 and p21, inhibitors of cyclin-dependent kinases, (ii) presence of senescence-associated ⁇ -galactosidase, a marker of lysosomal activity, (iii) appearance of senescence-associated heterochromatin foci and downregulation of lamin B1 levels, (iv) resistance to apoptosis caused by an increased expression of anti-apoptotic BCL-family protein, and (v) upregulation of CD26 (DPP4), CD36 (Scavenger receptor), forkhead box 4 (FOXO4), and secretory carrier membrane protein 4 (SCAMP4).
- Senescent cells also express an inflammatory signature, the so-called senescence- associated secretory phenotype (SASP).
- SASP senescence- associated secretory phenotype
- IL-6 IL-6
- TGF- ⁇ growth factors
- CCL-2 chemokines
- MMP-3 matrix metalloproteinases
- SASP factors can contribute to tumor suppression by triggering senescence surveillance, an immune-mediated clearance of senescent cells.
- DNA damage results in: (1) high deposition of ⁇ H2Ax (histone coding gene) and 53BP1 (involved in DNA damage response) in chromatin: this leads to activation of a kinase cascade eventually resulting in p53 activation, and (2) activation of p16INK4a and ARF (both encoded by CDKN2A) and P15INK4b (encoded by CDKN2B): p53 induces transcription of cyclin-dependent kinase inhibitor (p21) and along with both p16INK4a and p15INK4b block genes for cell cycle progression (CDK4 and CDK6).
- ⁇ H2Ax histone coding gene
- 53BP1 involved in DNA damage response
- NK cells such as IL-15 and CCL2
- macrophages such as CFS-1 and CCL2
- NK cells such as IL-15 and CCL2
- SASP factors that function as chemoattractants mainly for .
- NK cells such as IL-15 and CCL2
- macrophages such as CFS-1 and CCL2
- innate immune cells mediate the immunosurveillance mechanism for eliminating stressed cells.
- Senescent cells usually up-regulate the NK-cell activating receptor NKG2D and DNAM-1 ligands, which belong to a family of stress-inducible ligands: an important component of the frontline immune defense against infectious diseases and malignancies.
- NK cells can then specifically induce the death of senescent cells through their cytolytic machinery.
- NK cells A role for NK cells in the immune surveillance of senescent cells has been pointed out in liver fibrosis (Sagiv et al., Oncogene 32(15):1971-1977, 2013), hepatocellular carcinoma (Iannello et al., J. Exp. Med.210(10):2057-2069, 2013), multiple myeloma (Soriani et al., Blood 113(15):3503-3511, 2009), and glioma cells stressed by dysfunction of the mevalonate pathway (Ciaglia et al., Int. J. Cancer 142(1):176-190, 2018). Endometrial cells undergo acute cellular senescence and do not differentiate into decidual cells.
- the differentiated decidual cells secrete IL-15 and thereby recruit uterine NK cells to target and eliminate the undifferentiated senescent cells thus helping to re-model and rejuvenate the endometrium (Brighton et al., Elife 6:e31274, 2017).
- p53-expressing senescent liver satellite cells skewed the polarization of resident Kupfer macrophages and freshly infiltrated macrophages toward the pro-inflammatory M1 phenotype, which display senolytic activity.
- F4/80 + macrophages have been shown to play a key role in the clearance of mouse uterine senescent cells to maintain postpartum uterine function.
- Senescent cells recruit NK cells by mainly upregulating ligands to NKG2D (expressed on NK cells), chemokines, and other SASP factors.
- NK cells mainly upregulating ligands to NKG2D (expressed on NK cells), chemokines, and other SASP factors.
- In vivo models of liver fibrosis have shown effective clearance of senescent cells by activated NK cells (Krizhanovsky et al., Cell 134(4):657-667, 2008).
- Studies have described various models to study senescence including liver fibrosis (Krizhanovsky et al., Cell 134(4):657-667, 2008), osteoarthritis (Xu et al., J. Gerontol. A Biol. Sci. Med.
- MERS-CoV Middle East Respiratory Syndrome
- CD26 is the functional receptor for the entry of MERS-CoV in humans (Raj et al., J. Virol.88(3):1834-1838, 2014).
- the engagement of the MERS-CoA spike protein S with CD26 mediates viral attachment and internalization.
- the residues involved in the CD26 virus binding are identical to the ADA binding domain indicating a potential competition for CD26 binding (Lu et al., Nature 500(7461):227-231, 2013).
- CD26 exerts its physiological roles either via its enzymatic activity by regulating many peptides or via its interactions with a variety of binding partners. Consequently, altered expression, and/or activity of CD26 have been implicated in several pathological processes, including inflammation, viral infection, immune-mediated diseases, tumor growth, cellular senescence, and metabolic diseases (Mentlein et al., Regul. Pept.85(1):9-24, 1999; Lambeir et al., Crit. Rev. Clin. Lab.
- CD26 is a cell-surface targetable protein for drug development to treat a variety of diseases including viral infections and aging-related pathologies.
- This application describes the identification of novel human-derived monoclonal antibodies and antigen-binding domains that specifically binding to human CD26.
- proteins including an anti-CD26 antigen-binding domain where the anti-CD26 antigen-binding domain comprises: (a) a heavy chain variable domain comprising a CDR1 comprising SEQ ID NO: 1, a CDR2 comprising SEQ ID NO: 2, and a CDR3 comprising SEQ ID NO: 3, and a light chain variable domain comprising a CDR1 comprising SEQ ID NO: 4, a CDR2 comprising SEQ ID NO: 5, and a CDR3 comprising SEQ ID NO: 6; (b) a heavy chain variable domain comprising a CDR1 comprising SEQ ID NO: 7, a CDR2 comprising SEQ ID NO: 8, and a CDR3 comprising SEQ ID NO: 9, and a light chain
- the antigen-binding domain comprises a heavy chain variable domain comprising a CDR1 comprising SEQ ID NO: 1, a CDR2 comprising SEQ ID NO: 2, and a CDR3 comprising SEQ ID NO: 3, and a light chain variable domain comprising a CDR1 comprising SEQ ID NO: 4, a CDR2 comprising SEQ ID NO: 5, and a CDR3 comprising SEQ ID NO: 6.
- the heavy chain variable domain comprises a sequence that is at least 80% (e.g., at least 85%, at least 90%, at least 92%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 61.
- the light chain variable domain comprises a sequence that is at least 80% (e.g., at least 85%, at least 90%, at least 92%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 62.
- the antigen-binding domain comprises a heavy chain variable domain comprising a CDR1 comprising SEQ ID NO: 7, a CDR2 comprising SEQ ID NO: 8, and a CDR3 comprising SEQ ID NO: 9, and a light chain variable domain comprising a CDR1 comprising SEQ ID NO: 10, a CDR2 comprising SEQ ID NO: 11, and a CDR3 comprising SEQ ID NO: 12.
- the heavy chain variable domain comprises a sequence that is at least 80% (e.g., at least 85%, at least 90%, at least 92%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 63.
- the light chain variable domain comprises a sequence that is at least 80% (e.g., at least 85%, at least 90%, at least 92%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 64.
- the antigen-binding domain comprises a heavy chain variable domain comprising a CDR1 comprising SEQ ID NO: 13, a CDR2 comprising SEQ ID NO: 14, and a CDR3 comprising SEQ ID NO: 15, and a light chain variable domain comprising a CDR1 comprising SEQ ID NO: 16, a CDR2 comprising SEQ ID NO: 17, and a CDR3 comprising SEQ ID NO: 18.
- the heavy chain variable domain comprises a sequence that is at least 80% (e.g., at least 85%, at least 90%, at least 92%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 65.
- the light chain variable domain comprises a sequence that is at least 80% (e.g., at least 85%, at least 90%, at least 92%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 66.
- the antigen-binding domain comprises a heavy chain variable domain comprising a CDR1 comprising SEQ ID NO: 19, a CDR2 comprising SEQ ID NO: 20, and a CDR3 comprising SEQ ID NO: 21, and a light chain variable domain comprising a CDR1 comprising SEQ ID NO: 22, a CDR2 comprising SEQ ID NO: 23, and a CDR3 comprising SEQ ID NO: 24.
- the heavy chain variable domain comprises a sequence that is at least 80% (e.g., at least 85%, at least 90%, at least 92%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 67.
- the light chain variable domain comprises a sequence that is at least 80% (e.g., at least 85%, at least 90%, at least 92%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 68.
- the antigen-binding domain comprises a heavy chain variable domain comprising a CDR1 comprising SEQ ID NO: 25, a CDR2 comprising SEQ ID NO: 26, and a CDR3 comprising SEQ ID NO: 27, and a light chain variable domain comprising a CDR1 comprising SEQ ID NO: 28, a CDR2 comprising SEQ ID NO: 29, and a CDR3 comprising SEQ ID NO: 30.
- the heavy chain variable domain comprises a sequence that is at least 80% (e.g., at least 85%, at least 90%, at least 92%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 69.
- the light chain variable domain comprises a sequence that is at least 80% (e.g., at least 85%, at least 90%, at least 92%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 70.
- the antigen-binding domain comprises a heavy chain variable domain comprising a CDR1 comprising SEQ ID NO: 31, a CDR2 comprising SEQ ID NO: 32, and a CDR3 comprising SEQ ID NO: 33, and a light chain variable domain comprising a CDR1 comprising SEQ ID NO: 34, a CDR2 comprising SEQ ID NO: 35, and a CDR3 comprising SEQ ID NO: 36.
- the heavy chain variable domain comprises a sequence that is at least 80% (e.g., at least 85%, at least 90%, at least 92%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 71.
- the light chain variable domain comprises a sequence that is at least 80% (e.g., at least 85%, at least 90%, at least 92%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 72.
- the antigen-binding domain comprises a heavy chain variable domain comprising a CDR1 comprising SEQ ID NO: 37, a CDR2 comprising SEQ ID NO: 38, and a CDR3 comprising SEQ ID NO: 39, and a light chain variable domain comprising a CDR1 comprising SEQ ID NO: 40, a CDR2 comprising SEQ ID NO: 41, and a CDR3 comprising SEQ ID NO: 42.
- the heavy chain variable domain comprises a sequence that is at least 80% (e.g., at least 85%, at least 90%, at least 92%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 73.
- the light chain variable domain comprises a sequence that is at least 80% (e.g., at least 85%, at least 90%, at least 92%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 74.
- the antigen-binding domain comprises a heavy chain variable domain comprising a CDR1 comprising SEQ ID NO: 43, a CDR2 comprising SEQ ID NO: 44, and a CDR3 comprising SEQ ID NO: 45, and a light chain variable domain comprising a CDR1 comprising SEQ ID NO: 46, a CDR2 comprising SEQ ID NO: 47, and a CDR3 comprising SEQ ID NO: 48.
- the heavy chain variable domain comprises a sequence that is at least 80% (e.g., at least 85%, at least 90%, at least 92%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 75.
- the light chain variable domain comprises a sequence that is at least 80% (e.g., at least 85%, at least 90%, at least 92%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 76.
- the antigen-binding domain comprises a heavy chain variable domain comprising a CDR1 comprising SEQ ID NO: 49, a CDR2 comprising SEQ ID NO: 50, and a CDR3 comprising SEQ ID NO: 51, and a light chain variable domain comprising a CDR1 comprising SEQ ID NO: 52, a CDR2 comprising SEQ ID NO: 53, and a CDR3 comprising SEQ ID NO: 54.
- the heavy chain variable domain comprises a sequence that is at least 80% (e.g., at least 85%, at least 90%, at least 92%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 77.
- the light chain variable domain comprises a sequence that is at least 80% (e.g., at least 85%, at least 90%, at least 92%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 78.
- the antigen-binding domain comprises a heavy chain variable domain comprising a CDR1 comprising SEQ ID NO: 55, a CDR2 comprising SEQ ID NO: 56, and a CDR3 comprising SEQ ID NO: 57, and a light chain variable domain comprising a CDR1 comprising SEQ ID NO: 58, a CDR2 comprising SEQ ID NO: 59, and a CDR3 comprising SEQ ID NO: 60.
- the heavy chain variable domain comprises a sequence that is at least 80% (e.g., at least 85%, at least 90%, at least 92%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 79.
- the light chain variable domain comprises a sequence that is at least 80% (e.g., at least 85%, at least 90%, at least 92%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 80.
- CD26 Ab-01D Heavy Chain Variable Domain CDR1 (SEQ ID NO: 1) TINDSYIH CD26 Ab-01D Heavy Chain Variable Domain CDR2 (SEQ ID NO: 2) WIWPYGGFTY CD26 Ab-01D Heavy Chain Variable Domain CDR3 (SEQ ID NO: 3) ARFLGSSSIMDY CD26 Ab-01D Light Chain Variable Domain CDR1 (SEQ ID NO: 4) RASQDVNSNVA CD26 Ab-01D Light Chain Variable Domain CDR2 (SEQ ID NO: 5) FGSGGLYS CD26 Ab-01D Light Chain Variable Domain CDR3 (SEQ ID NO: 6) QQYSSYPL CD26 Ab-04A Heavy Chain Variable Domain CDR1 (SEQ ID NO: 7) AINNYSIH CD26 Ab-04A Heavy Chain Variable Domain CDR2 (SEQ ID NO: 8) SIWPYGGFTS CD26 Ab-04A Heavy Chain Variable Domain CDR3 (SEQ ID NO: 9) ARFFSSYGDMDY CD26 Ab-04A Light Chain Variable Domain
- any of the proteins described herein can include an antigen-binding domain that includes a heavy chain variable domain that comprises a sequence that is at least 80% identical (e.g., at least 85% identical, at least 90% identical, at least 92% identical, at least 94% identical, at least 96% identical, at least 98% identical, at least 99% identical, or 100% identical) to SEQ ID NO: 63, and a light chain variable domain that comprises a sequence that is at least 80% identical (e.g., at least 85% identical, at least 90% identical, at least 92% identical, at least 94% identical, at least 96% identical, at least 98% identical, at least 99% identical, or 100% identical) to SEQ ID NO: 64.
- any of the proteins described herein can include an antigen-binding domain that includes a heavy chain variable domain that comprises a sequence that is at least 80% identical (e.g., at least 85% identical, at least 90% identical, at least 92% identical, at least 94% identical, at least 96% identical, at least 98% identical, at least 99% identical, or 100% identical) to SEQ ID NO: 65, and a light chain variable domain that comprises a sequence that is at least 80% identical (e.g., at least 85% identical, at least 90% identical, at least 92% identical, at least 94% identical, at least 96% identical, at least 98% identical, at least 99% identical, or 100% identical) to SEQ ID NO: 66.
- any of the proteins described herein can include an antigen-binding domain that includes a heavy chain variable domain that comprises a sequence that is at least 80% identical (e.g., at least 85% identical, at least 90% identical, at least 92% identical, at least 94% identical, at least 96% identical, at least 98% identical, at least 99% identical, or 100% identical) to SEQ ID NO: 67, and a light chain variable domain that comprises a sequence that is at least 80% identical (e.g., at least 85% identical, at least 90% identical, at least 92% identical, at least 94% identical, at least 96% identical, at least 98% identical, at least 99% identical, or 100% identical) to SEQ ID NO: 68).
- an antigen-binding domain that includes a heavy chain variable domain that comprises a sequence that is at least 80% identical (e.g., at least 85% identical, at least 90% identical, at least 92% identical, at least 94% identical, at least 96% identical, at least 98% identical, at least 99% identical, or 100% identical
- any of the proteins described herein can include an antigen-binding domain that includes a heavy chain variable domain that comprises a sequence that is at least 80% identical (e.g., at least 85% identical, at least 90% identical, at least 92% identical, at least 94% identical, at least 96% identical, at least 98% identical, at least 99% identical, or 100% identical) to SEQ ID NO: 69, and a light chain variable domain that comprises a sequence that is at least 80% identical (e.g., at least 85% identical, at least 90% identical, at least 92% identical, at least 94% identical, at least 96% identical, at least 98% identical, at least 99% identical, or 100% identical) to SEQ ID NO: 70.
- an antigen-binding domain that includes a heavy chain variable domain that comprises a sequence that is at least 80% identical (e.g., at least 85% identical, at least 90% identical, at least 92% identical, at least 94% identical, at least 96% identical, at least 98% identical, at least 99% identical, or 100% identical)
- any of the proteins described herein can include an antigen-binding domain that includes a heavy chain variable domain that comprises a sequence that is at least 80% identical (e.g., at least 85% identical, at least 90% identical, at least 92% identical, at least 94% identical, at least 96% identical, at least 98% identical, at least 99% identical, or 100% identical) to SEQ ID NO: 71, and a light chain variable domain that comprises a sequence that is at least 80% identical (e.g., at least 85% identical, at least 90% identical, at least 92% identical, at least 94% identical, at least 96% identical, at least 98% identical, at least 99% identical, or 100% identical) to SEQ ID NO: 72.
- an antigen-binding domain that includes a heavy chain variable domain that comprises a sequence that is at least 80% identical (e.g., at least 85% identical, at least 90% identical, at least 92% identical, at least 94% identical, at least 96% identical, at least 98% identical, at least 99% identical, or 100% identical)
- any of the proteins described herein can include an antigen-binding domain that includes a heavy chain variable domain that comprises a sequence that is at least 80% identical (e.g., at least 85% identical, at least 90% identical, at least 92% identical, at least 94% identical, at least 96% identical, at least 98% identical, at least 99% identical, or 100% identical) to SEQ ID NO: 73, and a light chain variable domain that comprises a sequence that is at least 80% identical (e.g., at least 85% identical, at least 90% identical, at least 92% identical, at least 94% identical, at least 96% identical, at least 98% identical, at least 99% identical, or 100% identical) to SEQ ID NO: 74.
- an antigen-binding domain that includes a heavy chain variable domain that comprises a sequence that is at least 80% identical (e.g., at least 85% identical, at least 90% identical, at least 92% identical, at least 94% identical, at least 96% identical, at least 98% identical, at least 99% identical, or 100% identical
- any of the proteins described herein can include an antigen-binding domain that includes a heavy chain variable domain that comprises a sequence that is at least 80% identical (e.g., at least 85% identical, at least 90% identical, at least 92% identical, at least 94% identical, at least 96% identical, at least 98% identical, at least 99% identical, or 100% identical) to SEQ ID NO: 75, and a light chain variable domain that comprises a sequence that is at least 80% identical (e.g., at least 85% identical, at least 90% identical, at least 92% identical, at least 94% identical, at least 96% identical, at least 98% identical, at least 99% identical, or 100% identical) to SEQ ID NO: 76).
- any of the proteins described herein can include an antigen-binding domain that includes a heavy chain variable domain that comprises a sequence that is at least 80% identical (e.g., at least 85% identical, at least 90% identical, at least 92% identical, at least 94% identical, at least 96% identical, at least 98% identical, at least 99% identical, or 100% identical) to SEQ ID NO: 77, and a light chain variable domain that comprises a sequence that is at least 80% identical (e.g., at least 85% identical, at least 90% identical, at least 92% identical, at least 94% identical, at least 96% identical, at least 98% identical, at least 99% identical, or 100% identical) to SEQ ID NO: 78.
- an antigen-binding domain that includes a heavy chain variable domain that comprises a sequence that is at least 80% identical (e.g., at least 85% identical, at least 90% identical, at least 92% identical, at least 94% identical, at least 96% identical, at least 98% identical, at least 99% identical, or 100% identical
- any of the proteins described herein can include an antigen-binding domain that includes a heavy chain variable domain that comprises a sequence that is at least 80% identical (e.g., at least 85% identical, at least 90% identical, at least 92% identical, at least 94% identical, at least 96% identical, at least 98% identical, at least 99% identical, or 100% identical) to SEQ ID NO: 79, and a light chain variable domain that comprises a sequence that is at least 80% identical (e.g., at least 85% identical, at least 90% identical, at least 92% identical, at least 94% identical, at least 96% identical, at least 98% identical, at least 99% identical, or 100% identical) to SEQ ID NO: 80.
- any of the proteins described herein can include an antigen-binding domain that includes a heavy chain variable domain encoded by a nucleic acid that comprises a sequence that is at least 80% identical (e.g., at least 85% identical, at least 90% identical, at least 92% identical, at least 94% identical, at least 96% identical, at least 98% identical, at least 99% identical, or 100% identical) to SEQ ID NO: 81, and a light chain variable domain encoded by a nucleic acid that comprises a sequence that is at least 80% identical (e.g., at least 85% identical, at least 90% identical, at least 92% identical, at least 94% identical, at least 96% identical, at least 98% identical, at least 99% identical, or 100% identical) to SEQ ID NO: 82.
- any of the proteins described herein can include an antigen-binding domain that includes a heavy chain variable domain encoded by a nucleic acid that comprises a sequence that is at least 80% identical (e.g., at least 85% identical, at least 90% identical, at least 92% identical, at least 94% identical, at least 96% identical, at least 98% identical, at least 99% identical, or 100% identical) to SEQ ID NO: 83, and a light chain variable domain encoded by a nucleic acid that comprises a sequence that is at least 80% identical (e.g., at least 85% identical, at least 90% identical, at least 92% identical, at least 94% identical, at least 96% identical, at least 98% identical, at least 99% identical, or 100% identical) to SEQ ID NO: 84.
- any of the proteins described herein can include an antigen-binding domain that includes a heavy chain variable domain encoded by a nucleic acid that comprises a sequence that is at least 80% identical (e.g., at least 85% identical, at least 90% identical, at least 92% identical, at least 94% identical, at least 96% identical, at least 98% identical, at least 99% identical, or 100% identical) to SEQ ID NO: 85, and a light chain variable domain encoded by a nucleic acid that comprises a sequence that is at least 80% identical (e.g., at least 85% identical, at least 90% identical, at least 92% identical, at least 94% identical, at least 96% identical, at least 98% identical, at least 99% identical, or 100% identical) to SEQ ID NO: 86.
- any of the proteins described herein can include an antigen-binding domain that includes a heavy chain variable domain encoded by a nucleic acid that comprises a sequence that is at least 80% identical (e.g., at least 85% identical, at least 90% identical, at least 92% identical, at least 94% identical, at least 96% identical, at least 98% identical, at least 99% identical, or 100% identical) to SEQ ID NO: 87, and a light chain variable domain encoded by a nucleic acid that comprises a sequence that is at least 80% identical (e.g., at least 85% identical, at least 90% identical, at least 92% identical, at least 94% identical, at least 96% identical, at least 98% identical, at least 99% identical, or 100% identical) to SEQ ID NO: 88.
- any of the proteins described herein can include an antigen-binding domain that includes a heavy chain variable domain encoded by a nucleic acid that comprises a sequence that is at least 80% identical (e.g., at least 85% identical, at least 90% identical, at least 92% identical, at least 94% identical, at least 96% identical, at least 98% identical, at least 99% identical, or 100% identical) to SEQ ID NO: 89, and a light chain variable domain encoded by a nucleic acid that comprises a sequence that is at least 80% identical (e.g., at least 85% identical, at least 90% identical, at least 92% identical, at least 94% identical, at least 96% identical, at least 98% identical, at least 99% identical, or 100% identical) to SEQ ID NO: 90.
- any of the proteins described herein can include an antigen-binding domain that includes a heavy chain variable domain encoded by a nucleic acid that comprises a sequence that is at least 80% identical (e.g., at least 85% identical, at least 90% identical, at least 92% identical, at least 94% identical, at least 96% identical, at least 98% identical, at least 99% identical, or 100% identical) to SEQ ID NO: 91, and a light chain variable domain encoded by a nucleic acid that comprises a sequence that is at least 80% identical (e.g., at least 85% identical, at least 90% identical, at least 92% identical, at least 94% identical, at least 96% identical, at least 98% identical, at least 99% identical, or 100% identical) to SEQ ID NO: 92.
- any of the proteins described herein can include an antigen-binding domain that includes a heavy chain variable domain encoded by a nucleic acid that comprises a sequence that is at least 80% identical (e.g., at least 85% identical, at least 90% identical, at least 92% identical, at least 94% identical, at least 96% identical, at least 98% identical, at least 99% identical, or 100% identical) to SEQ ID NO: 93, and a light chain variable domain encoded by a nucleic acid that comprises a sequence that is at least 80% identical (e.g., at least 85% identical, at least 90% identical, at least 92% identical, at least 94% identical, at least 96% identical, at least 98% identical, at least 99% identical, or 100% identical) to SEQ ID NO: 94.
- any of the proteins described herein can include an antigen-binding domain that includes a heavy chain variable domain encoded by a nucleic acid that comprises a sequence that is at least 80% identical (e.g., at least 85% identical, at least 90% identical, at least 92% identical, at least 94% identical, at least 96% identical, at least 98% identical, at least 99% identical, or 100% identical) to SEQ ID NO: 95, and a light chain variable domain encoded by a nucleic acid that comprises a sequence that is at least 80% identical (e.g., at least 85% identical, at least 90% identical, at least 92% identical, at least 94% identical, at least 96% identical, at least 98% identical, at least 99% identical, or 100% identical) to SEQ ID NO: 96.
- any of the proteins described herein can include an antigen-binding domain that includes a heavy chain variable domain encoded by a nucleic acid that comprises a sequence that is at least 80% identical (e.g., at least 85% identical, at least 90% identical, at least 92% identical, at least 94% identical, at least 96% identical, at least 98% identical, at least 99% identical, or 100% identical) to SEQ ID NO: 97, and a light chain variable domain encoded by a nucleic acid that comprises a sequence that is at least 80% identical (e.g., at least 85% identical, at least 90% identical, at least 92% identical, at least 94% identical, at least 96% identical, at least 98% identical, at least 99% identical, or 100% identical) to SEQ ID NO: 98.
- any of the proteins described herein can include an antigen-binding domain that includes a heavy chain variable domain encoded by a nucleic acid that comprises a sequence that is at least 80% identical (e.g., at least 85% identical, at least 90% identical, at least 92% identical, at least 94% identical, at least 96% identical, at least 98% identical, at least 99% identical, or 100% identical) to SEQ ID NO: 99, and a light chain variable domain encoded by a nucleic acid that comprises a sequence that is at least 80% identical (e.g., at least 85% identical, at least 90% identical, at least 92% identical, at least 94% identical, at least 96% identical, at least 98% identical, at least 99% identical, or 100% identical) to SEQ ID NO: 100.
- the proteins can be single-chain polypeptides. In some embodiments, the proteins can be multi-chain polypeptides. In some examples, the proteins described herein can be an antibody, antigen-binding antibody fragment, or a chimeric antigen receptor.
- Antigen-Binding Domains The antigen-binding domains present in any of the proteins described herein (e.g., single- or multi-chain proteins) described herein are each independently selected from the group consisting of: a VHH domain, a VNAR domain, and a scFv.
- any of the antigen-binding domains described herein is a BiTe, a (scFv)2, a nanobody, a nanobody-HSA, a DART, a TandAb, a scDiabody, a scDiabody-CH3, scFv- CH-CL-scFv, a HSAbody, scDiabody-HAS, or a tandem-scFv.
- Additional examples of antigen-binding domains that can be used in any of the proteins described herein are known in the art.
- a VHH domain is a single monomeric variable antibody domain that can be found in camelids.
- a VNAR domain is a single monomeric variable antibody domain that can be found in cartilaginous fish.
- VHH domains and VNAR domains are described in, e.g., Cromie et al., Curr. Top. Med. Chem.15:2543- 2557, 2016; De Genst et al., Dev. Comp. Immunol.30:187-198, 2006; De Meyer et al., Trends Biotechnol.32:263-270, 2014; Kijanka et al., Nanomedicine 10:161-174, 2015; Kovaleva et al., Expert. Opin. Biol. Ther.14:1527-1539, 2014; Krah et al., Immunopharmacol.
- two or more of polypeptides present in the multi-chain protein can assemble (e.g., non-covalently assemble) to form any of the antigen-binding domains described herein, e.g., an antigen-binding fragment of an antibody (e.g., any of the antigen-binding fragments of an antibody described herein), a VHH-scAb, a VHH- Fab, a Dual scFab, a F(ab’)2, a diabody, a crossMab, a DAF (two-in-one), a DAF (four- in-one), a DutaMab, a DT-IgG, a knobs-in-holes common light chain, a
- Non- limiting examples of an antigen-binding fragment of an antibody include an Fv fragment, a Fab fragment, a F(ab') 2 fragment, and a Fab' fragment.
- an antigen-binding fragment of an antibody is an antigen-binding fragment of an IgG (e.g., an antigen-binding fragment of IgG1, IgG2, IgG3, or IgG4) (e.g., an antigen-binding fragment of a human or humanized IgG, e.g., human or humanized IgG1, IgG2, IgG3, or IgG4); an antigen-binding fragment of an IgA (e.g., an antigen-binding fragment of IgA1 or IgA2) (e.g., an antigen-binding fragment of a human or humanized IgA, e.g., a human or humanized IgA1 or IgA2); an antigen-binding fragment of an IgD (e.g., an antigen- binding fragment of a human or humanized IgD); an antigen-binding fragment of an IgE (e.g., an antigen-binding fragment of a human or
- An “Fv” fragment includes a non-covalently-linked dimer of one heavy chain variable domain and one light chain variable domain.
- a “Fab” fragment includes, the constant domain of the light chain and the first constant domain (CH1) of the heavy chain, in addition to the heavy and light chain variable domains of the Fv fragment.
- a “F(ab')2” fragment includes two Fab fragments joined, near the hinge region, by disulfide bonds.
- a “dual variable domain immunoglobulin” or “DVD-Ig” refers to multivalent and multispecific binding proteins as described, e.g., in DiGiammarino et al., Methods Mol.
- a protein described herein can be an antibody (e.g., a human or humanized antibody).
- an antibody can be a human or humanized IgG, e.g., a human or humanized IgG1, IgG2, IgG3, or IgG4.
- an antibody can be a human or humanized IgA (e.g., a human or humanized IgA1 or IgA2).
- an antibody can be a human or humanized IgD, a human or humanized IgE, or a human or humanized IgM.
- any of the proteins described herein can include an Fc receptor (e.g., an Fc receptor including three substitutions of S239D, A330L, and I332E).
- Chimeric Antigen Receptors in some embodiments, can be a chimeric antigen receptor.
- Chimeric antigen receptors include an extracellular antigen-binding domain (e.g., any of the anti-CD26 antigen-binding domains described herein), a transmembrane domain, a costimulatory domain (e.g., an intracellular CD28 domain), and a CD3zeta signaling domain.
- a chimeric antigen receptor can include an extracellular antigen-binding domain (e.g., any of the anti-CD26 antigen-binding domains described herein), a transmembrane domain (e.g., a CD8 alpha transmembrane domain), a CD28 intracellular signaling domain, and a CD3zeta intracellular signaling domain.
- a chimeric antigen receptor can include a hinge region (e.g., a CD8 alpha hinge region) disposed between the extracellular antigen-binding domain and the transmembrane domain.
- a hinge region can comprise a sequence that is at least 80% identical (e.g., at least 85%, at least 90%, at least 92%, at least 94%, at least 96%, at least 98%, at least 99%, or 100% identical) to SEQ ID NO: 254.
- a hinge region can be encoded by a sequence that is at least 80% identical (e.g., at least 85%, at least 90%, at least 92%, at least 94%, at least 96%, at least 98%, at least 99%, or 100% identical) to SEQ ID NO: 255.
- a transmembrane domain can include a sequence that is at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identical to SEQ ID NO: 101 (FWVLVVVGGVLACYSLLVTVAFIIFWV).
- a transmembrane domain can be a transmembrane domain from CD28 (e.g., human CD28).
- a chimeric antigen receptor can include a transmembrane and cytoplasmic signaling domain from CD28 that includes a sequence that is at least 80% identical (e.g., at least 85%, at least 90%, at least 92%, at least 94%, at least 96%, at least 98%, at least 99%, or 100% identical) to SEQ ID NO: 256.
- the transmembrane and cytoplasmic signaling domain from CD28 can be encoded by a sequence that is at least 80% identical (e.g., at least 85%, at least 90%, at least 92%, at least 94%, at least 96%, at least 98%, at least 99%, or 100% identical) to SEQ ID NO: 257.
- a costimulatory domain can include a sequence that is at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identical to SEQ ID NO: 102 (RSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS).
- a CD3zeta signaling domain can include a sequence that is at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identical to SEQ ID NO: 103
- a CD3zeta signaling domain can include a sequence that is at least 80% (e.g., at least 85%, at least 90%, at least 92%, at least 94%, at least 96%, at least 98%, at least 99%, or 100% identical) to SEQ ID NO: 258.
- a CD3zeta signaling domain is encoded by a sequence that is at least 80% identical (e.g., at least 85%, at least 90%, at least 92%, at least 94%, at least 96%, at least 98%, at least 99%, or 100% identical) to SEQ ID NO: 259.
- Human CD3zeta Signaling Domain (SEQ ID NO: 258)
- Human CD3zeta Signaling Domain (SEQ ID NO: 259)
- a chimeric antigen receptor can include a sequence that is at least 80% identical (e.g., at least 85%, at least 90%, at least 92%, at least 94%, at least 96%, at least 98%, at least 99%, or 100% identical) to SEQ ID NO: 253.
- a chimeric antigen receptor can be encoded by a sequence that is at least 80% identical (e.g., at least 85%, at least 90%, at least 92%, at least 94%, at least 96%, at least 98%, at least 99% or 100% identical) to SEQ ID NO: 252.
- Exemplary Anti-CD26 Chimeric Antigen Receptor (with Signal Sequence) SEQ ID NO: 253
- Exemplary Anti-CD26 Chimeric Antigen Receptor with Signal Sequence
- a chimeric antigen receptor can include a sequence that is at least 80% identical (e.g., at least 85%, at least 90%, at least 92%, at least 94%, at least 96%, at least 98%, at least 99%, or 100% identical) to SEQ ID NO: 260.
- a chimeric antigen receptor can be encoded by a sequence that is at least 80% identical (e.g., at least 85%, at least 90%, at least 92%, at least 94%, at least 96%, at least 98%, at least 99% or 100% identical) to SEQ ID NO: 261.
- nucleic acids that include a sequence that encodes any of the proteins described herein.
- a set of nucleic acids that together include sequences that encode any of the multi-chain proteins described herein.
- vectors that include a sequence that encode any of the proteins described herein.
- sets of vectors that together include sequences that encode any of the multi-chain proteins described herein. Non-limiting examples of vectors include expression vectors.
- expression vectors include viral vectors (e.g., a lentivirus vector, an adeno-associated virus vector, or a retrovirus vector). Some embodiments of any of the vectors or nucleic acids described herein can further include a promoter operably linked to a sequence or sequences encoding the protein.
- Cells Also provided herein are cells including a nucleic acid encoding any of the proteins described herein, or a vector comprising any of the nucleic acids described herein. In some examples of any of the cells described herein, the cell is an immune cell.
- the cell is a production cell line, including by not limited to Chinese Hamster ovary (CHO) cells (e.g., CHO.K1, CD-CHO, CHO-S, GS CHO, CHO-DG44, etc.), HEK293, Cos, NS0, Sp2/0, and PerC6 cells.
- CHO Chinese Hamster ovary
- an “immune cell” refers to a cell of the immune system which can be categorized as lymphocytes (e.g., T cells, B cells, and NK cells), neutrophils, and monocytes/macrophages.
- the immune cell is a T cell, a B cell, or a natural killer (NK) cell.
- the immune cell can be a T cell, e.g., a CD4+ T cell, a CD8+ T cell, a Treg cell, a Th1 T cell, a Th2 T cell, a Th17 T cell, an unspecific T cell, or a population of T cells that comprises a combination thereof.
- compositions e.g., pharmaceutical compositions
- compositions that include at least one of any of the proteins described herein or any of the cells described herein.
- compositions e.g., pharmaceutical compositions
- compositions that include at least one of any of the nucleic acids described herein or any of the vectors described herein.
- the compositions can be disposed in a sterile vial or a pre-loaded syringe.
- the compositions e.g., pharmaceutical compositions
- are formulated for different routes of administration e.g., intravenous, subcutaneous, intramuscular, or intratumoral.
- the compositions e.g., pharmaceutical compositions
- can include a pharmaceutically acceptable carrier e.g., phosphate buffered saline.
- Single or multiple administrations of any of the pharmaceutical compositions described herein can be given to a subject depending on, for example: the dosage and frequency as required and tolerated by the patient.
- a dosage of the pharmaceutical composition should provide a sufficient quantity of the protein, nucleic acid, vector, or cell to effectively treat or ameliorate conditions, diseases, or symptoms.
- methods of treating a subject having a cancer e.g., any of the cancers described herein
- methods of treating a subject having a cancer that include administering a therapeutically effective amount of at least one of any of the compositions or pharmaceutical compositions provided herein.
- Kits Also provided herein are kits that include any of the pharmaceutical compositions described herein. In some embodiments, the kits can include instructions for performing any of the methods described herein. In some embodiments, the kits can include at least one dose of any of the compositions (e.g., pharmaceutical compositions) described herein.
- kits can provide a syringe for administering any of the pharmaceutical compositions described herein.
- Methods of Treating Age-Related and Inflammatory Disease in a Subject Provided herein are methods of treating an age-related disease or an inflammatory disease in a subject, that include administering a therapeutically effective amount of any of the proteins described herein or any of the pharmaceutical compositions described herein. Also provided herein are methods of treating an age-related disease or an inflammatory disease in a subject, that include administering a therapeutically effective amount of any of the nucleic acids described herein or any of the pharmaceutical compositions described herein.
- the methods further include administering: (i) a therapeutically effective amount of an NK cell activating agent and/or an NK cell and/or monoclonal antibody; and (ii) a therapeutically effective amount of a Treg cell activating agent and/or a Treg cell and/or a monoclonal antibody and/or an advanced glycation end product (AGE) inhibitor.
- the age-related disease is inflamm-aging related.
- Also provided herein are methods of treating an age-related disease or an inflammatory disease that include administering: (i) a therapeutically effective amount of an NK cell activating agent and/or an NK cell and/or monoclonal antibody; and (ii) a therapeutically effective amount of a Treg cell activating agent and/or a Treg cell and/or a monoclonal antibody and/or an advanced glycation end product (AGE) inhibitor.
- a therapeutically effective amount of an NK cell activating agent and/or an NK cell and/or monoclonal antibody a therapeutically effective amount of a Treg cell activating agent and/or a Treg cell and/or a monoclonal antibody and/or an advanced glycation end product (AGE) inhibitor.
- AGE advanced glycation end product
- (ii) is administered to the subject prior to administration of (i) to the subject.
- the subject is administered the protein, the cell, or the nucleic acid at substantially the same time as (i) and (ii).
- the subject is administered the protein, the cell, or the nucleic acid prior to the administration of (i) and (ii).
- the subject is administered the protein, the cell, or the nucleic acid after the administration of (i) and (ii).
- the method includes administering a therapeutically effective amount of an NK cell to the subject.
- the NK cell is an autologous NK cell.
- the method can further include: isolating the NK cell from the subject; and culturing the isolated NK cell in a liquid culture medium under conditions sufficient to induce or increase proliferation of the NK cell, where following the isolating and culturing steps, the NK cell is administered to the subject.
- the liquid culture medium includes one or more multi-chain chimeric polypeptide(s) (e.g., any of the exemplary multi-chain chimeric polypeptide(s) described herein).
- the NK cell includes a chimeric antigen receptor (e.g., a chimeric antigen receptor comprises an extracellular domain that binds specifically to tissue factor or CD26) (e.g., any of the chimeric antigen receptors described herein that include any of the anti-CD26 antigen-binding domains described herein).
- the method can include administering a therapeutically effective amount of an NK cell activating agent to the subject.
- the NK cell activating agent is one or more multi-chain chimeric polypeptide(s) (e.g., one or more of any of the multi-chain chimeric polypeptides described herein).
- the NK cell activating agent is one or more of an anti-tissue factor antibody, an anti-CD26 antibody (e.g., any of the anti-CD26 antibodies described herein), and/or an anti-CD36 antibody.
- the NK cell activating agent includes one or more multi-chain chimeric polypeptide(s) and one or more of an anti- tissue factor antibody, an anti-CD26 antibody (e.g., any of the anti-CD26 antibodies described herein), and/or an anti-CD36 antibody.
- the method includes administering a therapeutically effective amount of a Treg cell to the subject.
- the Treg cell is an autologous Treg cell.
- the method further includes: isolating the Treg cell from the subject; culturing the isolated Treg cell in a liquid culture medium under conditions sufficient to induce or increase proliferation of the Treg cell, where following the isolating and culturing steps, the Treg cell is administered to the subject.
- the liquid culture medium includes one or more single-chain chimeric polypeptide(s).
- the Treg cell includes a chimeric antigen receptor (e.g., a chimeric antigen receptor including an extracellular domain that binds specifically to tissue factor, CD26 (e.g., any of the anti-CD26 antibodies described herein), and/or CD36).
- the method includes administering a therapeutically effective amount of a Treg cell activating agent to the subject.
- the Treg cell activating agent is one or more single-chain chimeric polypeptide(s) (e.g., one or more of any of the single-chain chimeric polypeptides described herein).
- the Treg cell activating agent is one or both of an anti-tissue factor antibody, anti-CD26 antibody (e.g., any of the anti-CD26 antibodies described herein), and/or an anti-CD36 antibody.
- the Treg cell activating agent is a soluble RAGE trap.
- the Treg cell activating agent includes one or more single- chain chimeric polypeptide(s) and one or more of an anti-tissue factor antibody, an anti- CD26 antibody (e.g., any of the anti-CD26 antibodies described herein), an anti-CD36 antibody, and a soluble RAGE trap.
- the method includes administering a therapeutically effective amount of a monoclonal antibody to the subject.
- a monoclonal antibody comprises one or more of an anti-tissue factor antibody, anti-CD26 antibody (e.g., any of the anti-CD26 antibodies described herein), and/or anti-CD36 antibody that can directly or indirectly reduce inflammasome or senescent cell activity.
- the method includes administering a therapeutically effective amount of an advanced glycation end product (AGE) inhibitor to the subject.
- an advanced glycation end product (AGE) inhibitor comprises one or more of soluble RAGE trap that can directly or indirectly reduce inflammasome or senescent cell activity.
- the aging-related disease is inflamm-aging related.
- Non-limiting examples of aging-related disease is selected from the group consisting of: Alzheimer’s disease, aneurysm, cystic fibrosis, fibrosis in pancreatitis, glaucoma, hypertension, idiopathic pulmonary fibrosis, inflammatory bowel disease, intervertebral disc degeneration, macular degeneration, osteoarthritis, type 2 diabetes mellitus, adipose atrophy, lipodystrophy, atherosclerosis, cataracts, COPD, idiopathic pulmonary fibrosis, kidney transplant failure, liver fibrosis, loss of bone mass, myocardial infarction, sarcopenia, wound healing, alopecia, cardiomyocyte hypertrophy, osteoarthritis, Parkinson’s disease, age-associated loss of lung tissue elasticity, macular degeneration, cachexia, glomerulosclerosis, liver cirrhosis, NAFLD, osteoporosis, amyotrophic lateral sclerosis, Huntington’s disease,
- Non -limiting examples of inflammatory diseases include: rheumatoid arthritis, inflammatory bowel disease, lupus erythematosus, lupus nephritis, amyotrophic lateral sclerosis, diabetic nephropathy, CNS injury, Alzheimer’s disease, Parkinson’s disease, Crohn’s disease, multiple sclerosis, Guillain-Barre syndrome, psoriasis, Grave’s disease, ulcerative colitis, nonalcoholic steatohepatitis, and mood disorders.
- the age-related disease is a cancer.
- Non-limiting examples of cancer are selected from the group consisting of: solid tumor, hematological tumor, sarcoma, osteosarcoma, glioblastoma, neuroblastoma, melanoma, rhabdomyosarcoma, Ewing sarcoma, osteosarcoma, B-cell neoplasms, multiple myeloma, B-cell lymphoma, B-cell non-Hodgkin’s lymphoma, Hodgkin’s lymphoma, chronic lymphocytic leukemia (CLL), acute myeloid leukemia (AML), chronic myeloid leukemia (CML), acute lymphocytic leukemia (ALL), myelodysplastic syndromes (MDS), cutaneous T-cell lymphoma, retinoblastoma, stomach cancer, urothelial carcinoma, lung cancer, renal cell carcinoma, gastric and esophageal cancer, pancreatic cancer, prostate cancer, breast cancer, colorec
- the subject can be a subject identified or diagnosed as having an age-related disease or having chronic inflammation.
- methods of treating cancer in a subject including administering to the subject a therapeutically effective amount of any one of the proteins described herein.
- methods of treating an infectious disease in a subject including administering to the subject a therapeutically effective amount of any one of the proteins described herein.
- methods of treating an infectious disease in a subject including administering to the subject a therapeutically effective amount of any one of the proteins described herein or any one of the pharmaceutical compositions described herein.
- Non-limiting examples of infectious disease include: anthrax, arboviral disease, babesiosis, botulism, brucellosis, campylobacteriosis, cholera, congenital syphilis, covid- 19, dengue virus infections, diphtheria, ehrlichiosis and anaplasmosis, gonorrhea, Hansen’s disease, hantavirus infection, hepatitis, HIV infection, invasive pneumococcal disease, legionellosis, listeriosis, lyme disease, malaria, measles, meningococcal disease, pertussis, rubella, salmonellosis, smallpox, tetanus, tuberculosis, viral hemorrhagic fever, and zika virus disease.
- these methods can result in a reduction in the number, severity, or frequency of one or more symptoms of the age-related disease in the subject (e.g., as compared to the number, severity, or frequency of the one or more symptoms of the cancer in the subject prior to treatment).
- the methods can result in a decrease (e.g., about 1% decrease to about 99% decrease, an about 1% decrease to about 95% decrease, about 1% decrease to about 90% decrease, about 1% decrease to about 85% decrease, about 1% decrease to about 80% decrease, about 1% decrease to about 75% decrease, about 1% to about 70% decrease, about 1% decrease to about 65% decrease, about 1% decrease to about 60% decrease, about 1% decrease to about 55% decrease, about 1% decrease to about 50% decrease, about 1% decrease to about 45% decrease, about 1% decrease to about 40% decrease, about 1% decrease to about 35% decrease, about 1% decrease to about 30% decrease, about 1% decrease to about 25% decrease, about 1% decrease to about 20% decrease, about 1% decrease to about 15% decrease, about 1% decrease to about 10% decrease, about 1% decrease to about 5% decrease, about 5% decrease to about 99% decrease, an about 5% decrease to about 95% decrease, about 5% decrease to about 90% decrease, about 5% decrease to about 85% decrease, about 5% decrease to about 80% decrease,
- the subject or “subject in need of treatment” may be a canine (e.g., a dog), feline (e.g., a cat), equine (e.g., a horse), ovine, bovine, porcine, caprine, primate, e.g., a simian (e.g., a monkey (e.g., marmoset, baboon), or an ape (e.g., a gorilla, chimpanzee, orangutan, or gibbon) or a human; or rodent (e.g., a mouse, a guinea pig, a hamster, or a rat).
- a canine e.g., a dog
- feline e.g., a cat
- equine e.g., a horse
- ovine, bovine, porcine caprine
- primate e.g., a simian (e.g.,
- the subject or “subject in need of treatment” may be a non-human mammal, especially mammals that are conventionally used as models for demonstrating therapeutic efficacy in humans (e.g., murine, lapine, porcine, canine or primate animals) may be employed.
- Treg Cells In some embodiments, a Treg cell can be administered to the subject. In some embodiments, a Treg cell administered to the subject can be an autologous Treg cell, haploidentical Treg cell, or allogenic Treg cell isolated from peripheral blood or umbilical cord blood.
- the methods described herein can further include isolating a Treg cell from a subject, culturing the isolated Treg cell in a liquid culture medium, and administering the Treg cell back to the subject.
- a Treg cell can be isolated using a commercially available kit (see, e.g., EasySep TM Human CD4 + CD127 low CD25 + Regulatory T Cell Isolation Kit or Dynabeads Regulatory CD4 + CD25 + T Cell Kit).
- the liquid culture medium can include one or more of a single-chain chimeric polypeptide (e.g., any of the exemplary single-chain chimeric polypeptides described herein, e.g., 2t2 or 3t28).
- the liquid culture medium can include the use of a bead having on its surface CD3 and CD28, and recombinant IL-2 or 2t2.
- the Treg cell can comprise a chimeric antigen receptor (e.g., a chimeric antigen receptor that includes an extracellular domain that binds specifically to tissue factor, CD26 (e.g., any of the anti-CD26 antigen-binding domains described herein), or CD36).
- extracellular domains that can bind to tissue factor, CD26 or CD36 are scFvs.
- Non-limiting examples of anti-CD36 antibodies are commercially available from Invitrogen, Abcam, GeneTex, Novus Biologicals, Proteintech, and EMD Millipore.
- Treg Cell activating Agents can be administered to the subject.
- the Treg cell activating agent can be a single-chain chimeric polypeptide (e.g., any of the exemplary single-chain chimeric polypeptides described herein), an anti-tissue factor antibody (e.g., the anti-tissue factor antibodies described in U.S. Patent No.7,968,094 and U.S.
- Patent No.8,007,795 a soluble RAGE protein, an anti-CD26 antibody (e.g, any of the anti-CD26 antibodies described herein), or an anti-CD36 antibody.
- a soluble RAGE protein can have a sequence that is at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identical to SEQ ID NO: 104 or SEQ ID NO: 105.
- NK Cells In some embodiments, a NK cell can be administered to the subject.
- a NK cell administered to the subject can be an autologous NK cell, haploidentical NK cells, or allogeneic NK cells isolated from peripheral blood, umbilical cord blood, or isolated and differentiated from iPSC.
- the methods described herein can further include isolating a NK cell from a subject, culturing the isolated NK cell in a liquid culture medium, and administering the NK cell back to the subject.
- a NK cell can be isolated using a commercially available kit (see, e.g., EasySep TM Human NK Cell Isolation Kit, MojoSort Human NK Cell Isolation Kit, and Novus Biologicals Human NK Cell Isolation Kit).
- the liquid culture medium can include one or more of a multi-chain chimeric polypeptide (e.g., any of the exemplary multi-chain chimeric polypeptides described herein, e.g., 18t15-12s and/or 7t15-21s).
- the NK cell can comprise a chimeric antigen receptor (e.g., a chimeric antigen receptor that includes an extracellular domain that binds specifically to tissue factor or CD26).
- extracellular domains that can bind to tissue factor or CD26 are scFvs.
- Non-limiting examples of an anti-CD26 antibodies are commercially available from Abcam, Invitrogen, and GeneTex.
- anti-CD26 antibodies are the anti-CD26 antibodies described herein.
- Non-limiting examples of anti-tissue factor heavy chain variable domain and light chain variable domains are described in U.S. Patent No.7,968,094 and U.S. Patent No.8,007,795.
- Chimeric antigen receptors include a transmembrane domain, a costimulatory domain (e.g., an intracellular CD28 domain), and a CD3zeta signaling domain.
- a transmembrane domain can include a sequence that is at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identical to SEQ ID NO: 101.
- a costimulatory domain can include a sequence that is at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identical to SEQ ID NO: 102.
- a CD3zeta signaling domain can include a sequence that is at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identical to SEQ ID NO: 103.
- NK Cell Activating Agents In some embodiments, one or more NK cell activating agents can be administered to the subject.
- the NK cell activating agent can be one or more multi-chain chimeric polypeptide (e.g., any of the exemplary multi-chain chimeric polypeptides described herein), an anti-tissue factor antibody (e.g., the anti-tissue factor antibodies described in U.S. Patent No.7,968,094 and U.S. Patent No.8,007,795), an anti-CD36 antibody (e.g., the anti-CD36 antibodies commercially available from Invitrogen, Abcam, GeneTex, Novus Biologicals, Proteintech, and EMD Millipore), and an anti-CD26 antibody (e.g., the anti-CD26 antibodies commercially available from Abcam, Invitrogen, and GeneTex).
- an anti-tissue factor antibody e.g., the anti-tissue factor antibodies described in U.S. Patent No.7,968,094 and U.S. Patent No.8,007,795
- an anti-CD36 antibody e.g., the anti-CD36 antibodies commercially available
- NK cell activating agents such as cytokine-based agents, can act by directing activating NK cells or can enhance NK cell activity, such as antibodies mediating antibody-dependent cellular cytotoxicity (ADCC) of NK cells.
- Multi-Chain Chimeric Polypeptides Provided herein are multi-chain chimeric polypeptides that include (a) a first chimeric polypeptide comprising: (i) a first target-binding domain; (ii) a soluble tissue factor domain; and (iii) a first domain of a pair of affinity domains; (b) a second chimeric polypeptide comprising: (i) a second domain of a pair of affinity domains; and (ii) a second target-binding domain, where the first chimeric polypeptide and the second chimeric polypeptide associate through the binding of the first domain and the second domain of the pair of affinity domains.
- the first target-binding domain e.g., any of the first target-binding domains described herein
- the soluble tissue factor domain e.g., any of the exemplary soluble tissue factor domains described herein
- the first chimeric polypeptide further comprises a linker sequence (e.g., any of the exemplary linker sequences described herein or known in the art) between the first target-binding domain (e.g., any of the exemplary first target-binding domains described herein) and the soluble tissue factor domain (e.g., any of the exemplary soluble tissue factor domains described herein) in the first chimeric polypeptide.
- a linker sequence e.g., any of the exemplary linker sequences described herein or known in the art
- the soluble tissue factor domain e.g., any of the exemplary soluble tissue factor domains described herein
- the first domain of the pair of affinity domains e.g., any of the exemplary first domains of any of the exemplary pairs of affinity domains described herein
- the first chimeric polypeptide further comprises a linker sequence (e.g., any of the exemplary linker sequences described herein or known in the art) between the soluble tissue factor domain (e.g., any of the exemplary soluble tissue factor domains described herein) and the first domain of the pair of affinity domains (e.g., any of the exemplary first domains of any of the exemplary pairs of affinity domains described herein) in the first chimeric polypeptide.
- a linker sequence e.g., any of the exemplary linker sequences described herein or known in the art
- the second domain of the pair of affinity domains e.g., any of the exemplary second domains of any of the exemplary pairs of affinity domains described herein
- the second target-binding domain e.g., any of the exemplary second target-binding domains described herein
- the second chimeric polypeptide further comprises a linker sequence (e.g., any of the exemplary linker sequences described herein or known in the art) between the second domain of the pair of affinity domains (e.g., any of the exemplary second domains of any of the exemplary pairs of affinity domains described herein) and the second target- binding domain (e.g., any of the exemplary second target-binding domains described herein) in the second chimeric polypeptide.
- a linker sequence e.g., any of the exemplary linker sequences described herein or known in the art
- Tissue Factor Human tissue factor is a 263 amino-acid transmembrane protein containing three domains: (1) a 219-amino acid N-terminal extracellular domain (residues 1-219); (2) a 22-amino acid transmembrane domain (residues 220-242); and (3) a 21-amino acid cytoplasmic C-terminal tail (residues 242-263) ((UniProtKB Identifier Number: P13726).
- the cytoplasmic tail contains two phosphorylation sites at Ser253 and Ser258, and one S- palmitoylation site at Cys245. Deletion or mutation of the cytoplasmic domain was not found to affect tissue factor coagulation activity.
- Tissue factor has one S-palmitoylation site in the intracellular domain of the protein at Cys245.
- the Cys245 is located at the amino acid terminus of the intracellular domain and close to the membrane surface.
- the tissue factor transmembrane domain is composed of a single-spanning ⁇ -helix.
- the extracellular domain of tissue factor composed of two fibronectin type III domains, is connected to the transmembrane domain through a six-amino acid linker. This linker provides conformational flexibility to decouple the tissue factor extracellular domain from its transmembrane and cytoplasmic domains.
- Each tissue factor fibronectin type III module is composed of two overlapping ⁇ sheets with the top sheet domain containing three antiparallel ⁇ -strands and the bottom sheet containing four ⁇ -strands.
- the ⁇ -strands are connected by ⁇ -loops between strand ⁇ A and ⁇ B, ⁇ C and ⁇ D, and ⁇ E and ⁇ F, all of which are conserved in conformation in the two modules.
- a unique feature of tissue factor is a 17- amino acid ⁇ -hairpin between strand ⁇ 10 and strand ⁇ 11, which is not a common element of the fibronectin superfamily.
- the N-terminal domain also contains a 12 amino acid loop between ⁇ 6F and ⁇ 7G that is not present in the C-terminal domain and is unique to tissue factor.
- a fibronectin type III domain structure is a feature of the immunoglobulin-like family of protein folds and is conserved among a wide variety of extracellular proteins.
- the zymogen FVII is rapidly converted to FVIIa by limited proteolysis once it binds to tissue to form the active tissue factor-FVIIa complex.
- the FVIIa which circulates as an enzyme at a concentration of approximately 0.1 nM (1% of plasma FVII), can also bind directly to tissue factor.
- tissue factor and FVIIa on the tissue factor-FVIIa complex greatly increases the enzymatic activity of FVIIa: an approximate 20- to 100-fold increase in the rate of hydrolysis of small, chromogenic peptidyl substrates, and nearly a million-fold increase in the rate of activation of the natural macromolecular substrates FIX and FX.
- tissue factor-FVIIa complex on phospholipid bilayer i.e., upon exposure of phosphatidyl-L-serine on membrane surfaces
- FIX or FX activation increases the rate of FIX or FX activation, in a Ca 2+ -dependent manner, an additional 1,000-fold.
- the roughly million-fold overall increase in FX activation by tissue factor-FVIIa-phospholipid complex relative to free FVIIa is a critical regulatory point for the coagulation cascade.
- FVII is a ⁇ 50 kDa, single-chain polypeptide consisting of 406 amino acid residues, with an N-terminal ⁇ -carboxyglutamate-rich (GLA) domain, two epidermal growth factor-like domains (EGF1 and EFG2), and a C-terminal serine protease domain.
- GLA N-terminal ⁇ -carboxyglutamate-rich
- EGF1 and EFG2 epidermal growth factor-like domains
- C-terminal serine protease domain is activated to FVIIa by a specific proteolytic cleavage of the Ile- 154 -Arg 152 bond in the short linker region between the EGF2 and the protease domain. This cleavage results in the light and heavy chains being held together by a single disulfide bond of Cys 135 and Cys 262 .
- FVIIa binds phospholipid membrane in a Ca 2+ -dependent manner through its N- terminal GLA-domain.
- GLA domain Immediately C-terminal to the GLA domain is an aromatic stack and two EGF domains.
- the aromatic stack connects the GLA to EGF1 domain which binds a single Ca 2+ ion. Occupancy of this Ca 2+ -binding site increases FVIIa amidolytic activity and tissue factor association.
- the catalytic triad consist of His 193 , Asp 242 , and Ser 344 , and binding of a single Ca 2+ ion within the FVIIa protease domain is critical for its catalytic activity.
- FVIIa Proteolytic activation of FVII to FVIIa frees the newly formed amino terminus at Ile 153 to fold back and be inserted into the activation pocket forming a salt bridge with the carboxylate of Asp 343 to generate the oxyanion hole. Formation of this salt bridge is critical for FVIIa activity. However, oxyanion hole formation does not occur in free FVIIa upon proteolytic activation. As a result, FVIIa circulates in a zymogen-like state that is poorly recognized by plasma protease inhibitors, allowing it to circulate with a half-life of approximately 90 minutes. Tissue factor-mediated positioning of the FVIIa active site above the membrane surface is important for FVIIa towards cognate substrates.
- Free FVIIa adopts a stable, extended structure when bound to the membrane with its active site positioned ⁇ 80 ⁇ above the membrane surface.
- the FVa active site Upon FVIIa binding to tissue factor, the FVa active site is repositioned ⁇ 6 ⁇ closer to the membrane. This modulation may aid in a proper alignment of the FVIIa catalytic triad with the target substrate cleavage site.
- GLA- domainless FVIIa it has been shown that the active site was still positioned a similar distance above the membrane, demonstrating that tissue factor is able to fully support FVIIa active site positioning even in the absence of FVIIa-membrane interaction.
- tissue factor supported full FVIIa proteolytic activity as long as the tissue factor extracellular domain was tethered in some way to the membrane surface.
- raising the active site of FVIIa greater than 80 ⁇ above the membrane surface greatly reduced the ability of the tissue factor-FVIIa complex to activate FX but did not diminish tissue factor-FVIIa amidolytic activity.
- Alanine scanning mutagenesis has been used to assess the role of specific amino acid side chains in the tissue factor extracellular domain for interaction with FVIIa (Gibbs et al., Biochemistry 33(47): 14003-14010, 1994; Schullek et al., J Biol Chem 269(30): 19399-19403, 1994).
- Thr 60 is only partially solvent-exposed and may play a local structural role rather than making a significant contact with ligand.
- the binding site extends onto the concave side of the intermodule angle involving Glu 24 and Gln 110 , and potentially the more distant residue Val 207 .
- the binding region extends from Asp58 onto a convex surface area formed by Lys 48 , Lys 46 , Gln 37 , Asp 44 , and Trp 45 .
- Trp 45 and Asp 44 do not interact independently with FVIIa, indicating that the mutational effect at the Trp 45 position may reflect a structural importance of this side chain for the local packing of the adjacent Asp 44 and Gln 37 side chain.
- the interactive area further includes two surface- exposed aromatic residues, Phe 76 and Tyr 78 , which form part of the hydrophobic cluster in the N-module.
- the known physiologic substrates of tissue factor-FVIIa are FVII, FIX, and FX and certain proteinase-activated receptors.
- Mutational analysis has identified a number of residues that, when mutated, support full FVIIa amidolytic activity towards small peptidyl substrates but are deficient in their ability to support macromolecular substrate (i.e., FVII, FIX, and FX) activation (Ruf et al., J Biol Chem 267(31): 22206-22210, 1992; Ruf et al., J Biol Chem 267(9): 6375-6381, 1992; Huang et al., J Biol Chem 271(36): 21752-21757, 1996; Kirchhofer et al., Biochemistry 39(25): 7380-7387, 2000).
- macromolecular substrate i.e., FVII, FIX, and FX
- tissue factor loop region at residues 159-165, and residues in or adjacent to this flexible loop have been shown to be critical for the proteolytic activity of the tissue factor-FVIIa complex.
- the residues Lys 165 and Lys 166 have also been demonstrated to be important for substrate recognition and binding.
- Lys 165 and Lys 166 face away from each other, with Lys 165 pointing towards FVIIa in most tissue factor-FVIIa structures, and Lys 166 pointing into the substrate binding exosite region in the crystal structure. Putative salt bridge formation between Lys 165 of and Gla 35 of FVIIa would support the notion that tissue factor interaction with the GLA domain of FVIIa modulates substrate recognition.
- the soluble tissue factor domain can be a wildtype tissue factor polypeptide lacking the signal sequence, the transmembrane domain, and the intracellular domain.
- the soluble tissue factor domain can be a tissue factor mutant, wherein a wildtype tissue factor polypeptide lacking the signal sequence, the transmembrane domain, and the intracellular domain, and has been further modified at selected amino acids.
- the soluble tissue factor domain can be a soluble human tissue factor domain. In some examples, the soluble tissue factor domain can be a soluble mouse tissue factor domain. In some examples, the soluble tissue factor domain can be a soluble rat tissue factor domain.
- soluble human tissue factor domains a mouse soluble tissue factor domain, a rat soluble tissue factor domain, and mutant soluble tissue factor domains are shown below.
- a soluble tissue factor domain can include a sequence that is at least 70% identical, at least 72% identical, at least 74% identical, at least 76% identical, at least 78% identical, at least 80% identical, at least 82% identical, at least 84% identical, at least 86% identical, at least 88% identical, at least 90% identical, at least 92% identical, at least 94% identical, at least 96% identical, at least 98% identical, at least 99% identical, or 100% identical to SEQ ID NO: 120, 122, 123,
- a soluble tissue factor domain can include a sequence of SEQ ID NO: 120, 122, 123, 124, or 125, with one to twenty amino acids (e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20) amino acids removed from its N-terminus and/or one to twenty amino acids (e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20) amino acids removed from its C-terminus.
- amino acids e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20
- the soluble tissue factor domain is not capable of binding to Factor VIIa. In some examples of any of the single- or multi-chain chimeric polypeptides described herein, the soluble tissue factor domain does not convert inactive Factor X into Factor Xa.
- the single- or multi-chain chimeric polypeptide does not stimulate blood coagulation in a mammal.
- the soluble tissue factor domain can be a soluble human tissue factor domain.
- the soluble tissue factor domain can be a soluble mouse tissue factor domain.
- the soluble tissue factor domain can be a soluble rat tissue factor domain.
- the soluble tissue factor domain does not include one or more (e.g., two, three, four, five, six, or seven) of: a lysine at an amino acid position that corresponds to amino acid position 20 of mature wildtype human tissue factor protein; an isoleucine at an amino acid position that corresponds to amino acid position 22 of mature wildtype human tissue factor protein; a tryptophan at an amino acid position that corresponds to amino acid position 45 of mature wildtype human tissue factor protein; an aspartic acid at an amino acid position that corresponds to amino acid position 58 of mature wildtype human tissue factor protein; a tyrosine at an amino acid position that corresponds to amino acid position 94 of mature wildtype human tissue factor protein; an arginine at an amino acid position that corresponds to amino acid position 135 of mature wildtype human tissue factor protein; and a phenylalanine at an amino acid position that corresponds to amino acid position 140 of mature wildtype human tissue factor protein.
- a lysine at an amino acid position that corresponds to amino acid position
- the mutant soluble tissue factor possesses the amino acid sequence of SEQ ID NO: 122 or SEQ ID NO: 123.
- the soluble tissue factor domain can be encoded by a nucleic acid including a sequence that is at least 70% identical, at least 72% identical, at least 74% identical, at least 76% identical, at least 78% identical, at least 80% identical, at least 82% identical, at least 84% identical, at least 86% identical, at least 88% identical, at least 90% identical, at least 92% identical, at least 94% identical, at least 96% identical, at least 98% identical, at least 99% identical, or 100% identical to SEQ ID NO: 121.
- Linker Sequences In some embodiments, the linker sequence can be a flexible linker sequence.
- linker sequences that can be used are described in Klein et al., Protein Engineering, Design & Selection 27(10):325–330, 2014; Priyanka et al., Protein Sci.22(2):153–167, 2013.
- the linker sequence is a synthetic linker sequence.
- the first chimeric polypeptide can include one, two, three, four, five, six, seven, eight, nine, or ten linker sequence(s) (e.g., the same or different linker sequences, e.g., any of the exemplary linker sequences described herein or known in the art).
- the second chimeric polypeptide can include one, two, three, four, five, six, seven, eight, nine, or ten linker sequence(s) (e.g., the same or different linker sequences, e.g., any of the exemplary linker sequences described herein or known in the art).
- a linker sequence can have a total length of 1 amino acid to about 100 amino acids, 1 amino acid to about 90 amino acids, 1 amino acid to about 80 amino acids, 1 amino acid to about 70 amino acids, 1 amino acid to about 60 amino acids, 1 amino acid to about 50 amino acids, 1 amino acid to about 45 amino acids, 1 amino acid to about 40 amino acids, 1 amino acid to about 35 amino acids, 1 amino acid to about 30 amino acids, 1 amino acid to about 25 amino acids, 1 amino acid to about 24 amino acids, 1 amino acid to about 22 amino acids, 1 amino acid to about 20 amino acids, 1 amino acid to about 18 amino acids, 1 amino acid to about 16 amino acids, 1 amino acid to about 14 amino acids, 1 amino acid to about 12 amino acids, 1 amino acid to about 10 amino acids, 1 amino acid to about 8 amino acids, 1 amino acid to about 6 amino acids, 1 amino acid to about 4 amino acids, about 2 amino acids to about 100 amino acids, about 2 amino acids to about 90 amino acids, about 2 amino acids to about 80 amino acids, about 2 amino acids to about 70 amino acids,
- the linker is rich in glycine (Gly or G) residues. In some embodiments, the linker is rich in serine (Ser or S) residues. In some embodiments, the linker is rich in glycine and serine residues. In some embodiments, the linker has one or more glycine-serine residue pairs (GS), e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more GS pairs. In some embodiments, the linker has one or more Gly-Gly-Gly-Ser (GGGS) sequences, e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more GGGS sequences.
- GS glycine-serine residue pairs
- GGGS Gly-Gly-Gly-Ser
- the linker has one or more Gly-Gly-Gly-Gly-Ser (GGGGS) sequences, e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more GGGGS sequences. In some embodiments, the linker has one or more Gly-Gly-Ser-Gly (GGSG) sequences, e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more GGSG sequences. In some embodiments, the linker sequence can comprise or consist of NO: 126). In some embodiments, the linker sequence can be encoded by a nucleic acid comprising or consisting of: NO: 127).
- the linker sequence can comprise or consist of: Target-Binding Domains
- the first target-binding domain, the second target-binding domain, and/or the additional one or more target-binding domains can be an antigen-binding domain (e.g., any of the exemplary antigen-binding domains described herein or known in the art), a soluble interleukin or cytokine protein (e.g., any of the exemplary soluble interleukin proteins or soluble cytokine proteins described herein), and a soluble interleukin or cytokine receptor (e.g., any of the exemplary soluble interleukin receptors or soluble cytokine receptors described herein).
- an antigen-binding domain e.g., any of the exemplary antigen-binding domains described herein or known in the art
- a soluble interleukin or cytokine protein e.g., any of the exemplary soluble interleukin proteins or soluble cytokine proteins
- one or more of the first target-binding domain e.g., any of the exemplary first target binding domains described herein or known in the art
- the second target-binding domain e.g., any of the exemplary second target binding domains described herein or known in the art
- the one or more additional target binding domains can each, independently, bind specifically to a target selected from the group of: bind specifically to a target selected from the group consisting of: CD16a, CD28, CD3 (e.g., one or more of CD3 ⁇ , CD3 ⁇ , CD3 ⁇ , CD3 ⁇ , and CD3 ⁇ ), CD33, CD20, CD19, CD22, CD123, IL-1R, IL-1, VEGF, IL-6R, IL-4, IL-10, PDL-1, TIGIT, PD-1, TIM3, CTLA4, MICA, MICB, IL-6, IL-8, TNF
- the first target-binding domain, the second target-binding domain, and/or the one or more additional target-binding domains can each independent have a total number of amino acids of about 5 amino acids to about 1000 amino acids, about 5 amino acids to about 950 amino acids, about 5 amino acids to about 900 amino acids, about 5 amino acids to about 850 amino acids, about 5 amino acids to about 800 amino acids, about 5 amino acids to about 750 amino acids, about 5 amino acids to about 700 amino acids, about 5 amino acids to about 650 amino acids, about 5 amino acids to about 600 amino acids, about 5 amino acids to about 550 amino acids, about 5 amino acids to about 500 amino acids, about 5 amino acids to about 450 amino acids, about 5 amino acids to about 400 amino acids, about 5 amino acids to about 350 amino acids, about 5 amino acids to about 300 amino acids, about 5 amino acids to about 280 amino acids, about 5 amino acids to about 260 amino acids, about 5 amino acids to about 240 amino acids, about 5 amino acids to about 350 amino acids, about 5 amino acids to about 300 amino acids, about 5
- any of the target-binding domains described herein can bind to its target with a dissociation equilibrium constant (KD) of less than 1 x 10 -7 M, less than 1 x 10 -8 M, less than 1 x 10 -9 M, less than 1 x 10 -10 M, less than 1 x 10 -11 M, less than 1 x 10 -12 M, or less than 1 x 10 -13 M.
- KD dissociation equilibrium constant
- the antigen-binding protein construct provided herein can bind to an identifying antigen with a KD of about 1 x 10 -3 M to about 1 x 10 -5 M, about 1 x 10 -4 M to about 1 x 10 -6 M, about 1 x 10 -5 M to about 1 x 10 -7 M, about 1 x 10 -6 M to about 1 x 10 -8 M, about 1 x 10 -7 M to about 1 x 10 -9 M, about 1 x 10 -8 M to about 1 x 10 -10 M, or about 1 x 10 -9 M to about 1 x 10 -11 M (inclusive).
- any of the target-binding domains described herein can bind to its target with a K D of between about 1 pM to about 30 nM (e.g., about 1 pM to about 25 nM, about 1 pM to about 20 nM, about 1 pM to about 15 nM, about 1 pM to about 10 nM, about 1 pM to about 5 nM, about 1 pM to about 2 nM, about 1 pM to about 1 nM, about 1 pM to about 950 pM, about 1 pM to about 900 pM, about 1 pM to about 850 pM, about 1 pM to about 800 pM, about 1 pM to about 750 pM, about 1 pM to about 700 pM, about 1 pM to about 650 pM, about 1 pM to about 600 pM, about 1 pM to about 550 pM, about 1 pM to about 500 pM, about 1
- any of the target-binding domains described herein can bind to its target with a K D of between about 1 nM to about 10 nM (e.g., about 1 nM to about 9 nM, about 1 nM to about 8 nM, about 1 nM to about 7 nM, about 1 nM to about 6 nM, about 1 nM to about 5 nM, about 1 nM to about 4 nM, about 1 nM to about 3 nM, about 1 nM to about 2 nM, about 2 nM to about 10 nM, about 2 nM to about 9 nM, about 2 nM to about 8 nM, about 2 nM to about 7 nM, about 2 nM to about 6 nM, about 2 nM to about 5 nM, about 2 nM to about 4 nM, about 2 nM to about 3 nM, about 3 nM to about 10 nM, about 3 nM to about 10
- any of the polypeptides described herein e.g., an electrophoretic mobility shift assay, a filter binding assay, surface plasmon resonance, and a biomolecular binding kinetics assay, etc.
- Antigen-Binding Domains In some embodiments of any of the single- or multi-chain chimeric polypeptides described herein, the first target-binding domain and the second target-binding domain bind specifically to the same antigen. In some embodiments of these single- or multi- chain chimeric polypeptides, the first target-binding domain and the second target- binding domain bind specifically to the same epitope.
- the first target-binding domain and the second target-binding domain include the same amino acid sequence. In some embodiments of any of the single- or multi-chain chimeric polypeptides described herein, the first target-binding domain and the second target-binding domain bind specifically to different antigens. In some embodiments of any of the single- or multi-chain chimeric polypeptides described herein, one or both of the first target-binding domain and the second target- binding domain is an antigen-binding domain.
- the first target-binding domain and the second target-binding domain are each antigen-binding domains.
- the antigen-binding domain includes or is a scFv or a single domain antibody (e.g., a VHH or a VNAR domain).
- an antigen-binding domain e.g., any of the antigen-binding domains described herein
- Patent No.9,035,026) CD28 (see, e.g., those described in U.S. Patent No.7,723,482), CD3 (see, e.g., those described in U.S. Patent No.9,226,962), CD33 (see, e.g., those described in U.S. Patent No.8,759,494), CD20 (see, e.g., those described in WO 2014/026054), CD19 (see, e.g., those described in U.S.
- Patent No.9,701,758 CD22 (see, e.g., those described in WO 2003/104425), CD123 (see, e.g., those described in WO 2014/130635), IL-1R (see, e.g., those described in U.S. Patent No.8,741,604), IL- 1 (see, e.g., those described in WO 2014/095808), VEGF (see, e.g., those described in U.S. Patent No.9,090,684), IL-6R (see, e.g., those described in U.S. Patent No. 7,482,436), IL-4 (see, e.g., those described in U.S. Patent Application Publication No.
- IL-10 see, e.g., those described in U.S. Patent Application Publication No.2016/0340413
- PDL-1 see, e.g., those described in Drees et al., Protein Express. Purif.94:60-66, 2014
- TIGIT see, e.g., those described in U.S. Patent Application Publication No.2017/0198042
- PD-1 see, e.g., those described in U.S. Patent No. 7,488,802
- TIM3 see, e.g., those described in U.S.
- Patent No.8,552,156 CTLA4 (see, e.g., those described in WO 2012/120125), MICA (see, e.g., those described in WO 2016/154585), MICB (see, e.g., those described in U.S. Patent No.8,753,640), IL-6 (see, e.g., those described in Gejima et al., Human Antibodies 11(4):121-129, 2002), IL-8 (see, e.g., those described in U.S. Patent No.6,117,980), TNF ⁇ (see, e.g., those described in Geng et al., Immunol.
- CD26a see, e.g., those described in WO 2017/189526
- CD36 see, e.g., those described in U.S. Patent Application Publication No.2015/0259429
- ULBP2 see, e.g., those described in U.S. Patent No. 9,273,136
- CD30 see, e.g., those described in Homach et al., Scand. J. Immunol. 48(5):497-501, 1998)
- CD200 see, e.g., those described in U.S. Patent No.9,085,623
- IGF-1R see, e.g., those described in U.S. Patent Application Publication No.
- MUC4AC see, e.g., those described in WO 2012/170470
- MUC5AC see, e.g., those described in U.S. Patent No.9,238,084
- Trop-2 see, e.g., those described in WO 2013/068946
- CMET see, e.g., those described in Edwardraja et al., Biotechnol. Bioeng.106(3):367-375, 2010
- EGFR see, e.g., those described in Akbari et al., Protein Expr. Purif.127:8-15, 2016
- HER1 see, e.g., those described in U.S.
- HER2 see, e.g., those described in Cao et al., Biotechnol. Lett.37(7):1347-1354, 2015
- HER3 see, e.g., those described in U.S. Patent No.9,505,843
- PSMA see, e.g., those described in Parker et al., Protein Expr. Purif.89(2):136-145, 2013
- CEA see, e.g., those described in WO 1995/015341
- B7H3 see, e.g., those described in U.S.
- Patent No.9,371,395) EPCAM (see, e.g., those described in WO 2014/159531), BCMA (see, e.g., those described in Smith et al., Mol. Ther.26(6):1447-1456, 2018), P-cadherin (see, e.g., those described in U.S. Patent No. 7,452,537), CEACAM5 (see, e.g., those described in U.S. Patent No.9,617,345), a UL16-binding protein (see, e.g., those described in WO 2017/083612), HLA-DR (see, e.g., Pistillo et al., Exp. Clin.
- any of the antigen-binding domains present in any of the single- or multi-chain chimeric polypeptides described herein are each independently selected from the group consisting of: a VHH domain, a VNAR domain, and a scFv.
- any of the antigen-binding domains described herein is a BiTe, a (scFv) 2 , a nanobody, a nanobody- HSA, a DART, a TandAb, a scDiabody, a scDiabody-CH3, scFv-CH-CL-scFv, a HSAbody, scDiabody-HAS, or a tandem-scFv.
- a VHH domain is a single monomeric variable antibody domain that can be found in camelids.
- a VNAR domain is a single monomeric variable antibody domain that can be found in cartilaginous fish.
- Non-limiting aspects of VHH domains and V NAR domains are described in, e.g., Cromie et al., Curr. Top. Med. Chem.15:2543-2557, 2016; De Genst et al., Dev. Comp.
- each of the antigen-binding domains in the single- or multi-chain chimeric polypeptides described herein are both VHH domains, or at least one antigen-binding domain is a VHH domain. In some embodiments, each of the antigen-binding domains in the single- or multi-chain chimeric polypeptides described herein are both VNAR domains, or at least one antigen-binding domain is a VNAR domain. In some embodiments, each of the antigen-binding domains in the single- or multi-chain chimeric polypeptides described herein are both scFv domains, or at least one antigen-binding domain is a scFv domain.
- two or more of polypeptides present in the single- or multi-chain chimeric polypeptide can assemble (e.g., non-covalently assemble) to form any of the antigen-binding domains described herein, e.g., an antigen-binding fragment of an antibody (e.g., any of the antigen-binding fragments of an antibody described herein), a VHH-scAb, a VHH-Fab, a Dual scFab, a F(ab’)2, a diabody, a crossMab, a DAF (two- in-one), a DAF (four-in-one), a DutaMab, a DT-IgG, a knobs-in-holes common light chain, a knobs-in-holes assembly, a charge pair, a Fab-arm exchange, a SEEDbody, a LUZ-Y, a Fcab, a ⁇ -body, an orthogonal Fab
- Non-limiting examples of an antigen-binding fragment of an antibody include an Fv fragment, a Fab fragment, a F(ab') 2 fragment, and a Fab' fragment.
- an antigen-binding fragment of an antibody is an antigen-binding fragment of an IgG (e.g., an antigen-binding fragment of IgG1, IgG2, IgG3, or IgG4) (e.g., an antigen-binding fragment of a human or humanized IgG, e.g., human or humanized IgG1, IgG2, IgG3, or IgG4); an antigen-binding fragment of an IgA (e.g., an antigen-binding fragment of IgA1 or IgA2) (e.g., an antigen-binding fragment of a human or humanized IgA, e.g., a human or humanized IgA1 or IgA2); an antigen-binding fragment of an IgD (e.g., an antigen-binding fragment of a human or humanized IgD); an antigen-binding fragment of an IgE (e.g., an antigen-binding fragment of a human
- any of the antigen-binding domains described herein can bind to an antigen selected from the group consisting of: a protein, a carbohydrate, a lipid, and a combination thereof. Additional examples and aspects of antigen-binding domains are known in the art. Soluble Interleukin or Cytokine Protein In some embodiments of any of the single- or multi-chain chimeric polypeptides described herein, one or both of the first target-binding domain and the second target- binding domain can be a soluble interleukin protein or soluble cytokine protein.
- the soluble interleukin or soluble cytokine protein is selected from the group of: IL-2, IL-3, IL-7, IL-8, IL-10, IL-12, IL-15, IL-17, IL-18, IL-21, PDGF-DD, SCF, and FLT3L.
- soluble IL-2, IL-3, IL-7, IL-8, IL-10, IL-15, IL-17, IL-18, IL-21, PDGF-DD, SCF, and FLT3L are provided below.
- Human Soluble IL-2 (SEQ ID NO: 129) Human Soluble IL-3 (SEQ ID NO: 130) a n g Human Soluble IL-7 (SEQ ID NO: 131) Human Soluble IL-8 (SEQ ID NO: 132) Human Soluble IL-10 (SEQ ID NO: 133) Human Soluble IL-15 (SEQ ID NO: 134) Human Soluble IL-17 (SEQ ID NO: 135) Human Soluble IL-18 (SEQ ID NO: 136) Human Soluble PDGF-DD (SEQ ID NO: 137) Human Soluble SCF (SEQ ID NO: 138) Human Soluble FLT3L (SEQ ID NO: 139)
- soluble MICA, MICB, ULBP1, ULBP2, ULBP3, ULBP4, ULBP5, and ULBP6 are provided below.
- Human Soluble MICA Human Soluble MICB (SEQ ID NO: 141) Human Soluble ULBP1 (SEQ ID NO: 142) Human Soluble ULBP2 (SEQ ID NO: 143) Human Soluble ULBP3 (SEQ ID NO: 144) Human Soluble ULBP4 (SEQ ID NO: 145) Human Soluble ULBP5 (SEQ ID NO: 146) Human Soluble ULBP6 (SEQ ID NO: 147) Additional examples of soluble interleukin proteins and soluble cytokine proteins are known in the art.
- Soluble Receptor In some embodiments of any of the single- or multi-chain chimeric polypeptides described herein, one or both of the first target-binding domain and the second target- binding domain is a soluble interleukin receptor, a soluble cytokine receptor or a ligand receptor. In some embodiments, the soluble receptor is a soluble TGF- ⁇ receptor II (TGF- ⁇ RII) (see, e.g., those described in Yung et al., Am. J. Resp. Crit. Care Med.
- TGF- ⁇ RII soluble TGF- ⁇ receptor II
- a soluble TGF- ⁇ RIII see, e.g., those described in Heng et al., Placenta 57:320, 2017
- a soluble NKG2D see, e.g., Cosman et al., Immunity 14(2):123- 133, 2001; Costa et al., Front. Immunol., Vol.9, Article 1150, May 29, 2018; doi: 10.3389/fimmu.2018.01150
- a soluble NKp30 see, e.g., Costa et al., Front.
- a soluble NKp44 see, e.g., those described in Costa et al., Front. Immunol., Vol.9, Article 1150, May 29, 2018; doi: 10.3389/fimmu.2018.01150
- a soluble NKp46 see, e.g., Mandelboim et al., Nature 409:1055-1060, 2001; Costa et al., Front.
- the first chimeric polypeptide further includes one or more (e.g., two, three, four, five, six, seven, eight, nine, or ten) additional target-binding domain(s) (e.g., any of the exemplary target-binding domains described herein or known in the art).
- At least one of the one or more additional antigen-binding domain(s) can be positioned between the soluble tissue factor domain (e.g., any of the exemplary soluble tissue factor domains described herein or known in the art) and the first domain of the pair of affinity domains (e.g., any of the exemplary first domains of any of the exemplary pairs of affinity domains described herein).
- the first chimeric polypeptide can further include a linker sequence (e.g., any of the exemplary linker sequences described herein or known in the art) between the soluble tissue factor domain (e.g., any of the exemplary soluble tissue factor domains described herein) and the at least one of the one or more additional target- binding domain(s) (e.g., any of the exemplary target-binding domains described herein or known in the art), and/or a linker sequence (e.g., any of the exemplary linker sequences described herein or known in the art) between the at least one of the one or more additional target-binding domain(s) (e.g., any of the exemplary target-binding domains described herein or known in the art) and the first domain of the pair of affinity domains (e.g., any of the exemplary first domains described herein of any of the exemplary pairs of affinity domains described herein).
- a linker sequence e.g., any of the exemplary linker sequences
- the first chimeric polypeptide further includes one or more (e.g., two, three, four, five, six, seven, eight, nine, or ten) additional target-binding domains at the N-terminal and/or C-terminal end of the first chimeric polypeptide.
- At least one of the one or more additional target-binding domains directly abuts the first domain of the pair of affinity domains (e.g., any of the exemplary first domains described herein of any of the exemplary pairs of affinity domains described herein) in the first chimeric polypeptide.
- the first chimeric polypeptide further includes a linker sequence (e.g., any of the exemplary linker sequences described herein or known in the art) between the at least one of the one or more additional target-binding domains (e.g., any of the exemplary target-binding domains described herein or known in the art) and the first domain of the pair of affinity domains (e.g., any of the exemplary first domains described herein of any of the exemplary pairs of affinity domains described herein).
- a linker sequence e.g., any of the exemplary linker sequences described herein or known in the art
- the at least one of the one or more additional target-binding domains directly abuts the first target-binding domain (e.g., any of the exemplary target-binding domains described herein or known in the art) in the first chimeric polypeptide.
- the first chimeric polypeptide further comprises a linker sequence (e.g., any of the exemplary linker sequences described herein or known in the art) between the at least one of the one or more additional target-binding domains (e.g., any of the exemplary target-binding domains described herein or known in the art) and the first target-binding domain (e.g., any of the exemplary target-binding domains described herein or known in the art).
- a linker sequence e.g., any of the exemplary linker sequences described herein or known in the art
- At least one of the one or more additional target-binding domains is disposed at the N- and/or C-terminus of the first chimeric polypeptide, and at least one of the one or more additional target-binding domains (e.g., any of the exemplary target-binding domains described herein or known in the art) is positioned between the soluble tissue factor domain (e.g., any of the exemplary soluble tissue factor domains described herein or known in the art) and the first domain of the pair of affinity domains (e.g., any of the exemplary first domains of any of the exemplary pairs of affinity domains described herein) in the first chimeric polypeptide.
- the soluble tissue factor domain e.g., any of the exemplary soluble tissue factor domains described herein or known in the art
- affinity domains e.g., any of the exemplary first domains of any of the exemplary pairs of affinity domains described herein
- the at least one additional target-binding domain (e.g., any of the exemplary target-binding domains described herein or known in the art) of the one or more additional target-binding domains disposed at the N-terminus directly abuts the first target-binding domain (e.g., any of the exemplary target-binding domains described herein or known in the art) or the first domain of the pair of affinity domains (e.g., any of the exemplary first domains described herein of any of the exemplary pairs of affinity domains described herein) in the first chimeric polypeptide.
- the first chimeric polypeptide further comprises a linker sequence (e.g., any of the linker sequences described herein or known in the art) disposed between the at least one additional target-binding domain (e.g., any of the exemplary target-binding domains described herein or known in the art) and the first target-binding domain (e.g., any of the exemplary target-binding domains described herein or known in the art) or the first domain of the pair of affinity domains (e.g., any of the exemplary first domains described herein of any of the exemplary pairs of affinity domains described herein) in the first chimeric polypeptide.
- a linker sequence e.g., any of the linker sequences described herein or known in the art
- the at least one additional target-binding domain (e.g., any of the exemplary target-binding domains described herein or known in the art) of the one or more additional target-binding domains disposed at the C-terminus directly abuts the first target-binding domain (e.g., any of the exemplary target-binding domains described herein or known in the art) or the first domain of the pair of affinity domains (e.g., any of the exemplary first domains of any of the exemplary pairs of affinity domains described herein) in the first chimeric polypeptide.
- the first chimeric polypeptide further includes a linker sequence (e.g., any of the exemplary linker sequences described herein or known in the art) disposed between the at least one additional target-binding domain (e.g., any of the exemplary target-binding domains described herein or known in the art) and the first target-binding domain (e.g., any of the exemplary target-binding domains described herein or known in the art) or the first domain of the pair of affinity domains (e.g., any of the exemplary first domains described herein of any of the exemplary pairs of affinity domains described herein) in the first chimeric polypeptide.
- a linker sequence e.g., any of the exemplary linker sequences described herein or known in the art
- the at least one of the one or more additional target-binding domains positioned between the soluble tissue factor domain (e.g., any of the exemplary soluble tissue factor domains described herein) and the first domain of the pair of affinity domains (e.g., any of the first domains described herein or any of the exemplary pairs of affinity domains described herein), directly abuts the soluble tissue factor domain and/or the first domain of the pair of affinity domains.
- the first chimeric polypeptide further comprises a linker sequence (e.g., any of the exemplary linker sequences described herein or known in the art) disposed (i) between the soluble tissue factor domain (e.g., any of the exemplary soluble tissue factor domains described herein) and the at least one of the one or more additional target-binding domains (e.g., any of the exemplary target-binding domains described herein or known in the art) positioned between the soluble tissue factor domain (e.g., any of the exemplary soluble tissue factor domains described herein) and the first domain of the pair of affinity domains (e.g., any of the exemplary first domains of any of the exemplary pairs of affinity domains described herein), and/or (ii) between the first domain of the pair of affinity domains and the at least one of the one or more additional target-binding domains positioned between the soluble tissue factor domain and the first domain of the pair of affinity domains.
- a linker sequence e.g.,
- the second chimeric polypeptide further includes one or more (e.g., two, three, four, five, six, seven, eight, nine, or ten) additional target-binding domains (e.g., any of the exemplary target-binding domains described herein or known in the art) at the N- terminal end and/or the C-terminal end of the second chimeric polypeptide.
- additional target-binding domains e.g., any of the exemplary target-binding domains described herein or known in the art
- At least one of the one or more additional target-binding domains directly abuts the second domain of the pair of affinity domains (e.g., any of the exemplary second domains of any of the exemplary pairs of affinity domains described herein) in the second chimeric polypeptide.
- the second chimeric polypeptide further includes a linker sequence (e.g., any of the exemplary linker sequences described herein or known in the art) between at least one of the one or more additional target- binding domains (e.g., any of the exemplary target-binding domains described herein or known in the art) and the second domain of the pair of affinity domains (e.g., any of the second domains described herein of any of the exemplary pairs of affinity domains described herein) in the second chimeric polypeptide.
- a linker sequence e.g., any of the exemplary linker sequences described herein or known in the art
- At least one of the one or more additional target-binding domains directly abuts the second target- binding domain (e.g., any of the target-binding domains described herein or known in the art) in the second chimeric polypeptide.
- the second chimeric polypeptide further includes a linker sequence (e.g., any of the exemplary linker sequences described herein or known in the art) between at least one of the one or more additional target-binding domains (e.g., any of the exemplary target binding domains described herein or known in the art) and the second target-binding domain (e.g., any of the exemplary target binding domains described herein or known in the art) in the second chimeric polypeptide.
- a linker sequence e.g., any of the exemplary linker sequences described herein or known in the art
- two or more (e.g., three or more, four or more, five or more, six or more, seven or more, eight or more, nine or more, or ten or more) of the first target-binding domain, the second target-binding domain, and the one or more additional target-binding domains bind specifically to the same antigen.
- two or more (e.g., three or more, four or more, five or more, six or more, seven or more, eight or more, nine or more, or ten or more) of the first target-binding domain, the second target-binding domain, and the one or more additional target-binding domains bind specifically to the same epitope.
- two or more (e.g., three or more, four or more, five or more, six or more, seven or more, eight or more, nine or more, or ten or more) of the first target-binding domain, the second target-binding domain, and the one or more additional target-binding domains include the same amino acid sequence.
- the first target-binding domain, the second target-binding domain, and the one or more additional target-binding domains each bind specifically to the same antigen.
- the first target-binding domain, the second target-binding domain, and the one or more additional target-binding domains each bind specifically to the same epitope.
- the first target-binding domain, the second target-binding domain, and the one or more additional target-binding domains each include the same amino acid sequence. In some embodiments of any of the multi-chain chimeric polypeptides described herein, the first target-binding domain, the second target-binding domain, and the one or more additional target-binding domains bind specifically to different antigens.
- one or more (e.g., two or more, three or more, four or more, five or more, six or more, seven or more, eight or more, nine or more, or ten or more) of the first target-binding domain, the second target-binding domain, and the one or more target-binding domains is an antigen- binding domain.
- the first target-binding domain, the second target-binding domain, and the one or more additional target-binding domains are each an antigen-binding domain (e.g., a scFv or a single-domain antibody).
- a multi-chain chimeric polypeptide includes: 1) a first chimeric polypeptide that includes a first domain of a pair of affinity domains, and 2) a second chimeric polypeptide that includes a second domain of a pair of affinity domains such that the first chimeric polypeptide and the second chimeric polypeptide associate through the binding of the first domain and the second domain of the pair of affinity domains.
- the pair of affinity domains is a sushi domain from an alpha chain of human IL-15 receptor (IL15R ⁇ ) and a soluble IL-15.
- a sushi domain also known as a short consensus repeat or type 1 glycoprotein motif, is a common motif in protein-protein interaction.
- Sushi domains have been identified on a number of protein- binding molecules, including complement components C1r, C1s, factor H, and C2m, as well as the nonimmunologic molecules factor XIII and ⁇ 2-glycoprotein.
- a typical Sushi domain has approximately 60 amino acid residues and contains four cysteines (Ranganathan, Pac. Symp Biocomput.2000:155-67). The first cysteine can form a disulfide bond with the third cysteine, and the second cysteine can form a disulfide bridge with the fourth cysteine.
- the soluble IL15 has a D8N or D8A amino acid substitution.
- the human IL15R ⁇ is a mature full- length IL15R ⁇ .
- the pair of affinity domains is barnase and barnstar.
- the pair of affinity domains is a PKA and an AKAP.
- the pair of affinity domains is an adapter/docking tag module based on mutated RNase I fragments (Rossi, Proc Natl Acad Sci USA.103:6841-6846, 2006; Sharkey et al., Cancer Res.68:5282-5290, 2008; Rossi et al., Trends Pharmacol Sci.
- a first chimeric polypeptide of a multi-chain chimeric polypeptide includes a first domain of a pair of affinity domains and a second chimeric polypeptide of the multi-chain chimeric polypeptide includes a second domain of a pair of affinity domains, wherein the first domain of the pair of affinity domains and the second domain of the pair of affinity domains bind to each other with a dissociation equilibrium constant (KD) of less than 1 x 10 -7 M, less than 1 x 10 -8 M, less than 1 x 10 -9 M, less than 1 x 10 -10 M, less than 1 x 10 -11 M, less than 1 x 10 -12 M, or less than 1 x 10 -13 M.
- KD dissociation equilibrium constant
- the first domain of the pair of affinity domains and the second domain of the pair of affinity domains bind to each other with a KD of about 1 x 10 -4 M to about 1 x 10 -6 M, about 1 x 10 -5 M to about 1 x 10 -7 M, about 1 x 10 -6 M to about 1 x 10 -8 M, about 1 x 10 -7 M to about 1 x 10 -9 M, about 1 x 10 -8 M to about 1 x 10 -10 M, about 1 x 10 -9 M to about 1 x 10 -11 M, about 1 x 10 -10 M to about 1 x 10 -12 M, about 1 x 10 -11 M to about 1 x 10 -13 M, about 1 x 10 -4 M to about 1 x 10 -5 M, about 1 x 10 -5 M to about 1 x 10- 6 M, about 1 x 10 -6 M to about 1 x 10 -7 M, about 1 x 10 -7 M to about 1 x 10 -8 M, about 1 x 10 -4
- any of a variety of different methods known in the art can be used to determine the KD value of the binding of the first domain of the pair of affinity domains and the second domain of the pair of affinity domains (e.g., an electrophoretic mobility shift assay, a filter binding assay, surface plasmon resonance, and a biomolecular binding kinetics assay, etc.).
- a first chimeric polypeptide of a multi-chain chimeric polypeptide includes a first domain of a pair of affinity domains and a second chimeric polypeptide of the multi-chain chimeric polypeptide includes a second domain of a pair of affinity domains, wherein the first domain of the pair of affinity domains, the second domain of the pair of affinity domains, or both is about 10 to 100 amino acids in length.
- a first domain of a pair of affinity domains, a second domain of a pair of affinity domains, or both can be about 10 to 100 amino acids in length, about 15 to 100 amino acids in length, about 20 to 100 amino acids in length, about 25 to 100 amino acids in length, about 30 to 100 amino acids in length, about 35 to 100 amino acids in length, about 40 to 100 amino acids in length, about 45 to 100 amino acids in length, about 50 to 100 amino acids in length, about 55 to 100 amino acids in length, about 60 to 100 amino acids in length, about 65 to 100 amino acids in length, about 70 to 100 amino acids in length, about 75 to 100 amino acids in length, about 80 to 100 amino acids in length, about 85 to 100 amino acids in length, about 90 to 100 amino acids in length, about 95 to 100 amino acids in length, about 10 to 95 amino acids in length, about 10 to 90 amino acids in length, about 10 to 85 amino acids in length, about 10 to 80 amino acids in length, about 10 to 75 amino acids in length, about 10 to 70 amino acids in length, about 10 to 65 amino acids in length
- a first domain of a pair of affinity domains, a second domain of a pair of affinity domains, or both is about 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, or 100 amino acids in length.
- any of the first and/or second domains of a pair of affinity domains disclosed herein can include one or more additional amino acids (e.g., 1, 2, 3, 5, 6, 7, 8, 9, 10, or more amino acids) at its N-terminus and/or C-terminus, so long as the function of the first and/or second domains of a pair of affinity domains remains intact.
- a sushi domain from an alpha chain of human IL-15 receptor can include one or more additional amino acids at the N-terminus and/or the C-terminus, while still retaining the ability to bind to a soluble IL-15.
- a soluble IL-15 can include one or more additional amino acids at the N-terminus and/or the C-terminus, while still retaining the ability to bind to a sushi domain from an alpha chain of human IL-15 receptor (IL15R ⁇ ).
- a non-limiting example of a sushi domain from an alpha chain of IL-15 receptor alpha can include a sequence that is at least 70% identical, at least 75% identical, at least 80% identical, at least 85% identical, at least 90% identical, at least 95% identical, at least 99% identical, or 100% identical to (SEQ ID NO: 148).
- a sushi domain from an alpha chain of IL15R ⁇ can be encoded by a nucleic acid including
- a soluble IL-15 can include a sequence that is at least 70% identical, at least 75% identical, at least 80% identical, at least 85% identical, at least 90% identical, at least 95% identical, at least 99% identical, or 100% identical to Q Q S (SEQ ID NO: 134).
- a soluble IL-15 can be encoded by a nucleic acid including the sequence of Signal Sequence
- a multi-chain chimeric polypeptide includes a first chimeric polypeptide that includes a signal sequence at its N-terminal end.
- a multi-chain chimeric polypeptide includes a second chimeric polypeptide that includes a signal sequence at its N-terminal end.
- both the first chimeric polypeptide of a multi-chain chimeric polypeptide and a second chimeric polypeptide of the multi-chain chimeric polypeptide include a signal sequence.
- a signal sequence is an amino acid sequence that is present at the N-terminus of a number of endogenously produced proteins that directs the protein to the secretory pathway (e.g., the protein is directed to reside in certain intracellular organelles, to reside in the cell membrane, or to be secreted from the cell).
- a first chimeric polypeptide of a multi-chain chimeric polypeptide, a second chimeric polypeptide of the multi-chain chimeric polypeptide, or both includes a signal sequence having an amino acid sequence MKWVTFISLLFLFSSAYS (SEQ ID NO: 151).
- a first chimeric polypeptide of a multi-chain chimeric polypeptide, a second chimeric polypeptide of the multi-chain chimeric polypeptide, or both includes a signal sequence encoded by the nucleic acid sequence: In some embodiments, a first chimeric polypeptide of a multi-chain chimeric polypeptide, a second chimeric polypeptide of the multi-chain chimeric polypeptide, or both includes a signal sequence having an amino acid sequence (SEQ ID NO: 155).
- a first chimeric polypeptide of a multi-chain chimeric polypeptide, a second chimeric polypeptide of the multi-chain chimeric polypeptide, or both includes a signal sequence having an amino acid sequence (SEQ ID NO: 156).
- a first chimeric polypeptide of a multi-chain chimeric polypeptide, a second chimeric polypeptide of the multi-chain chimeric polypeptide, or both includes a signal sequence having an amino acid sequence
- a first chimeric polypeptide of a multi-chain chimeric polypeptide, a second chimeric polypeptide of the multi-chain chimeric polypeptide, or both includes a signal sequence having an amino acid sequence (SEQ ID NO: 158).
- a first chimeric polypeptide of a multi-chain chimeric polypeptide, a second chimeric polypeptide of the multi-chain chimeric polypeptide, or both includes a signal sequence that is about 10 to 100 amino acids in length.
- a signal sequence can be about 10 to 100 amino acids in length, about 15 to 100 amino acids in length, about 20 to 100 amino acids in length, about 25 to 100 amino acids in length, about 30 to 100 amino acids in length, about 35 to 100 amino acids in length, about 40 to 100 amino acids in length, about 45 to 100 amino acids in length, about 50 to 100 amino acids in length, about 55 to 100 amino acids in length, about 60 to 100 amino acids in length, about 65 to 100 amino acids in length, about 70 to 100 amino acids in length, about 75 to 100 amino acids in length, about 80 to 100 amino acids in length, about 85 to 100 amino acids in length, about 90 to 100 amino acids in length, about 95 to 100 amino acids in length, about 10 to 95 amino acids in length, about 10 to 90 amino acids in length, about 10 to 85 amino acids in length, about 10 to 80 amino acids in length, about 10 to 75 amino acids in length, about 10 to 70 amino acids in length, about 10 to 65 amino acids in length, about 10 to 60 amino acids in length, about 10 to 55 amino acids in length, about 10 to to 100
- a signal sequence is about 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, or 100 amino acids in length.
- any of the signal sequences disclosed herein can include one or more additional amino acids (e.g., 1, 2, 3, 5, 6, 7, 8, 9, 10, or more amino acids) at its N-terminus and/or C-terminus, so long as the function of the signal sequence remains intact.
- a signal sequence having the amino acid sequence can include one or more additional amino acids at the N-terminus or C-terminus, while still retaining the ability to direct a first chimeric polypeptide of a multi-chain chimeric polypeptide, a second chimeric polypeptide of the multi-chain chimeric polypeptide, or both to the secretory pathway.
- a first chimeric polypeptide of a multi-chain chimeric polypeptide, a second chimeric polypeptide of the multi-chain chimeric polypeptide, or both includes a signal sequence that directs the multi-chain chimeric polypeptide into the extracellular space.
- a multi-chain chimeric polypeptide includes a first chimeric polypeptide that includes a peptide tag (e.g., at the N-terminal end or the C- terminal end of the first chimeric polypeptide).
- a multi-chain chimeric polypeptide includes a second chimeric polypeptide that includes a peptide tag (e.g., at the N-terminal end or the C-terminal end of the second chimeric polypeptide).
- both the first chimeric polypeptide of a multi-chain chimeric polypeptide and a second chimeric polypeptide of the multi-chain chimeric polypeptide include a peptide tag.
- a first chimeric polypeptide of a multi- chain chimeric polypeptide, a second chimeric polypeptide of the multi-chain chimeric polypeptide, or both include two or more peptide tags.
- Exemplary peptide tags that can be included in a first chimeric polypeptide of a multi-chain chimeric polypeptide, a second chimeric polypeptide of the multi-chain chimeric polypeptide, or both include, without limitation, AviTag (GLNDIFEAQKIEWHE; SEQ ID NO: 159), a calmodulin-tag (KRRWKKNFIAVSAANRFKKISSSGAL; SEQ ID NO: 160), a polyglutamate tag (EEEEEE; SEQ ID NO: 161), an E-tag (GAPVPYPDPLEPR; SEQ ID NO: 162), a FLAG-tag (DYKDDDDK; SEQ ID NO: 163), an HA-tag, a peptide from hemagglutinin (YPYDVPDYA; SEQ ID NO: 164), a his-tag (HHHHH (SEQ ID NO: 165); HHHHHH (SEQ ID NO: 166); HHHHHHH (SEQ ID NO: 167);
- tissue factor protein is a peptide tag.
- Peptide tags that can be included in a first chimeric polypeptide of a multi-chain chimeric polypeptide, a second chimeric polypeptide of the multi-chain chimeric polypeptide, or both can be used in any of a variety of applications related to the multi- chain chimeric polypeptide.
- a peptide tag can be used in the purification of a multi-chain chimeric polypeptide.
- a first chimeric polypeptide of a multi-chain chimeric polypeptide e.g., a recombinantly expressed first chimeric polypeptide
- a second chimeric polypeptide of the multi-chain chimeric polypeptide e.g., a recombinantly expressed second chimeric polypeptide
- both can include a myc tag
- the multi-chain chimeric polypeptide that includes the myc-tagged first chimeric polypeptide, the myc-tagged second chimeric polypeptide, or both can be purified using an antibody that recognizes the myc tag(s).
- a first chimeric polypeptide of a multi-chain chimeric polypeptide e.g., a recombinantly expressed first chimeric polypeptide
- a second chimeric polypeptide of the multi-chain chimeric polypeptide e.g., a recombinantly expressed second chimeric polypeptide
- both can include a histidine tag
- the multi-chain chimeric polypeptide that includes the histidine-tagged first chimeric polypeptide, the histidine-tagged second chimeric polypeptide, or both can be purified using a nickel or cobalt chelate.
- a peptide tag is removed from the first chimeric polypeptide and/or the second chimeric polypeptide of the multi-chain chimeric polypeptide after purification. In some embodiments, a peptide tag is not removed from the first chimeric polypeptide and/or the second chimeric polypeptide of the multi-chain chimeric polypeptide after purification.
- Peptide tags that can be included in a first chimeric polypeptide of a multi-chain chimeric polypeptide, a second chimeric polypeptide of the multi-chain chimeric polypeptide, or both can be used, for example, in immunoprecipitation of the multi-chain chimeric polypeptide, imaging of the multi-chain chimeric polypeptide (e.g., via Western blotting, ELISA, flow cytometry, and/or immunocytochemistry), and/or solubilization of the multi-chain chimeric polypeptide.
- a first chimeric polypeptide of a multi-chain chimeric polypeptide, a second chimeric polypeptide of the multi-chain chimeric polypeptide, or both includes a peptide tag that is about 10 to 100 amino acids in length.
- a peptide tag can be about 10 to 100 amino acids in length, about 15 to 100 amino acids in length, about 20 to 100 amino acids in length, about 25 to 100 amino acids in length, about 30 to 100 amino acids in length, about 35 to 100 amino acids in length, about 40 to 100 amino acids in length, about 45 to 100 amino acids in length, about 50 to 100 amino acids in length, about 55 to 100 amino acids in length, about 60 to 100 amino acids in length, about 65 to 100 amino acids in length, about 70 to 100 amino acids in length, about 75 to 100 amino acids in length, about 80 to 100 amino acids in length, about 85 to 100 amino acids in length, about 90 to 100 amino acids in length, about 95 to 100 amino acids in length, about 10 to 95 amino acids in length, about 10 to 90 amino acids in length, about 10 to 85 amino acids in length, about 10 to 80 amino acids in length, about 10 to 75 amino acids in length, about 10 to 70 amino acids in length, about 10 to 65 amino acids in length, about 10 to 60 amino acids in length, about 10 to 55 amino acids in length, about
- a peptide tag is about 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, or 100 amino acids in length.
- Peptide tags included in a first chimeric polypeptide of a multi-chain chimeric polypeptide, a second chimeric polypeptide of the multi-chain chimeric polypeptide, or both can be of any suitable length.
- peptide tags can be 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, or more amino acids in length.
- the two or more peptide tags can be of the same or different lengths.
- any of the peptide tags disclosed herein may include one or more additional amino acids (e.g., 1, 2, 3, 5, 6, 7, 8, 9, 10, or more amino acids) at the N-terminus and/or C-terminus, so long as the function of the peptide tag remains intact.
- a myc tag having the amino acid sequence EQKLISEEDL can include one or more additional amino acids (e.g., at the N-terminus and/or the C- terminus of the peptide tag), while still retaining the ability to be bound by an antibody (e.g., 9E10).
- the first target-binding domain and the second targeting-binding domain each independently bind specifically to a receptor of IL-18 or a receptor of IL-12.
- the first target-binding domain and the soluble tissue factor domain directly abut each other in the first chimeric polypeptide.
- the first chimeric polypeptide further comprises a linker sequence (e.g., any of the exemplary linkers described herein) between the first target-binding domain and the soluble tissue factor domain in the first chimeric polypeptide.
- a linker sequence e.g., any of the exemplary linkers described herein
- the second domain of the pair of affinity domains and the second target-binding domain directly abut each other in the second chimeric polypeptide.
- the second chimeric polypeptide further includes a linker sequence (e.g., any of the exemplary linkers described herein) between the second domain of the pair of affinity domains and the second target-binding domain in the second chimeric polypeptide.
- the soluble tissue factor domain can be any of the exemplary soluble tissue factor domains described herein.
- the pair of affinity domains can be any of the exemplary pairs of affinity domains described herein.
- one or both of the first target-binding domain and the second target-binding domain is an agonistic antigen-binding domain.
- the first target-binding domain and the second target-binding domain are each agonistic antigen-binding domains.
- the antigen-binding domain includes a scFv or single-domain antibody.
- one or both of the first target-binding domain and the second target-binding domain is a soluble IL-15 or a soluble IL-18.
- the first target-binding domain and the second target-binding domain are each independently a soluble IL-15 or a soluble IL-18. In some embodiments of these multi-chain chimeric polypeptides, the first target-binding domain and the second target-binding domain both bind specifically to a receptor of IL-18 or a receptor of IL-12. In some embodiments of these multi-chain chimeric polypeptides, the first target-binding domain and the second target-binding domain bind specifically to the same epitope. In some embodiments of these multi-chain chimeric polypeptides, the first target-binding domain and the second target-binding domain include the same amino acid sequence.
- the first target- binding domain binds specifically to a receptor for IL-12, and the second target-binding domain binds specifically to a receptor for IL-18. In some embodiments of these multi-chain chimeric polypeptides, the first target-binding domain binds specifically to a receptor for IL-18, and the second target-binding domain bind specifically to a receptor for IL-12. In some embodiments of these multi-chain chimeric polypeptides, the first target- binding domain includes a soluble IL-18 (e.g., a soluble human IL-18).
- the soluble human IL-18 includes a sequence that is at least 80% identical (e.g., at least 82% identical, at least 84% identical, at least 86% identical, at least 88% identical, at least 90% identical, at least 92% identical, at least 94% identical, at least 96% identical, at least 98% identical, at least 99% identical, or 100% identical) to:
- the soluble human IL-18 is encoded by a sequence that is at least 80% identical (e.g., at least 82% identical, at least 84% identical, at least 86% identical, at least 88% identical, at least 90% identical, at least 92% identical, at least 94% identical, at least 96% identical, at least 98% identical, at least 99% identical, or 100% identical) to:
- the second target-binding domain includes a soluble IL-12 (e.g., a soluble IL-12 (e.g., a soluble IL-12 (e.g., a)-2-chain IL-18 (e.g., a soluble IL-12
- the soluble human IL-15 includes a sequence of soluble human IL-12 ⁇ (p40) and a sequence of soluble human IL- 12 ⁇ (p35).
- the soluble IL-15 human IL-15 further includes a linker sequence (e.g., any of the exemplary linker sequences described herein) between the sequence of soluble IL-12 ⁇ (p40) and the sequence of soluble human IL-12 ⁇ (p35).
- the linker sequence comprises GGGGSGGGGSGGGGS (SEQ ID NO: 126).
- the sequence of soluble human IL-12 ⁇ (p40) comprises a sequence that is at least 80% identical (e.g., at least 82% identical, at least 84% identical, at least 86% identical, at least 88% identical, at least 90% identical, at least 92% identical, at least 94% identical, at least 96% identical, at least 98% identical, at least 99% identical, or 100% identical) to:
- the soluble human IL-12 ⁇ (p40) is encoded by a sequence that is at least 80% identical (e.g., at least 82% identical, at least 84% identical, at least 86% identical, at least 88% identical, at least 90% identical, at least 92% identical, at least 94% identical, at least 96% identical, at least 98% identical, at least 99% identical, or 100% identical) to:
- the soluble human IL-12 ⁇ (p35) is encoded by a sequence that is at least 80% identical (e.g., at least 82% identical, at least 84% identical, at least 86% identical, at least 88% identical, at
- a first chimeric polypeptide is encoded by a sequence that is at least 80% identical (e.g., at least 82% identical, at least 84% identical, at least 86% identical, at least 88% identical, at least 90% identical, at least 92% identical, at least 94% identical, at least 96% identical, at least 98% identical, at least 99% identical, or 100% identical) to:
- a first chimeric polypeptide can include a sequence that is at least 80% identical (e.g., at least 82% identical, at least 84% identical, at least 86% identical, at least 88% identical, at least 90% identical, at least 92% identical, at least 94% identical, at least 96% identical, at least 98% identical, at least 99% identical, or 100% identical) to:
- a first chimeric polypeptide is encoded by a sequence that is at least 80% identical (e.g., at least 82% identical, at least 84% identical, at least 86% identical, at least 88% identical, at least 90% identical, at least 92% identical,
- the second chimeric polypeptide can include a sequence that is at least 80% identical (e.g., at least 82% identical, at least 84% identical, at least 86% identical, at least 88% identical, at least 90% identical, at least 92% identical, at least 94% identical, at least 96% identical, at least 98% identical, at least 99% identical, or 100% identical) to:
- a second chimeric polypeptide is encoded by a sequence that is at least 80% identical (e.g., at least 82% identical, at least 84% identical, at least 86% identical, at least 88% identical, at least 90% identical, at least 92% identical, at least 94% identical, at least 96% identical, at least 98% identical, at least 99% identical, or 100% identical) to:
- a second chimeric polypeptide can include a sequence that is at least 80% identical (e.g., at least 82% identical, at least 84% identical, at least 86% identical, at least 88% identical, at least 90% identical, at least 92% identical, at least 94% identical, at least 96% identical, at least 98% identical, at least 99% identical, or 100% identical) to: (S Q NO: 96).
- a second chimeric polypeptide is encoded by a sequence that is at least 80% identical (e.g., at least 82% identical, at least 84% identical, at least 86% identical, at least 88% identical, at least 90% identical, at least 92% identical, at least 94% identical, at least 96% identical, at least 98% identical, at least 99% identical, or 100% identical) to: Exemplary Multi-Chain Chimeric Polypeptides- Type B
- the first target-binding domain and the second targeting-binding domain each independently bind specifically to a receptor of IL-7 or a receptor of IL-21.
- the first target-binding domain and the soluble tissue factor domain directly abut each other in the first chimeric polypeptide.
- the first chimeric polypeptide further comprises a linker sequence (e.g., any of the exemplary linkers described herein) between the first target-binding domain and the soluble tissue factor domain in the first chimeric polypeptide.
- the soluble tissue factor domain and the first domain of the pair of affinity domains directly abut each other in the first chimeric polypeptide.
- the first chimeric polypeptide further includes a linker sequence (e.g., any of the exemplary linkers described herein) between the soluble tissue factor domain and the first domain of the pair of affinity domains in the first chimeric polypeptide.
- a linker sequence e.g., any of the exemplary linkers described herein
- the second domain of the pair of affinity domains and the second target-binding domain directly abut each other in the second chimeric polypeptide.
- the second chimeric polypeptide further includes a linker sequence (e.g., any of the exemplary linkers described herein) between the second domain of the pair of affinity domains and the second target-binding domain in the second chimeric polypeptide.
- the soluble tissue factor domain can be any of the exemplary soluble tissue factor domains described herein.
- the pair of affinity domains can be any of the exemplary pairs of affinity domains described herein.
- one or both of the first target-binding domain and the second target-binding domain is a soluble IL-21 (e.g., a soluble human IL-21 polypeptide) or a soluble IL-7 (e.g., a soluble human IL-7 polypeptide).
- the first target-binding domain and the second target-binding domain are each independently a soluble IL-21 or a soluble IL-7.
- the first target-binding domain and the second target-binding domain both bind specifically to a receptor of IL-21 or a receptor of IL-7.
- the first target-binding domain and the second target-binding domain bind specifically to the same epitope. In some embodiments of these multi-chain chimeric polypeptides, the first target-binding domain and the second target-binding domain include the same amino acid sequence. In some embodiments of these multi-chain chimeric polypeptides, the first target- binding domain binds specifically to a receptor for IL-21, and the second target-binding domain binds specifically to a receptor for IL-7.
- the first target-binding domain binds specifically to a receptor for IL-7, and the second target-binding domain binds specifically to a receptor for IL-21.
- the first target- binding domain includes a soluble IL-21 (e.g., a soluble human IL-21).
- the soluble human IL-21 includes a sequence that is at least 80% identical (e.g., at least 82% identical, at least 84% identical, at least 86% identical, at least 88% identical, at least 90% identical, at least 92% identical, at least 94% identical, at least 96% identical, at least 98% identical, at least 99% identical, or 100% identical) to:
- the soluble human IL-21 is encoded by a sequence that is at least 80% identical (e.g., at least 82% identical, at least 84% identical, at least 86% identical, at least 88% identical, at least 90% identical, at least 92% identical, at least 94% identical, at least 96% identical, at least 98% identical, at least 99% identical, or 100% identical) to:
- the soluble human IL-21 is encoded by a sequence that is at least 80% identical (e.g., at least 82% identical, at least 84% identical, at least 86% identical, at least 88% identical, at least 90% identical, at least 92% identical, at least 94% identical, at
- a first chimeric polypeptide can include a sequence that is at least 80% identical (e.g., at least 82% identical, at least 84% identical, at least 86% identical, at least 88% identical, at least 90% identical, at least 92% identical, at least 94% identical, at least 96% identical, at least 98% identical, at least 99% identical, or 100% identical) to:
- a first chimeric polypeptide is encoded by a sequence that is at least 80% identical (e.g., at least 82% identical, at least 84% identical, at least 86% identical, at least 88% identical, at least 90% identical, at least 92% identical, at least 94% identical, at least 96% identical, at least 98% identical, at least 99% identical, or 100% identical) to:
- the second chimeric polypeptide can include a sequence that is at least 80% identical (e.g., at least 82% identical, at least 84% identical, at least 86% identical, at least 88% identical, at least 90% identical
- the first target-binding domain and the second targeting-binding domain each independently bind specifically to a receptor of IL-7 or a receptor of IL-21.
- the first target-binding domain and the soluble tissue factor domain directly abut each other in the first chimeric polypeptide.
- the first chimeric polypeptide further comprises a linker sequence (e.g., any of the exemplary linkers described herein) between the first target-binding domain and the soluble tissue factor domain in the first chimeric polypeptide.
- a linker sequence e.g., any of the exemplary linkers described herein
- the soluble tissue factor domain and the first domain of the pair of affinity domains directly abut each other in the first chimeric polypeptide.
- the first chimeric polypeptide further includes a linker sequence (e.g., any of the exemplary linkers described herein) between the soluble tissue factor domain and the first domain of the pair of affinity domains in the first chimeric polypeptide.
- a linker sequence e.g., any of the exemplary linkers described herein
- the second domain of the pair of affinity domains and the second target-binding domain directly abut each other in the second chimeric polypeptide.
- the second chimeric polypeptide further includes a linker sequence (e.g., any of the exemplary linkers described herein) between the second domain of the pair of affinity domains and the second target-binding domain in the second chimeric polypeptide.
- the soluble tissue factor domain can be any of the exemplary soluble tissue factor domains described herein.
- the pair of affinity domains can be any of the exemplary pairs of affinity domains described herein.
- one or both of the first target-binding domain and the second target-binding domain is a soluble IL-21 (e.g., a soluble human IL-21 polypeptide) or a soluble IL-7 (e.g., a soluble human IL-7 polypeptide).
- the first target-binding domain and the second target-binding domain are each independently a soluble IL-21 or a soluble IL-7.
- the first target-binding domain and the second target-binding domain both bind specifically to a receptor of IL-21 or a receptor of IL-7.
- the first target-binding domain and the second target-binding domain bind specifically to the same epitope. In some embodiments of these multi-chain chimeric polypeptides, the first target-binding domain and the second target-binding domain include the same amino acid sequence. In some embodiments of these multi-chain chimeric polypeptides, the first target- binding domain binds specifically to a receptor for IL-21, and the second target-binding domain binds specifically to a receptor for IL-7.
- the first target-binding domain binds specifically to a receptor for IL-7
- the second target-binding domain binds specifically to a receptor for IL-21.
- the soluble human IL-21 includes a sequence that is at least 80% identical (e.g., at least 82% identical, at least 84% identical, at least 86% identical, at least 88% identical, at least 90% identical, at least 92% identical, at least 94% identical, at least 96% identical, at least 98% identical, at least 99% identical, or 100% identical) to:
- the soluble human IL-21 is encoded by a sequence that is at least 80% identical (e.g., at least 82% identical, at least 84% identical, at least 86% identical, at least 88% identical, at least 90% identical, at least 92% identical, at least 94% identical, at least 96% identical,
- a first chimeric polypeptide can include a sequence that is at least 80% identical (e.g., at least 82% identical, at least 84% identical, at least 86% identical, at least 88% identical, at least 90% identical, at least 92% identical, at least 94% identical, at least 96% identical, at least 98% identical, at least 99% identical, or 100% identical) to:
- a first chimeric polypeptide is encoded by a sequence that is at least 80% identical (e.g., at least 82% identical, at least 84% identical, at least 86% identical, at least 88% identical, at least 90% identical, at least 92% identical, at least 94% identical, at least 96% identical, at least 98% identical, at least 99% identical, or 100% identical) to:
- the second chimeric polypeptide can include a sequence that is at least 80% identical (e.g., at least 82% identical, at least 84% identical, at least 86% identical, at least 88% identical, at least 90% identical
- the first target-binding domain and the soluble tissue factor domain directly abut each other in the first chimeric polypeptide.
- the first chimeric polypeptide further comprises a linker sequence (e.g., any of the exemplary linkers described herein) between the first target-binding domain and the soluble tissue factor domain in the first chimeric polypeptide.
- the soluble tissue factor domain and the first domain of the pair of affinity domains directly abut each other in the first chimeric polypeptide.
- the first chimeric polypeptide further includes a linker sequence (e.g., any of the exemplary linkers described herein) between the soluble tissue factor domain and the first domain of the pair of affinity domains in the first chimeric polypeptide.
- a linker sequence e.g., any of the exemplary linkers described herein
- the second domain of the pair of affinity domains and the second target-binding domain directly abut each other in the second chimeric polypeptide.
- the second chimeric polypeptide further includes a linker sequence (e.g., any of the exemplary linkers described herein) between the second domain of the pair of affinity domains and the second target-binding domain in the second chimeric polypeptide.
- the soluble tissue factor domain can be any of the exemplary soluble tissue factor domains described herein.
- the pair of affinity domains can be any of the exemplary pairs of affinity domains described herein.
- the first target- binding domain and the second target-binding domain each independently bind specifically to TGF- ⁇ . In some embodiments of these multi-chain chimeric polypeptides, the first target-binding domain and the second target-binding domain bind specifically to the same epitope. In some embodiments of these multi-chain chimeric polypeptides, the first target-binding domain and the second target-binding domain include the same amino acid sequence.
- the first target-binding domain and the second target-binding domain is a soluble TGF- ⁇ receptor (e.g., a soluble TGF ⁇ RII receptor, e.g., a soluble human TGF ⁇ RII).
- the soluble human TGFR ⁇ RII includes a first sequence of soluble human TGFR ⁇ RII and a second sequence of soluble human TGFR ⁇ RII.
- the soluble human TGFR ⁇ RII includes a linker disposed between the first sequence of soluble human TGFR ⁇ RII and the second sequence of soluble human TGFR ⁇ RII.
- the linker includes the sequence GGGGSGGGGSGGGGS (SEQ ID NO: 126).
- the first sequence of soluble human TGFR ⁇ RII receptor comprises a sequence that is at least 80% identical (e.g., at least 82% identical, at least 84% identical, at least 86% identical, at least 88% identical, at least 90% identical, at least 92% identical, at least 94% identical, at least 96% identical, at least 98% identical, at least 99% identical, or 100% identical) to:
- the second sequence of soluble human TGFR ⁇ RII receptor comprises a sequence that is at least 80% identical (e.g., at least 82% identical, at least 84% identical, at least 86% identical, at least 88% identical, at least 90% identical, at least 92% identical, at least 94% identical, at least 96% identical, at least 98% identical, at least 99% identical, or 100% identical) to: c (SEQ ID NO: 224).
- the first sequence of soluble human TGFR ⁇ RII receptor is encoded by a sequence that is at least 80% identical (e.g., at least 82% identical, at least 84% identical, at least 86% identical, at least 88% identical, at least 90% identical, at least 92% identical, at least 94% identical, at least 96% identical, at least 98% identical, at least 99% identical, or 100% identical) to:
- the second sequence of soluble human TGFR ⁇ RII receptor is encoded by a sequence that is at least 80% identical (e.g., at least 82% identical, at least 84% identical, at least 86% identical, at least 88% identical, at least 90% identical, at least 92% identical, at least 94% identical, at least 96% identical, at least 98% identical, at least 99% identical, or 100% identical) to:
- a first chimeric polypeptide can include a sequence that is at least 80% identical (e.g., at least 82% identical, at least 84% identical, at least 86% identical, at least 88% identical, at least 90% identical, at least 92% identical, at least 94% identical, at least 96% identical, at least 98% identical, at least 99% identical, or 100% identical) to: T K W V
- a first chimeric polypeptide is encoded by a sequence that is at least 80% identical (e.g., at least 82% identical, at least 84% identical, at least 86% identical, at least 88% identical, at least 90% identical, at least 92% identical, at least 94% identical, at least 96% identical, at least 98% identical, at least 99% identical, or 100% identical) to:
- the second chimeric polypeptide can include a sequence that is at least 80% identical (e.g., at least 82% identical, at least 84% identical, at least 86% identical, at least 88% identical, at least 99% identical, or 100% identical)
- the first target-binding domain e.g., any of the exemplary target-binding domains described herein or known in the art
- the soluble tissue factor domain e.g., any of the exemplary soluble tissue factor domains described herein
- the single-chain chimeric polypeptide further comprises a linker sequence (e.g., any of the exemplary linker sequences described herein or known in the art) between the first target- binding domain (e.g., any of the exemplary target-binding domains described herein or known in the art) and the soluble tissue factor domain (e.g., any of the exemplary soluble tissue factor domains described herein).
- a linker sequence e.g., any of the exemplary linker sequences described herein or known in the art
- the soluble tissue factor domain e.g., any of the exemplary soluble tissue factor domains described herein
- the second target-binding domain e.g., any of the exemplary target-binding domains described herein or known in the art
- the single-chain chimeric polypeptide further comprises a linker sequence (e.g., any of the exemplary linker sequences described herein or known in the art) between the soluble tissue factor domain (e.g., any of the exemplary soluble tissue factor domains described herein) and the second target-binding domain (e.g., any of the exemplary target-binding domains described herein or known in the art).
- a linker sequence e.g., any of the exemplary linker sequences described herein or known in the art
- the first target-binding domain e.g., any of the exemplary target-binding domains described herein or known in the art
- the second target-binding domain e.g., any of the exemplary target-binding domains described herein or known in the art
- the single-chain chimeric polypeptide further comprises a linker sequence (e.g., any of the exemplary linker sequences described herein or known in the art) between the first target-binding domain (e.g., any of the exemplary target-binding domains described herein or known in the art) and the second target-binding domain (e.g., any of the exemplary target-binding domains described herein or known in the art).
- a linker sequence e.g., any of the exemplary linker sequences described herein or known in the art
- the second target-binding domain e.g., any of the exemplary target-binding domains described herein or known in the art
- the soluble tissue factor domain e.g., any of the exemplary soluble tissue factor domains described herein
- the single-chain chimeric polypeptide further comprises a linker sequence (e.g., any of the exemplary linker sequences described herein or known in the art) between the second target-binding domain (e.g., any of the exemplary target-binding domains described herein or known in the art) and the soluble tissue factor domain (e.g., any of the exemplary soluble tissue factor domains described herein or known in the art).
- a linker sequence e.g., any of the exemplary linker sequences described herein or known in the art
- the first target-binding domain and/or the second target-binding domain can independently bind specifically to CD3 (e.g., human CD3) or CD28 (e.g., human CD28).
- CD3 e.g., human CD3
- CD28 e.g., human CD28
- the first target-binding domain binds specifically to CD3 (e.g., human CD3) and the second target-binding domain binds specifically to CD28 (e.g., human CD28).
- the first target-binding domain binds specifically to CD28 (e.g., human CD28) and the second target-binding domain binds specifically to CD3 (e.g., human CD3).
- CD28 e.g., human CD28
- CD3 e.g., human CD3
- the first target- binding domain and the soluble tissue factor domain directly abut each other.
- the single-chain chimeric polypeptide further includes a linker sequence (e.g., any of the exemplary linkers described herein) between the first target-binding domain and the soluble tissue factor domain.
- the soluble tissue factor domain and the second target-binding domain directly abut each other.
- the single-chain chimeric polypeptide further includes a linker sequence (e.g., any of the exemplary linkers described herein) between the soluble tissue factor domain and the second target-binding domain.
- one or both of the first target-binding domain and the second target-binding domain is an antigen- binding domain.
- the first target-binding domain and the second target-binding domain are each an antigen- binding domain (e.g., any of the exemplary antigen-binding domains described herein).
- the antigen-binding domain includes a scFv or a single domain antibody.
- an scFv that binds specifically to CD3 can include a sequence that is at least 80% identical (e.g., at least 82% identical, at least 84% identical, at least 86% identical, at least 88% identical, at least 90% identical, at least 92% identical, at least 94% identical, at least 96% identical, at least 98% identical, at least 99% identical, or 100% identical) to:
- an scFv that binds specifically to CD3 can be encoded by a sequence that is at least 80% identical (e.g., at least 82% identical, at least 84% identical, at least 86% identical, at least 88% identical, at least 90% identical, at least 92% identical, at least 94% identical, at least 96% identical, at least 98% identical, at least 99% identical, or 100% identical) to:
- an scFv that binds specifically to CD28 can include a sequence that is at least 80% identical (e.g., at least 82% identical, at least 84% identical, at least 86% identical, at least 88% identical, at least 90% identical, at least 92% identical, at least 94% identical, at least 96% identical, at least 98% identical, at least 99% identical, or 100% identical) to:
- an scFv that binds specifically to CD28 can be encoded by a sequence that is at least 80% identical (e.g., at least 82% identical, at least 84% identical, at least 86% identical, at least 88% identical, at least 90% identical, at least 92% identical, at least 94% identical, at least 96% identical, at least 98% identical, at least 99% identical, or 100% identical) to:
- the first target- binding domain and/or the second target-binding domain is a soluble receptor (e.g., a soluble CD28 receptor or a soluble CD3 receptor).
- the soluble tissue factor domain can be any of the exemplary soluble tissue factor domains described herein.
- a single-chain chimeric polypeptide can include a sequence that is at least 80% identical (e.g., at least 82% identical, at least 84% identical, at least 86% identical, at least 88% identical, at least 90% identical, at least 92% identical, at least 94% identical, at least 96% identical, at least 98% identical, at least 99% identical, or 100% identical) to:
- a single-chain chimeric polypeptide is encoded by a sequence that is at least 80% identical (e.g., at least 82% identical, at least 84% identical, at least 86% identical, at least 88% identical, at least 90% identical, at least 92% identical, at least 94% identical, at least 96% identical, at least 98% identical, at least 99% identical, or 100% identical) to:
- a single-chain chimeric polypeptide can include a sequence that is at least 80% identical (e.g., at least 82% identical, at least 84% identical, at least 86% identical, at least 88% identical, at least 90% identical, at least 92% identical, at least 94% identical, at least 96% identical, at least 98% identical, at least 99% identical, or 100% identical) to:
- a single-chain chimeric polypeptide is encoded by a sequence that is at least 80% identical (e.g., at least 82% identical, at least 84% identical, at least 86% identical, at least 88% identical, at least 90% identical, at least 92% identical, at least 94% identical, at least 96% identical, at least 98% identical, at least 99% identical, or 100% identical) to:
- the first target-binding domain and/or the second target-binding domain can independently bind specifically to an IL-2 receptor (e.g., human IL-2 receptor).
- an IL-2 receptor e.g., human IL-2 receptor
- the first target- binding domain and the soluble tissue factor domain directly abut each other.
- the single-chain chimeric polypeptide further includes a linker sequence (e.g., any of the exemplary linkers described herein) between the first target-binding domain and the soluble tissue factor domain.
- the soluble tissue factor domain and the second target-binding domain directly abut each other.
- the single-chain chimeric polypeptide further includes a linker sequence (e.g., any of the exemplary linkers described herein) between the soluble tissue factor domain and the second target-binding domain.
- the first target- binding domain and the second target-binding domain is a soluble human IL-2 protein.
- an IL-2 protein that binds specifically to an IL-2 receptor can include a sequence that is at least 80% identical (e.g., at least 82% identical, at least 84% identical, at least 86% identical, at least 88% identical, at least 90% identical, at least 92% identical, at least 94% identical, at least 96% identical, at least 98% identical, at least 99% identical, or 100% identical) to:
- an IL-2 protein that binds specifically to an IL-2 receptor can be encoded by a sequence that is at least 80% identical (e.g., at least 82% identical, at least 84% identical, at least 86% identical, at least 88% identical, at least 90% identical, at least 92% identical, at least 94% identical, at least 96% identical, at least 98% identical, at least 99% identical, or 100% identical) to:
- an IL-2 protein that binds specifically to an IL-2 receptor can be encoded by a sequence that is at least 80% identical (e.g., at least 82% identical, at least 84% identical,
- a single-chain chimeric polypeptide can include a sequence that is at least 80% identical (e.g., at least 82% identical, at least 84% identical, at least 86% identical, at least 88% identical, at least 90% identical, at least 92% identical, at least 94% identical, at least 96% identical, at least 98% identical, at least 99% identical, or 100% identical) to:
- a single-chain chimeric polypeptide is encoded by a sequence that is at least 80% identical (e.g., at least 82% identical, at least 84% identical, at least 86% identical, at least 88% identical, at least 90% identical, at least 92% identical, at least 94% identical, at least 96% identical, at least 98% identical, at least 99% identical, or 100% identical) to:
- a single-chain chimeric polypeptide can include a sequence that is at least 80% identical (e.g., at least 82% identical, at least 84% identical, at least 86% identical, at least 88% identical, at least 90% identical, at least
- Example 1 Screening of anti-CD26 scFv clones A plate of scFv clones were selected and their binding to CD26, Fc, and proA/L were tested. Controls include binding to Fc (IgG) representing non-specific binding and binding to proA/L (Protein A/L) representing detection of properly folded scFv. For the Fc assays, the scFvs were tested to determine whether they bind specifically to the Fc portion of an antibody.
- Fc IgG
- proA/L ProA/L
- the CD26 binding assays were performed using a CD26-Fc fusion protein, and therefore, the Fc assay was performed to ensure that each scFv does not bind specifically to the Fc portion of an antibody.
- the proA/L assay is performed to determine whether each scFv has an intact structure with six CDRs and framework regions. The assay utilizes a proA and proL mixture.
- DNA was also prepared for the scFv constructs and was sent for DNA sequencing to determine light chain (LC)/ heavy chain (HC) region sequences (Figure.1).
- Example 2. Analysis of DNA sequences of selected scFvs The DNA sequence of each selected clone was translated into an amino acid sequence and the light chain and heavy chain variable domain sequences were determined.
- the light chain (LC) and heavy chain (HC) amino acid sequences were analyzed to determine unique clone sequences and unique clone numbers. Then, the unique clone sequences were compared with their binding characteristics. As a result, five unique clones with binding were identified (CD26-01D, CD26- 04A, CD26-10B, CD26-12D, and CD26-03B). Sequencing results indicate that the light chain and heavy chain sequences for the five unique clones were intact and the sequences for the CDR-L1, CDR-L2, CDR-L3, CDR-H1, CDR-H2, and CDR-H3 were determined to be unique from each other ( Figure 2).
- the front portion of the sequence is the light chain (LC) variable domain (underlined), and the terminal portion of the sequence the heavy chain (HC) variable domain (underlined).
- the LC and HC variable domains are linked to each other with linker sequence, which is shown with place- holding Xs.
- CD26-03G scFv (SEQ ID NO: 113) CD26-04E scFv (SEQ ID NO: 114) CD26-01F scFv (SEQ ID NO: 115) DIQMTQSPSSLSASVGDRVTITCRASQDVWGYVAWYQQKPGKAPKLLIFSSRSL CD26-01G scFv (SEQ ID NO: 116) CD26-07H scFv amino acid sequence (SEQ ID NO: 117) Example 6.
- Anti-CD26 IgG1 monoclonal antibodies were constructed based on the scFv sequences provided above in Example 2.
- the CD26-binding of anti-CD26 monoclonal antibodies was determined with ELISA using either a human CD26-Fc fusion protein or goat anti-human IgG.
- the CD26-Fc sequences were obtained from the UniProt website and DNA encoding these sequences was synthesized by Genewiz.
- the construct was made linking the C-terminal of CD26 sequence (N29-P766) with human IgG1 Fc.
- the nucleic acid and protein sequences of the construct are shown below.
- the nucleic acid sequence of the CD26-Fc construct (including signal peptide sequence) is as follows (SEQ ID NO: 118): (Signal peptide) ATGAAGTGGGTGACCTTCATCAGCCTGCTGTTCCTGTTCTCCAGCGCCT
- the amino acid sequence of the human CD26-Fc construct (including signal peptide sequence) is as follows (SEQ ID NO: 119): (Signal peptide) MKWVTFISLLFLFSSAYS
- the CD26-Fc construct was cloned into a modified retrovirus expression vectors as described previously (Hughes et al., Hum. Gene Ther.16:457–72, 2005), and the expression vectors were transfected into CHO-K1 cells. Expression of the construct in CHO-K1 cells allowed for secretion of the soluble CD26-Fc fusion protein (referred to as CD26-Fc), which can be purified by MabSelect protein A affinity and other chromatography methods. Human CD26-Fc fusion protein (sequence shown above) or goat anti-human IgG was used to coat 96 well Maxisorp plates. The plates were blocked with blocking buffer.
- Anti-tissue factor antibody (Anti-TF Ab) was used as a negative control and PE-conjugated anti-CD26 (BioLegend) as a positive control. The results demonstrate that CD26Ab-01D and CD26-04A bind to CD26 well and the three tested antibodies have very weak binding (Figure 9).
- Example 8. ADCC Activities of Anti-CD26 Antibodies ADCC activities of the anti-CD26 monoclonal antibodies were analyzed. Human CD26-transfected CHO cells (CHO26) were labeled with CellTrace Violet and used as target cells, and fresh human NK cells (left: donor-1 and right: donor-2) were used as effector cells.
- the effector cells were plated with violet-labeled target cells at the indicated effector:target (E:T) ratios with 26Ab-01D or 26Ab-04A at a 5 nM concentration.
- Anti-tissue factor antibody (Anti-TF Ab) was used as a control.
- Target cell inhibition (%) was calculated using a formula: (1-viable CHO26 cell number in experimental sample/viable CHO26 cell number in the sample without splenocytes) x 100 on day 2 by flow cytometry.
- the results show CD26Ab-01D- and CD26Ab-04A- dependent and NK cell-mediated cytotoxicity against CD26 positive CHO cells (Figure 10).
- the anti-CD26 monoclonal antibodies were probed with SAHRP/ABTS and read using an ELISA plate reader at 405 nM. The results show that ADA was able to block CD26Ab-01D and CD26Ab-04A binding to CD26 molecule ( Figure 11).
- Example 10 Anti-CD26 CAR Treg cells An anti-human CD26 chimerical antigen receptor (CAR) was generated comprising a HC leader, anti-CD26 scFv, c-myc tag, CD8 ⁇ hinge, CD28 transmembrane/cytoplasmic domain, and CD3 zeta cytoplasmic domain sequences obtained from our own data or the UniProt website and DNA for these sequences was synthesized by Genewiz.
- CAR CD26 chimerical antigen receptor
- constructs were made linking the anti-CD26 V L to anti-CD26 VH with a linker to generate a single chain version of anti-CD26 antibody and then directly linking the anti-CD26 scFv sequence to the c-myc tag, CD8 ⁇ hinge, CD28 transmembrane/cytoplasmic domain, CD3 zeta cytoplasmic domain ( Figure 12).
- the nucleic acid and protein sequences of a construct comprising anti-CD26 CAR are shown below.
- the nucleic acid sequence of the anti-CD26 CAR construct (including signal peptide sequence) is as follows (SEQ ID NO: 252): (Signal peptide)
- the amino acid sequence of the anti-CD26 CAR (including signal peptide sequence) is as follows (SEQ ID NO: 253) (CDRs shown in bold): (Signal peptide) MDRLTSSFLLLIVPAYVLS
- the anti-CD26 CAR construct was cloned into a lentivirus expression vector pLVX-EF1a-IRES-ZsGreen1 (Cat# 631982, Takara).
- the expression vector was mixed with Lenti-X Packaging Single Shots (Cat# 631275, Takara) and transfected into Lenti-X 293T cells (Cat# 632180, Takara).
- the lentiviral supernatants from the transfected Lenti- X 293T cells were collected after 3 days incubation at 37 o C in a CO2 incubator.
- An estimated titer of lentivirus was instantly evaluated with the Lenti-X GoStixTM Plus (Cat# 631280, Takara).
- the actual lentivirus titers were further evaluated by transduction of Lenti-X 293T cells.
- Human Treg cells were isolated with a Miltenyi human Treg cell isolation kit (Cat# 130-094-775, Miltenyi) from donor buffy coat PBMCs.
- the Treg cells were activated with Dynabeads human T-Activator CD3/CD28 (Cat#11131D, ThermoFisher) overnight, and transduced with the lentivirus carrying anti-CD26 CAR at a MOI of 40 measured by flow cytometry.
- the ⁇ CD26 CAR-transduced Treg cells were verified by stimulation with biotinylated CD26-Fc conjugated Dynabeads M280 Streptavidin (Cat# 11205D, ThermoFisher).
- ⁇ CD26 CAR Treg cells were activated and expanded using antigen-specific CD26-beads (3-fold) or through the TCR using CD3/CD28 beads (5-fold), but not by non-specific tissue factor conjugated beads or medium only ( Figure 13 and Figure 14).
- Figure 13 shows images of total Treg cells (upper panels) and anti-CD26 CAR Treg cells (lower panels) stimulated with the specific antigen (CD26/beads), non-specific antigen (TF/beads), or TCR (CD3/CD28/beads) for 3 days, where the ⁇ CD26 CAR Treg cells were shown to be activated and expanded using antigen-specific CD26-beads (3- fold, lower left panel) or through the TCR using CD3/CD28 beads (5-fold, lower right panel), but not by non-specific tissue factor conjugated beads (lower middle panel).
- CD26/beads specific antigen
- TF/beads non-specific antigen
- TCR CD3/CD28/beads
- the CAR-transduced Treg cells and un-transduced Treg cells were stained with the specific antigen: biotinylated CD26-Fc or a non-specific antigen: biotinylated tissue factor (TF), and detected by R-Phycoerythrin (PE)-conjugated Streptavidin (Cat# 016- 110-084, Jackson ImmunoResearch).
- specific antigen biotinylated CD26-Fc or a non-specific antigen: biotinylated tissue factor (TF)
- PE R-Phycoerythrin
- the ⁇ CD26 CAR Treg cells were specifically stained with CD26-Fc at 100 nM and 10 nM but not with TF, suggesting that anti-CD26 CAR was well displayed on the Treg cell surface and functionally interacts with the specific antigen at an affinity over 10 nM (Figure 15).
- the ⁇ CD26 CAR-transduced Treg cells and un-transduced Treg cells were stained with the indicated antibodies shown in Figure 16.
- the ⁇ CD26 CAR Treg cells expressed more CD39 and CTLA-4 compared to the un-transduced Treg cells. The higher CD39 and CTLA-4 expression might be related to a better suppression ability of the ⁇ CD26 CAR Treg cells than the untransduced Treg cells in the suppression assays.
- ⁇ CD26 CAR Treg cells or untransduced Treg cells were incubated with the CellTrace violet cell proliferation kit (Cat# C34557, ThermoFisher)-labelled Tresp cells from the same donor for 5 days.
- the suppression of Tresp cell proliferation by ⁇ CD26 CAR Treg cells and untransduced Treg cells were analyzed by flow cytometry.
- the ⁇ CD26 CAR Treg cells suppressed Tresp proliferation better than the untransduced Treg cells did ( Figure 17).
- the culture supernatants from the suppression assays were collected for ELISA analysis of the interferon gamma and IL-10 produced by Treg or Tresp cells.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Immunology (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Organic Chemistry (AREA)
- Pharmacology & Pharmacy (AREA)
- Epidemiology (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Cell Biology (AREA)
- Genetics & Genomics (AREA)
- Molecular Biology (AREA)
- Biophysics (AREA)
- Biochemistry (AREA)
- Zoology (AREA)
- Engineering & Computer Science (AREA)
- Gastroenterology & Hepatology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Hematology (AREA)
- Biomedical Technology (AREA)
- Biotechnology (AREA)
- Developmental Biology & Embryology (AREA)
- Virology (AREA)
- Oncology (AREA)
- Microbiology (AREA)
- Mycology (AREA)
- Peptides Or Proteins (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
- Medicines Containing Material From Animals Or Micro-Organisms (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Investigating Or Analysing Biological Materials (AREA)
Abstract
Priority Applications (6)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
AU2021262794A AU2021262794A1 (en) | 2020-04-29 | 2021-04-29 | Anti-CD26 proteins and uses thereof |
CN202180043401.3A CN115836087A (zh) | 2020-04-29 | 2021-04-29 | 抗cd26蛋白及其用途 |
EP21727042.0A EP4143231A1 (fr) | 2020-04-29 | 2021-04-29 | Protéines anti-cd26 et leurs utilisations |
US17/922,067 US20230174666A1 (en) | 2020-04-29 | 2021-04-29 | Anti-cd26 proteins and uses thereof |
JP2022566042A JP2023525495A (ja) | 2020-04-29 | 2021-04-29 | 抗cd26タンパク質及びそれらの使用法 |
CA3181417A CA3181417A1 (fr) | 2020-04-29 | 2021-04-29 | Proteines anti-cd26 et leurs utilisations |
Applications Claiming Priority (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US202063017467P | 2020-04-29 | 2020-04-29 | |
US63/017,467 | 2020-04-29 |
Publications (1)
Publication Number | Publication Date |
---|---|
WO2021222587A1 true WO2021222587A1 (fr) | 2021-11-04 |
Family
ID=76035139
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/US2021/029920 WO2021222587A1 (fr) | 2020-04-29 | 2021-04-29 | Protéines anti-cd26 et leurs utilisations |
Country Status (7)
Country | Link |
---|---|
US (1) | US20230174666A1 (fr) |
EP (1) | EP4143231A1 (fr) |
JP (1) | JP2023525495A (fr) |
CN (1) | CN115836087A (fr) |
AU (1) | AU2021262794A1 (fr) |
CA (1) | CA3181417A1 (fr) |
WO (1) | WO2021222587A1 (fr) |
Cited By (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2023224635A1 (fr) * | 2022-05-20 | 2023-11-23 | Academia Sinica | Anticorps recombinants, kits les comprenant et leurs utilisations dans le diagnostic du virus de la peste porcine africaine |
Families Citing this family (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
KR20210069639A (ko) | 2018-08-30 | 2021-06-11 | 에이치씨더블유 바이올로직스, 인크. | 단일-사슬 키메라 폴리펩타이드 및 이의 용도 |
Citations (55)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO1995015341A1 (fr) | 1993-12-03 | 1995-06-08 | Cancer Research Campaign Technology Limited | Anticorps dirige contre l'antigene carcino-embryonnaire (cea) |
US6117980A (en) | 1997-02-21 | 2000-09-12 | Genentech, Inc. | Humanized anti-IL-8 monoclonal antibodies |
WO2003104425A2 (fr) | 2002-06-07 | 2003-12-18 | The Government Of The United States Of America, As Represented By The Secretary Of The Department Of Health And Human Services | Nouveaux anticorps anti-cd22 stables |
US7452537B2 (en) | 2005-04-26 | 2008-11-18 | Agouron Pharmaceuticals, Inc. | P-cadherin antibodies |
US7482436B2 (en) | 2002-08-30 | 2009-01-27 | Juridical Foundation The Chemo-Sero-Therapeutic Research Institute | Human antihuman interleukin-6 antibody and fragment of antibody |
US7488802B2 (en) | 2002-12-23 | 2009-02-10 | Wyeth | Antibodies against PD-1 |
US7612181B2 (en) | 2005-08-19 | 2009-11-03 | Abbott Laboratories | Dual variable domain immunoglobulin and uses thereof |
US7723482B2 (en) | 2000-12-26 | 2010-05-25 | Institut National De La Sante Et De La Recherche Medicale (Inserm) | Anti-CD28 antibody |
US7968094B2 (en) | 1997-03-10 | 2011-06-28 | Genentech, Inc. | Use of anti-tissue factor antibodies for treating thromboses |
US8007795B2 (en) | 2001-10-29 | 2011-08-30 | Genentech, Inc. | Anti-tissue factor antibodies and methods of use thereof |
US20120171197A1 (en) | 2007-12-21 | 2012-07-05 | Medimmune Limited | Binding members for interleukin-4 receptor alpha (IL-4Ra) - 173 |
WO2012120125A1 (fr) | 2011-03-09 | 2012-09-13 | Antitope Ltd | Anticorps anti-ctla4 humanisés |
WO2012170470A1 (fr) | 2011-06-06 | 2012-12-13 | Board Of Regents Of The University Of Nebraska | Compositions et méthodes de détection et de traitement du cancer |
WO2012175692A1 (fr) | 2011-06-22 | 2012-12-27 | INSERM (Institut National de la Santé et de la Recherche Médicale) | Anticorps anti-axl et utilisations associées |
WO2013068946A2 (fr) | 2011-11-11 | 2013-05-16 | Rinat Neuroscience Corp. | Anticorps spécifiques de trop-2 et leurs utilisations |
US8552156B2 (en) | 2010-06-11 | 2013-10-08 | Kyowa Hakko Kirin Co., Ltd | Anti-TIM-3 antibody |
US20130274446A1 (en) | 2010-08-12 | 2013-10-17 | Tohoku University | Fragment of humanized anti-egfr antibody substituted-lysine variable fragment and use thereof |
US8586714B2 (en) | 2009-09-01 | 2013-11-19 | Abbvie, Inc. | Dual variable domain immunoglobulins and uses thereof |
WO2014007513A1 (fr) | 2012-07-02 | 2014-01-09 | Hanwha Chemical Corporation | Nouvel anticorps monoclonal se liant spécifiquement à dll4 et son utilisation |
WO2014026054A2 (fr) | 2012-08-10 | 2014-02-13 | University Of Southern California | Procédés et produits thérapeutiques cd20 scfv-elp |
US8716450B2 (en) | 2009-10-15 | 2014-05-06 | Abbvie Inc. | Dual variable domain immunoglobulins and uses thereof |
US8722855B2 (en) | 2009-10-28 | 2014-05-13 | Abbvie Inc. | Dual variable domain immunoglobulins and uses thereof |
US8735546B2 (en) | 2010-08-03 | 2014-05-27 | Abbvie Inc. | Dual variable domain immunoglobulins and uses thereof |
US8741604B2 (en) | 2008-11-07 | 2014-06-03 | Medimmune Limited | Nucleic acid molecule encoding a specific IL-1R1 antibody |
US8753640B2 (en) | 2011-05-31 | 2014-06-17 | University Of Washington Through Its Center For Commercialization | MIC-binding antibodies and methods of use thereof |
US8759494B2 (en) | 2009-09-25 | 2014-06-24 | Gemoab Monoclonals Gmbh | Anti-CD33 antibodies and use thereof for immunotargeting in treating CD33-associated illnesses |
WO2014095808A1 (fr) | 2012-12-17 | 2014-06-26 | Delenex Therapeutics Ag | Anticorps contre il-1 bêta |
WO2014130635A1 (fr) | 2013-02-20 | 2014-08-28 | Novartis Ag | Ciblage efficace de la leucémie primaire humaine au moyen de lymphocytes t génétiquement modifiés des récepteurs d'antigènes chimériques anti-cd123 |
US8822645B2 (en) | 2008-07-08 | 2014-09-02 | Abbvie Inc. | Prostaglandin E2 dual variable domain immunoglobulins and uses thereof |
WO2014159531A1 (fr) | 2013-03-14 | 2014-10-02 | The Board Of Regents Of The University Of Texas System | Epcam de ciblage d'anticorps monoclonaux pour la détection de métastases ganglionnaires du cancer de la prostate |
US9035026B2 (en) | 2005-05-26 | 2015-05-19 | Affimed Gmbh | Anti-CD16 binding molecules |
WO2015089881A1 (fr) * | 2013-12-19 | 2015-06-25 | 江苏众红生物工程创药研究院有限公司 | Anticorps humain anti-cd26 et son application |
US9085623B2 (en) | 2010-02-11 | 2015-07-21 | Alexion Pharmaceuticals, Inc. | Therapeutic methods using anti-CD200 antibodies |
US9090684B2 (en) | 2008-06-25 | 2015-07-28 | Esbatech, An Alcon Biomedical Research Unit Llc | Stable and soluble antibodies inhibiting VEGF |
US20150259429A1 (en) | 2012-08-28 | 2015-09-17 | Institut Curie | Cluster of differentiation 36 (cd36) as a therapeutic target for hiv infection |
US9226962B2 (en) | 2002-09-10 | 2016-01-05 | Affimed Gmbh | Human CD3-specific antibody with immunosuppressive properties |
US9238084B2 (en) | 2003-06-16 | 2016-01-19 | Immunomedics, Inc. | Anti-mucin antibodies for early detection and treatment of pancreatic cancer |
US9273136B2 (en) | 2008-08-04 | 2016-03-01 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Fully human anti-human NKG2D monoclonal antibodies |
EP3029069A1 (fr) * | 2013-07-31 | 2016-06-08 | Juntendo Educational Foundation | Anticorps monoclonal anti-cd26 humain, ou son fragment de liaison à l'antigène |
US9371395B2 (en) | 2011-04-25 | 2016-06-21 | Daiichi Sankyo Company, Limited | Anti B7-H3 antibody |
WO2016106221A1 (fr) | 2014-12-22 | 2016-06-30 | The Rockefeller University | Anticorps agonistes anti-mertk et leurs utilisations |
US9441034B2 (en) | 2008-03-27 | 2016-09-13 | Zymogenetics, Inc. | Compositions and methods for inhibiting PDGFRβ and VEGF-A |
WO2016154585A1 (fr) | 2015-03-26 | 2016-09-29 | Charles Sentman | Fragments de liaison à l'antigène anti-mica, molécules hybrides, cellules exprimant ceux-ci et procédés d'utilisation |
WO2016166348A1 (fr) | 2015-04-17 | 2016-10-20 | Elsalys Biotech | Anticorps anti-tyro3 et leurs utilisations |
US20160340413A1 (en) | 2012-08-08 | 2016-11-24 | Roche Glycart Ag | Interleukin-10 fusion proteins and uses thereof |
US9505843B2 (en) | 2014-01-29 | 2016-11-29 | Samsung Electronics Co., Ltd. | Anti-Her3 scFV fragment and bispecific anti-c-Met/anti-Her3 antibodies comprising the same |
US20160367664A1 (en) | 2015-08-06 | 2016-12-22 | Agency For Science, Technology And Research | IL2Rbeta/Common Gamma Chain Antibodies |
US20170051063A1 (en) | 2011-04-19 | 2017-02-23 | Merrimack Pharmaceuticals, Inc. | Monospecific and bispecific anti-igf-1r and anti-erbb3 antibodies |
US9617345B2 (en) | 2012-11-20 | 2017-04-11 | Sanofi | Anti-CEACAM5 antibodies and uses thereof |
WO2017083612A1 (fr) | 2015-11-13 | 2017-05-18 | Dana-Farber Cancer Institute, Inc. | Protéine de fusion nkg2d-ig pour l'immunothérapie contre le cancer |
US9701758B2 (en) | 2013-05-24 | 2017-07-11 | Board Of Regents, The University Of Texas System | Anti-CD19 scFv (FMC63) polypeptide |
US20170198042A1 (en) | 2014-08-19 | 2017-07-13 | Merck Sharp & Dohme Corp. | Anti-tigit antibodies |
WO2017149538A1 (fr) | 2016-03-01 | 2017-09-08 | Yissum Research Development Company Of The Hebrew University Of Jerusalem Ltd. | Anticorps spécifiques du récepteur du poliovirus humain (pvr) |
WO2017189526A1 (fr) | 2016-04-25 | 2017-11-02 | Musc Foundation For Research Development | Cellules immunitaires à expression cd26 élevée et cellules immunes cd26-négatives activées et leurs utilisations |
EP3348276A1 (fr) * | 2015-09-11 | 2018-07-18 | Y'S AC Co., Ltd. | Composition de traitement du cancer associant un anticorps anti-cd26 et un autre agent anti-cancéreux |
-
2021
- 2021-04-29 WO PCT/US2021/029920 patent/WO2021222587A1/fr unknown
- 2021-04-29 AU AU2021262794A patent/AU2021262794A1/en active Pending
- 2021-04-29 EP EP21727042.0A patent/EP4143231A1/fr active Pending
- 2021-04-29 US US17/922,067 patent/US20230174666A1/en active Pending
- 2021-04-29 CA CA3181417A patent/CA3181417A1/fr active Pending
- 2021-04-29 CN CN202180043401.3A patent/CN115836087A/zh active Pending
- 2021-04-29 JP JP2022566042A patent/JP2023525495A/ja active Pending
Patent Citations (56)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO1995015341A1 (fr) | 1993-12-03 | 1995-06-08 | Cancer Research Campaign Technology Limited | Anticorps dirige contre l'antigene carcino-embryonnaire (cea) |
US6117980A (en) | 1997-02-21 | 2000-09-12 | Genentech, Inc. | Humanized anti-IL-8 monoclonal antibodies |
US7968094B2 (en) | 1997-03-10 | 2011-06-28 | Genentech, Inc. | Use of anti-tissue factor antibodies for treating thromboses |
US7723482B2 (en) | 2000-12-26 | 2010-05-25 | Institut National De La Sante Et De La Recherche Medicale (Inserm) | Anti-CD28 antibody |
US8007795B2 (en) | 2001-10-29 | 2011-08-30 | Genentech, Inc. | Anti-tissue factor antibodies and methods of use thereof |
WO2003104425A2 (fr) | 2002-06-07 | 2003-12-18 | The Government Of The United States Of America, As Represented By The Secretary Of The Department Of Health And Human Services | Nouveaux anticorps anti-cd22 stables |
US7482436B2 (en) | 2002-08-30 | 2009-01-27 | Juridical Foundation The Chemo-Sero-Therapeutic Research Institute | Human antihuman interleukin-6 antibody and fragment of antibody |
US9226962B2 (en) | 2002-09-10 | 2016-01-05 | Affimed Gmbh | Human CD3-specific antibody with immunosuppressive properties |
US7488802B2 (en) | 2002-12-23 | 2009-02-10 | Wyeth | Antibodies against PD-1 |
US9238084B2 (en) | 2003-06-16 | 2016-01-19 | Immunomedics, Inc. | Anti-mucin antibodies for early detection and treatment of pancreatic cancer |
US7452537B2 (en) | 2005-04-26 | 2008-11-18 | Agouron Pharmaceuticals, Inc. | P-cadherin antibodies |
US9035026B2 (en) | 2005-05-26 | 2015-05-19 | Affimed Gmbh | Anti-CD16 binding molecules |
US7612181B2 (en) | 2005-08-19 | 2009-11-03 | Abbott Laboratories | Dual variable domain immunoglobulin and uses thereof |
US8258268B2 (en) | 2005-08-19 | 2012-09-04 | Abbott Laboratories | Dual variable domain immunoglobulin and uses thereof |
US20120171197A1 (en) | 2007-12-21 | 2012-07-05 | Medimmune Limited | Binding members for interleukin-4 receptor alpha (IL-4Ra) - 173 |
US9441034B2 (en) | 2008-03-27 | 2016-09-13 | Zymogenetics, Inc. | Compositions and methods for inhibiting PDGFRβ and VEGF-A |
US9090684B2 (en) | 2008-06-25 | 2015-07-28 | Esbatech, An Alcon Biomedical Research Unit Llc | Stable and soluble antibodies inhibiting VEGF |
US8822645B2 (en) | 2008-07-08 | 2014-09-02 | Abbvie Inc. | Prostaglandin E2 dual variable domain immunoglobulins and uses thereof |
US9273136B2 (en) | 2008-08-04 | 2016-03-01 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Fully human anti-human NKG2D monoclonal antibodies |
US8741604B2 (en) | 2008-11-07 | 2014-06-03 | Medimmune Limited | Nucleic acid molecule encoding a specific IL-1R1 antibody |
US8586714B2 (en) | 2009-09-01 | 2013-11-19 | Abbvie, Inc. | Dual variable domain immunoglobulins and uses thereof |
US8759494B2 (en) | 2009-09-25 | 2014-06-24 | Gemoab Monoclonals Gmbh | Anti-CD33 antibodies and use thereof for immunotargeting in treating CD33-associated illnesses |
US8716450B2 (en) | 2009-10-15 | 2014-05-06 | Abbvie Inc. | Dual variable domain immunoglobulins and uses thereof |
US8722855B2 (en) | 2009-10-28 | 2014-05-13 | Abbvie Inc. | Dual variable domain immunoglobulins and uses thereof |
US9085623B2 (en) | 2010-02-11 | 2015-07-21 | Alexion Pharmaceuticals, Inc. | Therapeutic methods using anti-CD200 antibodies |
US8552156B2 (en) | 2010-06-11 | 2013-10-08 | Kyowa Hakko Kirin Co., Ltd | Anti-TIM-3 antibody |
US8735546B2 (en) | 2010-08-03 | 2014-05-27 | Abbvie Inc. | Dual variable domain immunoglobulins and uses thereof |
US20130274446A1 (en) | 2010-08-12 | 2013-10-17 | Tohoku University | Fragment of humanized anti-egfr antibody substituted-lysine variable fragment and use thereof |
WO2012120125A1 (fr) | 2011-03-09 | 2012-09-13 | Antitope Ltd | Anticorps anti-ctla4 humanisés |
US20170051063A1 (en) | 2011-04-19 | 2017-02-23 | Merrimack Pharmaceuticals, Inc. | Monospecific and bispecific anti-igf-1r and anti-erbb3 antibodies |
US9371395B2 (en) | 2011-04-25 | 2016-06-21 | Daiichi Sankyo Company, Limited | Anti B7-H3 antibody |
US8753640B2 (en) | 2011-05-31 | 2014-06-17 | University Of Washington Through Its Center For Commercialization | MIC-binding antibodies and methods of use thereof |
WO2012170470A1 (fr) | 2011-06-06 | 2012-12-13 | Board Of Regents Of The University Of Nebraska | Compositions et méthodes de détection et de traitement du cancer |
WO2012175692A1 (fr) | 2011-06-22 | 2012-12-27 | INSERM (Institut National de la Santé et de la Recherche Médicale) | Anticorps anti-axl et utilisations associées |
WO2013068946A2 (fr) | 2011-11-11 | 2013-05-16 | Rinat Neuroscience Corp. | Anticorps spécifiques de trop-2 et leurs utilisations |
WO2014007513A1 (fr) | 2012-07-02 | 2014-01-09 | Hanwha Chemical Corporation | Nouvel anticorps monoclonal se liant spécifiquement à dll4 et son utilisation |
US20160340413A1 (en) | 2012-08-08 | 2016-11-24 | Roche Glycart Ag | Interleukin-10 fusion proteins and uses thereof |
WO2014026054A2 (fr) | 2012-08-10 | 2014-02-13 | University Of Southern California | Procédés et produits thérapeutiques cd20 scfv-elp |
US20150259429A1 (en) | 2012-08-28 | 2015-09-17 | Institut Curie | Cluster of differentiation 36 (cd36) as a therapeutic target for hiv infection |
US9617345B2 (en) | 2012-11-20 | 2017-04-11 | Sanofi | Anti-CEACAM5 antibodies and uses thereof |
WO2014095808A1 (fr) | 2012-12-17 | 2014-06-26 | Delenex Therapeutics Ag | Anticorps contre il-1 bêta |
WO2014130635A1 (fr) | 2013-02-20 | 2014-08-28 | Novartis Ag | Ciblage efficace de la leucémie primaire humaine au moyen de lymphocytes t génétiquement modifiés des récepteurs d'antigènes chimériques anti-cd123 |
WO2014159531A1 (fr) | 2013-03-14 | 2014-10-02 | The Board Of Regents Of The University Of Texas System | Epcam de ciblage d'anticorps monoclonaux pour la détection de métastases ganglionnaires du cancer de la prostate |
US9701758B2 (en) | 2013-05-24 | 2017-07-11 | Board Of Regents, The University Of Texas System | Anti-CD19 scFv (FMC63) polypeptide |
EP3029069A1 (fr) * | 2013-07-31 | 2016-06-08 | Juntendo Educational Foundation | Anticorps monoclonal anti-cd26 humain, ou son fragment de liaison à l'antigène |
WO2015089881A1 (fr) * | 2013-12-19 | 2015-06-25 | 江苏众红生物工程创药研究院有限公司 | Anticorps humain anti-cd26 et son application |
US9505843B2 (en) | 2014-01-29 | 2016-11-29 | Samsung Electronics Co., Ltd. | Anti-Her3 scFV fragment and bispecific anti-c-Met/anti-Her3 antibodies comprising the same |
US20170198042A1 (en) | 2014-08-19 | 2017-07-13 | Merck Sharp & Dohme Corp. | Anti-tigit antibodies |
WO2016106221A1 (fr) | 2014-12-22 | 2016-06-30 | The Rockefeller University | Anticorps agonistes anti-mertk et leurs utilisations |
WO2016154585A1 (fr) | 2015-03-26 | 2016-09-29 | Charles Sentman | Fragments de liaison à l'antigène anti-mica, molécules hybrides, cellules exprimant ceux-ci et procédés d'utilisation |
WO2016166348A1 (fr) | 2015-04-17 | 2016-10-20 | Elsalys Biotech | Anticorps anti-tyro3 et leurs utilisations |
US20160367664A1 (en) | 2015-08-06 | 2016-12-22 | Agency For Science, Technology And Research | IL2Rbeta/Common Gamma Chain Antibodies |
EP3348276A1 (fr) * | 2015-09-11 | 2018-07-18 | Y'S AC Co., Ltd. | Composition de traitement du cancer associant un anticorps anti-cd26 et un autre agent anti-cancéreux |
WO2017083612A1 (fr) | 2015-11-13 | 2017-05-18 | Dana-Farber Cancer Institute, Inc. | Protéine de fusion nkg2d-ig pour l'immunothérapie contre le cancer |
WO2017149538A1 (fr) | 2016-03-01 | 2017-09-08 | Yissum Research Development Company Of The Hebrew University Of Jerusalem Ltd. | Anticorps spécifiques du récepteur du poliovirus humain (pvr) |
WO2017189526A1 (fr) | 2016-04-25 | 2017-11-02 | Musc Foundation For Research Development | Cellules immunitaires à expression cd26 élevée et cellules immunes cd26-négatives activées et leurs utilisations |
Non-Patent Citations (116)
Title |
---|
"UniProtKB", Database accession no. P13726 |
ABBOTT ET AL., IMMUNOGENETICS, vol. 40, no. 5, 1994, pages 331 - 338 |
ABBOTT ET AL., IMMUNOGENTICS, vol. 40, no. 5, 1994, pages 331 - 338 |
AERTGEERTS ET AL., PROTEIN SCI, vol. 13, no. 2, 2004, pages 412 - 421 |
AKBARI ET AL., PROTEIN EXPR. PURIF., vol. 127, 2016, pages 8 - 15 |
ANGEVIN ERIC ET AL: "First-in-human phase 1 of YS110, a monoclonal antibody directed against CD26 in advanced CD26-expressing cancers", BRITISH JOURNAL OF CANCER, vol. 116, no. 9, 14 March 2017 (2017-03-14), GB, pages 1126 - 1134, XP055828899, ISSN: 0007-0920, Retrieved from the Internet <URL:http://www.nature.com/articles/bjc201762> [retrieved on 20210729], DOI: 10.1038/bjc.2017.62 * |
BAKER ET AL., NATURE, vol. 479, no. 7372, 2011, pages 232 - 236 |
BARREIRA DA SILVA ET AL., NAT. IMMUNOL., vol. 16, no. 8, 2015, pages 850 - 858 |
BISHWAJIT ET AL., CELLULAR IMMUNOL., vol. 170, no. 1, 1996, pages 25 - 33 |
BOREA ET AL., PHYSIOL. REV., vol. 98, no. 3, 2018, pages 1591 - 1625 |
BOURGEOIS ET AL., FEBS LETT, vol. 592, no. 12, 2018, pages 2083 - 2097 |
BRIGHTON ET AL., ELIFE, vol. 6, 2017, pages e31274 |
BROXMEYER ET AL., STEM CELLS DEV, vol. 25, no. 8, 2016, pages 575 - 585 |
BROXMEYER ET AL., STEM CELLS DEV., vol. 25, no. 8, 2016, pages 575 - 585 |
BUHLING ET AL., IMMUNOL. LETT., vol. 45, no. 1-2, 1995, pages 47 - 51 |
CAO ET AL., BIOTECHNOL. LETT., vol. 37, no. 7, 2015, pages 1347 - 1354 |
CHILDS ET AL., NAT. REV. DRUG DISCOV., vol. 16, no. 10, 2017, pages 718 - 735 |
CHINTA ET AL., CELL REP., vol. 22, no. 4, 2018, pages 930 - 940 |
CIAGLIA ET AL., INT. J. CANCER, vol. 142, no. 1, 2018, pages 176 - 190 |
CONARELLO ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 100, no. 11, 2003, pages 6825 - 6830 |
COSMAN ET AL., IMMUNITY, vol. 14, no. 2, 2001, pages 123 - 133 |
COSTA ET AL., FRONT. IMMUNOL., vol. 9, 29 May 2018 (2018-05-29) |
CROMIE ET AL., CURR. TOP. MED. CHEM., vol. 15, 2016, pages 2543 - 2557 |
DE GENST ET AL., DEV. COMP. IMMUNOL., vol. 30, 2006, pages 187 - 198 |
DE MEYER ET AL., TRENDS BIOTECHNOL., vol. 32, 2014, pages 263 - 270 |
DE MEYER, TRENDS. BIOTECHNOL., vol. 32, 2014, pages 263 - 270 |
DEACON ET AL., FRONT. ENDOCRINOL., vol. 10, 2019, pages 80 |
DEAGLIO ET AL., J. EXP. MED., vol. 204, no. 6, 2007, pages 1257 - 1265 |
DEYEV ET AL., NAT BIOTECHNOL, 2003, pages 1486 - 1492 |
DIGIAMMARINO ET AL., METHODS MOL. BIOL., vol. 899, 2012, pages 145 - 156 |
DIKOV ET AL., CELL. MOL. BIOL., vol. 50, 2004, pages 565 - 568 |
DONG ET AL., J. IMMUNOL., vol. 156, no. 4, 1996, pages 1349 - 1355 |
DONG ET AL., J. IMMUNOL., vol. 159, no. 12, 1997, pages 6070 - 6076 |
DREES ET AL., PROTEIN EXPRESS. PURIF., vol. 94, 2014, pages 60 - 66 |
EDWARDRAJA ET AL., BIOTECHNOL. BIOENG., vol. 106, no. 3, 2010, pages 367 - 375 |
FARR ET AL., NAT. MED., vol. 23, no. 9, 2017, pages 1072 - 1079 |
GARBER, NATURE REVIEWS DRUG DISCOVERY, vol. 13, 2014, pages 799 - 801 |
GEJIMA ET AL., HUMAN ANTIBODIES, vol. 11, no. 4, 2002, pages 121 - 129 |
GENG ET AL., IMMUNOL. RES., vol. 62, no. 3, 2015, pages 377 - 385 |
GIBBS ET AL., BIOCHEMISTRY, vol. 33, no. 47, 1994, pages 14003 - 14010 |
GORRELL ET AL., CELL IMMUNOL, vol. 134, no. 1, 1991, pages 205 - 215 |
GORRELL ET AL., CELL. IMMUNOL., vol. 134, no. 1, 1991, pages 205 - 215 |
GUTSCHMIDT ET AL., HISTOCHEMISTRY, vol. 73, no. 2, 1981, pages 285 - 304 |
GUTSCHMIDT ET AL., HISTOCHEMISTRY, vol. 73, no. 2, 1982, pages 285 - 304 |
HEBBAR ET AL., CLIN. EXP. IMMUNOL., vol. 136, 2004, pages 388 - 392 |
HENG ET AL., PLACENTA, vol. 57, 2017, pages 320 |
HOLLANDE ET AL., NAT. IMMUNOL., vol. 20, no. 3, 2019, pages 257 - 264 |
HOMACH ET AL., SCAND. J. IMMUNOL., vol. 48, no. 5, 1998, pages 497 - 501 |
HUANG ET AL., JBIOL CHEM, vol. 271, no. 36, 1996, pages 21752 - 21757 |
HUGHES ET AL., HUM. GENE THER, vol. 16, 2005, pages 457 - 72 |
IANNELLO ET AL., J. EXP. MED., vol. 210, no. 10, 2013, pages 2057 - 2069 |
INZUCCHI ET AL., CIRCULATION, vol. 117, no. 4, 2008, pages 574 - 584 |
JAKOB ET AL., MABS, vol. 5, 2013, pages 358 - 363 |
KIJANKA ET AL., NANOMEDICINE, vol. 10, 2015, pages 161 - 174 |
KIM ET AL., GENES DEV, vol. 31, no. 15, 2017, pages 1529 - 1534 |
KIM ET AL., GENES DEV., vol. 31, no. 15, 2017, pages 1529 - 1534 |
KIRCHHOFER ET AL., BIOCHEMISTRY, vol. 39, no. 25, 2000, pages 7380 - 7387 |
KIRKLAND ET AL., EBIOMEDICINE, vol. 21, 2017, pages 21 - 28 |
KLEIN ET AL., PROTEIN ENGINEERING, DESIGN & SELECTION, vol. 27, no. 10, 2014, pages 325 - 330 |
KLEMANN ET AL., CLIN. EXP. IMMUNOL., vol. 185, no. 1, 2016, pages 1 - 21 |
KOVALEVA ET AL., EXPERT. OPIN. BIOL. THER., vol. 14, 2014, pages 1527 - 1539 |
KRAH ET AL., IMMUNOPHARMACOL. IMMUNOTOXICOL., vol. 38, 2016, pages 21 - 28 |
KRIZHANOVSKY ET AL., CELL, vol. 134, no. 4, 2008, pages 657 - 667 |
LAMBEIR ET AL., CRIT. REV. CLIN. LAB. SCI., vol. 40, no. 3, 2003, pages 209 - 294 |
LOSTER ET AL., BIOCHEM. BIOPHYS. RES. COMM., vol. 217, no. 1, 1995, pages 341 - 348 |
LU ET AL., NATURE, vol. 500, no. 7461, 2013, pages 227 - 231 |
MANDELBOIM ET AL., NATURE, vol. 409, 2001, pages 1055 - 1060 |
MARGUET ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 97, no. 12, 2000, pages 6874 - 6879 |
MENTLEIN ET AL., REGUL. PEPT., vol. 85, no. 1, 1999, pages 9 - 24 |
MORENO ET AL., FRONT. PHARMACOL., vol. 9, 2018, pages 106 |
MUJIC-DELIC ET AL., TRENDS PHARMACOL. SCI., vol. 35, 2014, pages 247 - 255 |
MULVIHILL ET AL., ENDOCR. REV., vol. 35, no. 6, 2014, pages 992 - 1019 |
MUYLDERMANS ET AL., TRENDS BIOCHEM. SCI., vol. 26, 2001, pages 230 - 235 |
MUYLDERMANS, ANN. REV. BIOCHEM., vol. 82, 2013, pages 775 - 797 |
MUYLDERMANS, J. BIOTECHNOL., vol. 74, 2001, pages 277 - 302 |
NISHIDA ET AL., BLOOD CANCER J, vol. 8, no. 11, 2018, pages 99 |
OHHUMA ET AL., BIOCHEM. BIOPHYS. RES. COMM., vol. 386, no. 2, 2009, pages 327 - 332 |
OHNUMA ET AL., FRONT. BIOSCI., vol. 13, 2008, pages 2299 - 2310 |
OHNUMA ET AL., J. IMMUNOL., vol. 167, no. 12, 2001, pages 6745 - 6755 |
OHNUMA ET AL., MOL. CELL. BIOL., vol. 25, no. 17, 2005, pages 7743 - 7757 |
OHNUMA ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 101, no. 39, 2004, pages 14186 - 14191 |
OVADYA ET AL., J. CLIN. INVEST., vol. 128, no. 4, 2018, pages 1247 - 1254 |
PARKER ET AL., PROTEIN EXPR. PURIF., vol. 89, no. 2, 2013, pages 136 - 145 |
PISTILLO ET AL., EXP. CLIN. IMMUNOGENET., vol. 14, no. 2, 1997, pages 123 - 130 |
PRIYANKA ET AL., PROTEIN SCI., vol. 22, no. 2, 2013, pages 153 - 167 |
RAHBARIZADEH ET AL., IMMUNOL. INVEST., vol. 40, 2011, pages 299 - 338 |
RAJ ET AL., J. VIROL., vol. 88, no. 3, 2014, pages 1834 - 1838 |
RANGANATHAN, PAC. SYMP BIOCOMPUT., vol. 2000, pages 155 - 67 |
RASMUSSEN ET AL., NAT.STRUCT. BIOL., vol. 10, no. 1, 2003, pages 19 - 25 |
RAZ ET AL., DIABETOLOGIA, vol. 49, no. 11, 2006, pages 2564 - 2571 |
RESTA ET AL., IMMUNOL. REV., vol. 161, 1998, pages 95 - 109 |
ROSSI ET AL., TRENDS PHARMACOL SCI, vol. 33, 2012, pages 474 - 481 |
ROSSI, PROC NATL ACAD SCI USA., vol. 103, 2006, pages 6841 - 6846 |
RUF ET AL., JBIOL CHEM, vol. 267, no. 31, 1992, pages 22206 - 22210 |
SAGIV ET AL., ONCOGENE, vol. 32, no. 15, 2013, pages 1971 - 1977 |
SCHULLEK ET AL., JBIOL CHEM, vol. 269, no. 30, 1994, pages 19399 - 19403 |
SHARKEY ET AL., CANCER RES, vol. 68, 2008, pages 5282 - 5290 |
SMITH ET AL., MOL. THER., vol. 26, no. 6, 2018, pages 1447 - 1456 |
SORIANI ET AL., BLOOD, vol. 113, no. 15, 2009, pages 3503 - 3511 |
SPIESS ET AL., MOL. IMMUNOL., vol. 67, 2015, pages 95 - 106 |
TAHARA-HANAOKA ET AL., INT. IMMUNOL., vol. 16, no. 4, 2004, pages 533 - 538 |
TAKEDA ET AL., LUNG CANCER, vol. 137, 2019, pages 64 - 70 |
TANAKA ET AL., J. IMMUNOL., vol. 149, no. 2, 1992, pages 481 - 486 |
VAN AUDENHOVE ET AL., EBIOMEDICINE, vol. 8, 2016, pages 40 - 48 |
VAN BOCKSTAELE ET AL., CURR. OPIN. INVESTIG. DRUGS, vol. 10, 2009, pages 1212 - 1224 |
VANKADARI ET AL., EMERG. MICROBES INFECT., vol. 9, no. l, 2020, pages 601 - 604 |
WASHBURN ET AL., PLOS ONE, vol. 6, no. 3, 2011, pages e18439 |
WEBER ET AL., NATURE, vol. 356, no. 6372, 1992, pages 793 - 796 |
WEIHOFEN ET AL., J. BIOL. CHEM., vol. 279, no. 41, 2004, pages 43330 - 43335 |
WESOLOWSKI ET AL., MED. MICROBIOL. IMMUNOL., vol. 198, 2009, pages 157 - 174 |
XU ET AL., J. GERONTOL. A BIOL. SCI. MED. SCI., vol. 72, no. 6, 2017, pages 780 - 785 |
XU ET AL., NAT. MED., vol. 24, no. 8, 2018, pages 1246 - 1256 |
YU ET AL., FEBSJ, vol. 277, no. 5, 2010, pages 1126 - 1144 |
YUNG ET AL., AM. J. RESP. CRIT. CARE MED., vol. 194, no. 9, 2016, pages 1140 - 1151 |
ZHONG ET AL., DIABETES, vol. 62, no. 1, 2013, pages 149 - 157 |
ZHOU SHU ET AL: "A novel chimeric antigen receptor redirecting T-cell specificity towards CD26cancer cells", LEUKEMIA, vol. 35, no. 1, 21 April 2020 (2020-04-21), pages 119 - 129, XP037330082, ISSN: 0887-6924, DOI: 10.1038/S41375-020-0824-Y * |
Cited By (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2023224635A1 (fr) * | 2022-05-20 | 2023-11-23 | Academia Sinica | Anticorps recombinants, kits les comprenant et leurs utilisations dans le diagnostic du virus de la peste porcine africaine |
Also Published As
Publication number | Publication date |
---|---|
AU2021262794A1 (en) | 2022-11-24 |
EP4143231A1 (fr) | 2023-03-08 |
JP2023525495A (ja) | 2023-06-16 |
CN115836087A (zh) | 2023-03-21 |
CA3181417A1 (fr) | 2021-11-04 |
US20230174666A1 (en) | 2023-06-08 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US20210122805A1 (en) | Fc FUSION PROTEINS COMPRISING NOVEL LINKERS OR ARRANGEMENTS | |
US11377477B2 (en) | PD-1 targeted IL-15/IL-15RALPHA fc fusion proteins and uses in combination therapies thereof | |
US11732045B2 (en) | Multi-specific binding proteins for cancer treatment | |
CA3108949A1 (fr) | Polypeptides chimeres a chaines multiples et leurs utilisations | |
CA3109139A1 (fr) | Methodes de traitement de troubles lies au vieillissement | |
EP3988577A1 (fr) | Anticorps anti-cd137 | |
WO2020163646A1 (fr) | Domaines de liaison à l'antigène anti-gitr et leurs utilisations | |
KR102505383B1 (ko) | Dll3 표적 다중 특이성 항원 결합 분자 및 그의 사용 | |
CA2976089A1 (fr) | Anticorps anti-muc1* humanises | |
CN106687478B (zh) | 新的抗人Tie-2抗体 | |
CN113166265B (zh) | 抗紧密连接蛋白18.2和抗4-1bb双特异性抗体及其用途 | |
US20230174666A1 (en) | Anti-cd26 proteins and uses thereof | |
KR20220130687A (ko) | Ltbr 및 edb 결합 도메인을 포함하는 다중특이성 결합 분자 및 이의 용도 | |
CA3145387A1 (fr) | Proteines de fusion comprenant une paire de ligand-recepteur et proteine biologiquement fonctionnelle | |
JP2022553129A (ja) | ポリオウイルス受容体(pvr)に対する抗体およびその使用 | |
CN117106099A (zh) | 一种抗dll3嵌合抗原受体及其用途 | |
JP2024500242A (ja) | 腫瘍特異的クローディン18.2抗体と薬物との複合体 | |
CA3184756A1 (fr) | Methodes de traitement de troubles lies au vieillissement | |
US20240190987A1 (en) | Engineered EpCam Binding Antibodies | |
KR20220003567A (ko) | Pd-1 및 lag-3에 대한 이중특이적 항체 | |
WO2022022709A1 (fr) | PROTÉINE DE FUSION SIRPα-FC | |
EP4382166A1 (fr) | Nanocorps anti-pd-l1 et son utilisation | |
JP2024523034A (ja) | 二重特異性抗ccl2抗体 | |
CA3221735A1 (fr) | Anticorps anti-ccl2 bispecifiques | |
KR20240082364A (ko) | 인터루킨-2 돌연변이 및 이의 융합 단백질 |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 21727042 Country of ref document: EP Kind code of ref document: A1 |
|
ENP | Entry into the national phase |
Ref document number: 3181417 Country of ref document: CA |
|
ENP | Entry into the national phase |
Ref document number: 2022566042 Country of ref document: JP Kind code of ref document: A |
|
ENP | Entry into the national phase |
Ref document number: 2021262794 Country of ref document: AU Date of ref document: 20210429 Kind code of ref document: A |
|
NENP | Non-entry into the national phase |
Ref country code: DE |
|
ENP | Entry into the national phase |
Ref document number: 2021727042 Country of ref document: EP Effective date: 20221129 |