WO2021202926A1 - Methods and combinations for dual targeting of tnf family members - Google Patents

Methods and combinations for dual targeting of tnf family members Download PDF

Info

Publication number
WO2021202926A1
WO2021202926A1 PCT/US2021/025453 US2021025453W WO2021202926A1 WO 2021202926 A1 WO2021202926 A1 WO 2021202926A1 US 2021025453 W US2021025453 W US 2021025453W WO 2021202926 A1 WO2021202926 A1 WO 2021202926A1
Authority
WO
WIPO (PCT)
Prior art keywords
binds
light
molecule
antigen binding
binding domain
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2021/025453
Other languages
English (en)
French (fr)
Inventor
Michael Croft
Rana HERRO
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
La Jolla Institute for Allergy and Immunology
Original Assignee
La Jolla Institute for Allergy and Immunology
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by La Jolla Institute for Allergy and Immunology filed Critical La Jolla Institute for Allergy and Immunology
Priority to EP21780761.9A priority Critical patent/EP4126960A4/en
Priority to JP2022560454A priority patent/JP2023530046A/ja
Priority to US17/916,548 priority patent/US20230159649A1/en
Publication of WO2021202926A1 publication Critical patent/WO2021202926A1/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2875Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the NGF/TNF superfamily, e.g. CD70, CD95L, CD153, CD154
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P29/00Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • A61K2039/507Comprising a combination of two or more separate antibodies
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76Antagonist effect on antigen, e.g. neutralization or inhibition of binding
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/30Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto

Definitions

  • Fibrosis and thickening of the skin is a characteristic of several inflammatory and autoimmune diseases including systemic sclerosis (SSc) or scleroderma, and atopic dermatitis (Boin and Wigley, 2009; Rosenbloom etal. , 2010; Wynn and Ramalingam, 2012; Yamamoto, 2009).
  • Current treatments involve non-selective immunotherapy with corticosteroids, D- penicillamine, methotrexate, or cyclophosphamide, but defining new targets for intervention of fibrosis in the skin is important.
  • Fibrosis is a feature that is shared with other diseases such as severe asthma, and autoimmune diseases like RA, Crohn’s disease, and SLE, but whether there are common molecules that promote clinical symptoms across these syndromes is not clear. As such, there is a need to develop additional therapeutics for addressing fibrosis, skin fibrosis, and associated diseases and indications such as autoimmune diseases and respiratory diseases.
  • LIGHT which stands for “homologous to lymphotoxin, exhibits inducible expression and competes with HS V glycoprotein D for binding to herpesvirus entry mediator, a receptor expressed on T lymphocytes”
  • TNFSF14 also known as TNFSF14, p30 polypeptide
  • TNFSF15 TNF-like Ligand 1A
  • the subject has a fibrotic disease, a skin disease or inflammation, an autoimmune disorder, or a respiratory disease.
  • also disclosed herein include pharmaceutical compositions, combinations, and kits with use of one or more of the methods described herein.
  • modulating the activity of LIGHT and the activity of TL1A in the subject in need thereof comprises, consists essentially of, or yet further consists of administering to the subject a sufficient amount of a first molecule that modulates the activity of LIGHT and a second molecule that modulates the activity of TL1A.
  • modulating the activity of LIGHT and the activity of TL1 A in the subject in need thereof comprises, consists essentially of, or yet further consists of reducing, decreasing, suppressing, limiting, controlling, or inhibiting the activity of LIGHT, and reducing, decreasing, suppressing, limiting, controlling, or inhibiting the activity of TL1A.
  • the first molecule comprises, consists essentially of, or yet further consists of a fusion of an immunoglobulin with a) herpesvirus entry mediator (HVEM) or b) lymphotoxin beta receptor (LTpR) polypeptide.
  • HVEM herpesvirus entry mediator
  • LpR lymphotoxin beta receptor
  • the first molecule comprises, consists essentially of, or yet further consists of a polypeptide that binds to LIGHT, HVEM, or LTpR, a peptidomimetic that modulates LIGHT, or a small molecule that modulates LIGHT.
  • the first molecule comprises, consists essentially of, or yet further consists of an antibody that binds to LIGHT, an antibody that binds to HVEM, or an antibody that binds to LTpR.
  • the second molecule comprises, consists essentially of, or yet further consists of a fusion of death receptor 3 (DR3) with an immunoglobulin, a polypeptide that binds to DR3, a fusion of DcR3 with an immunoglobulin, a peptidomimetic that modulates TL1 A, or a small molecule that modulates TL1 A.
  • DR3 death receptor 3
  • the second molecule comprises, consists essentially of, or yet further consists of an antibody that binds to TL1 A or an antibody that binds to DR3.
  • the antibody is a full-length antibody or an antigen binding fragment thereof.
  • the antibody fragment is a Fab, Fab’, F(ab’)2, Fv, Fd, single-chain Fv (scFv), trispecific (Fab3), bispecific (Fab2), diabody ((VL-VH)2 or (VH-VLL), triabody (trivalent), tetrabody (tetravalent), minibody ((scFv-Crik), bispecific single-chain Fv (Bis-scFv), IgGdeltaCH2, scFv-Fc, or (SCFV) 2 -FC.
  • the antibody that binds to LIGHT, HVEM, or LTpR is a multispecific antibody that binds to LIGHT, HVEM, or LTpR and one or more of TL1A or DR3.
  • the multispecific antibody comprises, consists essentially of, or yet further consists of: a) a first antigen binding domain that binds to LIGHT, HVEM, or LTpR and a second antigen binding domain that binds to TL1 A; b) a first antigen binding domain that binds to LIGHT, HVEM, or LTpR and a second antigen binding domain that binds to DR3; c) a first antigen binding domain that binds to LIGHT and a second antigen binding domain that binds to TL1 A or DR3; d) a first antigen binding domain that binds to HVEM and a second antigen binding domain that binds to TL1 A or DR3; e)
  • the multispecific antibody is a bispecific antibody, optionally a full-length antibody or an antigen binding fragment thereof.
  • the fragment of the bispecific antibody is a scFv.
  • the method comprises administering to the subject the first molecule and the second molecule.
  • the first molecule and the second molecule are administered simultaneously.
  • the first molecule and the second molecule are administered sequentially.
  • the first molecule is administered prior to administering the second molecule.
  • the first molecule is administered after administering the second molecule.
  • the first molecule is an inhibitor of LIGHT.
  • the second molecule is an inhibitor of TL1A.
  • the fibrotic disease comprises, consists essentially of, or yet further consists of fibrosis of a parenchymal organ or tissue, optionally of the lung, liver, skin, kidney, brain, heart, joints, intestine, or the bone marrow.
  • the fibrotic disease comprises, consists essentially of, or yet further consists of interstitial lung disease (ILD), liver cirrhosis, or idiopathic pulmonary fibrosis.
  • ILD interstitial lung disease
  • liver cirrhosis or idiopathic pulmonary fibrosis.
  • the skin disease or inflammation comprises, consists essentially of, or yet further consists of atopic dermatitis, scleroderma, psoriasis, onchocercal dermatitis, nephrogenic fibrosing dermopathy, mixed connective tissue disease, scleromyxedema, keloid, sclerodactyly, or eosinophilic fasciitis.
  • the respiratory disease or disorder comprises, consists essentially of, or yet further consists of asthma, allergic asthma, bronchiolitis, pleuritis, chronic obstructive pulmonary disease (COPD), extrinsic bronchial asthma, allergic rhinitis, eosophageal allergy, or gastrointestinal allergy.
  • the respiratory disease comprises, consists essentially of, or yet further consists of nodules, eosinophilia, rheumatism, dermatitis and swelling (NERDS).
  • the respiratory disease comprises, consists essentially of, or yet further consists of airway obstruction, apnea, asbestosis, atelectasis, berylliosis, bronchiectasis, bronchiolitis, bronchiolitis obliterans organizing pneumonia, bronchitis, bronchopulmonarydysplasia empyema, pleural empyema, pleural epiglottitis, hemoptysis, hypertension, kartagener syndrome, meconium aspiration, pleural effusion, pleurisy, pneumonia, pneumothorax, respiratory distress syndrome, respiratory hypersensitivity, respiratory tract infections, rhinoscleroma, scimitar syndrome, severe acute respiratory syndrome, silicosis, or tracheal stenosis.
  • the autoimmune disorder is systemic sclerosis, rheumatoid arthritis (RA), lupus (e.g., systemic lupus erythematosus or SLE), inflammatory bowel disease (IBD), eosinophilic esophagitis (EoE), ankylosing spondylitis (AS), experimental autoimmune encephalomyelitis (EAE), or an autoimmune inflammatory disease of the central nervous system (CNS).
  • the method further comprises, consists essentially of, or yet further consists of administering to the subject an additional therapeutic agent.
  • the additional therapeutic agent comprises, consists essentially of, or yet further consists of an anti-inflammatory drug, a steroid, a hormone, or an immunosuppressant drug.
  • the first molecule and/or the second molecule and the additional therapeutic agent are administered simultaneously.
  • the first molecule and/or the second molecule and the additional therapeutic agent are administered sequentially.
  • the first molecule and/or the second molecule are administered prior to administering the additional therapeutic agent.
  • the first molecule and/or the second molecule are administered after administering the additional therapeutic agent.
  • the first molecule and/or the second molecule and/or the additional therapeutic agent are administered systemically.
  • the first molecule and/or the second molecule and/or the additional therapeutic agent are administered locally. In some embodiments, the first molecule and/or the second molecule and/or the additional therapeutic agent are administered by parenteral administration. In some embodiments, the first molecule and/or the second molecule and/or the additional therapeutic agent are administered intravenously or subcutaneously. In some embodiments, the subject is a mammal or a human.
  • a pharmaceutical composition comprising, consisting essentially of, or yet further consisting of as the active agent a first molecule that modulates the activity of LIGHT (p30 polypeptide), a second molecule that modulates the activity of TNF-like Ligand 1A (TL1A), and a pharmaceutically acceptable excipient.
  • a combination comprising, consisting essentially of, or yet further consisting of a first molecule that modulates the activity of LIGHT (p30 polypeptide) and a second molecule that modulates the activity of TNF-like Ligand 1A (TL1 A).
  • the combination further comprises, consists essentially of, or yet further consists of a pharmaceutically acceptable excipient.
  • the first molecule comprises, consists essentially of, or yet further consists of a fusion of an immunoglobulin and a) herpesvirus entry mediator (HVEM) or b) lymphotoxin beta receptor (LTpR) polypeptide with.
  • the first molecule comprises, consists essentially of, or yet further consists of a polypeptide that binds to LIGHT, HVEM, or LTpR, a peptidomimetic that modulates LIGHT, or a small molecule that modulates LIGHT.
  • the first molecule comprises, consists essentially of, or yet further consists of an antibody that binds to LIGHT, an antibody that binds to HVEM, or an antibody that binds to LTpR.
  • the second molecule comprises, consists essentially of, or yet further consists of a fusion of DR3 with an immunoglobulin, a polypeptide that binds to DR3, a fusion of DcR3 with an immunoglobulin, a peptidomimetic that modulates TL1A, or a small molecule that modulates TL1 A.
  • the second molecule comprises, consists essentially of, or yet further consists of an antibody that binds to TL1 A or an antibody that binds to DR3.
  • antibody that binds to LIGHT, HVEM, or LTBR is a multispecific antibody that binds to LIGHT, HVEM, or LTBR and one or more of TL1A or DR3.
  • the multispecific antibody comprises, consists essentially of, or yet further consists of: a) a first antigen binding domain that binds to LIGHT, HVEM, or LTpR and a second antigen binding domain that binds to TL1 A; b) a first antigen binding domain that binds to LIGHT, HVEM, or LTpR and a second antigen binding domain that binds to DR3; c) a first antigen binding domain that binds to LIGHT and a second antigen binding domain that binds to TL1 A or DR3; d) a first antigen binding domain that binds to HVEM and a second antigen binding domain that binds to TL1 A or DR3; e) a first antigen binding domain that bind
  • the combination comprises, consists essentially of, or yet further consists of a pharmaceutical composition comprising the first molecule that modulates the activity of LIGHT (p30 polypeptide), the second molecule that modulates the activity of TNF-like Ligand 1A (TL1 A), and a pharmaceutically acceptable excipient.
  • the first molecule is an inhibitor of LIGHT.
  • the second molecule is an inhibitor of TL1A.
  • kits comprising, consisting essentially of, or yet consisting of a first molecule that modulates the activity of LIGHT (p30 polypeptide) and/or a second molecule that modulates the activity of TNF-like Ligand 1A (TL1A) for use with the method described below, and optionally comprises instructions for use.
  • the first molecule is an inhibitor of LIGHT.
  • the second molecule is an inhibitor of TL1A.
  • FIG. 1 illustrates a cartoon representation of key modulators of TNF family proteins inseveral immune-mediated disorders.
  • LIGHT (also known as TNFSF14 and CD258), is a soluble and membrane expressed pro-inflammatory molecule that acts through two receptors, the herpesvirus entry mediator (HVEM; TNFRSF14; CD270) and the lymphotoxin b receptor (LTpR; TNFRSF3). HVEM is found on most lymphoid and several non-lymphoid cells, and LTpR is on APC and non-lymphoid cells. LIGHT is a product of T cells and is made by all CD4 T cells regardless of Th phenotype as well as by CD8 T cells.
  • HVEM herpesvirus entry mediator
  • LIGHT lymphotoxin b receptor
  • LIGHT can be made by macrophages, neutrophils, and eosinophils.
  • TL1A (TNFSF15) is also a soluble and membrane- expressed molecule, made by several cells including dendritic cells, macrophages, fibroblasts, epithelial cells, neutrophils and eosinophils.
  • TL1A acts through the receptor DR3 (TNFRSF25) that can be expressed on T cells, innate lymphoid cells, and structural cells such as fibroblasts and epithelial cells.
  • FIG. 2A - FIG. 2C illustrate LTpR, HVEM, and DR3 are co-expressed or active in lung epithelial cells and fibroblasts, and keratinocytes and dermal fibroblasts.
  • FIG. 3A-FIG. 3C illustrate that rLIGHT and rTLl A promote airway remodeling independent of one another.
  • Naive mice were injected with PBS or 1 Opg rLIGHT or rTLl A intratracheally on two consecutive days. On day 3, accumulation of collagen was analyzed in the airways with trichrome staining.
  • FIG. 3A rLIGHT was injected into DR3-/- mice, or rTLl A into LIGHT-/- mice.
  • FIG. 3B rLIGHT was combined with rTLl A (5 pg each), and the extent of collagen deposition scored as well as the extent of inflammation scored.
  • FIG. 3C rLIGHT and rTLl A were injected into RAG-/- mice. Note: aSMA expression was also upregulated by rLIGHT and rTLl A in all cases and not shown in the data.
  • FIG. 4 illustrates blocking LIGHT interactions reduces airway fibrosis and remodeling induced by allergen, in a model of asthma.
  • WT mice were sensitized with house dust mite extract (HDM) i.n. on days 0, 7 and 14, and treated 2x per week for 4 weeks with i.n. HDM to promote remodeling.
  • Control IgG or LTpR-Ig were given i.p. 2x per week for the last 4 weeks.
  • FIG. 5A - FIG. 5B illustrate reduced atopic dermatitis and psoriasis skin inflammatory responses in LIGHT-deficient mice.
  • WT littermates and LIGHT-/- mice were sensitized: (FIG. 5A) in 2 cycles epicutaneously with house dust mite (HDM) extract, given on a gauze pad placed on the abraded shaved back for 3 days starting on day 0, and repeated on day 8; and (FIG. 5B) with a cream containing imiquimod, given on the shaved back once a day for 7 days. Mice were examined visually on day 14 (FIG. 5 A) or day 8 (FIG. 5B), and with Masson’s tri chrome staining of skin sections (for collagen). Representative of 6-20 mice/group from 2-4 experiments.
  • HDM house dust mite
  • FIG. 6A-FIG. 6C illustrate reduced airway remodeling in models of asthma and systemic sclerosis and skin remodeling in models of atopic dermatitis and psoriasis after neutralizing TL1A-DR3.
  • FIG. 6A-FIG. 6B Mice were sensitized with (FIG. 6A) HDM i.n. over 6 weeks, and (FIG. 6B) bleomycin i.t over 7 days. WT and DR3-/- mice, and (FIG. 6A)
  • FIG. 6C WT mice treated with DR3.Fc given i.p. 2x per week for the last 4 weeks.
  • FIG. 6C WT and DR3-/- mice treated epicutaneously with HDM (top), or imiquimod over 7 days (bottom). Sections stained with Masson’s trichrome or anti-aSMA (bronchiole’s outlined with dotted lines). Airway sections scored for trichome and aSMA expression (FIG. 6A-FIG. 6B). Data representative of, or means ⁇ s.e.m from, 6-20 mice. All results representative of, or from, 3 experiments. *p ⁇ 0.05.
  • FIG. 7 illustrates blocking TL1 A reduces airway fibrosis and remodeling in a model of systemic sclerosis.
  • Mice were sensitized with bleomycin i.t over 7 days, and treated with DR3.Fc or control IgG given i.p. Lung sections stained with Masson’s trichrome or anti-aSMA. Airway sections scored for trichome and aSMA expression. Data representative of, or means ⁇ s.e.m from, 6-20 mice.
  • FIG. 8A illustrates LIGHT promotes steroid-resistant responses in normal human bronchial epithelial cells (HBE). HBE were stimulated with rLIGHT without (black bars) or with (gray bars) budesonide. Data are mean fold increase in mRNA over unstimulated cells after 3 days, measured by RT-PCR. Steroid sensitivity was arbitrarily set at >75% inhibition of the LIGHT -induced response, indicated to the left of the thick dotted lines.
  • FIG. 8B illustrates TL1 A promotes fibrotic activity in human bronchial epithelial cells similar to LIGHT. HBE were stimulated with rLIGHT (left) or rTLl A (right) for 48hrs and expression of periostin and TSLP examined by IF staining.
  • FIG. 9A - FIG. 9D illustrate LIGHT and TL1 A induce inflammatory and remodeling activity in human airway fibroblasts (HAF). HAF were stimulated with rLIGHT or rTLl A with or without TGF-b.
  • FIG. 9A Proliferation (left, thymidine incorporation) or aSMA mRNA (right) induced by LIGHT, TGF-b or both.
  • FIG. 9B mRNA for select genes induced by LIGHT.
  • FIG. 9C Collagen 13 and periostin protein (IF stain; DAPI is used for collagen) and mRNA induced by TL1 A.
  • FIG. 9A Proliferation (left, thymidine incorporation) or aSMA mRNA (right) induced by LIGHT, TGF-b or both.
  • FIG. 9B mRNA for select genes induced by LIGHT.
  • FIG. 9C Collagen 13 and periostin protein (IF stain; DAPI is used for collagen) and
  • FIG. 10 illustrates therapeutic blocking of LIGHT and TL1 A limits allergen-driven atopic dermatitis.
  • WT mice were sensitized epicutaneously with HDM in 2 cycles. Mice were treated with IgG, DR3.Fc, LTbR.Fc, or both (200 pg i.v.) after disease had developed, starting on day 7 one day prior to the second HDM exposure, with mice analyzed on day 14. Clinical symptoms (eruption, scaling, bleeding, redness) from individual mice; and representative skin sections stained with tri chrome blue. Data individual mice, with 4 mice per group. *p ⁇ 0.05.
  • FIG. 11 A - FIG. 1 IB illustrate LIGHT and TL1 A and their receptors are expressed in atopic dermatitis (AD) skin.
  • FIG. 11 A shows bulk RNA-seq analysis of transcripts in AD lesional and non-lesional skin vs. healthy.
  • IL-5 and IL-9 are expressed at low levels (TPM, transcripts per million, ⁇ 0.3) like IL-4 (not shown);
  • IL-13 is upregulated in lesional and non- lesional AD;
  • LIGHT is expressed at higher levels than IL-13 in AD lesions (TPM mean 1.2 vs.
  • FIG. 1 IB shows single cell RNA-seq analysis of transcripts in AD lesional and non-lesional skin. Data are mean TPM from multiple single cells. LTpR, HVEM, and DR3 transcripts are found in keratinocytes and fibroblasts from lesional and non-lesional skin.
  • FIG. 12A and FIG. 12B illustrate LIGHT-deficiency decreases skin fibrosis and remodeling induced by bleomycin in a model of scleroderma, whereas LIGHT intradermal injection alone induces skin fibrosis and remodeling reminiscent of scleroderma.
  • FIG. 12A shows WT and LIGHT _/ mice were injected with bleomycin.
  • FIG. 12B shows WT mice were injected with either PBS or LIGHT (20pg/mouse). Masson tri chrome (collagen), alpha Smooth muscle actin (aSMA) and TSLP immunofluorescent staining of skin sections. The data is representative of 6 to 10 mice per group.
  • FIG. 13 shows unregulated expression of LIGHT and TL1 A mRNA transcripts in lung biopsies from patients with systemic sclerosis with pulmonary fibrosis compared to normal lungs from healthy individuals.
  • a cell includes a plurality of cells, including mixtures thereof.
  • compositions and methods include the recited elements, but do not exclude others.
  • Consisting essentially of when used to define compositions and methods, shall mean excluding other elements of any essential significance to the combination for the intended use. For example, a composition consisting essentially of the elements as defined herein would not exclude trace contaminants from the isolation and purification method and pharmaceutically acceptable carriers, such as phosphate buffered saline, preservatives and the like.
  • Consisting of shall mean excluding more than trace elements of other ingredients and substantial method steps for administering the compositions disclosed herein. Aspects defined by each of these transition terms are within the scope of the present disclosure.
  • LIGHT is a protein expressed by activated CD4/CD8 T cells, dendritic cells (DCs), monocytes, and natural killer cells (NK).
  • HVEM herpes virus entry mediator
  • LT R lymphotoxin beta receptor
  • a first molecule that modulates the activity of a LIGHT ((p30 polypeptide) receptor refers to a molecule that alters the activity of the LIGHT receptor.
  • the first molecule decreases, reduces, or limits the activity of the LIGHT receptor, e.g., decreases the activity by about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80, 90%, or 100%.
  • the first molecule decreases the activity of the LIGHT receptor by about 1- fold, 2-fold, 3-fold, 4-fold, 5-fold, 6-fold, 7-fold, 8-fold, 9-fold, 10-fold, 20-fold, 30-fold, 40- fold, 50-fold, 100-fold, 200-fold, 500-fold, or more.
  • the first molecule can modulate the activity of the LIGHT receptor either directly or indirectly, by binding to LIGHT, or to its binding partner HVEM or LTpR.
  • Modulators of the LIGHT receptor include, but are not limited to, a fusion of an immunoglobulin with HVEM or LTpR; a polypeptide that binds to LIGHT, HVEM, or LTpR; a peptidomimetic that modulates LIGHT; a small molecule that modulates LIGHT; an antibody that binds to LIGHT, an antibody that binds to HVEM, or an antibody that binds to LTpR.
  • the first molecule that modulates the activity of the LIGHT receptor is an inhibitor of LIGHT.
  • an inhibitor of LIGHT refers to a molecule that directly or indirectly inhibits or blocks binding of LIGHT (p30 polypeptide) to HVEM or to LT R. Inhibitors therefore include molecules that bind to LIGHT as well as molecules that bind to a LIGHT receptor, e.g., HVEM or LT R. LIGHT (p30 polypeptide) inhibitors therefore include molecules that bind to LIGHT (p30 polypeptide), molecules that bind to HVEM, as well as molecules that bind to LT R.
  • inhibitors of LIGHT include, but are not limited to, a fusion of an immunoglobulin with HVEM or LTpR; a polypeptide that binds to LIGHT, HVEM, or LTpR; a peptidomimetic that modulates LIGHT, HVEM, or LTpR; a small molecule that modulates LIGHT; an antibody that binds to LIGHT, an antibody that binds to HVEM, or an antibody that binds to LTpR.
  • the first molecule that modulates the activity of a LIGHT receptor comprises a fusion of an immunoglobulin with a herpesvirus entry mediator (HVEM) polypeptide or a lymphotoxin beta receptor (LTpR) polypeptide.
  • HVEM also known as tumor necrosis factor receptor superfamily member 14, TNFRSF14, TR2, CD270, CD40-like protein, or LIGHTR
  • TNF receptor superfamily that functions in signal transduction pathways that activate inflammatory immune responses.
  • the HVEM polypeptide comprises a mammalian HVEM polypeptide, e.g., a HVEM polypeptide from a rodent, a non-human primate, or a human.
  • the HVEM polypeptide comprises a full-length polypeptide.
  • the HVEM polypeptide comprises a functional fragment, for example, comprising a truncation of about 5, 10, 15, 20, 25, 30, 35, 40, 50, or more amino acid residues from the N-terminus, the C-terminus, or a combination thereof.
  • the fusion polypeptide comprising an immunoglobulin and a HVEM polypeptide is an inhibitor of LIGHT.
  • HVEM herpesvirus entry mediator sequence
  • SEQ ID NO: 1 A non-limiting representative example of human HVEM (herpesvirus entry mediator) sequence comprises a polypeptide as set forth below (SEQ ID NO: 1):
  • LTpR also known as tumor necrosis factor receptor superfamily member 3 or TNFRSF3
  • TNFRSF3 tumor necrosis factor receptor superfamily member 3
  • the LTpR polypeptide comprises a mammalian LTpR polypeptide, e.g., a LTpR polypeptide from a rodent, a non-human primate, or a human.
  • the LTpR polypeptide comprises a full-length polypeptide.
  • the LTpR polypeptide comprises a functional fragment, for example, comprising a truncation of about 5, 10, 15, 20, 25, 30, 35,
  • the fusion polypeptide comprising an immunoglobulin and a LTpR polypeptide is an inhibitor of LIGHT.
  • a non-limiting representative example of human LT R sequence comprises a polypeptide as set forth below (SEQ ID NO:2):
  • the immunoglobulin is an antibody (e.g., an IgG, IgM, IgA,
  • the immunoglobulin is an IgG antibody (e.g., IgGl, IgG2, IgG3, or IgG4 antibody).
  • the immunoglobulin comprises the Fc region of an antibody (e.g., the Fc region of an IgG antibody, optionally an IgGl, IgG2, IgG3, or IgG4 Fc region).
  • the Fc region is from a human antibody (e.g., a human IgG antibody, optionally a human IgGl, IgG2, IgG3, or IgG4 Fc region).
  • An exemplary sequence of the Fc region comprises
  • the fusion polypeptide further comprises a linker that bridges the immunoglobulin with either HVEM or LTpR.
  • the linker comprises a peptide, e.g., a poly-Ala peptide, a poly-Gly peptide, or a peptide comprising a plurality of Ala and Gly residues.
  • the peptide is from 2 to 20 amino acids in length, optionally from 2 to 15, 2 to 10, 2 to 8, 2 to 6, 5 to 20, 5 to 15, 5 to 10, 10 to 20, 12 to 20, or 12 to 15 amino acids in length.
  • the linker comprises (Gly4Ser) n in which n is an integer selected from 1 to 10, e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10.
  • the first molecule that modulates the activity of a LIGHT receptor comprises a polypeptide that binds to LIGHT, HVEM, or LTpR.
  • the first molecule comprises a LIGHT polypeptide.
  • the LIGHT polypeptide comprises a mammalian LIGHT polypeptide, e.g., a LIGHT polypeptide from a rodent, a non human primate, or a human.
  • the LIGHT polypeptide comprises a full-length polypeptide.
  • the LIGHT polypeptide comprises a functional fragment, for example, comprising a truncation of about 5, 10, 15, 20, 25, 30, 35, 40, 50, or more amino acid residues from the N-terminus, the C-terminus, or a combination thereof. In some cases, the LIGHT polypeptide is an inhibitor of LIGHT.
  • a non-limiting representative example of human LIGHT (p30 polypeptide) sequence comprises a polypeptide as set forth below: MEESVVRPSVFVVDGQTDIPFTRLGRSHRRQSCSVARVGLGLLLLLMGAGLAVQGWFL LOLHWRLGEMVTRLPDGP AGSWEOLIOERRSHEVNP AAHLTGAN S SLTGSGGPLLWET
  • the first molecule that modulates the activity of a LIGHT receptor comprises a polypeptide that binds to LIGHT.
  • the polypeptide that binds to LIGHT comprises a HVEM polypeptide or a LTpR polypeptide.
  • the HVEM polypeptide comprises a mammalian HVEM polypeptide, e.g., a HVEM polypeptide from a rodent, a non-human primate, or a human (e.g., SEQ ID NO: 1).
  • the HVEM polypeptide comprises a full-length polypeptide.
  • the HVEM polypeptide comprises a functional fragment, for example, comprising a truncation of about 5, 10, 15, 20, 25, 30, 35, 40, 50, or more amino acid residues from the N-terminus, the C-terminus, or a combination thereof.
  • the LTpR polypeptide comprises a mammalian LTpR polypeptide, e.g., a LTpR polypeptide from a rodent, a non-human primate, or a human (e.g., SEQ ID NO: 2).
  • the LTpR polypeptide comprises a full-length polypeptide.
  • the LTpR polypeptide comprises a functional fragment, for example, comprising a truncation of about 5, 10, 15, 20, 25, 30, 35, 40, 50, or more amino acid residues from the N- terminus, the C-terminus, or a combination thereof.
  • the HVEM polypeptide and/or the LTpR polypeptide is an inhibitor of LIGHT.
  • the first molecule that modulates the activity of a LIGHT receptor comprises a peptidomimetic that modulates LIGHT, HVEM, or LTpR.
  • the first molecule is an inhibitor of LIGHT.
  • the term “mimetic” refers to a synthetic chemical compound which has substantially the same structural and/or functional characteristics as the reference molecule.
  • the mimetic can be entirely composed of synthetic, non-natural amino acid analogues, or can be a chimeric molecule including one or more natural peptide amino acids and one or more non-natural amino acid analogs.
  • the mimetic can also incorporate any number of natural amino acid conservative substitutions as long as such substitutions do not destroy activity.
  • the first molecule that modulates the activity of a LIGHT receptor comprises a small molecule that modulates LIGHT.
  • the small molecule can include those that can bind selectively as well as those that bind non- selectively to LIGHT, HVEM, or LTpR in solution, in solid phase, in vitro, ex vivo or in vivo.
  • selective can refer to a small molecule modulator (e.g., inhibitor) that binds specifically to the target entity (e.g., LIGHT, HVEM, or LTpR) and does not significantly bind to a non-ligand or non-target entity.
  • a non-selective modulator means that the modulator (e.g., the inhibitor) is not selective for the entity to which it binds, i.e., it cross-reacts with other entities.
  • exemplary small molecule modulators of LIGHT can further include salts or derivatives of a small molecule modulator.
  • the first molecule that modulates the activity of a LIGHT receptor comprises an antibody that binds to LIGHT, an antibody that binds to HVEM, or an antibody that binds to LTpR.
  • LIGHT antibodies include, for example, antibodies that bind to human LIGHT, a non-human primate LIGHT, a rodent LIGHT, or a combination thereof.
  • Non-limiting examples of antibodies that bind to human LIGHT include clone T5-39 (BioLegend, San Diego, CA), clone 115520 (R&D Systems, Minneapolis, MN), clones A-20 and C-20 (Santa Cruz Biotech, Santa Cruz, CA), and clone 4E3 (Novus Biologicals, Inc., Littleton, CO).
  • Exemplary antibodies that bind to human HVEM include MAB3561 (R&D Systems), R718 (BD Biosciences), and HVEM Antibody D-5 (Santa Cruz Biotechnology).
  • Exemplary antibodies that bind to human LTpR include MAB6291 and AF629 (R&D Systems), and 31G4D8 (BioLegend®).
  • TNF-like Ligand 1 A (also known as tumor necrosis factor superfamily member 15 or TNFSF15) is a member of the TNF superfamily.
  • TL1A can be expressed by multiple cell types including endothelial cells and fibroblasts and is upregulated by stimulation with proinflammatory cytokines such as TNF-a and IL-1.
  • TL1A expression has also been detected on antigen-presenting cells and lymphocytes such as dendritic cells (DCs), macrophages, and T cells.
  • DCs dendritic cells
  • TL1 A can promote inflammation through acting on cells such as T cells and innate lymphoid cells or non-lymphoid cells via the tumor necrosis factor receptor superfamily (TNFRSF) cell surface receptor death receptor 3 (DR3, also known as tumor necrosis factor receptor superfamily member 25, TNFRSF25, APO-3, TRAMP, LARD, and WSL-1).
  • TNFRSF tumor necrosis factor receptor superfamily
  • DR3 tumor necrosis factor receptor superfamily member 25, APO-3, TRAMP, LARD, and WSL-1
  • Both TL1 A and LIGHT can also bind the soluble molecule decoy receptor 3 (DcR3 also known as tumor necrosis factor receptor superfamily member 6B, TNFRSF6B, TR6, and M68).
  • DcR3 is a member of the tumor necrosis factor receptor superfamily (TNFRSF) and is thought to be a naturally produced inhibitor of TL1A and LIGHT.
  • a second molecule that modulates the activity of a TL1 A receptor refers to a molecule that alters the activity of the TL1 A receptor.
  • the second molecule decreases, reduces, or limits the activity of the TL1 A receptor, e.g., decreases the activity by about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80, 90%, or 100%.
  • the second molecule decreases the activity of the TL1 A receptor by about 1-fold, 2-fold, 3 -fold, 4-fold, 5-fold, 6-fold, 7-fold, 8-fold, 9-fold, 10-fold, 20-fold, 30-fold, 40-fold, 50-fold, 100-fold, 200-fold, 500-fold, or more.
  • the second molecule can modulate the activity of the TL1 A receptor either directly or indirectly, by binding to TL1 A, or to its binding partner death receptor 3 (DR3).
  • Modulators of the TL1 A receptor include, but are not limited to, a fusion of an immunoglobulin with DR3 or DcR3; a polypeptide that binds to TL1 A or DR3; a peptidomimetic that modulates TL1 A or DR3; a small molecule that modulates TL1 A or DR3; an antibody that binds to TL1 A, or an antibody that binds to DR3.
  • the second molecule that modulates the activity of the TL1 A receptor is an inhibitor of TL1A.
  • an inhibitor of TL1A refers to a molecule that directly or indirectly inhibits or blocks binding of TL1A to DR3. Inhibitors therefore include molecules that bind to TL1 A as well as molecules that bind to a TL1 A receptor, e.g., DR3. TL1A inhibitors therefore include molecules that bind to TL1 A and molecules that bind to DR3.
  • inhibitors of TL1A include, but are not limited to, a fusion of an immunoglobulin with DR3 or DcR3; a polypeptide that binds to TL1 A or DR3; a peptidomimetic that modulates TL1 A or DR3; a small molecule that modulates TL1 A or DR3; an antibody that binds to TL1A, or an antibody that binds to DR3.
  • the second molecule that modulates the activity of a TL1 A receptor comprises a fusion of an immunoglobulin with a DR3 polypeptide or a DcR3 polypeptide.
  • the DR3 polypeptide comprises a mammalian DR3 polypeptide, e.g., a DR3 polypeptide from a rodent, a non-human primate, or a human.
  • the DR3 polypeptide comprises a full-length polypeptide.
  • the DR3 polypeptide comprises a functional fragment, for example, comprising a truncation of about 5, 10, 15, 20, 25, 30, 35, 40, 50, or more amino acid residues from the N-terminus, the C-terminus, or a combination thereof.
  • the fusion polypeptide comprising an immunoglobulin and a DR3 polypeptide is an inhibitor of TL1A.
  • a non-limiting representative example of human DR3 sequence comprises a polypeptide as set forth below (SEQ ID NO: 5)
  • the second molecule that modulates the activity of a TL1 A receptor comprises a fusion of an immunoglobulin with a DcR3 polypeptide.
  • the DcR3 polypeptide comprises a mammalian DcR3 polypeptide, e.g., a DcR3 polypeptide from a rodent, a non-human primate, or a human.
  • the DcR3 polypeptide comprises a full-length polypeptide.
  • the DcR3 polypeptide comprises a functional fragment, for example, comprising a truncation of about 5, 10, 15, 20, 25, 30, 35, 40, 50, or more amino acid residues from the N-terminus, the C-terminus, or a combination thereof.
  • the fusion polypeptide comprising an immunoglobulin and a DcR3 polypeptide is an inhibitor of TL1 A.
  • a non-limiting representative example of human DcR3 sequence comprises a polypeptide as set forth below (SEQ ID NO: 6)
  • the fusion polypeptide further comprises a linker that bridges the immunoglobulin with either DR3 or DcR3.
  • the linker comprises a peptide, e.g., a poly-Ala peptide, a poly-Gly peptide, or a peptide comprising a plurality of Ala and Gly residues.
  • the peptide is from 2 to 20 amino acids in length, optionally from 2 to 15, 2 to 10, 2 to 8, 2 to 6, 5 to 20, 5 to 15, 5 to 10, 10 to 20, 12 to 20, or 12 to 15 amino acids in length.
  • the linker comprises (Gly4Ser) n in which n is an integer selected from 1 to 10, e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10.
  • the second molecule that modulates the activity of a TL1 A receptor comprises a polypeptide that binds to TL1 A or DR3.
  • the second molecule comprises a TL1 A polypeptide.
  • the TL1 A polypeptide comprises a mammalian TL1 A polypeptide, e.g., a TL1 A polypeptide from a rodent, a non-human primate, or a human.
  • the TL1 A polypeptide comprises a full-length polypeptide.
  • the TL1 A polypeptide comprises a functional fragment, for example, comprising a truncation of about 5, 10, 15, 20, 25, 30, 35, 40, 50, or more amino acid residues from the N- terminus, the C-terminus, or a combination thereof.
  • the TL1 A polypeptide is an inhibitor of TL1A.
  • a non-limiting representative example of human TL1A sequence comprises a polypeptide as set forth below (SEQ ID NO: 7)
  • the second molecule that modulates the activity of a TL1 A receptor comprises a polypeptide that binds to TL1 A.
  • the polypeptide that binds to TL1 A comprises a DR3 polypeptide or a DcR3 polypeptide.
  • the DR3 polypeptide comprises a mammalian DR3 polypeptide, e.g., a DR3 polypeptide from a rodent, a non-human primate, or a human (e.g., SEQ ID NO: 5).
  • the DR3 polypeptide comprises a full-length polypeptide.
  • the DR3 polypeptide comprises a functional fragment, for example, comprising a truncation of about 5, 10, 15, 20, 25, 30, 35, 40, 50, or more amino acid residues from the N-terminus, the C-terminus, or a combination thereof.
  • the DcR3 polypeptide comprises a mammalian DcR3 polypeptide, e.g., a DcR3 polypeptide from a rodent, a non-human primate, or a human (e.g., SEQ ID NO: 6).
  • the DcR3 polypeptide comprises a full-length polypeptide.
  • the DcR3 polypeptide comprises a functional fragment, for example, comprising a truncation of about 5, 10, 15, 20, 25, 30, 35, 40, 50, or more amino acid residues from the N-terminus, the C-terminus, or a combination thereof.
  • the DR3 polypeptide and/or the DcR3 polypeptide is an inhibitor of TL1A.
  • the second molecule that modulates the activity of a TL1 A receptor comprises a peptidomimetic that modulates TL1 A or DR3.
  • the second molecule is an inhibitor of TL1A or DR3.
  • the term “mimetic” refers to a synthetic chemical compound which has substantially the same structural and/or functional characteristics as the reference molecule.
  • the mimetic can be entirely composed of synthetic, non-natural amino acid analogues, or can be a chimeric molecule including one or more natural peptide amino acids and one or more non-natural amino acid analogs.
  • the mimetic can also incorporate any number of natural amino acid conservative substitutions as long as such substitutions do not destroy activity.
  • the second molecule that modulates the activity of a TL1 A receptor comprises a small molecule that modulates TL1 A or DR3.
  • the small molecule can include those that can bind selectively as well as those that bind non- selectively to TL1 A or DR3 in solution, in solid phase, in vitro, ex vivo or in vivo.
  • selective can refer to a small molecule modulator (e.g., inhibitor) that binds specifically to the target entity (e.g., TL1 A or DR3) and does not significantly bind to a non-ligand or non-target entity.
  • a non-selective modulator means that the modulator (e.g., the inhibitor) is not selective for the entity to which it binds, i.e., it cross-reacts with other entities.
  • exemplary small molecule modulators of TL1A or DR3 can further include salts or derivatives of a small molecule modulator.
  • the second molecule that modulates the activity of a TL1 A receptor comprises an antibody that binds to TL1 A or an antibody that binds to DR3.
  • TL1 A antibodies include, for example, antibodies that bind to human TL1 A, non-human primate TL1 A, a rodent TL1 A, or a combination thereof.
  • Non-limiting examples of antibodies that bind to human TL1 A include AF744 and MAB7441 (R&D Systems), L4G9 (Enzo Life Sciences, Inc.), and Ab85566 (Abeam).
  • Exemplary antibodies that bind to human DR3 include MAB943 (R&D Systems), LS-B7731 (LifeSpan BioSciences), and anti-DR3 antibody from Biorbyt.
  • antibodies include mammalian, human, humanized, humaneered or primatized forms of heavy or light chain, VH and VL, respectively, immunoglobulin (Ig) molecules.
  • An “antibody” means any monoclonal or polyclonal immunoglobulin molecule, such as IgM, IgG, IgA, IgE, IgD, and any subclass thereof, which includes intact immunoglobulin molecules, two full length heavy chains linked by disulfide bonds to two full length light variable domains, VH and VL, individually or in any combination, as well as subsequences, such as Fab, Fab’, (Fab’ Fv, Fd, scFv and sdFv, unless otherwise expressly stated.
  • An antibody that binds to LIGHT, HVEM, LT R, TL1 A, or DR3 means that the antibody has an affinity for LIGHT, HVEM, LT R, TL1 A, or DR3. “Binding” or “binds” is where the binding is selective between the two referenced molecules. Thus, binding of an antibody for LIGHT, HVEM, LT R, TL1 A, or DR3 is that which is selective for an epitope present in LIGHT, HVEM, LT R, TL1 A, or DR3.
  • the binding is a specific binding, which can be distinguished from non-specific when the dissociation constant (KD) is less than about 1 X 10 5 M or less than about 1 X 10 6 M or 1 X 10 7 M.
  • KD dissociation constant
  • Selective binding can be distinguished from non-selective binding using assays known in the art (e.g., immunoprecipitation, ELISA, Western blotting) with appropriate controls.
  • the antibody is a full-length antibody or an antigen binding fragment thereof.
  • the antibody fragment can be a Fab, Fab’, F(ab’)2, Fv, Fd, single-chain Fv (scFv), trispecific (Fab3), bispecific (Fab2), diabody ((VL-VH)2 or (VH-VL)2), triabody (trivalent), tetrabody (tetravalent), minibody ((SCFV-CH)2), bispecific single-chain Fv (Bis-scFv), IgGdeltaCH2, scFv-Fc, or (scFv)2-Fc.
  • the antibody is a humanized antibody, a human antibody, a chimeric antibody, a murine antibody, a monoclonal antibody, or a polyclonal antibody.
  • the antibody is a multispecific antibody that binds to LIGHT
  • a multispecific antibody refers to an antibody that binds to two or more target epitopes.
  • the multispecific antibody comprises a first antigen binding domain that binds to LIGHT, HVEM, or
  • LTpR a second antigen binding domain that binds to TL1 A or DR3
  • a third antigen domain that 1) binds to an additional target epitope selected from LIGHT, HVEM,
  • the multispecific antibody comprises a first antigen binding domain that binds to LIGHT, HVEM, or
  • the multispecific antibody comprises a first antigen binding domain that binds to LIGHT, HVEM, or
  • the multispecific antibody comprises a first antigen binding domain that binds to LIGHT and a second antigen binding domain that binds to TL1A or DR3. In some instances, the multi specific antibody comprises a first antigen binding domain that binds to HVEM and a second antigen binding domain that binds to TL1 A or DR3. In some instances, the multispecific antibody comprises a first antigen binding domain that binds to LTpR and a second antigen binding domain that binds to TL1 A or DR3.
  • the multispecific antibody comprises a first antigen binding domain that binds to LIGHT and a second antigen binding domain that binds to TL1 A. In some instances, the multispecific antibody comprises a first antigen binding domain that binds to LIGHT and a second antigen binding domain that binds to DR3. In some instances, the multispecific antibody comprises a first antigen binding domain that binds to
  • the multispecific antibody comprises a first antigen binding domain that binds to HVEM and a second antigen binding domain that binds to DR3. In some instances, the multispecific antibody comprises a first antigen binding domain that binds to LTpR and a second antigen binding domain that binds to TL1 A. In some instances, the multispecific antibody comprises a first antigen binding domain that binds to LTpR and a second antigen binding domain that binds to DR3.
  • the multispecific antibody further comprises a third antigen domain that 1) binds to an additional target epitope selected from LIGHT, HVEM, LTpR, TL1 A, or DR3 that is not the same as the first antigen binding domain or the second antigen binding domain, 2) binds to the Fey receptor of an antibody to modulate effector functions; or 3) an alternative target that is associated with a fibrotic disease, skin disease or inflammation, autoimmune disorder, or a respiratory disease.
  • a third antigen domain that 1) binds to an additional target epitope selected from LIGHT, HVEM, LTpR, TL1 A, or DR3 that is not the same as the first antigen binding domain or the second antigen binding domain, 2) binds to the Fey receptor of an antibody to modulate effector functions; or 3) an alternative target that is associated with a fibrotic disease, skin disease or inflammation, autoimmune disorder, or a respiratory disease.
  • the multispecific antibody is a bispecific antibody that binds to LIGHT, HVEM, or LTpR and one or more of TL1A or DR3.
  • Exemplary bispecific antibody formats include, but are not limited to, scFv, diabody, triabody, tetrabody, minibody, Bis-scFv, and tetravalent bispecific antibodies (e.g., fusion of an IgG antibody with a single chain domain). Additional bispecific antibody formats can be found in Labrijn, et al., “Bispecific antibodies: a mechanistic review of the pipeline,” Nature Reviews 18: 585-608 (2019).
  • the bispecific antibody binds to LIGHT, HVEM, or LTpR and one or more of TL1A or DR3.
  • the bispecific antibody comprises a first antigen binding domain that binds to LIGHT, HVEM, or LTpR and a second antigen binding domain that binds to TL1 A.
  • the bispecific antibody comprises a first antigen binding domain that binds to LIGHT, HVEM, or LTpR and a second antigen binding domain that binds to DR3.
  • the bispecific antibody comprises a first antigen binding domain that binds to LIGHT and a second antigen binding domain that binds to TL1 A or DR3.
  • the bispecific antibody comprises a first antigen binding domain that binds to HVEM and a second antigen binding domain that binds to TL1 A or DR3. In some instances, the bispecific antibody comprises a first antigen binding domain that binds to LTpR and a second antigen binding domain that binds to TL1 A or DR3. In some instances, the bispecific antibody comprises a first antigen binding domain that binds to LIGHT and a second antigen binding domain that binds to TL1 A. In some instances, the bispecific antibody comprises a first antigen binding domain that binds to LIGHT and a second antigen binding domain that binds to DR3.
  • the bispecific antibody comprises a first antigen binding domain that binds to HVEM and a second antigen binding domain that binds to TL1 A. In some instances, the bispecific antibody comprises a first antigen binding domain that binds to HVEM and a second antigen binding domain that binds to DR3. In some instances, the bispecific antibody comprises a first antigen binding domain that binds to LTpR and a second antigen binding domain that binds to TL1 A. In some instances, the bispecific antibody comprises a first antigen binding domain that binds to LTpR and a second antigen binding domain that binds to DR3.
  • a “human antibody” means that the amino acid sequence of the antibody is fully human, i.e., human heavy and light chain variable and constant regions.
  • the antibody amino acids are coded for in the human DNA antibody sequences or exist in a human antibody.
  • Fully human antibodies can be made by human antibody transgenic or transchromosomic animals, such as mice, or by isolation from human antibody producing cell lines (e.g., B cells) by recombinant DNA methodology known to the skilled artisan, such as gene cloning by reverse transcriptase polymerase chain reaction (RT-PCR).
  • An antibody that is non-human may be made fully human by substituting non-human amino acid residues with amino acid residues that exist in a human antibody.
  • humanized when used in reference to an antibody, means that the antibody sequence has non-human amino acid residues of one or more complementarity determining regions (CDRs) that specifically bind to the antigen in an acceptor human immunoglobulin molecule, and one or more human amino acid residues in the framework region (FR) that flank the CDRs.
  • CDRs complementarity determining regions
  • Any mouse, rat, guinea pig, goat, non-human primate (e.g., ape, chimpanzee, macaque, orangutan, etc.) or other animal antibody may be used as a CDR donor for producing humanized antibody.
  • Human framework region residues can be replaced with corresponding non-human residues (e.g., from the donor variable region).
  • Residues in the human framework regions can therefore be substituted with a corresponding residue from the non-human CDR donor antibody.
  • a humanized antibody may include residues, which are found neither in the human antibody nor in the donor CDR or framework sequences.
  • the use of antibody components derived from humanized monoclonal antibodies reduces problems associated with the immunogenicity of non-human regions. Methods of producing humanized antibodies are known in the art (see, for example, U.S. Patent Nos. 5,225,539; 5,530,101, 5,565,332 and 5,585,089; Riechmann et ah, (1988) Nature 332:323; EP 239,400; W091/09967; EP 592,106; EP 519,596; Padlan Molecular Immunol.
  • humanized when used in reference to an antibody, means that the antibody sequence has high affinity for antigen but has a greater number of human germline sequences than a humanized antibody. Typically humaneered antibody has at least 90% or more human germline sequences.
  • chimeric antibody refers to an antibody in which different portions are derived from different animal species, such as those having a variable region derived from a murine monoclonal antibody and a human immunoglobulin constant region, e.g., humanized antibodies.
  • techniques developed for the production of “chimeric antibodies” (Morrison et al., 1984, Proc. Natl. Acad. Sci. 81:851-855; Neuberger et al., 1984, Nature 312:604-608; Takeda et al., 1985, Nature 314:452-454) by splicing genes from a mouse antibody molecule of appropriate antigen specificity together with genes from a human antibody molecule of appropriate biological activity are used.
  • Monoclonal antibodies are made by methods known in the art (Kohler et al, Nature , 256:495(1975); and Harlow and Lane, Using Antibodies: A Laboratory Manual Cold Spring Harbor Laboratory, 1999). Briefly, monoclonal antibodies can be obtained by injecting mice with antigen.
  • the polypeptide or peptide used to immunize an animal may be derived from translated DNA or chemically synthesized and conjugated to a carrier protein. Commonly used carriers which are chemically coupled to the immunizing peptide include, for example, keyhole limpet hemocyanin (KLH), thyroglobulin, bovine serum albumin (BSA), and tetanus toxoid.
  • KLH keyhole limpet hemocyanin
  • BSA bovine serum albumin
  • tetanus toxoid tetanus toxoid.
  • Antibody production is verified by analyzing a serum sample, removing the spleen to obtain B lymphocytes, fusing the B lymphocytes with myeloma cells to produce hybridomas, cloning the hybridomas, selecting positive clones that produce antibodies to the antigen, and isolating the antibodies from hybridoma cultures.
  • Monoclonal antibodies can be isolated and purified from hybridoma cultures by a variety of established techniques which include, for example, affinity chromatography with Protein-A Sepharose, size-exclusion chromatography, and ion-exchange chromatography (see e.g., Coligan et al., Current Protocols in Immunology sections 2.7.1-2.7.12 and sections 2.9.1-2.9.3; and Barnes et al. , “Methods in Molecular Biology,” 10:79-104, Humana Press (1992)).
  • single chain antibodies are adapted to produce single chain antibodies.
  • Single chain antibodies are formed by linking the heavy and light chain fragments of the Fv region via an amino acid bridge, resulting in a single chain polypeptide.
  • Techniques for the assembly of functional Fv fragments in E. coli are also optionally used (Skerra et al., 1988, Science 242:1038-1041).
  • an expression vector comprising the nucleotide sequence of an antibody or the nucleotide sequence of an antibody is transferred to a host cell by conventional techniques (e.g., electroporation, liposomal transfection, and calcium phosphate precipitation), and the transfected cells are then cultured by conventional techniques to produce the antibody.
  • conventional techniques e.g., electroporation, liposomal transfection, and calcium phosphate precipitation
  • the expression of the antibody is regulated by a constitutive, an inducible or a tissue, specific promoter.
  • host-expression vector systems is utilized to express an antibody or its binding fragment described herein.
  • host-expression systems represent vehicles by which the coding sequences of the antibody is produced and subsequently purified, but also represent cells that are, when transformed or transfected with the appropriate nucleotide coding sequences, express an antibody or its binding fragment in situ.
  • host-expression systems represent vehicles by which the coding sequences of the antibody is produced and subsequently purified, but also represent cells that are, when transformed or transfected with the appropriate nucleotide coding sequences, express an antibody or its binding fragment in situ.
  • microorganisms such as bacteria (e.g., E. coli and B.
  • subtilis transformed with recombinant bacteriophage DNA, plasmid DNA or cosmid DNA expression vectors containing an antibody or its binding fragment coding sequences; yeast (e.g., Saccharomyces Pichia) transformed with recombinant yeast expression vectors containing an antibody or its binding fragment coding sequences; insect cell systems infected with recombinant virus expression vectors (e.g., baculovirus) containing an antibody or its binding fragment coding sequences; plant cell systems infected with recombinant virus expression vectors (e.g., cauliflower mosaic virus (CaMV) and tobacco mosaic virus (TMV)) or transformed with recombinant plasmid expression vectors (e.g., Ti plasmid) containing an antibody or its binding fragment coding sequences; or mammalian cell systems (e.g., COS, CHO, BH, 293, 293T, 3T3 cells) harboring recombinant expression constructs containing promoters derived from the
  • cell lines that stably express an antibody are optionally engineered.
  • host cells are transformed with DNA controlled by appropriate expression control elements (e.g., promoter, enhancer, sequences, transcription terminators, polyadenylation sites, etc.), and a selectable marker.
  • appropriate expression control elements e.g., promoter, enhancer, sequences, transcription terminators, polyadenylation sites, etc.
  • engineered cells are then allowed to grow for 1-2 days in an enriched media, and then are switched to a selective media.
  • the selectable marker in the recombinant plasmid confers resistance to the selection and allows cells to stably integrate the plasmid into their chromosomes and grow to form foci that in turn are cloned and expanded into cell lines.
  • This method can advantageously be used to engineer cell lines which express the antibody or its binding fragments.
  • a number of selection systems are used, including but not limited to the herpes simplex virus thymidine kinase (Wigler et al., 1977, Cell 11 :223), hypoxanthine- guanine phosphoribosyltransferase (Szybalska & Szybalski, 192, Proc. Natl. Acad. Sci.
  • adenine phosphoribosyltransferase genes are employed in tk-, hgprt- or aprt- cells, respectively.
  • antimetabolite resistance are used as the basis of selection for the following genes: dhfr, which confers resistance to methotrexate (Wigler et al., 1980, Proc. Natl. Acad. Sci. USA 77:357; O'Hare et al., 1981, Proc. Natl. Acad. Sci. USA 78:1527); gpt, which confers resistance to mycophenolic acid (Mulligan & Berg,
  • the expression levels of an antibody are increased by vector amplification (for a review, see Bebbington and Hentschel, The use of vectors based on gene amplification for the expression of cloned genes in mammalian cells in DNA cloning, Vol. 3. (Academic Press, New York, 1987)).
  • vector amplification for a review, see Bebbington and Hentschel, The use of vectors based on gene amplification for the expression of cloned genes in mammalian cells in DNA cloning, Vol. 3. (Academic Press, New York, 1987)).
  • a marker in the vector system expressing an antibody is amplifiable
  • an increase in the level of inhibitor present in culture of host cell will increase the number of copies of the marker gene. Since the amplified region is associated with the nucleotide sequence of the antibody, production of the antibody will also increase (Crouse et al., 1983, Mol. Cell Biol. 3:257).
  • any method known in the art for purification of an antibody is used, for example, by chromatography (e.g., ion exchange, affinity, particularly by affinity for the specific antigen after Protein A, and sizing column chromatography), centrifugation, differential solubility, or by any other standard technique for the purification of proteins.
  • chromatography e.g., ion exchange, affinity, particularly by affinity for the specific antigen after Protein A, and sizing column chromatography
  • centrifugation e.g., centrifugation, differential solubility, or by any other standard technique for the purification of proteins.
  • biological equivalent thereof is intended to be synonymous with “equivalent thereof’ when referring to a reference protein, polypeptide or nucleic acid, intends those having minimal homology while still maintaining desired structure or functionality. Unless specifically recited herein, it is contemplated that any of the above also includes equivalents thereof. For example, an equivalent intends at least about 70% homology or identity, or at least 80% homology or identity and alternatively, or at least about 85%, or alternatively at least about 90%, or alternatively at least about 95%, or alternatively at least 98% percent homology or identity and/or exhibits substantially equivalent biological activity to the reference protein, polypeptide, or nucleic acid. Alternatively, when referring to polynucleotides, an equivalent thereof is a polynucleotide that hybridizes under stringent conditions to the reference polynucleotide or its complement.
  • equivalent polypeptide or “equivalent peptide fragment” refers to protein, polynucleotide, or peptide fragment encoded by a polynucleotide that hybridizes to a polynucleotide encoding the exemplified polypeptide or its complement of the polynucleotide encoding the exemplified polypeptide, under high stringency and/or which exhibit similar biological activity in vivo, e.g., approximately 100%, or alternatively, over 90% or alternatively over 85% or alternatively over 70%, as compared to the standard or control biological activity.
  • Additional embodiments within the scope of this disclosure are identified by having more than 60%, or alternatively, more than 65%, or alternatively, more than 70%, or alternatively, more than 75%, or alternatively, more than 80%, or alternatively, more than 85%, or alternatively, more than 90%, or alternatively, more than 95%, or alternatively more than 97%, or alternatively, more than 98% or 99% sequence homology or identity. Percentage homology or identity can be determined by sequence comparison using programs such as BLAST run under appropriate conditions. In one aspect, the program is run under default parameters.
  • homology or “identical”, percent “identity” or “similarity”, when used in the context of two or more nucleic acids or polypeptide sequences, refers to two or more sequences or subsequences that are the same or have a specified percentage of nucleotides or amino acid residues that are the same, e.g., at least 60% identity, preferably at least 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or higher identity over a specified region (e.g., nucleotide sequence encoding the chimeric PVX described herein).
  • Homology can be determined by comparing a position in each sequence which may be aligned for purposes of comparison. When a position in the compared sequence is occupied by the same base or amino acid, then the molecules are homologous at that position. A degree of homology between sequences is a function of the number of matching or homologous positions shared by the sequences.
  • the alignment and the percent homology or sequence identity can be determined using software programs known in the art, for example those described in Current Protocols in Molecular Biology (Ausubel et al., eds. 1987) Supplement 30, section 7.7.18, Table 7.7.1.
  • default parameters are used for alignment.
  • a preferred alignment program is BLAST, using default parameters.
  • the terms “homology” or “identical,” percent “identity” or “similarity” also refer to, or can be applied to, the complement of a test sequence.
  • the terms also include sequences that have deletions and/or additions, as well as those that have substitutions.
  • the preferred algorithms can account for gaps and the like.
  • identity exists over a region that is at least about 25 amino acids or nucleotides in length, or more preferably over a region that is at least 50-100 amino acids or nucleotides in length.
  • An “unrelated” or “non-homologous” sequence shares less than 40% identity, or alternatively less than 25% identity, with one of the sequences disclosed herein.
  • a polynucleotide or polynucleotide region (or a polypeptide or polypeptide region) having a certain percentage (for example, 80%, 85%, 90%, or 95%) of “sequence identity” to another sequence means that, when aligned, that percentage of bases (or amino acids) are the same in comparing the two sequences.
  • the alignment and the percent homology or sequence identity can be determined using software programs known in the art, for example those described in Current Protocols in Molecular Biology (Ausubel et al., eds. 1987) Supplement 30, section 7.7.18, Table 7.7.1.
  • default parameters are used for alignment.
  • a preferred alignment program is BLAST, using default parameters.
  • protein refers to a compound of two or more subunit amino acids, amino acid analogs or peptidomimetics.
  • the subunits may be linked by peptide bonds. In another aspect, the subunit may be linked by other bonds, e.g., ester, ether, etc.
  • a protein or peptide must contain at least two amino acids and no limitation is placed on the maximum number of amino acids which may comprise a protein’s or peptide’s sequence.
  • Polypeptides include full length native polypeptide, and “modified” forms such as subsequences, variant sequences, fusion/chimeric sequences and dominant-negative sequences.
  • amino acid refers to either natural and/or unnatural or synthetic amino acids, including glycine and both the D and L optical isomers, amino acid analogs and peptidomimetics.
  • Peptides include L- and D-isomers, and combinations thereof. Peptides can include modifications typically associated with post-translational processing of proteins, for example, cyclization (e.g., disulfide or amide bond), phosphorylation, glycosylation, carboxylation, ubiquitination, myristylation, or lipidation. Modified peptides can have one or more amino acid residues substituted with another residue, added to the sequence or deleted from the sequence. Specific examples include one or more amino acid substitutions, additions or deletions (e.g., 1-3, 3-5, 5-10, 10-20, or more).
  • Subsequences and fragments refer to polypeptides having one or more fewer amino acids in comparison to a reference (e.g., native) polypeptide sequence.
  • An antibody subsequence that specifically binds to LIGHT, HVEM or LT R can retain at least a part of its binding or LIGHT inhibitory or antagonist activity.
  • a variant peptide can have a sequence with 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or more identity to a reference sequence.
  • Variant sequences include naturally occurring alterations of sequence, due to intra-species polymorphisms or different species, as well as artificially produced alterations of sequence. Sequence homology between species is in the range of about 70-80%. An amino acid substitution is one example of a variant.
  • a “conservative substitution” is the replacement of one amino acid by a biologically, chemically or structurally similar residue.
  • Biologically similar means that the substitution is compatible with an activity or function of the unsubstituted sequence.
  • Structurally similar means that the amino acids have side chains with similar length, such as alanine, glycine and serine, or having similar size.
  • Chemical similarity means that the residues have the same charge or are both hydrophilic or hydrophobic.
  • Particular examples include the substitution of one hydrophobic residue, such as isoleucine, valine, leucine or methionine for another, or the substitution of one polar residue for another, such as the substitution of arginine for lysine, glutamic for aspartic acids, or glutamine for asparagine, serine for threonine, and the like.
  • Peptides synthesized and expressed as fusion proteins have one or more additional domains linked thereto, and are also referred to as chimeric polypeptides.
  • the additional domain(s) may confer an additional function upon the sequence.
  • HVEM-IgG or LT R-IgG fusion proteins can have LIGHT inhibitory activity.
  • fusion when used in reference to two or more molecules (e.g., polypeptides) means that the molecules are covalently attached.
  • a particular example for attachment of two protein sequences is an amide bond or equivalent.
  • chimeric when used in reference to a protein, means that the protein is comprised of one or more heterologous amino acid residues from one or more different proteins.
  • a chimeric polypeptide when used in reference to a polypeptide, means that the polypeptide is not normally contiguous with the other polypeptide in its natural environment.
  • a chimeric polypeptide means that a portion of the polypeptide does not exist fused with the other polypeptide in normal cells.
  • a chimeric polypeptide is a molecule that does not normally exist in nature, i.e., such a molecule is produced by the hand of man, e.g., artificially produced through recombinant DNA technology.
  • peptide mimetics can contain any combination of non-natural structural components, which are typically from three structural groups: a) residue linkage groups other than the natural amide bond (“peptide bond”) linkages; b) non-natural residues in place of naturally occurring amino acid residues; or c) residues which induce secondary structural mimicry, i.e., induce or stabilize a secondary structure, e.g., a beta turn, gamma turn, beta sheet, alpha helix conformation, and the like.
  • a polypeptide can be characterized as a mimetic when one or more of the residues are joined by chemical means other than an amide bond.
  • Individual peptidomimetic residues can be joined by amide bonds, non natural and non-amide chemical bonds other chemical bonds or coupling means including, for example, glutaraldehyde, N-hydroxysuccinimide esters, bifunctional maleimides, N,N’- dicyclohexylcarbodiimide (DCC) or N,N’-diisopropylcarbodiimide (DIC).
  • amide bonds non natural and non-amide chemical bonds other chemical bonds or coupling means including, for example, glutaraldehyde, N-hydroxysuccinimide esters, bifunctional maleimides, N,N’- dicyclohexylcarbodiimide (DCC) or N,N’-diisopropylcarbodiimide (DIC).
  • DCC dicyclohexylcarbodiimide
  • DIC N,N’-diisopropylcarbodiimide
  • Peptides and peptidomimetics can be produced and isolated using a variety of methods known in the art. Full length peptides and fragments (subsequences) can be synthesized using chemical methods known in the art (see, e.g., Caruthers, Nucleic Acids Res. Symp. Ser. (1980) 215; Horn, Nucleic Acids Res. Symp. Ser. (1980) 225; and Banga, A.K., Therapeutic Peptides and Proteins, Formulation, Processing and Delivery Systems (1995) Technomic Publishing Co., Lancaster, PA). Peptide synthesis can be performed using various solid-phase techniques (see, e.g., Roberge, Science (1995) 269:202; Merrifield, Methods Enzymol. (1997) 289:3).
  • Automated synthesis may be achieved, e.g., using a peptide synthesizer.
  • Modified peptides can be further produced by chemical modification methods (see, e.g., Belousov, Nucleic Acids Res. (1997) 25:3440; Frenkel, Free Radic. Biol. Med. (1995) 19:373; and Blommers, Biochemistry (1994) 33:7886).
  • a first molecule that modulates the activity of a LIGHT receptor and a second molecule that modulates the activity of a TL1 A receptor can each include those that can bind selectively as well as those that bind non- selectively to a ligand or target (e.g., LIGHT, HVEM, LT R, TL1 A, or DR3) in solution, in solid phase, in vitro, ex vivo or in vivo.
  • a ligand or target e.g., LIGHT, HVEM, LT R, TL1 A, or DR3
  • the term “selective” when used in reference to a LIGHT modulator means that the modulator (e.g., inhibitor) binds specifically to the target entity (e.g., LIGHT, HVEM, or LT R) and does not significantly bind to a non-ligand or non-target entity.
  • the term “selective” when used in reference to a TL1 A modulator means that the modulator (e.g., inhibitor) binds specifically to the target entity (e.g., TL1 A or DR3) and does not significantly bind to a non-ligand or non-target entity.
  • a non- selective modulator means that the modulator (e.g., the inhibitor) is not selective for the entity to which it binds, i.e., it cross-reacts with other entities.
  • LIGHT and/or TL1A modulators include variants and derivatives that retain at least a part or all of an activity of the non-variant or non- derivatized modulator (e.g., non-variant or non-derivatized inhibitor).
  • a particular activity (e.g., antagonist or inhibitory activity) of a LIGHT or TL1 A modulator e.g., LIGHT or TL1 A inhibitor
  • a LIGHT or TL1 A modulator e.g., LIGHT or TL1 A inhibitor
  • LIGHT or TL1 A inhibitor may have less or greater activity than non-variant or non-derivatized LIGHT or TL1 A modulator (e.g., LIGHT or TL1 A inhibitor).
  • Non-limiting examples of activities that can be retained, at least in part, include inhibitory or antagonist activity, binding affinity (e.g., Kd), avidity and binding selectivity (specificity) or non-selectivity.
  • the variant or derivatized modulator e.g., inhibitor
  • the variant or derivatized modulator can exhibit an activity (e.g., binding affinity) that is greater or less than a corresponding non-variant or non- derivatized modulator (e.g., inhibitor), e.g., greater or less inhibitory activity, binding affinity (e.g., Kd), avidity or binding selectivity (specificity) or non-selectivity.
  • “at least a part” of an activity of a modulator can be when the variant or derivatized agent has less of an inhibitory activity, e.g., 10-25%, 25-50%, 50-60%, 60-70%, 70-75%, 75- 80%, 80-85%, 85-90%, 90-95%, 95-99%, 100%, or any percent or numerical value or range or value within such ranges.
  • An activity of a modulator can be when the variant or derivatized agent has more inhibitory activity, e.g., 110-125%, 125-150%, 150-175%, 175- 200%, 200-250%, 250-300%, 300-400%, 400-500%, 500-1000%, 1000-2000%, 2000-5000%, or more, or any percent or numerical value or range or value within such ranges.
  • At least a part of binding affinity of a modulator can be when the variant or derivatized inhibitor has less affinity, e.g., 1-3-fold, 1-5-fold, 2-5 fold, 5-10-fold, 5-15-fold, 10-15-fold, 15- 20-fold, 20-25-fold, 25-30-fold, 30-50-fold, 50-100 fold, 100-500-fold 500- 1000-fold, 1000- 5000-fold, or less (e.g., Kd), or any numerical value or range of values within such ranges.
  • affinity e.g., 1-3-fold, 1-5-fold, 2-5 fold, 5-10-fold, 5-15-fold, 10-15-fold, 15- 20-fold, 20-25-fold, 25-30-fold, 30-50-fold, 50-100 fold, 100-500-fold 500- 1000-fold, 1000- 5000-fold, or less (e.g., Kd), or any numerical value or range of values within such ranges.
  • At least a part of binding affinity of a modulator can be when the variant or derivatized inhibitor has more affinity, e.g., 1-3-fold, 1-5-fold, 2-5 fold, 5-10-fold, 5-15-fold, 10- 15-fold, 15-20-fold, 20-25-fold, 25-30-fold, 30-50-fold, 50-100 fold, 100-500-fold 500-1000- fold, 1000-5000-fold, or more (e.g., Kd), or any numerical value or range of values within such ranges.
  • affinity e.g., 1-3-fold, 1-5-fold, 2-5 fold, 5-10-fold, 5-15-fold, 10- 15-fold, 15-20-fold, 20-25-fold, 25-30-fold, 30-50-fold, 50-100 fold, 100-500-fold 500-1000- fold, 1000-5000-fold, or more (e.g., Kd), or any numerical value or range of values within such ranges.
  • Dissociation (Kd) constants can be measured using radiolabeled inhibitors in competitive binding assays with increasing amounts of unlabelled inhibitor to generate saturation curves.
  • the target, ligand or receptor used in the binding assay e.g., LIGHT, HVEM, LT R, TL1 A, DR3, or DcR3
  • Association (K a ) and dissociation (Kd) constants can be measured using surface plasmon resonance (SPR) (Rich and Myszka, Curr. Opin. Biotechnol.11 : 54 (2000); Englebienne, Analyst.123:1599 (1998)).
  • LIGHT and/or TL1 A modulators can be identified by assays known in the art. For example, the amount of activity can be assessed directly, such as measuring the particular activity (e.g., inhibitor activity, binding affinity, avidity, selectivity (specificity) or non-selectivity).
  • a LIGHT modulator e.g., a LIGHT inhibitor
  • a TL1 A modulator e.g., a TL1 A inhibitor
  • a LIGHT modulator e.g., a LIGHT inhibitor and/or a TL1 A modulator (e.g., a TL1 A inhibitor) can also be identified by change in cell expression of a marker, such as ICAM expression.
  • LIGHT modulators e.g., LIGHT inhibitors
  • TL1 A modulators e.g., TL1 A inhibitors
  • LIGHT modulators can further be identified by the ability to inhibit binding of purified LIGHT to purified HVEM or LT R (or HVEM-IgG or LT R-IgG fusion proteins) or by the ability to inhibit binding of TL1 A to purified DR3 or DcR3 (or DR3-IgG or DcR3-IgG fusion proteins), for example, when immobilized on a substrate (e.g., plastic) by ELISA, or when any of the molecules are transfected into cells that can be identified by labeling with the corresponding binding partner by flow cytometry.
  • a substrate
  • plate bound LIGHT or TL1 A can be pre-incubated with LIGHT or TL1 A specific inhibitory molecules and blockade of receptor fusion protein binding measured by detection of the binding of the Fc fusion protein or lack of binding.
  • Blockade of cell surface associated LIGHT or TL1 A binding to receptors is assessed by pre-incubation of LIGHT or TL1 A inhibitory molecules with cell lines expressing LIGHT or TL1 A on the surface followed by addition of receptor Fc fusion proteins. Assessment of inhibition is measured by detection of binding of the receptor fusion proteins or lack of binding by flow cytometry.
  • Inhibition of LIGHT signaling or TL1A signaling in vitro can be determined by inhibiting LIGHT or TL1 A mediated chemokine secretion from colonic epithelial cells (HT29).
  • a method of reducing or inhibiting a fibrotic disease in a subject in need thereof which comprises, consists essentially of, or yet further consists of modulating the activity of LIGHT (p30 polypeptide) and the activity of TNF-like Ligand 1 A (TL1 A) in the subject in need thereof.
  • the method comprises, consists essentially of, or yet further consists of administering to the subject a sufficient amount of at least one of a first molecule that modulates the activity of LIGHT (p30 polypeptide) and a second molecule that modulates the activity of TNF-like Ligand 1A (TL1A), to reduce or inhibit a fibrotic disease in the subject.
  • a method of treating a skin disease or inflammation in a subject in need thereof which comprises, consists essentially of, or yet further consists of modulating the activity of LIGHT (p30 polypeptide) and the activity of TNF-like Ligand 1 A (TL1 A) in the subject in need thereof.
  • the method comprises, consists essentially of, or yet further consists of administering to the subject a sufficient amount of at least one of a first molecule that modulates the activity of LIGHT (p30 polypeptide) and a second molecule that modulates the activity of TNF-like Ligand 1A (TL1A), to treat the skin disease or inflammation in the subject.
  • a method of treating an autoimmune disorder in a subject in need thereof which comprises, consists essentially of, or yet further consists of modulating the activity of LIGHT (p30 polypeptide) and the activity of TNF-like Ligand 1A (TL1 A) in the subject in need thereof.
  • the method comprises, consists essentially of, or yet further consists of administering to the subject a sufficient amount of at least one of a first molecule that modulates the activity of LIGHT (p30 polypeptide) and a second molecule that modulates the activity of TNF-like Ligand 1A (TL1A), to treat the autoimmune disorder in the subject.
  • a method of treating a respiratory disease in a subject in need thereof which comprises, consists essentially of, or yet further consists of modulating the activity of LIGHT (p30 polypeptide) and the activity of TNF-like Ligand 1A (TL1 A) in the subject in need thereof.
  • the method comprises, consists essentially of, or yet further consists of administering to the subject a sufficient amount of at least one of a first molecule that modulates the activity of LIGHT (p30 polypeptide) and a second molecule that modulates the activity of TNF-like Ligand 1A (TL1A), to treat the respiratory disease in the subject.
  • a method of reducing or inhibiting the activity of a LIGHT (p30 polypeptide) receptor and/or the activity of a TNF-like Ligand 1 A (TL1 A) receptor in a subject in need thereof which comprises, consists essentially of, or yet further consists of modulating the activity of LIGHT (p30 polypeptide) and the activity of TNF-like Ligand 1A (TL1A) in the subject in need thereof.
  • the method comprises, consists essentially of, or yet further consists of administering to the subject a sufficient amount of at least one of a first molecule that modulates the activity of LIGHT (p30 polypeptide) and a second molecule that modulates the activity of TNF-like Ligand 1A (TL1A), to reduce or inhibits the activity of a LIGHT (p30 polypeptide) receptor and/or the activity of a TNF-like Ligand 1 A (TL1 A) receptor in the subject.
  • a first molecule that modulates the activity of LIGHT (p30 polypeptide) and a second molecule that modulates the activity of TNF-like Ligand 1A (TL1A) to reduce or inhibits the activity of a LIGHT (p30 polypeptide) receptor and/or the activity of a TNF-like Ligand 1 A (TL1 A) receptor in the subject.
  • modulating the activity of LIGHT and the activity of TL1A in the subject in need thereof comprises reducing, decreasing, suppressing, limiting, controlling, or inhibiting the activity of LIGHT, and reducing, decreasing, suppressing, limiting, controlling, or inhibiting the activity of TL1A.
  • a fibrotic disease comprises fibrosis (or fibrotic scarring) of parenchymal organs and tissues.
  • a fibrotic disease comprises fibrosis of the lung, liver, skin, kidney, brain, heart, joints, intestine, or the bone marrow, or a combination thereof.
  • the fibrotic disease comprises fibrosis of the lung, liver, or skin.
  • the fibrotic disease comprises interstitial lung disease (ILD), liver cirrhosis, or idiopathic pulmonary fibrosis.
  • ILD interstitial lung disease
  • liver cirrhosis or idiopathic pulmonary fibrosis.
  • the fibrotic disease is a skin fibrotic disease or disorder.
  • a “skin fibrotic disease or disorder” means a condition, disorder or disease related to a skin or dermal tissue.
  • Exemplary skin fibrotic disease or disorder include, but are not limited to, scleroderma and atopic dermatitis.
  • a skin disease or inflammation comprises atopic dermatitis, scleroderma, psoriasis, onchocercal dermatitis, nephrogenic fibrosing dermopathy, mixed connective tissue disease, scleromyxedema, keloid, sclerodactyly, or eosinophilic fasciitis.
  • the skin disease or inflammation comprises atopic dermatitis.
  • the skin disease or inflammation comprises scleroderma.
  • the skin disease or inflammation comprises psoriasis.
  • a respiratory disease comprises asthma, allergic asthma, bronchiolitis, pleuritis, chronic obstructive pulmonary disease (COPD), extrinsic bronchial asthma, allergic rhinitis, eosophageal allergy, or gastrointestinal allergy.
  • the respiratory disease comprises nodules, eosinophilia, rheumatism, dermatitis and swelling (NERDS).
  • the respiratory disease comprises airway obstruction, apnea, asbestosis, atelectasis, berylliosis, bronchiectasis, bronchiolitis, bronchiolitis obliterans organizing pneumonia, bronchitis, bronchopulmonarydysplasia, empyema, pleural empyema, pleural epiglottitis, hemoptysis, hypertension, kartagener syndrome, meconium aspiration, pleural effusion, pleurisy, pneumonia, pneumothorax, respiratory distress syndrome, respiratory hypersensitivity, respiratory tract infections, rhinoscleroma, scimitar syndrome, severe acute respiratory syndrome, silicosis, or tracheal stenosis.
  • Skin inflammation, skin fibrosis, scleroderma, or a respiratory disease include allergic and non-allergic skin inflammation, skin fibrosis, scleroderma, or a skin fibrotic disease or disorder, which may be provoked by a variety of factors including aberrant or undesirable immune responses.
  • skin inflammation, skin fibrosis, scleroderma, or a skin fibrotic disease or disorder may be caused by or associated with irritant particles (allergens such as pollen, dust, venoms, cotton, dander, foods).
  • Skin inflammation, skin fibrosis, scleroderma, or a skin fibrotic diseases or disorders can be acute, chronic, mild, moderate or severe.
  • An “allergen” is a substance that can promote, stimulate or induce skin inflammation, skin fibrosis, scleroderma, atopic dermatitis or skin fibrotic diseases or disorders in a subject. Allergens include plant/tree pollens, insect venoms, animal dander, house dust mite, dust, fungal spores, latex, food and drugs (e.g., penicillin).
  • allergens include proteins specific to the following genera: Canis ( Canis familiaris ); Dermatophagoides (e.g., Dermatophagoides farinae ); Felis ( Felis domesticus ); Ambrosia ( Ambrosia artemiisfolia ); Lolium (e.g., Lolium perenne or Lolium muhiflorum); Cryptomeria ( Cryptomeria japonica ); AlternariaiAlternariaalternatd) ; Alder; Alnus ( Alnusgultinosa ); Betula ( Betulaverrucosa ); Quercus ( Quercus alba); Olea ( Oleaeuropa ); Artemisia ( Artemisia vulgaris ); Plantago (e.g., Plantagolanceolata ); Parietaria (e.g., Parietariaofficinalisor Parietariajudaica); Blattella (e.g., latte l lager manica);
  • Thuya e.g., Thuyaorientalis
  • Chamaecyparis e.g., Chamaecyparisobtusa
  • Periplaneta e.g., Periplanetaamericana
  • Agropyron e.g., A gropyr
  • Allergens also include peptides and polypeptides used in experimental animal models of allergy and asthma, including ovalbumin (OVA) and Schistosoma mansoni
  • Avena e.g., Avena sativa
  • Holcus e.g., Holcuslanatus
  • Anthoxanthumi e.g ., Anthoxanthumodoratum
  • Arrhenatherum e.g., Arrhenatherumelatius
  • Agrostis e.g., Agrostis alba
  • Phleum e.g., Phleumpratense
  • Phalaris e.g., Phalarisarundinacea
  • Paspalum e.g., Paspalumnotatum
  • Sorghum e.g., Sorghum halepensis
  • Bromus e.g., Bromus inermis
  • Allergens also include peptides and polypeptides used in experimental animal
  • the autoimmune disorder comprises systemic sclerosis (e.g., scleroderma), rheumatoid arthritis (RA), lupus (e.g., systemic lupus erythematosus or SLE), inflammatory bowel disease (IBD), eosinophilic esophagitis (EoE), ankylosing spondylitis (AS), experimental autoimmune encephalomyelitis (EAE), or an autoimmune inflammatory disease of the central nervous system (CNS).
  • the autoimmune disorder comprises systemic sclerosis (scleroderma).
  • a method includes administering to a subject an amount of LIGHT modulator (e.g., LIGHT inhibitor) and/or TL1 A modulator (e.g., TL1 A inhibitor) sufficient to reduce or decrease progression, severity, frequency, duration, susceptibility or probability of one or more adverse symptoms associated with a fibrotic disease, a skin disease or inflammation, an autoimmune disorder, or a respiratory disease.
  • LIGHT modulator e.g., LIGHT inhibitor
  • TL1 A modulator e.g., TL1 A inhibitor
  • compositions such as LIGHT modulators (e.g., LIGHT inhibitors) and/or TL1 A modulators (e.g., TL1 A inhibitors) can be administered in sufficient or effective amounts to achieve a therapeutic benefit in a subject treated in accordance with the invention.
  • LIGHT modulators e.g., LIGHT inhibitors
  • TL1 A modulators e.g., TL1 A inhibitors
  • an “amount sufficient” or “amount effective” includes an amount that, in a given subject, can have a desired outcome or effect.
  • the “amount sufficient” or “amount effective” can be an amount of a LIGHT modulator (e.g., a LIGHT inhibitor) and/or a TL1 A modulator (e.g., a TL1 A inhibitor) that provides, in single or multiple doses, alone or in combination with one or more other (second) compounds or agents (e.g., a drug), treatments or therapeutic regimens, a long or short term detectable response, a desired outcome or beneficial effect in a particular given subject of any measurable or detectable degree or duration (e.g., for minutes, hours, days, months, years, or cured).
  • An amount sufficient or an amount effective can but need not be provided in a single administration and can but need not be administered alone (i.e., without a second drug, agent, treatment or therapeutic regimen), or in combination with another compound, agent, treatment or therapeutic regimen.
  • an amount sufficient or an amount effective need not be sufficient or effective if given in single or multiple doses without a second compound, agent, treatment or therapeutic regimen, since additional doses, amounts or duration above and beyond such doses, or additional drugs, agents, treatment or therapeutic regimens may be included in order to be effective or sufficient in a given subject.
  • an amount sufficient or an amount effective need not be effective in each and every subject, nor a majority of subjects in a given group or population.
  • an amount sufficient or an amount effective means sufficiency or effectiveness in a particular subject, not a group or the general population.
  • some subjects will exhibit a greater or less response to a method of the invention, including treatment/therapy.
  • the dose amount, frequency or duration may be proportionally increased or reduced, as indicated by the status of the condition, disorder or disease being treated, or any adverse side effects of the treatment or therapy. Dose amounts, frequencies or duration also considered sufficient and effective are those that result in a reduction of the use of another drug, agent, treatment or therapeutic regimen or protocol.
  • a LIGHT modulator e.g., a LIGHT inhibitor
  • a TL1A modulator e.g., a TL1A inhibitor
  • a beneficial or therapeutic effect if contact, administration or delivery in vivo results in the use of a lesser amount, frequency or duration of another drug, agent, treatment or therapeutic regimen or protocol to treat the condition, disorder or disease, or an adverse symptom thereof.
  • An “amount sufficient” or “amount effective” includes reducing, preventing, delaying or inhibiting onset, reducing, inhibiting, delaying, preventing or halting the progression or worsening of, reducing, relieving, alleviating the severity, frequency, duration, susceptibility or probability of one or more adverse or undesirable symptoms associated with the condition, disorder or disease of the subject.
  • hastening a subject s recovery from one or more adverse or undesirable symptoms associated with the condition, disorder or disease is considered to be an amount sufficient or effective.
  • beneficial effects and indicia of therapeutic benefit are as set forth herein and are known to the skilled artisan.
  • an “amount sufficient” or “amount effective,” in the appropriate context, can refer to therapeutic or prophylactic amounts.
  • Therapeutically or prophylactically sufficient or effective amounts mean an amount that, in a given subject, detectably improves the condition, disorder or disease, such as an inflammatory condition, disorder or disease, as assessed by one or more objective or subjective clinical endpoints appropriate for the condition, disorder or disease.
  • Sufficiency or effectiveness of a particular treatment can be ascertained by various clinical indicia and endpoints.
  • An “amount sufficient” or “amount effective” is therefore an amount that provides an objective or subjective reduction or improvement in progression, severity, frequency, susceptibility or probability of fibrosis, skin inflammation, skin fibrosis, an autoimmune disorder, a respiratory disease.
  • a reduction, decrease, inhibition, delay, halt, prevention or elimination of one or more adverse symptoms of fibrosis, skin inflammation, skin fibrosis, an autoimmune disorder, a respiratory disease can be used as a measure of sufficiency or effectiveness.
  • An “amount sufficient” or “amount effective” also includes an amount that, when used in combination with another binding agent, drug, or treatment or therapeutic regimen, reduces the dosage frequency, dosage amount, or an adverse symptom or side effect of the other binding agent, drug or treatment or therapeutic regimen, or eliminates the need for the other binding agent, drug or treatment or therapeutic regimen.
  • an “amount sufficient” or “amount effective” of a LIGHT modulator e.g., a LIGHT inhibitor
  • a TL1 A modulator e.g., a TL1 A inhibitor
  • a steroid antihistamine, beta adrenergic agonist, anticholinergic, methylxanthine, anti-IgE, anti- leukotriene, anti-beta2 integrin, anti-CCR3 antagonist, or anti-selectin required to achieve the same clinical endpoint.
  • the terms “treat,” “therapy” and grammatical variations thereof when used in reference to a method means the method provides an objective or subjective (perceived) improvement in a subjects’ condition, disorder or disease, or an adverse symptom associated with the condition, disorder or disease.
  • Non-limiting examples of an improvement can therefore reduce or decrease the probability, susceptibility or likelihood that the subject so treated will manifest one or more symptoms of the condition, disorder or disease.
  • Additional symptoms and physiological or psychological responses caused by or associated with fibrotic disease, skin disease, skin inflammation, skin fibrosis, an autoimmune disorder, or a respiratory disease are set forth herein and known in the art and, therefore, improvements in these and other adverse symptoms or physiological or psychological responses can also be included in the methods of the invention.
  • Methods of the invention therefore include providing a detectable or measurable beneficial effect or therapeutic benefit to a subject, or any objective or subjective transient or temporary, or longer-term improvement (e.g., cure) in the condition.
  • a satisfactory clinical endpoint is achieved when there is an incremental improvement in the subject’s condition or a partial reduction in the severity, frequency, duration or progression of one or more associated adverse symptoms or complications or inhibition, reduction, elimination, prevention or reversal of one or more of the physiological, biochemical or cellular manifestations or characteristics of the condition, disorder or disease.
  • a therapeutic benefit or improvement (“ameliorate” is used synonymously) therefore need not be complete ablation of any or all adverse symptoms or complications associated with the condition, disorder or disease but is any measurable or detectable objectively or subjectively meaningful improvement in the condition, disorder or disease. For example, inhibiting a worsening or progression of the condition, disorder or disease, or an associated symptom (e.g., slowing or stabilizing one or more symptoms, complications or physiological or psychological effects or responses), even if only for a few days, weeks or months, even if complete ablation of the condition, disorder or disease, or an associated adverse symptom is not achieved is considered to be beneficial effect.
  • an associated symptom e.g., slowing or stabilizing one or more symptoms, complications or physiological or psychological effects or responses
  • Prophylactic methods are included. “Prophylaxis” and grammatical variations thereof mean a method in accordance with the invention in which contact, administration or in vivo delivery to a subject is prior to manifestation or onset of a condition, disorder or disease (or an associated symptom or physiological or psychological response), such that it can eliminate, prevent, inhibit, decrease or reduce the probability, susceptibility, onset or frequency of having a condition, disorder or disease, or an associated symptom.
  • Target subjects for prophylaxis can be one of increased risk (probability or susceptibility) of contracting the condition, disorder or disease, or an associated symptom, or recurrence of a previously diagnosed condition, disorder or disease, or an associated symptom, as set forth herein.
  • the term “subject,” “host,” “individual,” and “patient” are as used interchangeably herein to refer to animals, typically mammalian animals. Any suitable mammal can be treated by a method, cell or composition described herein.
  • mammals include humans, non-human primates (e.g., apes, gibbons, chimpanzees, orangutans, monkeys, macaques, and the like), domestic animals (e.g., dogs and cats), farm animals (e.g., horses, cows, goats, sheep, pigs) and experimental animals (e.g., mouse, rat, rabbit, guinea pig).
  • a mammal is a human.
  • a mammal can be any age or at any stage of development (e.g., an adult, teen, child, infant, or a mammal in utero).
  • a mammal can be male or female.
  • a mammal can be a pregnant female.
  • a subject is a human.
  • a method disclosed herein further comprises administering to the subject an additional therapeutic agent.
  • additional therapeutic agent include anti-inflammatory, anti allergy, and/or immunosuppressant drugs.
  • Additional non-limiting examples of compounds and agents useful for employing in the invention, for example to treat a fibrotic disease, a skin disease, a skin inflammation, skin fibrosis, an autoimmune disease, or a respiratory disease include hormones, such as steroids (e.g., glucocorticoids); antihistamines; beta adrenergic agonists; anticholinergics; methylxanthines; anti-IgE; anti-leukotrienes; anti-beta2 integrins; anti-alpha-4 integrins; Hl-receptor antagonists; anti-CCR3 antagonists; and anti-selectins.
  • steroids e.g., glucocorticoids
  • antihistamines beta adrenergic agonists
  • anticholinergics methylxanthines
  • glucocorticoids include dexamethasone, triamcinolone acetonide (AZMACORT®), beclomethasone, dipropionate (VANCERIL®), flunisolide (AEROBID®), fluticasone propionate (FLOVENT®), prednisone, methylprednisolone and mometasonefuroate (ASMANEX®, TWISTHALER®).
  • antihistamines include chlorcyclizine, chlorpheniramine, triprolidine (ACTIFED®), diphenhydramine hydrochloride (BENADRYL®), fexofenadine hydrochloride (ALLEGRA®), hydroxyzine hydrochloride (ATARAX®), loratadine (CLARITIN®), promethazine hydrochloride (PHENERGAN®), pyrilamine; and anti-IgE omalizumab (XOLAIR®).
  • beta adrenergic agonists include albuterol (VENTOLIN®; PROVENTIL®), Xopenex®, (S)-isomer subtracted from racemic albuterol (Sepracor Inc.), pirbuterol, epinephrine, racepinephrine, adrenaline, isoproterenol, salmeterol (Serevent®), metaproterenol (ALUPENT®), bitolterol (Tornalate®), fenoterol (BEROTEC®), formoterol (Foradil®), isoetharine, procaterol, P2-adrenoceptor and terbutaline (BRETHINE®, LAMISIL®).
  • a specific non-limiting example of an anticholinergic includes ipratropium bromide (ATROVENT®) and tiotropium.
  • ipratropium bromide ATROVENT®
  • methylxanthines include theophylline, aminophylline, theobromine, cromolyn (Intal®) and nedocromil (Fisons).
  • a specific non-limiting example of an anti-IgE is omalizumab (XOLAIR®).
  • Specific non-limiting examples of anti-leukotrienes include cysteinyl-leukotriene (Cys-LT), Singulair® and Accolate®.
  • Anti-inflammatory agents useful for employing in the methods include cytokines and chemokines.
  • cytokines include anti-inflammatory cytokines such as IL-4 and IL-10.
  • Anti-cytokines and anti-chemokines such as antibodies that bind to pro-inflammatory cytokines, TNFa, IFNy, IL-1, IL-2, IL-6, etc., as well as anti-Th2 cytokines such as IL-5, IL-13, etc., can be employed in the methods.
  • Immunosuppressant agents useful for employing in the methods described herein include, but are not limited to, corticosteroids; Janus kinase inhibitors such as tofacitinib, calcineurin inhibitors such as cyclosporine and tacrolimus; mTOR inhibitors such as sirolimus and everolimus; IMDH inhibitors such as azathioprine, leflunomide, and mycophenolate; and biologies such as abatacept, adalimumab, anakinra, certolizumab, etanercept, golimumab, infliximab, ixekizumab, natalizumab, rituximab, secukinumab, tocilizumab, ustekinumab, and vedolizumab.
  • corticosteroids such as tofacitinib, calcineurin inhibitors such as cyclosporine and tacrolimus
  • Additional functional classes of compounds and agents useful as an additional therapeutic agent include selective or non-selective potassium channel activators (bronchodilatators); muscarinic M3 receptor antagonists; M2 receptor agonists; opioid receptor agonists (inhibit release of sensory neuropeptides); H3-receptor agonists (inhibit acetylcholine release); phospholipase A2 inhibitors; 5 -lipoxygenase inhibitors; 5 -lipoxygenase activating protein (FLAP) inhibitors; phosphodiesterase inhibitors; immunomodulating agents (Ciclosporine); antibody against adhesion molecules; and antagonists of tachykinins (e.g., Substance P or neurokinin).
  • bronchodilatators selective or non-selective potassium channel activators
  • muscarinic M3 receptor antagonists M2 receptor agonists
  • opioid receptor agonists inhibit release of sensory neuropeptides
  • H3-receptor agonists inhibitors
  • the first molecule and/or the second molecule and optionally the additional therapeutic agent are administered sequentially. In some cases, the first molecule and/or the second molecule are administered prior to administering the additional therapeutic agent. In some cases, the first molecule and/or the second molecule are administered after administering the additional therapeutic agent.
  • the first molecule and/or the second molecule and/or the additional therapeutic agent are administered systemically.
  • the first molecule and/or the second molecule and/or the additional therapeutic agent are administered locally.
  • the first molecule and/or the second molecule and/or the additional therapeutic agent are administered by parenteral administration.
  • the first molecule and/or the second molecule and/or the additional therapeutic agent are administered intravenously or subcutaneously.
  • a combination which comprises a first molecule that modulates the activity of LIGHT (p30 polypeptide) and a second molecule that modulates the activity of TNF-like Ligand 1A (TL1A).
  • the first molecule comprises a fusion of an immunoglobulin and a) herpesvirus entry mediator (HVEM) or b) lymphotoxin beta receptor (LTpR) polypeptide.
  • HVEM herpesvirus entry mediator
  • LpR lymphotoxin beta receptor
  • the first molecule comprises a polypeptide that binds to LIGHT, HVEM, or LTpR, a peptidomimetic that modulates LIGHT, or a small molecule that modulates LIGHT.
  • the first molecule comprises an antibody that binds to LIGHT, an antibody that binds to HVEM, or an antibody that binds to LTpR.
  • the second molecule comprises a fusion of DR3 with an immunoglobulin, a fusion of DcR3 with an immunoglobulin, a polypeptide that binds to DR3, a peptidomimetic that modulates TL1 A or DR3, or a small molecule that modulates TL1 A or DR3.
  • the second molecule comprises an antibody that binds to TL1 A or an antibody that binds to DR3.
  • the antibody that binds to LIGHT, HVEM, or LTpR is a multispecific antibody that binds to LIGHT, HVEM, or LTpR and one or more of TL1A or
  • the multispecific antibody comprises a first antigen binding domain that binds to LIGHT, HVEM, or LTpR and a second antigen binding domain that binds to TL1 A. In some instances, the multispecific antibody comprises a first antigen binding domain that binds to LIGHT, HVEM, or LTpR and a second antigen binding domain that binds to DR3. In some instances, the multispecific antibody comprises a first antigen binding domain that binds to LIGHT and a second antigen binding domain that binds to TL1 A or DR3. In some instances, the multispecific antibody comprises a first antigen binding domain that binds to HVEM and a second antigen binding domain that binds to TL1A or DR3.
  • the multi specific antibody comprises a first antigen binding domain that binds to LTpR and a second antigen binding domain that binds to TL1 A or DR3. In some instances, the multispecific antibody comprises a first antigen binding domain that binds to LIGHT and a second antigen binding domain that binds to TL1 A. In some instances, the multispecific antibody comprises a first antigen binding domain that binds to LIGHT and a second antigen binding domain that binds to DR3. In some instances, the multispecific antibody comprises a first antigen binding domain that binds to HVEM and a second antigen binding domain that binds to TL1 A.
  • the multispecific antibody comprises a first antigen binding domain that binds to HVEM and a second antigen binding domain that binds to DR3. In some instances, the multispecific antibody comprises a first antigen binding domain that binds to LTpR and a second antigen binding domain that binds to TL1 A. In some instances, the multispecific antibody comprises a first antigen binding domain that binds to LTpR and a second antigen binding domain that binds to DR3. In some cases, the multispecific antibody comprises abispecific antibody.
  • the combination comprises a pharmaceutical composition comprising the first molecule that modulates the activity of LIGHT (p30 polypeptide), the second molecule that modulates the activity of TNF-like Ligand 1A (TL1A), and a pharmaceutically acceptable excipient.
  • LIGHT p30 polypeptide
  • TNF-like Ligand 1A TNF-like Ligand 1A
  • compositions including LIGHT modulators (e.g., LIGHT inhibitors) and TL1 A modulators (e.g., TL1 A inhibitors) can be included in a pharmaceutically acceptable carrier (excipient, diluent, vehicle or filling agent) for administration to a subject.
  • a pharmaceutically acceptable carrier excipient, diluent, vehicle or filling agent
  • pharmaceutically acceptable and physiologically acceptable mean a biologically acceptable formulation, gaseous, liquid or solid, or mixture thereof, which is suitable for one or more routes of administration, in vivo delivery or contact.
  • Such formulations include solvents (aqueous or non-aqueous), solutions (aqueous or non-aqueous), emulsions (e.g., oil-in-water or water-in-oil), suspensions, syrups, elixirs, dispersion and suspension media, coatings, isotonic and absorption promoting or delaying agents, compatible with pharmaceutical administration or in vivo contact or delivery.
  • Aqueous and non-aqueous solvents, solutions and suspensions may include suspending agents and thickening agents.
  • Such pharmaceutically acceptable carriers include tablets (coated or uncoated), capsules (hard or soft), microbeads, powder, granules and crystals.
  • Cosolvents and adjuvants may be added to the formulation.
  • cosolvents contain hydroxyl groups or other polar groups, for example, alcohols, such as isopropyl alcohol; glycols, such as propylene glycol, polyethyleneglycol, polypropylene glycol, glycol ether; glycerol; polyoxyethylene alcohols and polyoxyethylene fatty acid esters.
  • Adjuvants include, for example, surfactants such as, soya lecithin and oleic acid; sorbitan esters such as sorbitan trioleate; and polyvinylpyrrolidone.
  • Supplementary active compounds e.g., preservatives, antioxidants, antimicrobial agents including biocides and biostats such as antibacterial, antiviral and antifungal agents
  • Pharmaceutical compositions may therefore include preservatives, anti-oxidants and antimicrobial agents.
  • Preservatives can be used to inhibit microbial growth or increase stability of the active ingredient thereby prolonging the shelf life of the pharmaceutical formulation.
  • Suitable preservatives include, for example, EDTA, EGTA, benzalkonium chloride or benzoic acid or benzoates, such as sodium benzoate.
  • Antioxidants include, for example, ascorbic acid, vitamin A, vitamin E, tocopherols, and similar vitamins or provitamins.
  • An antimicrobial agent or compound directly or indirectly inhibits, reduces, delays, halts, eliminates, arrests, suppresses or prevents contamination by or growth, infectivity, replication, proliferation, reproduction, of a pathogenic or non- pathogenic microbial organism.
  • Classes of antimicrobials include, antibacterial, antiviral, antifungal and antiparasitics.
  • Antimicrobials include agents and compounds that kill or destroy (-cidal) or inhibit (-static) contamination by or growth, infectivity, replication, proliferation, reproduction of the microbial organism.
  • antibacterials include penicillins (e.g., penicillin G, ampicillin, methicillin, oxacillin, and amoxicillin), cephalosporins (e.g., cefadroxil, ceforanid, cefotaxime, and ceftriaxone), tetracyclines (e.g., doxycycline, chlortetracycline, minocycline, and tetracycline), aminoglycosides (e.g., amikacin, gentamycin, kanamycin, neomycin, streptomycin, netilmicin, paromomycin and tobramycin), macrolides (e.g., azithromycin, clarithromycin, and erythromycin), fluoroquinolones (e.g., ciprofloxacin, lomefloxacin, and norfloxacin), and other antibiotics including chloramphenicol, clindamycin,
  • anti-virals include reverse transcriptase inhibitors; protease inhibitors; thymidine kinase inhibitors; sugar or glycoprotein synthesis inhibitors; structural protein synthesis inhibitors; nucleoside analogues; and viral maturation inhibitors.
  • anti-virals include nevirapine, delavirdine, efavirenz, saquinavir, ritonavir, indinavir, nelfmavir, amprenavir, zidovudine (AZT), stavudine (d4T), larnivudine (3TC), didanosine (DDI), zalcitabine (ddC), abacavir, acyclovir, penciclovir, valacyclovir, ganciclovir, l,-D-ribofuranosyl-l,2,4-triazole-3 carboxamide, 9->2-hydroxy- ethoxy methylguanine, adamantanamine, 5-iodo-2'-deoxyuridine, trifluorothymidine, interferon and adenine arabinoside.
  • Exemplary antifungals include agents such as benzoic acid, undecylenicalkanol amide, ciclopiroxolamine, polyenes, imidazoles, allylamine, thicarbamates, amphotericin B, butylparaben, clindamycin, econaxole, amrolfme, butenafme, naftifme, terbinafme, ketoconazole, elubiol, econazole, econaxole, itraconazole, isoconazole, miconazole, sulconazole, clotrimazole, enilconazole, oxiconazole, tioconazole, terconazole, butoconazole, thiabendazole, voriconazole, saperconazole, sertaconazole, fenticonazole, posaconazole, bifonazole, fluconazole, fluor acid,
  • the pH can be adjusted by use or addition of pharmacologically acceptable acids or bases.
  • inorganic acids include: hydrochloric acid, hydrobromic acid, nitric acid, sulfuric acid, and/or phosphoric acid.
  • organic acids are: ascorbic acid, citric acid, malic acid, tartaric acid, maleic acid, succinic acid, fumaric acid, acetic acid, formic acid and/or propionic acid, etc. Acids which form an acid addition salt with the active ingredient may also be used.
  • bases include alkali metal hydroxides and alkali metal carbonates. If such bases are used, the resulting salts which are contained in the pharmaceutical formulation, are typically compatible with the acid. If desired, mixtures of acids or bases may also be used.
  • compositions can optionally be formulated to be compatible with a particular route of administration.
  • pharmaceutical compositions include carriers (excipients, diluents, vehicles or filling agents) suitable for administration by various routes and delivery to targets, topically, locally, regionally or systemically.
  • Exemplary routes of administration for contact or in vivo delivery which a composition can optionally be formulated include skin, dermis or epidermis, oral, buccal, intrapulmonary, intrauterine, intradermal, topical, dermal, parenteral, sublingual, subcutaneous, intravascular, intrathecal, intraarticular, intracavity, transdermal, iontophoretic, intraocular, ophthalmic, optical, intravenous, intramuscular, intraglandular, intraorgan, intralymphatic.
  • Formulations suitable for parenteral administration comprise aqueous and non-aqueous solutions, suspensions or emulsions of the active compound, which preparations are typically sterile and can be isotonic with the blood of the intended recipient.
  • Non-limiting illustrative examples include water, saline, dextrose, fructose, ethanol, animal, vegetable or synthetic oils.
  • penetrants can be included in the pharmaceutical composition.
  • Penetrants are known in the art, and include, for example, for transmucosal administration, detergents, bile salts, and fusidic acid derivatives.
  • the active ingredient can be formulated into aerosols, sprays, ointments, salves, gels, or creams as generally known in the art.
  • pharmaceutical compositions typically include ointments, creams, lotions, pastes, gels, sprays, aerosols, or oils.
  • Carriers which may be used include Vaseline, lanolin, polyethylene glycols, alcohols, transdermal enhancers, and combinations thereof.
  • compositions and delivery systems appropriate for compositions and methods of the invention are known to the skilled artisan (see, e.g., Remington: The Science and Practice of Pharmacy (2003) 20 th ed., Mack Publishing Co., Easton, PA; Remington’s Pharmaceutical Sciences (1990) 18 th ed., Mack Publishing Co., Easton, PA; The Merck Index (1996) 12 th ed., Merck Publishing Group, Whitehouse, NJ; Pharmaceutical Principles of Solid Dosage Forms (1993), Technonic Publishing Co., Inc., Lancaster, Pa.; Ansel and Stoklosa, Pharmaceutical Calculations (2001) 11 th ed.,Lippincott Williams & Wilkins,
  • LIGHT modulators e.g., LIGHT inhibitors
  • TL1 A modulators e.g., TL1 A inhibitors
  • pharmaceutical compositions thereof can be packaged in unit dosage form (capsules, troches, cachets, lozenges, or tablets) for ease of administration and uniformity of dosage.
  • Unit dosage form refers to physically discrete units suited as dosages for treatment or therapy. Each unit contains a predetermined quantity of agent in association with the pharmaceutical carrier (excipient, diluent, vehicle or filling agent) which, when administered in one or more doses, is calculated to produce a desired beneficial effect.
  • Unit dosage forms also include, for example, ampules and vials, which may include a composition in a freeze-dried or lyophilized state; a sterile liquid carrier, for example, can be added prior to administration or delivery in vivo.
  • Unit dosage forms additionally include, for example, ampules and vials with liquid compositions disposed therein.
  • Unit dosage forms further include compositions for transdermal administration, such as “patches” adapted to remain in contact with the epidermis of the intended recipient for an extended or brief period of time.
  • the individual unit dosage forms can be included in multi-dose kits or containers.
  • Dose amounts, frequency and duration for binding agents, including LIGHT inhibitors, or pro-drugs thereof, can be can be empirically determined in appropriate animal models. Dose amounts, frequency and duration can also be determined and optimized in human clinical trials.
  • the dosage amount can range from about 0.0001 mg/kg of subject body weight/day to about 1,000.0 mg/kg of subject body weight/day.
  • doses can be more or less, as appropriate, for example, 0.00001 mg/kg of subject body weight to about 10,000.0 mg/kg of subject body weight, about 0.001 mg/kg, to about 1,000 mg/kg, about 0.01 mg/kg, to about 100 mg/kg, or about 0.1 mg/kg, to about 10 mg/kg of subject body weight over a given time period, e.g., 1, 2, 3, 4, 5 or more hours, days, weeks, months, years, in single bolus or in divided/metered doses.
  • a subject for treatment of a fibrotic disease, a skin disease, a skin inflammation, skin fibrosis, an autoimmune disease, or a respiratory disease, a subject may be administered in single bolus or in divided/metered doses in the range of about 10 to 50,000 micrograms (“mcg”)/day, 10 to 20,000 mcg/day, 10 to 10,000 mcg/day, 25-1,000 mcg/day, 25 to 400 mcg/day, 25-200 mcg/day, 25-100 mcg/day or 25-50 mcg/day, which can be adjusted to be greater or less according to the weight of the subject, e.g., per pound, kilogram, etc.
  • mcg micrograms
  • LIGHT modulators e.g., LIGHT inhibitors
  • TL1 A modulators e.g., TL1 A inhibitors
  • combinations of LIGHT and/or TL1A modulators e.g., LIGHT and/or TL1A inhibitors
  • other active ingredients and pharmaceutical formulations thereof can be administered to a subject at any frequency, as a single bolus or in divided/metered doses, one, two, three, four or more times over a given time period, e.g., per hour, day, week, month or year.
  • Exemplary dosage frequencies for a fibrotic disease, a skin disease, a skin inflammation, skin fibrosis, an autoimmune disease, or a respiratory disease can vary, but are typically from 1-7 times, 1-5 times, 1-3 times, 2-times or once, daily, weekly or monthly, to reduce, inhibit, decrease, delay, prevent, halt or eliminate progression, severity, frequency, duration, or probability of one or more adverse symptoms of the conditions, disorders or diseases, as set forth herein or that would be apparent to one skilled in the art. Timing of contact, administration or in vivo delivery can be dictated by the condition, disorder or disease to be treated.
  • an amount can be administered to the subject substantially contemporaneously with, or within about 1-60 minutes or hours of the onset of a symptom associated with or caused by a fibrotic disease, a skin disease, a skin inflammation, skin fibrosis, an autoimmune disease, or a respiratory disease.
  • Dosage amount, frequency or duration can be increased, if necessary, or reduced, for example, once control of the condition, disorder or disease is achieved, dose amounts, frequency or duration can be reduced.
  • Other conditions, disorders or diseases associated with fibrosis, with the skin, with an autoimmune disease, or with a respiratory disease can be similarly treated, dosing amount, frequency or duration reduced, when adequate control of the condition, disorder or disease is achieved.
  • the dosage amount, frequency and duration can vary depending upon the judgment of the skilled artisan which will consider various factors such as whether the treatment is prophylactic or therapeutic, the type or severity of the condition, disorder or disease, the associated symptom to be treated, the clinical endpoint(s) desired such as the type and duration of beneficial or therapeutic effect. Additional non-limiting factors to consider in determining appropriate dosage amounts, frequency, and duration include previous or simultaneous treatments, potential adverse systemic, regional or local side effects, the individual subject (e.g., general health, age, gender, race, bioavailability), condition of the subject such as other disorders or diseases present and other treatments or therapies that the subject has or is undergoing (e.g., medical history). The skilled artisan will appreciate the factors that may influence the dosage, frequency and duration required to provide an amount sufficient to provide a subject with a beneficial effect, such as a therapeutic benefit.
  • kits including LIGHT modulators (e.g., LIGHT inhibitors) and TL1 A modulators (e.g., TL1 A inhibitors) suitable for practicing the methods, treatment protocols or therapeutic regimes herein, and suitable packing material.
  • a kit includes a LIGHT modulator (e.g., a LIGHT inhibitor), a TL1 A modulator (e.g., a TL1 A inhibitor), and instructions for administering or using the LIGHT or TL1 A modulator (e.g., LIGHT or TL1 A inhibitor).
  • a kit in another embodiment, includes a LIGHT modulator (e.g., a LIGHT inhibitor), a TL1 A modulator (e.g., a TL1 A inhibitor), an article of manufacture for delivery of the LIGHT or TL1 A modulator (e.g., LIGHT or TL1 A inhibitor) to the target area, organ, tissue or system (e.g., skin) and instructions for administering the LIGHT or TL1 A modulator (e.g., LIGHT or TL1 A inhibitor).
  • a LIGHT modulator e.g., a LIGHT inhibitor
  • a TL1 A modulator e.g., a TL1 A inhibitor
  • an article of manufacture for delivery of the LIGHT or TL1 A modulator (e.g., LIGHT or TL1 A inhibitor) to the target area, organ, tissue or system (e.g., skin) and instructions for administering the LIGHT or TL1 A modulator (e.g., LIGHT or TL1 A inhibitor).
  • packing material refers to a physical structure housing a component of the kit.
  • the material can maintain the components sterilely, and can be made of material commonly used for such purposes (e.g., paper, corrugated fiber, glass, plastic, foil, ampules, vials, tubes, etc.).
  • Kits of the invention can include labels or inserts.
  • Labels or inserts include “printed matter,” e.g., paper or cardboard, or separate or affixed to a component, a kit or packing material (e.g., a box), or attached to an ampule, tube or vial containing a kit component.
  • Labels or inserts can additionally include a computer readable medium, such as a disk (e.g., floppy diskette, ZIP disk), optical disk such as CD- or DVD-ROM/RAM, DVD, MP3, magnetic tape, or an electrical storage media such as RAM and ROM or hybrids of these such as magnetic/optical storage media, FLASH media or memory type cards.
  • Labels or inserts can include identifying information of one or more components therein (e.g., the binding agent or pharmaceutical composition), dose amounts, clinical pharmacology of the active agent(s) including mechanism of action, pharmacokinetics and pharmacodynamics. Labels or inserts can include information identifying manufacturer information, lot numbers, and location and date of manufacture.
  • Labels or inserts can include information on a condition, disorder or disease for which a kit component may be used.
  • Labels or inserts can include instructions for the clinician or subject for using one or more of the kit components in a method, or treatment protocol or therapeutic regimen. Instructions can include dosage amounts, frequency or duration, and instructions for practicing any of the methods, treatment protocols or therapeutic regimes described herein.
  • Labels or inserts can include information on any benefit that a component may provide, such as a therapeutic benefit. Labels or inserts can include information on potential adverse side effects, such as warnings to the subject or clinician regarding situations where it would not be appropriate to use a particular composition (e.g., a LIGHT modulator or a TL1 A modulator).
  • adverse side effects are generally more likely to occur at higher dose amounts, frequency or duration of the active agent and, therefore, instructions could include recommendations against higher dose amounts, frequency or duration.
  • Adverse side effects could also occur when the subject has, will be or is currently taking one or more other medications that may be incompatible with the composition, or the subject has, will be or is currently undergoing another treatment protocol or therapeutic regimen which would be incompatible with the composition and, therefore, instructions could include information regarding such incompatibilities.
  • Non-limiting examples of adverse side effects include, for example, hypersensitivity, rash, neurological effects such as tachycardia; palpitations; headache; tremor and nervousness.
  • LIGHT interacts with the TNF superfamily receptors HVEM (herpesvirus entry mediator, TNFRSF14) and LTpR (lymphotoxin beta receptor, TNFRSF3), and TL1 A with DR3 (TNFRSF25) (4-6).
  • HVEM herpesvirus entry mediator, TNFRSF14
  • LTpR lymphotoxin beta receptor
  • TL1 A with DR3 TNFRSF25
  • LIGHT-deficient mice were protected from developing skin inflammation in models of scleroderma (7) and allergen-induced AD (8).
  • subcutaneous injection of recombinant LIGHT into naive mice induced features of AD, scleroderma, and psoriasis (8), and the inventors have found that LIGHT -deficient mice also display reduced epidermal reactions in a model of imiquimod- induced psoriasis.
  • LIGHT and TL1 A are effectors of skin pathology through driving epidermal hyperplasia and remodeling molecules such as collagen, periostin, and alpha smooth muscle actin in keratinocytes and/or fibroblasts. Through production of other factors such as TSLP, IL-33, and chemokines in these structural cells, LIGHT and TL1 A maintain disease through orchestrating immune inflammatory cells in the skin.
  • Study 1 Defining the inflammatory activities of LIGHT and TL1A in keratinocytes.
  • the inventors examine human epidermal keratinocytes in vitro to determine that LIGHT and TL1 A synergistically control transcriptional signatures in these cells that are found in human AD and psoriasis skin lesions, including key inflammatory cytokines and chemokines, and that together they drive keratinocyte hyperplasia and disrupt barrier function.
  • the inventors test with conditional deletion of LTpR, HVEM, and DR3 in keratinocytes to determine that direct activity of LIGHT and TL1 A through these receptors is essential for pathology and immune activity in mouse models of AD and psoriasis.
  • LIGHT and TL1 A work together to transcriptionally regulate keratinocytes and that this correlates with transcriptomes associated with human AD or psoriasis. They show the extent of overlap and divergence in activity between these TNF family proteins and the three keratinocyte-acting inflammatory cytokines currently most recognized as being of relevance to AD and psoriasis pathogenesis, namely IL-13, TNF, and IL-17. They also show that LIGHT and TL1 A induce common signaling pathways in keratinocytes, and connect functional activities of these proteins to intracellular activities that might be shared with other pro-inflammatory cytokines.
  • Study 2 Identifying the inflammatory activities of LIGHT and TL1A in dermal fibroblasts.
  • the inventors determine LIGHT and TL1 A co-operate to promote myofibroblast differentiation, upregulate production of collagen, periostin, and alpha smooth muscle actin, and promote expression of inflammatory cytokines and chemokines using human dermal fibroblasts relevant for AD or psoriasis.
  • the inventors determine the importance of signaling through HVEM, LTpR, and DR3, in fibroblasts with conditional deletion in mouse models of AD and psoriasis.
  • the results demonstrate the combined inflammatory effects of LIGHT and TL1 A in dermal fibroblasts and the relevance of LIGHT and TL1 A transcriptional regulation in these cells to transcriptomes present in human AD or psoriasis skin lesions. They also show how LIGHT and TL1 A differ from other key fibroblast-acting inflammatory cytokines (TNF, IL-17, IL-13), and reinforce the conclusions from Study 1 regarding the importance of common signaling pathways controlling cellular activity in AD or psoriasis.
  • TNF fibroblast-acting inflammatory cytokines
  • Study 3 Determining if therapeutic targeting of LIGHT and TL1A can block or reverse progression of skin inflammatory disease.
  • the inventors examine therapeutic blockade of LIGHT together with TL1 A and its suppression of ongoing skin inflammatory symptoms in models of AD and psoriasis, and determine that skin tissue remodeling can be reversed.
  • the inventors preclinical findings support the notion of single or combination targeting of these proteins in clinical trials in AD or psoriasis.
  • Keratinocytes and dermal fibroblasts are thought to be of central importance to skin inflammatory disorders, responding excessively to immune cell-derived cytokines and proliferating and/or producing fibrotic mediators such as collagen, and then expressing further pro-inflammatory cytokines and chemokines which attract and maintain cells of the innate and adaptive immune systems in the skin (9-11).
  • cytokines and chemokines which attract and maintain cells of the innate and adaptive immune systems in the skin (9-11).
  • each disorder has been suggested to develop through distinct immunological programs, with for example Th2/Tc2 immunity dominating atopic dermatitis (12) and TNF/Thl and Thl7/Th22 immunity dominating psoriasis (12-19).
  • TNF family proteins are key modulators of several immune-mediated disorders (5, 6, 23, 24).
  • LIGHT aka TNFSF14 and CD258, is a soluble and membrane expressed pro- inflammatory molecule (25-28) that acts through two receptors (FIG. 1), the herpesvirus entry mediator (HVEM; TNFRSF14; CD270) and the lymphotoxin b receptor (LTpR; TNFRSF3) (29, 30).
  • HVEM herpesvirus entry mediator
  • LTpR lymphotoxin b receptor
  • TNFRSF3 the lymphotoxin b receptor
  • LIGHT is a product of T cells (29,
  • LIGHT can be made by macrophages, neutrophils, and eosinophils (unpublished data). The inventors have reported, with gene-deficient animals, and blocking studies, that LIGHT is an orchestrator of lung tissue remodeling in models of severe asthma and systemic sclerosis, and importantly that recombinant LIGHT (rLIGHT) injected alone into the naive mouse lungs could reproduce this fibrotic activity (1, 2). Lung remodeling has features in common with the skin inflammatory diseases.
  • LIGHT is relevant to skin inflammation.
  • LIGHT was induced in the skin, and the inventors have reported that LIGHT-deficient mice exhibited strongly reduced dermal and epidermal thickening (7). To extend this data, the inventors set up models of AD and psoriasis.
  • the AD model is induced by epicutaneous exposure of the shaved back to house dust mite (HDM) allergen, given over 14 days (33-35). This drives a Th2 response resulting in scaling, thickening of the epidermal and dermal layers, and collagen deposition in the latter.
  • the psoriasis model uses a cream containing the TLR7/8 agonist imiquimod, given on the shaved back for 7-9 days (36-39). This drives primarily a Thl7 inflammatory response, also resulting in epidermal thickening, although dermal collagen deposition in this model is minor.
  • LIGHT-deficient mice were protected from developing atopic dermatitis (AD)-like skin lesions (8).
  • TL1A TNF-like ligand 1A; TNFSF15
  • TL1A acts through the stimulatory receptor DR3 (TNFRSF25).
  • DR3 is expressed on all T cells and upregulated after activation, and is inducible on ILC (40), and it is constitutive or inducible on several non-lymphoid cells as described below.
  • LIGHT and TL1 A act upon and how they control the skin inflammatory response. Both LIGHT and TL1 A directly regulate skin pathology by working together to drive excessive inflammatory activity in keratinocytes and dermal fibroblasts.
  • the inventors have shown that both of LIGHT’s receptors are expressed on human lung epithelial cells and lung fibroblasts (FIG. 2A), and showed that LIGHT promotes inflammatory mediators in these cells (2, 41, 42).
  • HVEM and LTpR expressed on human (and mouse, not shown) keratinocytes and dermal fibroblasts ((FIG. 2A) and (7, 8)).
  • DR3 has been visualized on human kidney tubular epithelial cells (43), mouse intestinal myofibroblasts (44), and human fibroblast like synoviocytes (45).
  • DR3 has also been shown to be expressed on human lung epithelial cells and fibroblasts, and found it can induce pro-inflammatory and remodeling-relevant activity in these cells (FIG. 2B; 3).
  • Serum soluble TL1 A was also increased in psoriasis and AD (49, 50).
  • the findings suggest there is enhanced activity of TL1 A and LIGHT in AD regardless of whether levels of these cytokines are elevated.
  • the inventors also analyzed published RNA-seq data (22, 53) to determine gene expression in AD skin biopsies. This showed expression of LIGHT, TL1 A, HVEM, LTpR, and DR3 in lesional skin (FIG. 11 A).
  • transcripts in both lesional and non-lesional skin were found for the three relevant receptors in the cells that are the focus of these studies, namely keratinocytes and fibroblasts (FIG. 1 IB).
  • HVEM, LTpR, and DR3 co-operatively drive epidermal thickening of relevance to AD and psoriasis by promoting keratinocyte hyperplasia (proliferation), through direct signaling as well as indirectly by promoting keratinocyte factors that act in an autocrine manner to increase proliferation.
  • the inventors also find that these receptors maintain ongoing skin inflammation by increasing production of inflammatory factors from keratinocytes that keep infiltrating immune cells in the skin and/or drive their functional activities.
  • Keratinocytes can be primary sources of cytokines like TSLP, IL-33, IL-23 and IL-19, and chemokines that attract cells such as macrophages, neutrophils, and eosinophils (68, 69).
  • the inventors examine whether LIGHT and TL1 A together promote these features with studies of human keratinocytes in vitro, and use targeted studies in vivo of HVEM, LTpR and DR3, with keratinocyte-specific conditional knockout mice in models of AD and psoriasis.
  • LIGHT and TL1A co-operate to promote hyperplasia and inflammatory features in human keratinocytes: Firstly, the inventors test how signaling from LIGHT and TL1 A directly regulate keratinocytes in vitro. Studies are performed with titrated doses of rLIGHT or rTLIA (0.1-100 ng/ml) vs. PBS, added to normal human epidermal keratinocytes from a minimum of 4 donors (obtained from Lonza) with kinetic analyses, as described previously (7, 8). LIGHT and TL1 A have maximal activity in the range 20-100 ng/ml, similar to IL-13 or IL-17.
  • rLIGHT can induce proliferation/hyperplasia of human keratinocytes via both HVEM and LTpR.
  • TL1 A could induce NF-KB activation in keratinocytes (FIG. 2C), a pathway that often is involved in cell division.
  • the inventors determine rTLl A alone displays a similar activity to LIGHT, and test this with BrdU, thymidine incorporation, and cell cycle flow analyses.
  • the inventors control for specificity with siRNA knockdown of DR3, and then determine synergistic or additive activities, cross-titrating rLIGHT together with rTLl A and measure the extent of cell division and growth.
  • the inventors also test if co-operation is at the level of the receptors (e.g. TL1 A enhances expression of the LIGHT receptors).
  • rLIGHT or rTLl A alone induce inflammatory activity of relevance to either AD and/or psoriasis, and the extent to which they co-operate and synergize.
  • the experiments are conducted in an unbiased manner with RNA-seq. This provides direct comparison between LIGHT and TL1 A and shows common as well as possibly distinct transcriptional targets in keratinocytes.
  • LIGHT and TL1 A promote known gene targets already described as elevated in AD or psoriatic skin lesions. For this the generated data is compared to RNA-seq and microarray data compiled from skin biopsies taken from AD and psoriasis patients (22).
  • these include inflammatory/anti-microbial proteins (S100A7, S100A8, S100A9, S100A12, DEFB4A); serine protease inhibitors (SERPINA1, SERPINB4, SERPINB3, SERPINB13); cytokines (IL36G, IL36A, IL22, IL19, IL17A, TNF, IL23A/pl9, IL23p40, IL6, ILlb); chemokines (CXCL13, CXCL9, CXCL10, CXCL1, CXCL2 , CXCL3, CXCL5, CXCL8, CXCL16, CCL20); matrix metalloproteinases (MMP9, MMP1, MMP19, MMP28, MMP10, MMP12), and possible autoantigens (LL37, ADAMTSL5, PLA2G4D).
  • S100A7, S100A8, S100A9, S100A12, DEFB4A serine protease inhibitors
  • AD these also include genes in common with psoriasis such as S100A7, S100A8, SERPINB3, IL17A, IL23A, TSLP, IL32, CCL2, CCL5, CXCL2, MMP9, and collagen isoforms COL4A1, 6A1, 21A1, but also AD- specific genes such as IL4, IL13, IL33, CSF1, VEGFA, and TGFB2.
  • This dataset may reflect not only gene transcripts upregulated in keratinocytes but also in other cell types present in the skin biopsies, including dermal fibroblasts. The inventors find a select number of these genes are upregulated by LIGHT and TL1 A in keratinocytes.
  • the inventors stimulate keratinocytes and compare the transcriptional profiles induced by rLIGHT and rTLIA. As well as upregulated genes, the inventors analyze the published data for downregulated genes in psoriatic vs. AD skin compared to healthy or non-lesional skin (22) and assess LIGHT and TL1 A-stimulated keratinocytes for these gene sets. Once the transcriptomes of each individual cytokine is profiled, the inventors focus on co-operativity. The inventors initially cross-titrate rLIGHT together with rTLIA and measure select genes by PCR, and then perform more comprehensive analyses with RNA-seq with fixed concentrations that give optimal effects together.
  • the inventors validate transcriptional targets that are synergistically upregulated or downregulated with further qPCR and protein analyses, particularly on cytokines and chemokines linked to AD or psoriasis.
  • rLIGHT can induce molecules from keratinocytes that are upregulated in AD and psoriasis biopsies (TSLP and periostin).
  • TSLP and periostin psoriasis biopsies
  • rLIGHT injected s.c. in vivo induced the cytokines IL-33 and IL-25 that are largely epithelial-derived and are upregulated in AD skin lesions (56, 71-75).
  • the inventors have shown that rLIGHT inducing several chemokines when injected s.c. into mice, such as CCL5 that is associated with AD and psoriasis.
  • the inventors test if both LIGHT and TL1 A promote a specific group of chemokines in keratinocytes, and determine if their activities are overlapping, including chemokines relevant for monocytes/macrophages, T cells, eosinophils, and neutrophils, such as CCL2, 3, 5, 7, 11, 13, and CXCL2, 3, 5, 8, 12, 15, as well as CCL17 and CCL20 which are involved in Th2 or Thl7 responses (76, 77).
  • IL-36a/IL-36y IL-19/IL-20/IL-22/IL-24
  • IL-22 IL-22 is primarily produced by T cells (78, 79), is upregulated in patients with AD (15, 16, 80), and when overexpressed in the mouse skin can induce AD-like symptoms (81). It can also drive proliferation of keratinocytes and upregulate other cytokines or chemokines like IL-20 and CCL17 (82-84).
  • IL-19 and IL-24 are primarily associated with psoriasis, but were upregulated in keratinocytes by IL-4, or in the skin of IL-4 transgenic mice (86), suggesting they could be pathogenic in AD as well.
  • IL-19 and IL-24 may contribute to epidermal hyperplasia (87, 88) and then could, in an autocrine manner, perpetuate the action of LIGHT and TL1A if induced by these molecules.
  • the inventors also inhibit soluble factors in the cultures, such as blocking TSLP, IL-19, or IL-24.
  • the inventors study barrier function proteins whose lowered expression is associated with AD or psoriasis such as filaggrin, loricrin, and involucrin. The inventors test whether either cytokine alone or together downregulates these molecules. The inventors similarly assay for tight junction proteins that are deregulated in AD or psoriasis (claudin-1 and -4, occludin, E-cadherin) using IF in air liquid interface 3D cultures (89, 90). Overall, the results in these experiments demonstrate how LIGHT and TL1 A transcriptionally regulate keratinocytes and how this correlates with transcriptomes associated with human AD or psoriasis.
  • TNF family proteins show the extent of overlap between these TNF family proteins and overlap or divergence from the three keratinocyte-acting inflammatory cytokines (TNF, IL-17, IL-13) currently most recognized as being of relevance to AD and psoriasis pathogenesis.
  • HVEM, LTpR, and DR3 in keratinocytes is essential for driving skin inflammation in vivo:
  • the inventors show the importance of LIGHT and TL1 A to keratinocyte activity in vivo with targeted studies in the mouse.
  • a HDM model of AD is used and an imiquimod model of psoriasis. Skin inflammation is monitored by clinical scoring, histology staining with trichrome or antibodies to collagen I or IV, aSMA, ki67, keratin 1, 5, 14, and 17, and quantitation of dermal and epidermal thickening.
  • the inventors monitor skin infiltrates in sections (toluidine blue, mast cells; congo red, eosinophils; vimentin and CD90 with/without aSMA, myofibroblasts/fibroblasts; Ly6G and myeloperoxidase, neutrophils), and in biopsy by flow cytometry (7, 91). This determines if there are selective effects on accumulation or persistence of Th2/Tc2, or Thl7/Th22 ab T cells, gd T cells, neutrophils, eosinophils, Ly6C hi/lo monocytes, M1/M2 macrophages, DC subsets, ILC, and mast cells. qPCR analyses are performed on select inflammatory cytokines and chemokines described below.
  • LIGHT and TL1 A are monitored by both bulk mRNA analyses of skin tissue, IF of tissue sections, and flow of individual cell populations. This will determine if there is co-expression of the ligands, differential expression, and kinetic differences in upregulation.
  • the inventors also correlate the expression of LIGHT and TL1 A with expression of signature cytokines of AD or psoriasis, namely TSLP, IL-5, IL-9, IL-13, IL-17, IL-22, and IL-23.
  • the inventors have found that deletion of HVEM in keratinocytes protected mice from developing experimental AD (8). Because one specific knockout in keratinocytes gave a striking phenotype and abolished disease, this does not mean that other molecules do not contribute to keratinocyte activity.
  • the inventors determine that there is cooperation between cytokine receptors to drive inflammatory processes, and moreover receptors also act in a temporal manner one after another. Either could give the result that deletion of each individual receptor results in a phenocopy and strongly reduce disease.
  • the inventors determine if HVEM expression in keratinocytes is also required for experimental psoriasis with the current K14-cre floxed mice used in the AD studies, and whether LTpR or DR3 are also active and essential in keratinocytes in the AD and psoriasis models by creating conditional knockouts of each of these receptors. With keratinocyte-specific deletion of LTpR or DR3, epidermal hyperplasia is reduced. The inventors also find reduced immune infiltrates as chemokine and cytokine products of keratinocytes that impact migration and maintenance of T cells, etc., are likely to be impaired.
  • the keratinocyte deletion of HVEM strongly reduced expression of IL-4, IL-5, and IL-13 in the AD model, as did a whole-animal deficiency in LIGHT (8).
  • LIGHT these contribute to late immune cell activity through stimulating keratinocytes to produce chemokines that affect the maintenance of effector T cells in the skin.
  • the inventors extend the above results and test with skin biopsy mRNA studies, as well as IF tissue staining, where there is a defect in vivo in select molecules when HVEM,
  • LTpR, or DR3 activity is absent in keratinocytes.
  • the inventors also compare expression of selected genes from above (e.g. TSLP, IL-33, periostin, ⁇ L-36y, CCL5, CCL17, CCL20, CCL26, IL-19, IL-24, loricrin, involucrin, and filaggrin) in skin biopsies from keratinocyte-specific knockouts to those in LIGHT vs. DR3 whole-animal knockouts in the two models. This allows the inventors to understand if cells other than keratinocytes contribute to the LIGHT- or TL1 A- dependent activity in the skin.
  • selected genes from above e.g. TSLP, IL-33, periostin, ⁇ L-36y, CCL5, CCL17, CCL20, CCL26, IL-19, IL-24, loricrin, involucrin, and filaggrin
  • the inventors further validate key downstream molecules, and co- operativity or synergy, by injecting s.c. titrated amounts of the recombinant cytokines (0.1 to 10pg), separately and together, vs. PBS, into WT and K14-creReceptor-floxed mice and assessing induction of mRNA and protein.
  • Periostin has been validated as an in vivo target of LIGHT -HVEM interactions in keratinocytes.
  • the inventors additionally inject rLIGHT into DR3-/- mice vs. K14-creDR3-flox mice, and rTLl A into LIGHT-/- vs. LTpR- and HVEM-flox mice to directly test if one is downstream, or simultaneously required, for skin inflammatory activity driven by the other molecule.
  • LTpR primarily activates NIK/IKK a-dependent non-canonical NF-KB, and HVEM IKKb-dependent canonical NF-KB, and DR3 has largely been linked to canonical NF-KB (98), but this is likely too simplistic (99-101). Furthermore, new activities via PI3K/Akt have been reported for HVEM, LTpR, and DR3 (102-105). The inventors determine that signaling by one or several of these pathways (NF-KB, JNK, ERK, Akt, and p38) regulates production of cytokines and chemokines in keratinocytes (106, 107).
  • One or two molecules can be focused downstream of both LIGHT and TL1 A (e.g. TSLP, periostin, CCL5) as well as any molecules that might be induced by each protein.
  • TL1 A e.g. TSLP, periostin, CCL5
  • the inventors perform inhibitory studies with inhibitors of canonical NF-kB (to block phosphorylation of IKKa or IKKb: Bay 11-7082, Bay 11-7085,
  • PF 184) and non-canonical NF-KB to block NIK: NIK-SMI1), and JNK (SP600125), p38 MAPK (SB203580), ERK1/2 (FR180204, U0126), and PI3K/Akt (LY294002, Aktil/2).
  • the inventors correlate inhibitor-suppression of cytokine/chemokine production with a direct activity of LIGHT or TL1A in promoting these signaling pathways (by assessing the phosphorylated forms, or with kinase assays e.g.
  • pAkt, pIKK, pJNK conversion of pi 00 to p52 for non- canonical NF-KB, nuclear accumulation of p65 and p50 for canonical NF-KB).
  • the inventors confirm data with more applied studies, e.g. with retroviral or lentiviral transfection of a phosphorylation-deficient mutant of IkBa (hcBaSR); or siRNA for NIK (NF-KB-inducing kinase). Further studies focus on dissecting how LIGHT synergizes with TL1 A.
  • the inventors determine whether any common targets and synergy of LIGHT and TL1 A are controlled by quantitative signaling through core pathways which may be canonical NF-KB for molecules such as TSLP, and non-canonical NF-KB for chemokines (both supported by basic signaling studies). The inventors also determine whether differential induction of any molecule discovered is under the control of specific MAP kinase pathways unique to LTpR, HVEM, or DR3.
  • Fibroblasts can proliferate extensively and undergo myofibroblast differentiation, leading to skin structural rigidity, involving upregulating proteins such as alpha smooth muscle actin (aSMA). They can also produce ECM proteins like collagen, and other proteins like periostin, that contribute to dermal tissue dysregulation. Fibroblasts additionally can make chemokines, and be a source of inflammatory cytokines such as IL-6, TNF, IL-33, IL- 24, IL-19 (and in some cases IL-23 (129, 130)) that can further modulate immune cell activity and/or act on keratinocytes to maintain or enhance the epidermal response (68, 69, 131-136).
  • aSMA alpha smooth muscle actin
  • LIGHT and TL1A drive accumulation of fibroblasts and promote inflammatory activity that fuels continued immune cell infiltration in the skin and helps to maintain keratinocyte dysregulation, reinforcing the direct signals keratinocytes receive from these cytokines.
  • the inventors test this in vitro with human dermal fibroblasts, and in vivo with fibroblast conditional knockouts of HVEM, LTpR, and DR3. The inventors further determine whether the same signaling cascades are active in fibroblasts as in keratinocytes, and if LIGHT and TL1A control similar or distinct functions in these two divergent cell types.
  • LIGHT and TL1A synergistic in driving proliferation and inflammatory activity in dermal fibroblasts The inventors determine inflammatory events that are triggered by LIGHT and TL1 A in normal human dermal fibroblasts, using cells from a minimum of 4 donors, with kinetic analyses. The inventors find that both LIGHT and TL1 A induce fibroblast proliferation, and may have differential abilities to induce myofibroblast differentiation. In preliminary studies, the inventors found that rLIGHT upregulated TSLP, periostin, and aSMA, in dermal fibroblasts, indicative of the latter, and this is confirmed with additional replicate experiments.
  • the inventors also test a range of inflammatory factors relevant to AD or psoriasis that have receptors on fibroblasts (e.g. LIGHT, IL-13, TGF-b, FGF, TNF, IL-17) to determine if they can promote DR3.
  • fibroblasts e.g. LIGHT, IL-13, TGF-b, FGF, TNF, IL-17
  • the inventors have found activities of TL1A in lung fibroblasts (3) that suggest that similar effects can be discovered in dermal fibroblasts if DR3 is adequately expressed.
  • rTLl A induced proliferation but not aSMA in lung fibroblasts, and it synergized with TGF-a, a primary factor that can promote myofibroblast differentiation, for both activities.
  • rTLIA alone induced periostin and collagen (3).
  • the inventors first titrate (0.1-100 ng/ml) the recombinant proteins vs. PBS on dermal fibroblasts and determine if LIGHT and TL1A promote proliferation (BrdU, thymidine incorporation, and cell cycle analysis) and/or myofibroblast differentiation (upregulation of collagen isoforms, tenascin, periostin, and aSMA). Next, the inventors perform RNA-seq and determine the extent of overlap and divergence in genes targeted by LIGHT vs. TL1 A.
  • the inventors determine how many of these transcripts are induced or suppressed in dermal fibroblasts by LIGHT or TL1A, and compare this to the actions of TNF, IL-13, and IL-17 that also have receptors on fibroblasts.
  • the inventors analyze the combined RNA-seq data for DEGs in fibroblasts vs. keratinocytes that are promoted by either LIGHT or TL1 A.
  • LIGHT and TL1 A overlap to a significant extent in their targets in fibroblasts and there is a common core transcriptional signature induced by both molecules in fibroblasts and keratinocytes as well as a unique signature in each cell type.
  • the inventors further test if LIGHT and TL1 A can induce adhesion molecules and chemokines relevant for skin localization of fibroblasts themselves, or aid migration of eosinophils, neutrophils, and T cells.
  • the inventors also block certain molecules in vitro, such as TGF-a that have been described to promote expression of periostin and a SMA in fibroblasts. Where a SMA is induced, in additional mechanistic studies, the inventors perform collagen gel contraction assays to determine the impact on fibroblast contractility (138, 139). Lastly, the inventors assess synergistic or additive activities of LIGHT and TL1 A when acting together, showing that strong synergy is exhibited for genes dependent on canonical and non-canonical NF-KB activity.
  • fibroblast expression of HVEM, LTBR, or DR3 contribute to AD or psoriasis in vivo?
  • the inventors further test whether fibroblasts are direct cellular targets of LIGHT and TL1 A in vivo using mice where HVEM, LTpR, or DR3 are conditionally deleted in these cells.
  • the inventors pursue deletion of each receptor if the in vitro studies show a strong effect of all three receptors in dermal fibroblasts.
  • the inventors firstly target fibroblasts by crossing to Colla2-cre mice (already in-house) given the broad expression of Colla2 in most fibroblasts, and assess the overall skin inflammatory response in the models of AD and psoriasis.
  • FSP1 S100a4-cre mice
  • FSP1 can be expressed in cells other than fibroblasts
  • FSP1 can be expressed in cells other than fibroblasts
  • FSP1 can be expressed in cells other than fibroblasts
  • Fibroblasts can be distinguished as CD45 Epcam CD3L Vimentin + CD90 + cells (3). This analysis was previously used to confirm constitutive expression of DR3 (and HVEM and LTpR) on fibroblasts, and the idea that DR3 was active under conditions of inflammation because TL1A was expressed by macrophages only with challenge with an epithelial insult (bleomycin) or an allergen (HDM).
  • bleomycin epithelial insult
  • HDM allergen
  • the inventors perform similar phenotypic studies in mouse skin for DR3, HVEM, and LTpR on dermal fibroblasts and also assess expression of TL1A and LIGHT on various inflammatory infiltrates after HDM or imiquimod challenge, including macrophages which are thought important to both AD and psoriasis (142-144).
  • the inventors then monitor steady state and inflammation-induced accumulation of fibroblasts in WT vs conditional KO mice by flow cytometry in skin biopsies as well as by IF microscopy in tissue sections, using aSMA staining to further distinguish and enumerate myofibroblasts from inflammatory fibroblasts.
  • Dermal thickening is a primary feature of the AD model, and the studies described herein show that fibroblast expression of HVEM, LTpR, and DR3 is a major contributor to this process. Dermal thickening is not seen in the psoriasis model, but strong infiltration of immune cells is common to both and a lack of chemokine production by fibroblasts will alter the balance of the infiltrates. Tissue infiltration of CD4 and CD8 T cells, gd T cells, ILCs, monocytes/macrophages, mast cells, etc., show there is a selective effect on recruitment or maintenance of certain cell types that could be linked to chemokine expression.
  • a lack of HVEM, LTpR, or DR3 expression in fibroblasts does directly affect initial generation or differentiation of CD4 or CD8 T cells, but this may affect T cell accumulation or maintenance over time due to defective chemokine production, and is tested in studies described above.
  • the inventors also show that epidermal hyperplasia in these models is diminished because of lower levels of fibroblast-derived cytokines such as IL-19, TNF, IL-23 and others, that can contribute directly or indirectly to deregulated keratinocyte activity.
  • Primary inflammatory factors that are reduced when each receptor is not expressed in fibroblasts are also investigated. This is done in parallel with studies in 2.1, and again focus on molecules associated with fibroblast activity (e.g.
  • the inventors compare skin biopsy mRNA profiles between the fibroblast-specific knockouts and the keratinocyte-specific knockouts, to further understand the relative contributions of keratinocytes and fibroblasts to individual inflammatory factors in the disease setting. These studies demonstrate the importance of fibroblast expression of LIGHT and TL1 A’s receptors to skin inflammation and provide direct insight into the role of fibroblasts in skin disease.
  • the inventors use several reagents: a pan LIGHT blocker, LTpR.Fc, that was used in severe asthma studies (1) that inhibits LIGHT binding to both HVEM and LTpR; specific antibodies to LTpR and HVEM that only block LIGHT binding to each respective receptor (2, 8, 160, 161); and a TL1 A blocking DR3.Fc fusion protein previously used in the inventors’ lung inflammation studies (3).
  • the antibodies/fusion proteins or control Ab/Fc are administered therapeutically (200 pg every 3 days) in the AD and psoriasis models after skin disease has been established.
  • AD model treatment first starts at day 7 when disease is already strongly evident after one cycle of HDM treatment, and the inventors then assess skin inflammation after the second cycle of HDM exposure on day 14, 20, and 30 to monitor progression or maintenance of disease.
  • the inventors generated supporting data reinforcing these studies and providing that blocking both molecules together is likely to be more therapeutically beneficial than blocking each molecule separately (FIG. 10).
  • the inventors extend the in vivo AD protocol to assess therapeutic activity where disease has already been established for some time and use repeated treatments of the skin with allergen to in part mimic chronic cyclic disease seen in human AD. For example, the inventors perform three or four cycles of allergen exposure over 21 or 28 days, with therapeutic antibody treatment starting after the second cycle or third cycle, respectively.
  • the inventors are more restricted in the imiquimod model as this is a self-limiting model.
  • the inventors have established that maximal disease is seen at day 6 with imiquimod treatment every day, and that this skin reaction is maintained at the same level if treatment is extended until day 12. Termination of treatment at 12 days, or continued treatment beyond this time, results in slow resolution of disease over the next 8-12 days.
  • the inventors then perform therapeutic blocking starting on day 7 through to day 11, and assess disease on day 12 and 20.
  • the inventors also start blocking on day 10 and monitor for quicker resolution of disease over that which occurs naturally in the next 10 days.
  • the inventors block LIGHT -LTpR vs. LIGHT -HVEM, as well as perform combination treatment with each antibody together with DR3.Fc, to determine if there is a qualitatively different effect neutralizing one or the other of LIGHT’s receptors.
  • the inventors monitor expression of LIGHT and TL1 A in the skin by mRNA and flow analyses over time and do this in the normal as well as extended models.
  • Combined studies demonstrate when LIGHT and TL1 A are active, which receptors are crucial, and that LIGHT and TL1 A function to maintain skin disease over time. Additionally, the studies demonstrate neutralization results in faster kinetics of resolution of disease where this occurs spontaneously.
  • the inventors repeat allergen or imiquimod treatments at later times to determine prior blocking provides a tolerogenic effect and limits future episodes of disease, including functional assessments of the T cell response and other infiltrates into the skin.
  • Peribronchial fibrosis and smooth muscle remodeling are primary characteristics of severe asthma and are associated with decline in airway function and reduced bronchodilator response.
  • the inventors have demonstrated the overall importance of two TNF family cytokines, LIGHT (TNFSF14) and TL1A (TNFSF15), to airway remodeling in mouse models of severe asthma driven by house dust mite allergen.
  • LIGHT and TL1 A are made by several immune cells, either T cells, macrophages, dendritic cells, eosinophils, or neutrophils.
  • LIGHT and TL1 A Their receptors (LTpR and HVEM for LIGHT; DR3 for TL1 A) are found on varying hematopoietic cells, but the inventors found that injection of either recombinant TL1 A or LIGHT into the airways of naive mice rapidly promotes smooth muscle alterations, collagen deposition, and airway hyperresponsiveness, suggesting important direct effects on airway structural cells.
  • the receptors for LIGHT and TL1 A are expressed on human airway fibroblasts and smooth muscle cells, two of the cell types that contribute to the in vivo pulmonary phenotypes that are regulated by LIGHT and TL1 A.
  • the data show that LIGHT and TL1 A can induce pro-fibrotic and inflammatory activities from these cells that are highly relevant to bronchoconstriction and airway remodeling.
  • LIGHT and TL1 A form a network of soluble cytokines to drive pathogenic phenotypes in these cells. Defining how LIGHT and TL1 A integrate with other mediators to control fibroblast and smooth muscle cell remodeling activities provides new combination therapeutic approaches to limit severe asthma, as disclosed herein.
  • recombinant TL1 A and LIGHT can promote increases in airway collagen and smooth muscle in vivo, and that blocking both molecules can reduce allergen- induced airway remodeling.
  • neutralizing reagents to LIGHT and TL1 A are utilized to understand the potential for combined therapeutic treatments in limiting allergen-induced airway remodeling. Failed trials blocking IL-4 or IL-13 alone, but success with dupilumab that blocks both molecules, has shown that combination targeting approaches in asthma are acceptable and likely to create greater benefit than monotherapy.
  • an understanding of the biology of LIGHT and TL1 A and how they synergize with other cytokines to promote remodeling features may lead to novel combination treatments for severe asthma.
  • LIGHT acts through two receptors in the TNFR superfamily, namely HVEM (TNFRSF14) and LTpR (TNFRSF3). LIGHT is not constitutively produced but can be transiently induced in activated T cells primarily as a soluble cytokine. It has also been found in some instances to be inducible in NK cells, DCs, macrophages, eosinophils and neutrophils.
  • TL1 A is similarly an inducible molecule, also likely acts primarily as a soluble cytokine, and can be made by DCs, macrophages, fibroblasts, epithelial cells, neutrophils and eosinophils (44, 46, 47). TL1 A acts through the receptor DR3 (TNFRSF25).
  • LIGHT the inventors have linked it to asthma by showing that LIGHT signaling via HVEM that is expressed on Th2 memory cells promoted their survival and accumulation in the airways, and thus controls airway inflammation via regulating the availability of IL-5 and IL-13 (49). The inventors then demonstrated that endogenous LIGHT production in the mouse contributes to airway remodeling in a manner distinct from regulating Th2 cells.
  • LIGHT- deficient mice were protected from accumulation of peribronchial and perivascular collagen and bronchiole-locating cells expressing aSMA (mature smooth muscle and myofibroblasts).
  • This LIGHT-deficient phenotype was further reproduced with semi-therapeutic treatment with a neutralizing LTpR.Ig fusion protein that blocks LIGHT interacting with LTpR and HVEM (e.g. FIG. 3 A (48)).
  • the inventors further showed that LIGHT was also active, co-operating with TGF-b, to drive airway remodeling during rhinovirus infection in the mouse (58)
  • LIGHT-/- mice displayed reduced thickening of the skin, less collagen in the adipose layers, and fewer aSMA+ keratinocytes and myofibroblasts in models of atopic dermatitis and scleroderma (Fig. 2b, (55, 59)).
  • the inventors have also expanded the concept of LIGHT being central to tissue remodeling, finding it crucial for skin thickening in the imiquimod-driven model of psoriasis. This suggests that LIGHT activity is not confined to only Th2 responses but it can be relevant for Thl7/Thl responses, of potential significance for severe asthmatics that might display the latter phenotypes (70-72).
  • TL1 A was also upregulated in the airways of HDM or bleomycin challenged animals, and with DR3 -deficient mice, it was found that it was also essential for tissue remodeling in the airways and skin in the same animal models of severe asthma, scleroderma, atopic dermatitis, and psoriasis where LIGHT is active (Fig. 6A-6C, (69).
  • the inventors furthered these observations by testing whether LIGHT and TL1 A could induce fibrosis and remodeling independently of other inflammatory activity, and of each other, by injecting the recombinant proteins into naive mice.
  • both molecules induced substantial collagen deposition and aSMA accumulation in the airways as well as the skin (FIG. 6A-6C, (54, 55,
  • LIGHT and TL1 A are mediators of airway tissue remodeling as they directly regulate functional activity in airway structural cells.
  • the inventors have already gathered much data on human bronchial epithelial cells.
  • rLIGHT can induce expression of adhesion molecules (ICAM-1, VCAM-1), proteinases (MMP-9, ADAM-8), cytokines (activin A, GM-CSF), and chemokines (CCL5, CCL20, CXCL1, CXCL3, CXCL5, CXCL1 1) in a steroid-resistant manner, of particular significance to severe asthma (FIG. 8A, and (53)).
  • TSLP and periostin were upregulated by LIGHT in HBE (FIG. 8B, (54)) and it was found that TL1 A also upregulated these molecules (FIG. 8B, (69)).
  • the inventors show that signaling through LTpR, HVEM, and DR3 directly regulates inflammatory events in HAF and that their individual activities drive unique phenotypes marked by differential gene expression.
  • the inventors compare rTLl A to rLIGHT, titrating each molecule (5-100 ng/ml, their optimal dose range, see (60, 69)).
  • the inventors perform kinetic analyses over 3 days (e.g. 4, 24, 48, 72hr) and compare data from 4-6 individual cell populations.
  • the inventors initially gain data with normal HAF.
  • the inventors have shown that LIGHT can promote proliferation of HAF but cannot drive myofibroblast differentiation (upregulation of aSMA), activities divergent from TGF-b (FIG. 9A).
  • LIGHT induced adhesion molecules IAMl, VCAMl
  • chemokines CCL5, CXCL5, 11, 12
  • cytokines TSLP, IL-33, IL-6, GM-CSF
  • MMP-9, ADAM8 metalloproteases
  • rTLl A can promote activities in HAF that might overlap with, but also be distinct from, LIGHT (FIG. 9C and 9D). This included promoting collagen 13 and periostin, the former shared with LIGHT but not the latter (FIG. 9C).
  • TL1 A also induced proliferation of HAF, similar to LIGHT, but unlike with LIGHT, TL1 A-driven proliferation was augmented by TGF-b and TL1A enhanced TGF-b driven aSMA (FIG. 9D).
  • the inventors have validated therapeutics blocking two TNF Superfamily members LIGHT and TL1 A in fibrotic diseases relevant to Systemic sclerosis (aka Scleroderma or SSc) and Pulmonary Fibrosis (PF) in humans.
  • SSc Systemic sclerosis
  • PF Pulmonary Fibrosis
  • LIGHT plays a central role in lung and skin fibrosis since it can control the expression of major pro-fibrotic factors such as TSLP, IL-13, TGF beta, and the extracellular matrix protein Periostin.
  • major pro-fibrotic factors such as TSLP, IL-13, TGF beta, and the extracellular matrix protein Periostin.
  • alpha-SMA alpha-smooth muscle actin
  • collagen depositions are observed.
  • LIGHT alone can induce a fibro-proliferative disorder that mimics human SSc-PF in the lung and skin; indeed, when administered alone into the airways or subcutaneously, LIGHT increases the accumulation of collagen and alpha-SMA leading to fibrosis.
  • TL1A TNF family Member
  • LIGHT and TL1 A synergize together without being inter-dependent in promoting fibrosis.
  • LIGHT and TL1 A promote remodeling aside from their pro-inflammatory role.
  • LIGHT and TL1 A maximize inflammation and fibrosis. Therefore, blocking concomitantly both LIGHT and TL1 A activities post-disease onset.
  • mice exposed to allergens epicutaneously to drive atopic dermatitis, post-disease onset were treated mice exposed to allergens epicutaneously to drive atopic dermatitis, post-disease onset.
  • the combination therapy neutralizing LIGHT and TL1 A was able to regress fibrosis of the skin, and decrease the clinical symptoms of eczema, namely eruption, scaling, bleeding and redness.
  • Epidermal thickening was drastically reduced when the signaling of both molecules was interrupted, as well as collagen deposition in the dermis.
  • the inventors extended these findings to treat two models of skin and lung fibrosis induced by bleomycin after the disease is established. The inventors also tested whether maintenance therapy is required to prevent the disease from re-stemming, once the treatment is interrupted.
  • An inflammatory/fibrotic signature of both TNF molecules on primary human fibroblasts was isolated from diseased individuals, and major players of SSc-PF.
  • the biological targets downstream of LIGHT and TL1 A serve as theranostic markers to monitor responses to targeted therapies.
  • the expression of LIGHT, TL1 A and their receptors in the serum and skin biopsies of SSc-PF patients was analysed via slow versus rapid progressors (matched with healthy control) over the course of a year.
  • TL1 A and their receptors can serve as prognostic markers to evaluate disease severity on human specimens from SSc-PF patients.
  • biological signature downstream of LIGHT and TL1A was identified on SSc-PF fibroblasts, leading to potential theranostics that can measure, monitor responses to targeted therapies, define novel regulators of fibrotic activity and enhance the understanding of the pathogenesis of fibrosis. The relevance of this work to Scleroderma and Pulmonary fibrosis therapies are tremendous.
  • LIGHT or TL1 A blockade in isolation can prevent lung and skin fibrosis in models of systemic sclerosis and idiopathic pulmonary fibrosis induced by bleomycin, as well as asthma and eczema induced by exposure to allergens.
  • LIGHT airway administration in a host lacking an active TL1 A signal maintains a fibroproliferative phenotype, and vice versa, TL1 A administration to LIGHT -deficient mice phenocopied wild type controls. This suggests both molecules act separately to drive fibrosis. Moreover, the inventors have shown that the concomitant administration of LIGHT and TL1 A maximized fibrosis in both the lung and skin, inducing passive inflammation and collagen deposition.
  • FIG. 12A and FIG. 12B illustrate LIGHT-deficiency decreases in scleroderma skin fibrosis induced by bleomycin whereas LIGHT intradermal injection alone induces scleroderma.
  • FIG. 13 shows unregulated expression of LIGHT and TL1 A transcripts in 8 SSc-PF patients compared to 8 Normal Lungs from healthy individuals.
  • Soumelis V. TSLP from allergy to vaccine adjuvant. Eur J Immunol. 2012;42(2):293-5. doi: 10.1002/eji.201142337.
  • IL-22 promotes allergic airway inflammation in epicutaneously sensitized mice. J Allergy Clin Immunol. 2018. doi: 10.1016/j jaci.2018.05.032.
  • PMCID PMC6298864. Glocova I, Bruck J, Geisel J, Muller-Hermelink E, Widmaier K, Yazdi AS, Rocken M, Ghoreschi K. Induction of skin-pathogenic Th22 cells by epicutaneous allergen exposure. Journal of dermatological science. 2017;87(3):268-77. doi: 10.1016/j.jdermsci.2017.06.006. Renert-Yuval Y, Guttman-Yassky E. Systemic therapies in atopic dermatitis: The pipeline. Clin Dermatol.
  • Croft M Costimulation of T cells by 0X40, 4-1BB, and CD27. Cytokine Growth Factor Rev. 2003;14(3-4):265-73. Croft M. The role of TNF superfamily members in T-cell function and diseases. Nat Rev Immunol. 2009;9(4):271-85. doi: nri2526 [pii] 10.1038/nri2526. Shaikh RB, Santee S, Granger SW, Butrovich K, Cheung T, Kronenberg M, Cheroutre H, Ware CF. Constitutive expression of LIGHT on T cells leads to lymphocyte activation, inflammation, and tissue destruction. J Immunol. 2001; 167(11):6330-7.
  • IL-23 from Langerhans cells is required for the development of imiquimod-induced psoriasis-like dermatitis by induction of IL-17A-producing gammadelta T cells.
  • PMCID PMC5868327.
  • Al-Lamki RS Wang J, Tolkovsky AM, Bradley JA, Griffin JL, Thiru S, Wang EC, Bolton E, Min
  • TL1A increased IL-6 production on fibroblast-like synoviocytes by preferentially activating TNF receptor 2 in rheumatoid arthritis.
  • Kotani H Masuda K, Tamagawa-Mineoka R, Nomiyama T, Soga F, Nin M, Asai J, Kishimoto S, Katoh N. Increased plasma LIGHT levels in patients with atopic dermatitis.
  • IL-33 is secreted by psoriatic keratinocytes and induces pro-inflammatory cytokines via keratinocyte and mast cell activation.
  • IL-33 and ST2 in atopic dermatitis expression profiles and modulation by triggering factors.
  • Palmoplantar pustular psoriasis is characterized by activation of the IL-17A pathway. Journal of dermatological science. 2017;85(l):20-6. doi: 10.1016/j.jdermsci.2016.09.019. Raychaudhuri SP, Jiang WY, Farber EM, Schall TJ, Ruff MR, Pert CB. Upregulation of RANTES in psoriatic keratinocytes: a possible pathogenic mechanism for psoriasis. Acta Derm Venereol. 1999;79(1):9-11. Patel DD, Kuchroo VK. Thl7 Cell Pathway in Human Immunity: Lessons from Genetics and Therapeutic Interventions. Immunity.
  • Palmoplantar Pustulosis and Palmoplantar Pustular Psoriasis are Highly Related Diseases that Appear to Be Distinct from Psoriasis Vulgaris.
  • Ziegler SF. The role of thymic stromal lymphopoietin (TSLP) in allergic disorders. Current opinion in immunology. 2010;22(6):795-9. doi: 10.1016/j.coi.2010.10.020.
  • PMCID 3032269.
  • IL-4 but not IL-13, modulates TARC (thymus and activation-regulated chemokine)/CCL17 and IP-10 (interferon-induced protein of 10kDA)/CXCL10 release by TNF-alpha and IFN-gamma in HaCaT cell line. Cytokine. 2002;20(l):l-6.
  • Th22 cells represent a distinct human T cell subset involved in epidermal immunity and remodeling. J Clin Invest. 2009; 119( 12):3573-85. doi: 10.1172/JCI40202. PMCID: 2786807. Fujita H. The role of IL-22 and Th22 cells in human skin diseases. Journal of dermatological science. 2013;72(l):3-8. doi: 10.1016/j.jdermsci.2013.04.028.
  • the Thl7 cytokine IL-22 induces IL-20 production in keratinocytes: a novel immunological cascade with potential relevance in psoriasis.
  • Noncanonical NF-kappaB activation requires coordinated assembly of a regulatory complex of the adaptors cIAPl, cIAP2, TRAF2 and TRAF3 and the kinase NIK. Nature immunology. 2008;9(12): 1371-8. doi: 10.1038/ni.l676. PMCID: 2676931.
  • Soroosh P Doherty TA, So T, Mehta AK, Khorram N, Norris PS, Scheu S, Pfeffer K, Ware C, Croft M. Herpesvirus entry mediator (TNFRSF14) regulates the persistence of T helper memory cell populations. Journal of Experimental Medicine. 2011;208(4):797-809. doi: 10.1084/jem.20101562. PMCID: 3135347. So T, Croft M. Regulation of PI-3-Kinase and Akt Signaling in T Lymphocytes and Other Cells by TNFR Family Molecules. Frontiers in immunology. 2013;4: 139. doi: 10.3389/fimmu.2013.00139.
  • IL-17R activation of human periodontal ligament fibroblasts induces IL-23 pl9 production: Differential involvement of NF-kappaB versus JNK/AP-1 pathways. Mol Immunol. 2011;48(4):647-56. doi: 10.1016/j.molimm.2010.11.008.
  • IL-17 induces production of IL-6 and IL-8 in rheumatoid arthritis synovial fibroblasts via NF-kappaB- and PI3-kinase/Akt- dependent pathways.
  • PMCID PMC400429. Hattori T, Ogura N, Akutsu M, Kawashima M, Watanabe S, Ito K, Kondoh T. Gene Expression Profiling of IL-17A-Treated Synovial Fibroblasts from the Human Temporomandibular Joint. Mediators Inflamm. 2015;2015:436067. doi: 10.1155/2015/436067.
  • PMCID PMC4709758.
  • Jinnin M, Ihn H, Yamane K, Tamaki K. Interleukin- 13 stimulates the transcription of the human alpha2(I) collagen gene in human dermal fibroblasts. J Biol Chem.
  • IL-4 and IL-13 induce myofibroblastic phenotype of human lung fibroblasts through c-Jun NH2 -terminal kinase-dependent pathway.
  • Interleukin- lbeta and tumor necrosis factor-alpha upregulate interleukin-23 subunitpl9 gene expression in human colonic subepithelial myofibroblasts.
  • PMCID PMC6441056. Clark RA, Kupper TS. Misbehaving macrophages in the pathogenesis of psoriasis. J Clin Invest. 2006; 116(8)2084-7. doi: 10.1172/JCI29441.
  • PMCID PMC1523394. Kasraie S, Werfel T. Role of macrophages in the pathogenesis of atopic dermatitis. Mediators Inflamm. 2013;2013:942375. doi: 10.1155/2013/942375.
  • PMCID PMC3603294.
  • HVEM-L Herpesvirus entry mediator ligand
  • LIGHT a TNF -like molecule, costimulates T cell proliferation and is required for dendritic cell- mediated allogeneic T cell response.
  • J Immunol. 2000;164(8):4105-10. Migone TS, Zhang J, Luo X, Zhuang L, Chen C, Hu B, Hong JS, Perry JW, Chen SF, Zhou JX, Cho YH, Ullrich S, Kanakaraj P, Carrell J, Boyd E, Olsen HS, Hu G, Pukac L, Liu D, Ni J, Kim S, Gentz R, Feng P, Moore PA, Ruben SM, Wei P.
  • TL1A is a TNF-like ligand for DR3 and TR6/DcR3 and functions as a T cell costimulator. Immunity. 2002;16(3):479-92. Papadakis KA, Prehn JL, Landers C, Han Q, Luo X, Cha SC, Wei P, Targan SR. TL1A synergizes with IL-12 and IL-18 to enhance IFN-gamma production in human T cells and NK cells. J Immunol. 2004;172(11):7002-7.
  • TNF-Like Protein IA-Death Receptor 3 Pathway Promotes Macrophage Foam Cell Formation In Vitro. J Immunol. 2010;184(10):5827-34. doi: jimmunol 0903782 Iniil 10.4049/iimmunol.0903782.
  • Anti-IL-5 treatment reduces deposition of ECM proteins in the bronchial subepithelial basement membrane of mild atopic asthmatics. J Clin Invest. 2003; 112(7): 1029-36. Epub 2003/10/03. doi: 10.1172/JCI17974. PubMed PMID: 14523040; PMCID: PMC198522. Riccio AM, Dal Negro RW, Micheletto C, De Ferrari L, Folli C, Chiappori A, Canonica GW. Omalizumab modulates bronchial reticular basement membrane thickness and eosinophil infiltration in severe persistent allergic asthma patients. Int J Immunopathol Pharmacol. 2012;25(2):475-84. Epub 2012/06/16.
  • PubMed PMID 11290525.
  • Xia YC Redhu NS, Moir LM, Koziol-White C, Ammit AJ, Al-Alwan L, Camoretti -Mercado B, Clifford RL.
  • Early growth response gene 1 -mediated apoptosis is essential for transforming growth factor betal-induced pulmonary fibrosis. J Exp Med. 2004;200(3):377-89. Epub 2004/08/04. doi: 10.1084/iem.20040104iem.20040104 [piil. PubMed PMID: 15289506; PMCID: 2211975.
  • the tumor necrosis factor family member LIGHT is a target for asthmatic airway remodeling. Nature Medicine. 2011; 17(5):596-603. Epub 2011/04/19. doi: nm.2356 [pii]10.1038/nm.2356. PubMed PMID: 21499267; PMCID: 3097134. Soroosh P, Doherty TA, So T, Mehta AK, Khorram N, Norris PS, Scheu S, Pfeffer K, Ware C, Croft M. Herpesvirus entry mediator (TNFRSF14) regulates the persistence of T helper memory cell populations. Journal of Experimental Medicine. 2011;208(4):797-809. Epub 2011/03/16. doi: 10.1084/jem.20101562.
  • PubMed PMID 21402741; PMCID: 3135347.
  • Sibilano R Gaudenzio N, DeGorter MK, Reber LL, Hernandez JD, Starkl PM, Zurek OW, Tsai M, Zahner S, Montgomery SB, Roers A, Kronenberg M, Yu M, Galli SJ.
  • a TNFRSF14-FcvarepsilonRI- mast cell pathway contributes to development of multiple features of asthma pathology in mice. Nat Commun. 2016;7: 13696. Epub 2016/12/17. doi: 10.1038/ncommsl3696. PubMedPMID: 27982078; PMCID: PMC5171877.
  • TNF-family receptor DR3 is essential for diverse T cell-mediated inflammatory diseases. Immunity. 2008;29(l):79-89. Epub 2008/06/24. doi: S1074- 7613(08)00269-0 [pii]10.1016/j.immuni.2008.04.021. PubMed PMID: 18571443.
  • Herro R Antunes Rda S, Aguilera AR, Tamada K, Croft M.
  • the Tumor Necrosis Factor Superfamily Molecule LIGHT Promotes Keratinocyte Activity and Skin Fibrosis. J Invest Dermatol. 2015; 135(8)2109-18. doi: 10.1038/jid.2015.110.
  • Rhinovirus infection interferes with induction of tolerance to aeroantigens through 0X40 ligand, thymic stromal lymphopoietin, and IL-33. J Allergy Clin Immunol. 2016; 137( l):278-88 e6. Epub 2015/06/24. doi: 10.1016/j jaci.2015.05.007. PubMed PMID: 26100084; PMCID: PMC4684822.
  • Tumor necrosis factor family member LIGHT acts with IL-lbeta and TGF-beta to promote airway remodeling during rhinovirus infection. Allergy. 2018 ;73 (7) : 1415 -24. Epub 2018/01/ 10. doi: 10.1111/all .13390. PubMed PMID : 29315623 ; PMCID : PMC6019192. Herro R, Shui JW, Zahner S, Sidler D, Kawakami Y, Kawakami T, Tamada K, Kronenberg M, Croft M. LIGHT-HVEM signaling in keratinocytes controls development of dermatitis. J Exp Med. 2018;215(2):415-22. Epub 2018/01/18.
  • PubMed PMID 9817170.
  • TNF-like ligand 1A is associated with the pathogenesis of psoriasis vulgaris and contributes to IL-17 production in PBMCs.
  • IL-17A produced by alphabeta T cells drives airway hyper-responsiveness in mice and enhances mouse and human airway smooth muscle contraction. Nat Med. 2012;18(4):547-54. Epub 2012/03/06. doi: 10.1038/nm.2684. PubMed PMID: 22388091; PMCID: PMC3321096.
  • Bulek K Chen X, Parron V, Sundaram A, Heqan T, Ouyang S, Liu C, Majors A, Zepp J, Gao J, Dongre A, Bodaszewska-Lubas M, Echard A, Aronica M, Carman J, Profziotis S, Sheppard D, Li X.
  • IL-17A recruits Rab35 to IL-17Rto Mediate PKCalpha-Dependent Stress Fiber Formation and Airway Smooth Muscle Contractility. J Immunol. 2019;202(5): 1540-8. Epub 2019/01/27. doi: 10.4049/jimmunol.1801025. PubMed PMID: 30683702; PMCID: PMC6379809. Tliba O, Deshpande D, Chen H, Van Besien C, Kannan M, Panettieri RA, Jr., Amrani Y. IL-13 enhances agonist-evoked calcium signals and contractile responses in airway smooth muscle. Br J Pharmacol. 2003; 140(7): 1159-62. Epub 2003/11/05.
  • PubMed PMID 14597600; PMCID: PMC1574143.
  • PubMed PMID 18322231. Chang Y, Al-Alwan L, Risse PA, Roussel L, Rousseau S, Halayko AJ, Martin JG, Hamid Q, Eidelman DH.
  • Interleukin- 13 augments transforming growth factor-betal -induced tissue inhibitor of metalloproteinase- 1 expression in primary human airway fibroblasts. Am J Physiol Cell Physiol. 2005;288(2):C435-42. doi: 10.1152/ajpcell.00035.2004. PubMed PMID: 15456694.
  • IL-17A enhances IL-13 activity by enhancing IL-13-induced signal transducer and activator of transcription 6 activation. J Allergy Clin Immunol. 2016. doi: 10.1016/j jaci.2016.04.037. PubMed PMID: 27417023. Hur GY, Pham A, Miller M, Weng N, Hu J, Kurten RC, Broide DH.
  • TGF-betal -induced phospholamban expression alters esophageal smooth muscle cell contraction in patients with eosinophilic esophagitis. J Allergy Clin Immunol. 2014; 134(5): 1100-7 e4. doi:
  • Herpesvirus entry mediator a member of the tumor necrosis factor receptor (TNFR) family, interacts with members of the TNFR- associated factor family and activates the transcription factors NF-kappaB and AP-1. J Biol Chem. 1997;272(22): 14029-32. PubMed PMID: 9162022. Dejardin E, Drain NM, Delhase M, Haas E, Cao Y, Makris C, Li ZW, Karin M, Ware CF, Green DR. The lymphotoxin-beta receptor induces different patterns of gene expression via two NF-kappaB pathways. Immunity. 2002;17(4):525-35. PubMed PMID: 12387745. Muller JR, Siebenlist U.
  • Lymphotoxin beta receptor induces sequential activation of distinct NF- kappa B factors via separate signaling pathways. J Biol Chem. 2003;278(14): 12006-12. PubMed PMID: 12556537. Hauer J, Puschner S, Ramakrishnan P, Simon U, Bongers M, Federle C, Engelmann H. TNF receptor (TNFR)-associated factor (TRAF) 3 serves as an inhibitor of TRAF2/5 -mediated activation of the noncanonical NF-kappaB pathway by TRAF-binding TNFRs. Proc Natl Acad Sci U S A. 2005;102(8):2874-9. PubMed PMID: 15708970.
  • Lee SH Kim EJ, Suk K, Kim IS, Lee WH. TL1A induces the expression of TGF-beta-inducible gene h3 (betaig-h3) through PKC, PI3K, and ERK in THP-1 cells.
  • PubMed PMID 26096887. Patel DD, Kuchroo VK. Thl7 Cell Pathway in Human Immunity: Lessons from Genetics and Therapeutic Interventions. Immunity. 2015;43(6) : 1040-51. doi: 10.1016/j. immuni.2015.12.003. PubMed PMID: 26682981. Wu NL, Huang DY, Tsou HN, Lin YC, Lin WW. Syk mediates IL-17-induced CCL20 expression by targeting Act 1 -dependent K63-linked ubiquitination of TRAF6. J Invest Dermatol. 2015; 135(2):490-8.
  • PubMed PMID 25202827. Zhu L, Wu Y, Wei H, Xing X, Zhan N, Xiong H, Peng B. IL-17R activation of human periodontal ligament fibroblasts induces IL-23 pl9 production: Differential involvement of NF-kappaB versus JNK/AP-1 pathways. Mol Immunol. 2011;48(4):647-56. doi: 10.1016/j.molimm.2010.11.008. PubMed PMID: 21145111. Dong Z, Yang Y, Zhang T, Li Y, Kang Q, Lei W, Cao Y, Niu X, Wang D, Tai W.
  • siRNA-Actl inhibits the function of IL-17 on lung fibroblasts via the NF-kappaB pathway. Respiration. 2013;86(4):332-40. doi: 10.1159/000348403. PubMed PMID: 23689683. Zhu S, Pan W, Shi P, Gao H, Zhao F, Song X, Liu Y, Zhao L, Li X, Shi Y, Qian Y. Modulation of experimental autoimmune encephalomyelitis through TRAF3 -mediated suppression of interleukin 17 receptor signaling. J Exp Med. 2010;207(12):2647-62. doi: 10.1084/jem.20100703. PubMed PMID: 21078888; PMCID: PMC2989772.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Medicinal Chemistry (AREA)
  • Immunology (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Animal Behavior & Ethology (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Genetics & Genomics (AREA)
  • Pain & Pain Management (AREA)
  • Biophysics (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Biochemistry (AREA)
  • Molecular Biology (AREA)
  • Rheumatology (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Medicinal Preparation (AREA)
  • Peptides Or Proteins (AREA)
PCT/US2021/025453 2020-04-02 2021-04-01 Methods and combinations for dual targeting of tnf family members Ceased WO2021202926A1 (en)

Priority Applications (3)

Application Number Priority Date Filing Date Title
EP21780761.9A EP4126960A4 (en) 2020-04-02 2021-04-01 Methods and combinations for dual targeting of tnf family members
JP2022560454A JP2023530046A (ja) 2020-04-02 2021-04-01 Tnfファミリーのメンバーの二重標的化のための方法および組合せ
US17/916,548 US20230159649A1 (en) 2020-04-02 2021-04-01 Methods and combinations for dual targeting of tnf family members

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US202063004030P 2020-04-02 2020-04-02
US63/004,030 2020-04-02

Publications (1)

Publication Number Publication Date
WO2021202926A1 true WO2021202926A1 (en) 2021-10-07

Family

ID=77928094

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2021/025453 Ceased WO2021202926A1 (en) 2020-04-02 2021-04-01 Methods and combinations for dual targeting of tnf family members

Country Status (4)

Country Link
US (1) US20230159649A1 (https=)
EP (1) EP4126960A4 (https=)
JP (1) JP2023530046A (https=)
WO (1) WO2021202926A1 (https=)

Cited By (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2024173865A3 (en) * 2023-02-17 2024-10-03 Prometheus Biosciences, Inc. Anti-tl1a antibody compositions and methods of treatment in the kidney
WO2024173861A3 (en) * 2023-02-17 2024-10-17 Prometheus Biosciences, Inc. Anti-tl1a antibody compositions and methods of treating skin
WO2025160334A1 (en) * 2024-01-26 2025-07-31 Flagship Pioneering Innovations Vii, Llc Immunoreceptor inhibitory proteins and related methods

Families Citing this family (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN121843714A (zh) 2023-08-11 2026-04-10 派拉冈医疗公司 Tl1a结合抗体及使用方法

Citations (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20090317388A1 (en) * 2005-05-25 2009-12-24 Linda Burkly Tl1a in treatment of disease
WO2014160883A1 (en) * 2013-03-27 2014-10-02 Cedars-Sinai Medical Center Treating fibrosis and inflammation by inhibiting tl1a
US20170058037A1 (en) * 2007-09-18 2017-03-02 La Jolla Institute For Allergy And Immunology Light inhibitors for asthma, lung and airway inflammation, respiratory, interstitial, pulmonary and fibrotic disease treatment
US20180016345A1 (en) * 2015-02-05 2018-01-18 La Jolla Institute For Allergy And Immunology Light inhibitors for scleroderma and skin fibrotic disease treatment
US20190119407A1 (en) * 2015-12-16 2019-04-25 Amgen Inc. Anti-tl1a/anti-tnf-alpha bispecific antigen binding proteins and uses thereof

Family Cites Families (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20180319889A1 (en) * 2015-11-02 2018-11-08 La Jolla Institute For Allergy & Immunology Method and medicament for treating airway and/or lung diseases
CN121930331A (zh) * 2019-09-13 2026-04-28 协和麒麟株式会社 DcR3变体

Patent Citations (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20090317388A1 (en) * 2005-05-25 2009-12-24 Linda Burkly Tl1a in treatment of disease
US20170058037A1 (en) * 2007-09-18 2017-03-02 La Jolla Institute For Allergy And Immunology Light inhibitors for asthma, lung and airway inflammation, respiratory, interstitial, pulmonary and fibrotic disease treatment
WO2014160883A1 (en) * 2013-03-27 2014-10-02 Cedars-Sinai Medical Center Treating fibrosis and inflammation by inhibiting tl1a
US20180016345A1 (en) * 2015-02-05 2018-01-18 La Jolla Institute For Allergy And Immunology Light inhibitors for scleroderma and skin fibrotic disease treatment
US20190119407A1 (en) * 2015-12-16 2019-04-25 Amgen Inc. Anti-tl1a/anti-tnf-alpha bispecific antigen binding proteins and uses thereof

Non-Patent Citations (2)

* Cited by examiner, † Cited by third party
Title
RANA HERRO; MICHAEL CROFT: "234.5: Shedding LIGHT and TL1A on fibrosis", JOURNAL OF IMMUNOLOGY, vol. 204, no. 1 supplement, 1 May 2020 (2020-05-01), pages 1 - 2, XP009531116, ISSN: 0022-1767 *
See also references of EP4126960A4 *

Cited By (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2024173865A3 (en) * 2023-02-17 2024-10-03 Prometheus Biosciences, Inc. Anti-tl1a antibody compositions and methods of treatment in the kidney
WO2024173861A3 (en) * 2023-02-17 2024-10-17 Prometheus Biosciences, Inc. Anti-tl1a antibody compositions and methods of treating skin
WO2025160334A1 (en) * 2024-01-26 2025-07-31 Flagship Pioneering Innovations Vii, Llc Immunoreceptor inhibitory proteins and related methods

Also Published As

Publication number Publication date
EP4126960A1 (en) 2023-02-08
JP2023530046A (ja) 2023-07-13
EP4126960A4 (en) 2024-11-13
US20230159649A1 (en) 2023-05-25

Similar Documents

Publication Publication Date Title
JP7351989B2 (ja) 炎症性状態の処置方法
US20230159649A1 (en) Methods and combinations for dual targeting of tnf family members
US12338283B2 (en) Methods for targeting the immune checkpoint PD1 pathway for treating pulmonary fibrosis
EP3102939A2 (en) AGENTS THAT MODULATE RGMb-NEOGENIN-BMP SIGNALING AND METHODS OF USE THEREOF
WO2008138017A2 (en) Methods and compositions for modifying t cell immune responses and inflammation
CN113508129B (zh) 突变的白介素-34(il-34)多肽及其在治疗中的用途
CN102725311A (zh) 治疗发炎的方法
JP7125979B2 (ja) 異所性骨化の治療又は予防のための医薬組成物
KR20230104152A (ko) 전신 홍반성 루푸스(sle)를 포함하는 자가면역 질환을 치료하기 위한 바이오마커, 방법 및 조성물
TW202440647A (zh) 經工程改造之pd-1抗體及其用途
US11135223B2 (en) Compositions and methods for inhibiting Dkk-1
WO2023034803A1 (en) Methods for treatment of fibrosis
KR20160124236A (ko) 만성 폐 동종이식편 기능이상 및 특발성 폐 섬유증의 예방 또는 치료를 위한 조성물 및 방법
Deng et al. Interleukin-17 family in health and immune diseases: From origin to clinical implications
CN111655289A (zh) 组合治疗剂
US20180298104A1 (en) Methods and pharmaceutical compositions for the treatment of th17 mediated diseases
CA2738605A1 (en) Composition and method for treatment of preterm labor
CN115768897B (zh) 改进的颗粒酶b变体
US20250289903A1 (en) Methods and compositions for treating eosinophil driven diseases and disorders
HK40114368A (zh) 用於治疗嗜酸性粒细胞驱动的疾病和病症的方法和组合物
KR20260041867A (ko) Pad4 조정제의 시트룰린화 및 활성을 평가하는 방법
JP2023551549A (ja) 炎症性皮膚状態を治療する方法
CN117015398A (zh) 治疗炎性皮肤病症的方法
US20090317357A1 (en) Methods for treating or preventing autoimmune disease using histamine h1 receptor-blocking agents

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 21780761

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 2022560454

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2021780761

Country of ref document: EP

Effective date: 20221102