WO2021201310A1 - 비타민과 덱스판테놀이 봉입된 에토좀 조성물 및 이의 제조방법 - Google Patents

비타민과 덱스판테놀이 봉입된 에토좀 조성물 및 이의 제조방법 Download PDF

Info

Publication number
WO2021201310A1
WO2021201310A1 PCT/KR2020/004318 KR2020004318W WO2021201310A1 WO 2021201310 A1 WO2021201310 A1 WO 2021201310A1 KR 2020004318 W KR2020004318 W KR 2020004318W WO 2021201310 A1 WO2021201310 A1 WO 2021201310A1
Authority
WO
WIPO (PCT)
Prior art keywords
composition
ethosome
hair
group
etosome
Prior art date
Application number
PCT/KR2020/004318
Other languages
English (en)
French (fr)
Inventor
김호준
전용주
Original Assignee
현대바이오사이언스 주식회사
(주)위바이오트리
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by 현대바이오사이언스 주식회사, (주)위바이오트리 filed Critical 현대바이오사이언스 주식회사
Priority to AU2020389480A priority Critical patent/AU2020389480A1/en
Publication of WO2021201310A1 publication Critical patent/WO2021201310A1/ko

Links

Images

Classifications

    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K8/00—Cosmetics or similar toiletry preparations
    • A61K8/02—Cosmetics or similar toiletry preparations characterised by special physical form
    • A61K8/14—Liposomes; Vesicles
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K8/00—Cosmetics or similar toiletry preparations
    • A61K8/02—Cosmetics or similar toiletry preparations characterised by special physical form
    • A61K8/11—Encapsulated compositions
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K8/00—Cosmetics or similar toiletry preparations
    • A61K8/18—Cosmetics or similar toiletry preparations characterised by the composition
    • A61K8/30—Cosmetics or similar toiletry preparations characterised by the composition containing organic compounds
    • A61K8/33—Cosmetics or similar toiletry preparations characterised by the composition containing organic compounds containing oxygen
    • A61K8/34—Alcohols
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K8/00—Cosmetics or similar toiletry preparations
    • A61K8/18—Cosmetics or similar toiletry preparations characterised by the composition
    • A61K8/30—Cosmetics or similar toiletry preparations characterised by the composition containing organic compounds
    • A61K8/40—Cosmetics or similar toiletry preparations characterised by the composition containing organic compounds containing nitrogen
    • A61K8/42—Amides
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K8/00—Cosmetics or similar toiletry preparations
    • A61K8/18—Cosmetics or similar toiletry preparations characterised by the composition
    • A61K8/30—Cosmetics or similar toiletry preparations characterised by the composition containing organic compounds
    • A61K8/55—Phosphorus compounds
    • A61K8/553—Phospholipids, e.g. lecithin
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K8/00—Cosmetics or similar toiletry preparations
    • A61K8/18—Cosmetics or similar toiletry preparations characterised by the composition
    • A61K8/30—Cosmetics or similar toiletry preparations characterised by the composition containing organic compounds
    • A61K8/64—Proteins; Peptides; Derivatives or degradation products thereof
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K8/00—Cosmetics or similar toiletry preparations
    • A61K8/18—Cosmetics or similar toiletry preparations characterised by the composition
    • A61K8/30—Cosmetics or similar toiletry preparations characterised by the composition containing organic compounds
    • A61K8/67—Vitamins
    • A61K8/673—Vitamin B group
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K8/00—Cosmetics or similar toiletry preparations
    • A61K8/18—Cosmetics or similar toiletry preparations characterised by the composition
    • A61K8/30—Cosmetics or similar toiletry preparations characterised by the composition containing organic compounds
    • A61K8/67—Vitamins
    • A61K8/676—Ascorbic acid, i.e. vitamin C
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K8/00—Cosmetics or similar toiletry preparations
    • A61K8/18—Cosmetics or similar toiletry preparations characterised by the composition
    • A61K8/30—Cosmetics or similar toiletry preparations characterised by the composition containing organic compounds
    • A61K8/67—Vitamins
    • A61K8/678—Tocopherol, i.e. vitamin E
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K9/00—Medicinal preparations characterised by special physical form
    • A61K9/10—Dispersions; Emulsions
    • A61K9/127—Liposomes
    • A61K9/1271—Non-conventional liposomes, e.g. PEGylated liposomes, liposomes coated with polymers
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61Q—SPECIFIC USE OF COSMETICS OR SIMILAR TOILETRY PREPARATIONS
    • A61Q7/00—Preparations for affecting hair growth

Definitions

  • the present invention is an ethosome composition
  • an ethosome composition comprising an etosome encapsulated with vitamins and dexpanthenol.
  • the sparingly soluble substance is effectively permeated into the skin, especially the scalp, and It has an effect and relates to an ethosome composition capable of preventing hair loss and a method for preparing the same.
  • Human hair is about 100,000 to 150,000 per person, and hair grows with its own cycle. This cycle is divided into anagen, catagen, and telogen, and according to this cycle, hair growth and hair loss are repeated. In this process, it is a natural phenomenon that an average of 100 hairs fall out per day.
  • Hair loss refers to a state in which hair is lost and sparse or lost. Although the mechanism of hair loss has not yet been precisely elucidated, the research so far has shown that excessive sebum production caused by abnormalities in the circulatory system such as endocrine system abnormalities such as hormone imbalance, autonomic nervous system and blood circulation disorders, nutritional deficiency of hair roots, allergy, bacterial infection, Genetic factors and aging are presumed to be the main causes.
  • hair loss which was mainly seen in middle-aged people in the past, can be easily found in young people in their 20s and 30s, and the number is also increasing.
  • the minoxidil formulation induces a vasodilatory effect by inducing the opening of Ca-channels, and through this, by increasing blood flow, it is a drug that induces hair growth by continuously supplying nutrients to the hair roots.
  • the effect is large with respect to hair loss in the crown region.
  • hair loss in areas other than the crown it has a disadvantage that it does not have a good effect.
  • finasteride inhibits the function of type 2 5-alpha reductase (5 ⁇ -reductase) to prevent the conversion of testosterone to DHT (dihydrotestosterone), thereby inhibiting hair loss.
  • DHT dihydrotestosterone
  • finasteride shows side effects such as decreased libido and erectile dysfunction in some patients.
  • a short-term rapid treatment is possible, but when the use of the therapeutic drug is stopped, it has a fatal problem in that hair loss proceeds immediately.
  • finasteride alone does not have a sufficient effect of improving hair loss, and it has a problem that it is difficult to show a continuous hair effect without the help of a DHT inhibitor.
  • an ethosome composition capable of efficiently delivering an active ingredient having an effect on hair growth and hair, and a method for preparing the same.
  • Patent Document 0001 Republic of Korea Patent No. 10-0352088
  • Patent Document 0002 Republic of Korea Patent Publication No. 10-2015-0044029
  • An object of the present invention is to provide an ethosome composition capable of efficiently delivering a sparingly soluble active ingredient by penetrating the skin barrier and a method for preparing the same.
  • the present invention uses an anti-aging skin active ingredient that has effects such as skin anti-aging, antioxidant, collagen promotion, etc., rather than a hair growth/wool functional active ingredient whose efficacy is recognized for hair growth/hair growth, by enabling efficient delivery to the scalp. , It aims to provide a composition that promotes the hair effect and prevents hair loss.
  • the ethosome composition according to the present invention for solving the above-mentioned problems is an ethosome composition comprising an ethosome encapsulated with vitamins and dexpanthenol,
  • the ethosome includes ethanol, a peptide, phosphatidyl choline, and an amino acid compound.
  • the peptide is pal-GHK, Pal-GQPR, Pal-KTTK, Pal-KTTKS, Biotin-GHK, PAL-KVK (Palmiotyl Tripeptide-5), Palmitoyl tripeptide-38, Palmitoyl-Tripeptide (Pal-RFK) , Human Oligopeptide-20(Val-Gly-Val-Ala-Pro-Gly), GHK-Cu, (AHK)2Cu, AHK-Cu, Myristic acid-KLAKK-CONH2, Hexapeptide-11, Octapeptide-2, Palmitoyl-hexapeptide , Acetyl tetrapeptide-15, Acetyl Hexapeptide 3, Acetyl Tetrapeptide-2, Acetyl Tetrapeptide-5, Acetyl-Decapeptide-3, Ac-KGHK, rh-Oligopeptide-1(humanEGF) (NSDSECPLSHDGYCLHDGVCMYIEALDKYACN
  • the vitamin may be at least one selected from the group consisting of vitamin E, vitamin C, vitamin B, salts thereof, and analogs thereof.
  • the amino acid compound may be one or more selected from the group consisting of amino acids and amino acid analogs, and the amino acids and amino acid analogs are NAC (N-Acetyl Cysteine), arginine (Arginin), lolysine, lysine ethyl ester, It may be at least one selected from the group consisting of histidine and histidine ethyl ester.
  • the ethosome composition is vitamin 20 to 70 mg/100ml, dexpanthenol 150 to 250 mg/100ml, ethanol 5 to 15 ml/100ml, peptide 0.1 to 10 mg/100ml, phosphatylcholine 10 to 1000 mg/100ml, it may be one containing 10 to 1000 mg/100ml of the amino acid compound.
  • the etosome may have an average particle diameter of 90 to 200 nm.
  • the etosome may have an absolute value of a surface charge value of 10 to 100 mV.
  • the present invention also provides a method for preparing the above-described ethosome composition
  • step (d) adding the solution of step (b) to the solution of step (a), followed by mixing;
  • step (e) adding the solution of step (c) to the solution of step (d), followed by mixing;
  • step (f) adding a pH adjusting agent to the solution of step (e), followed by mixing; It provides a method for producing an ethosome composition comprising a.
  • Step (c) may further include one or more selected from the group consisting of surfactants and other active ingredients for wool.
  • the pH adjusting agent may include one or more selected from the group consisting of citric acid and salts thereof.
  • the step (a) may be to add 80 to 120 g of the amino acid compound to 50 to 70 L of purified water.
  • Step (b) may be to add 100 to 300 g of dexpanthenol to 25 to 35 L of purified water.
  • the present invention also provides a composition for promoting hair growth and/or hair comprising the etosome composition according to the present invention.
  • the present invention also provides a composition for preventing telogen hair loss comprising the etosome composition according to the present invention.
  • composition for preventing telogen hair loss may be to prevent telogen hair loss by promoting scalp anti-aging and/or collagen production.
  • the present invention also provides a composition for promoting hair growth and/or hair, characterized in that the ethosome composition is a composition for men further comprising oleanolic acid and/or apigenin.
  • the etosome composition provides a composition for preventing telogen hair loss, characterized in that the composition for men further comprises oleanolic acid and/or apigenin.
  • skin anti-aging active ingredients having effects such as skin anti-aging, antioxidant, and collagen promotion are efficiently delivered to the scalp, thereby promoting hair growth and hair growth, and preventing hair loss.
  • the present invention has the effect of increasing the hair growth effect by enabling the efficient delivery of various compositions in addition to the active ingredient for hair growth using the etosome morphology.
  • FIG. 1 is a schematic diagram showing a hair cycle
  • Figure 6 is a graph showing the test results to confirm the skin penetration rate of Dexpantenol
  • Figure 13 is a graph showing the thickness of the skin tissue in the growth phase continuation / telogen inhibitory effect test
  • Figure 15 is a photograph recording the difference between each group on the 19th day after the start of the test in the growth phase continuation / telogen inhibitory effect test;
  • 16 is a graph in which the growth phase maintenance state of the growth phase continuation/resting phase inhibition effect experiment is scored.
  • the etosome composition according to the present invention has an effect of efficiently delivering vitamins and poorly soluble substances such as dexpanthenol by penetrating the skin.
  • Hydrophilic substances dissolve well in solvents such as water, but the skin is composed of a hydrophobic protective film, so it is difficult for hydrophilic active ingredients to be delivered into the skin. Therefore, there is a problem that the transfer efficiency using the solvent is lowered because it is not dissolved.
  • Etosome is a phospholipid nanovesicle used for skin and transdermal delivery of molecules, and the present invention uses this to form a vesicle like ethosome by using a phospholipid called phosphatidylcholine and encapsulates the active ingredient in the skin.
  • a phospholipid called phosphatidylcholine By moving to the protective film, it is configured to allow the active ingredient to penetrate into the skin protective film to efficiently deliver the active ingredient.
  • the present invention is not a component known to be effective for hair growth and wool, but an active ingredient for skin aging improvement that has effects such as skin anti-aging, antioxidant, and collagen promotion, and effectively delivers it to the scalp. By inducing aging and antioxidant effects, it promotes hair growth and wool, and has the effect of preventing hair loss.
  • the vitamin may be one or more selected from the group consisting of vitamin E, vitamin C, vitamin B, salts thereof, and analogs thereof. As long as it functions as a vitamin, any type may be used regardless of its form, for example, various forms such as vitamin E acetate and fat-soluble vitamin C may be used.
  • the ethosome contains ethanol, peptide, phosphatidylcholine, and an amino acid compound, thereby improving the flexibility of the ethosome shell, thereby increasing the skin penetration rate, and thereby, the effect of efficient delivery of active ingredients.
  • the peptide is pal-GHK, Pal-GQPR, Pal-KTTK, Pal-KTTKS, Biotin-GHK, PAL-KVK (Palmiotyl Tripeptide-5), Palmitoyl tripeptide-38, Palmitoyl-Tripeptide (Pal-RFK), Human Oligopeptide-20(Val-Gly-Val-Ala-Pro-Gly), GHK-Cu, (AHK)2Cu, AHK-Cu, Myristic acid-KLAKK-CONH2, Hexapeptide-11, Octapeptide-2, Palmitoyl-hexapeptide, Acetyl tetrapeptide-15, Acetyl Hexapeptide 3, Acetyl Tetrapeptide-2, Acetyl Tetrapeptide-5, Acetyl-Decapeptide-3, Ac-KGHK, rh-Oligopeptide-1 (humanEGF) (NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVG
  • the peptide has an effect on skin antioxidant, etc., it is not a component known to have an effect on hair growth, wool effect, etc., but in the present invention, by sufficiently efficiently delivering the component into the scalp, the antioxidant / By maximizing the anti-aging effect and controlling the hair growth cycle, the resting period is shortened, and the growth period is continued, thereby inducing hair growth and wool effects.
  • the peptide may preferably be pal-GHK.
  • the phosphatidyl choline is one of lecithins, and lecithin refers to a group of fatty substances occurring in animal and plant tissues consisting of phosphoric acid, choline, fatty acids, glycerol, glycolipids, triglycerides, and phospholipids.
  • phosphatidyl choline is a phospholipid class including choline as a headline, and as it is made of phospholipids such as a skin protective film, it has the advantage of easily penetrating the skin membrane during delivery of an active ingredient.
  • the amino acid compound may be one or more selected from the group consisting of amino acids and amino acid analogs, and the amino acids and amino acid analogs are specifically, N-Acetyl Cysteine (NAC), arginine and lysine, lysine ethyl ester, histidine, and histidine. It may include at least one selected from the group consisting of ethyl esters.
  • NAC N-Acetyl Cysteine
  • arginine and lysine arginine and lysine
  • lysine ethyl ester histidine
  • histidine histidine
  • histidine histidine
  • the ethosome composition is vitamin 20 to 70 mg/100ml, dexpanthenol 150 to 250 mg/100ml, ethanol 5 to 15 ml/100ml, peptide 0.1 to 10 mg/100ml, phosphatylcholine 10 to 1000 mg/100ml, may be one containing 10 to 1000 mg/100ml of the amino acid compound.
  • the vitamin may preferably be included in an amount of 30 to 60 mg/100ml, and when it is added in excess than the above content, there is a problem of vitamin precipitation during long-term storage, and when added in a small amount than the above content, high skin Despite the penetration rate, there is a problem that it is difficult to exhibit a sufficient effect.
  • the dexpanthenol may preferably be included in an amount of 120 to 220 mg/100ml, but when added in excess of the above content, there is a problem of difficult solubilization and poor stability, and when added in a small amount than the above content, effectiveness There is a problem that the effect exerted by the minute is insignificant.
  • the ethanol may be included in an amount of 7 to 12 mg/100ml, but when it is added in excess of the above content, there is a problem in that it cannot form an ethosome and becomes a dissolved state, and it is added in a small amount than the above content. In this case, there is a problem that the stability of the formulation of the poorly soluble material is lowered because the ethosome is not formed.
  • the peptide may preferably be included in an amount of 0.1 to 10 mg/100ml, when added in excess than the above content, there is a problem in that the manufacturing / production cost increases, and when added in a small amount than the above content , there is a problem in that it is difficult to exhibit a sufficient effect in spite of a high skin penetration rate.
  • the phosphatidylcholine may be included in an amount of 10 to 1000 mg/100ml, but when it is added in excess than the above content, an excess material that does not participate in ethosome formation remains and there is a serious problem in turbidity, the content When added in a smaller amount, there is a problem in ethosomizing the active substance.
  • the amino acid compound in the case of the amino acid compound, it may be included in an amount of 10 to 1000 mg/100ml, when it is added in excess than the above content, there is a problem of raising or lowering the pH, and when it is added in a small amount than the above content, then a pH adjusting agent There is a problem that must be added in excess.
  • the effective ingredient delivery effect of the ethosome composition is particularly excellent, and in particular, in the present invention, the hair growth cycle is controlled through effective delivery to the scalp to shorten the resting period and , characterized in that it has a hair growth and wool effect by continuing the growth phase.
  • the ethosome included in the ethosome composition may have an average particle diameter of 90 to 200 nm.
  • the size of the particles has a uniform effect, and has a more advantageous effect on effective ingredient delivery by maintaining a stable ethosome composition.
  • the etosome may also have an absolute value of a surface charge value of 10 to 100 mV. When it has the above range, the etosomes may be uniformly dispersed in the solution without clumping together.
  • the method for preparing an ethosome composition according to the present invention comprises the steps of: (a) solubilizing an amino acid compound in purified water;
  • step (c) may further include one or more selected from the group consisting of surfactants and other active ingredients for wool.
  • the surfactant may be, for example, a surfactant such as Poloxamer 188, Poloxamer 407, Poloxamer F-127, PEG 60 (hydrogenated cateroil), Polysorbate 80, tween 20, tween 60, tween 80.
  • the other active ingredients for wool are not particularly limited and can be used, for example, natural extracts and compounds such as melatonin and cheongpo extract, and the like, may be appropriately added as necessary.
  • the pH adjusting agent may include one or more selected from the group consisting of citric acid and salts thereof.
  • the step (a) may be to add 80 to 120 g of the amino acid compound to 50 to 70 L of purified water. Preferably, it may be to add 90 to 110 g of the amino acid compound to 55 to 65 L of purified water.
  • the step (b) may be to add 100 to 300 g of dexpanthenol to 25 to 35 L of purified water, preferably, to add 150 to 250 g of dexpanthenol to 27 to 32 L of purified water.
  • the ethosome composition according to the present invention can be used as a composition for promoting hair growth and/or wool, and as described above, by effectively penetrating the active ingredient having the effect of improving skin aging and anti-aging into the scalp using the ethosome composition. , prevents telogen hair loss by inducing an aging improvement effect of the scalp, and induces hair growth and/or wool effect by sustaining the growth phase.
  • a composition for preventing telogen hair loss that can prevent telogen hair loss.
  • composition according to the present invention can be used to induce hair growth, hair growth, or to improve or prevent hair loss.
  • the present invention can provide a composition for promoting hair growth and/or hair growth and a composition for preventing telogen hair loss, which are optimized according to the gender of the user.
  • ethosome composition can be used without distinction between women and men, but by configuring it to further include oleanolic acid and/or apigenin in addition to men, a composition particularly suitable for male users can be provided.
  • the oleanolic acid is a triterpenoid saponin, and is a pentacyclic triterpenoid. By using it, it is possible to provide a composition particularly suitable for men.
  • test substance was diluted with a 0.2% solution using distilled water and then measured, and measured using a Disposable cell.
  • Each sample was stored at 37°C and 70% humidity, and samples were collected and diluted at a predetermined time for measurement.
  • Table 4 below shows the stability measurement results for Examples 1 to 5 and 10 to 14 in which ZnO was not added.
  • the particle size distribution of the Example prepared according to the manufacturing process was completed with a very even particle size distribution of about 100 nm to 160 nm based on the Z-average size, and in the case of zeta potential, Examples 3 and 14 had the lowest charge Results with values were obtained, suggesting that the formulation has excellent long-term storage stability.
  • Examples 1 and 10 there was no change in the particle size distribution as time passed, but it was confirmed that the surface charge value increased, which means that the stability of the ethosome increases after 1 to 2 days or more from the initial stage.
  • Test kit Pion's skin pmapa test kit is used.
  • Experimental time was measured by using a microplate or by using HPLC to measure the amount of target material that moved toward the acceptor for 6 hours based on 6hr. It was calculated using the formula below.
  • composition of the experimental group The experimental group in which the material to be measured was added to the buffer solution provided by Pion was selected as a control group, and the experimental group was comparatively analyzed using the formulation corresponding to the example.
  • FIGS. 6 and 7 The experimental results measured using the above test method are shown in FIGS. 6 and 7 .
  • the penetration rate of the control group was calculated as 100%, and the relative penetration rate was shown.
  • 6 is an experimental result confirming the skin penetration rate for dexpantenol, a hydrophilic material, and it was confirmed that the penetration rate was increased due to the high penetration rate of etosomes when the ethosomal formulation was used despite the water-soluble material.
  • the degree of hair growth in each group was visually determined for each animal by the scoring system. According to the degree of hair growth, 0% for 0%, 1 to 25% for 1 point, 26 to 50% for 2 points, and 51 to 75% for hair growth. 3 points, 76 ⁇ 100% were divided into 4 points.
  • skin tissue was extracted and fixed in 10% neutral formalin for more than 48 hours while attached to filter paper.
  • the fixed tissue was trimmed from the head to the tail to a thickness of 5 to 10 mm, followed by general tissue treatment with alcohol, xylene, and paraffin.
  • 4 ⁇ m slices were made using a rotary slicer and stained with hematoxylin and eosin (H&E).
  • the thickness of the skin tissue was measured while observing with an optical microscope, and the ratio of growing hair follicles to resting hair follicles among 100 hair follicles for each animal was calculated.
  • the C57BL/6 mouse used in this experiment has the advantage of being able to determine whether or not the hair follicle has been introduced into the growth phase just by observing the change in skin color with the naked eye because the melanin production cycle and the growth phase of the hair follicle coincide. Therefore, in this experiment, in order to confirm the hair growth promoting effect of the test substance, the change in skin color and the time at which hair was observed for the first time were measured every day from immediately after application of the test substance.
  • FIG. 9 is a photograph of the skin tissue of the experimental group in which the hair was H&E dyed after application of the test substance of Experimental Example 4-1, and FIG. am.
  • the thickness measurement result of the skin tissue is shown in FIG. 9 .
  • the negative group it was 264.8 ⁇ 17.3 ⁇ m, whereas in the Rogaine group, it was 476.4 ⁇ 95.3 ⁇ m, confirming a clear increase in skin thickness.
  • the skin thickness was higher than that of the 6 group (569.9 ⁇ 54.5 ⁇ m) Rogaine group.
  • the skin tissue was excised, fixed in 10% neutral formalin, washed with running water 24 hours later, dehydrated with alcohol, xylene, and paraffin, transparent, penetrated, and then embedded in paraffin.
  • the embedded tissue was made into 4 ⁇ m slices, stained with hematoxylin and eosin (H&E), and observed under an optical microscope.
  • the duration of the growth phase of the test substance was measured.
  • the period when skin color pigmentation appears from pink to gray or black is the introduction period of the growth phase, and after hair growth occurs, the skin color change is observed once a day.
  • the difference (day) was compared with the time period.
  • FIG. 11 is a photograph of the skin tissue after H&E dyeing in Experimental Example 4-2, and FIG. 12 is a photograph recording the state of hair regrowth during the experimental period of Experimental Example 4-2.
  • Example 1 was placed in Experimental Group 3 and the experiment was performed.
  • groups 4, 5, 8 and 12 showed particularly high scores.
  • groups 8 and 12 which showed rapid growth phase transition, hair began to be observed from the 24th and 21st, respectively, and hair began to be observed from the 23rd day in the test group to which Hyundai Pharmaceutical Minoxidil, a positive control, was applied.
  • group 4 had an average of 3.1 ⁇ 0.7 points
  • group 12 had 2.5 ⁇ 0.7 points or higher, which was higher than Hyundai Pharm Minoxidil’s 2.8 ⁇ 1.3 points.
  • the state of hair regrowth was recorded as a photograph at regular intervals after application of the test substance, and the photographic results are shown in FIG. 10 .
  • hair was observed uniformly without deviation in group 4, and it was confirmed that hair was observed in a uniform and wide area in the group coated with the test substance of group 12 (Example 18) than in the minoxidil group, which is a positive control group.
  • the skin tissue was excised, fixed in 10% neutral formalin, washed with running water 24 hours later, dehydrated with alcohol, xylene, and paraffin, transparent, penetrated, and then embedded in paraffin. After making a 4 ⁇ m-thick section of the embedded tissue, hematoxylin and eosin (H&E) staining was performed and observed under a light microscope to measure the ratio of anagen and resting follicles and the change in skin tissue thickness.
  • H&E hematoxylin and eosin
  • the purpose of this experiment is an experiment conducted to confirm the effect on the growth phase continuation/resting phase inhibitory effect of Examples.
  • Figure 14 is a graph showing the growth phase hair follicle ratio in the anagen period / telogen inhibitory effect test.
  • FIG. 15 is a photograph recording the difference between each group on the 19th day after the start of the test in the growth phase continuation / telogen inhibitory effect test, and FIG.

Abstract

본 발명은 비타민과 덱스판테놀이 봉입된 에토좀을 포함하는 에토좀 조성물로서, 상기 에토좀은 에탄올, 펩티드, 포스파티틸콜린(Phosphatidyl choline), 아미노산 화합물을 포함하는 에토좀 조성물 및 이의 제조방법에 관한 것이다. [대표도] 도6

Description

비타민과 덱스판테놀이 봉입된 에토좀 조성물 및 이의 제조방법
본 발명은 비타민과 덱스판테놀이 봉입된 에토좀을 포함하는 에토좀 조성물로서, 난용성 물질이 봉입된 에토좀 조성물을 이용하여 피부, 특히, 두피에 난용성 물질을 효과적으로 투과시켜, 발모와 양모에 효과를 가지며, 탈모를 방지할 수 있는 에토좀 조성물 및 이의 제조방법에 관한 것이다.
인간의 머리카락은 개인 당 약 10~15만개 정도되며, 모발은 고유의 주기를 갖고 성장한다. 이 주기는 성장기(anagen), 퇴행기(catagen), 휴지기(telogen)로 나뉘며 이 주기에 따라, 모발의 성장과 탈락을 반복한다. 이 과정에서 하루 평균 100개가량의 머리카락이 탈락하는 것은 자연스러운 현상이다.
탈모는 모발이 빠져 성기거나 또는 소실한 상태를 말한다. 탈모의 기전은 아직 정확하게 밝혀지지 않았으나, 지금까지 연구된 바로는 호르몬 불균형 등 내분비계 이상, 자율신경계 및 혈액순환 장애 등의 순환계의 이상으로 생기는 과도한 피지 생성, 모근의 영양 결핍, 알레르기, 세균 감염, 유전적 요인, 노화 등을 주원인으로 추정되고 있다.
또한, 최근에는 복잡한 생활환경에서 오는 정신적 스트레스, 대기 오염, 음식물 등 환경적 요인에 의한 원인설도 대두되고 있다.
이와 같이 외부 탈모 요인이 증가함에 따라, 과거에는 중 장년층에서 주로 나타났던 탈모는 최근 20~30대 젊은 층에서도 쉽게 찾아볼 수 있으며, 그 수 역시 증가하는 추세에 있다.
이에 따라, 탈모를 치료하기 위하여 많은 연구가 진행되어 왔으며, 여성 호르몬제, 혈류 촉진제 등 약물요법과 모발 이식법이 개발되었다. 현재 탈모 치료에 있어서 가장 많이 사용되는 약물로써는 FDA에서 승인받은 미녹시딜 제제(Minoxidil)와 피나스테라이드(Finasteride)가 있다.
미녹시딜 제제는 Ca-채널의 오픈을 유도함으로써 혈관 확장 효과를 유도하고, 이를 통하여 혈류량을 증가시킴으로써 모근에 영양분을 지속적으로 공급함으로써 모발의 성장을 유도하는 약물이다. 특히, 정수리 부분의 탈모에 대해서 효과가 큰 것으로 알려져 있다. 그러나, 정수리 이외 부위의 탈모의 경우 좋은 효과를 갖지 못한 단점을 갖는다.
한편, 피나스테라이드는 제2형 5알파 환원효소(5α-reductase)의 기능을 억제시켜 테스토스테론(Testosterone)이 DHT(Dihydrotestosterone)으로 전환되는 것을 막아 탈모를 억제하는 효과를 갖는다. 하지만 피나스테라이드는 일부 환자에 성욕감퇴, 발기부전의 부작용을 보인다. 게다가 이러한 약물적 치료의 경우 단기간 빠른 치료는 가능하지만 치료용 약물의 사용을 중단하게 되면 즉시 탈모가 진행되는 치명적인 문제점을 가지고 있다. 그러나, 남성형 탈모 및 후기 탈모의 경우, 피나스테라이드만으로는 충분한 탈모 개선효과를 가지지 못하고, DHT inhibitor의 도움 없이는 지속적인 양모 효과가 나타나기 어려운 문제점을 가지고 있다.
따라서, 여성형 탈모, 남성형 탈모 그리고 후기 탈모증을 극복할 수 있는 서로 다른 양모제가 필요하며, 탈모 형태에 따라 다르게 접근함으로써 효율성을 높이고, 부작용을 줄일 필요가 있다.
유효성분의 경피전달(Transdermal delivery)를 위해서 다양한 제제화 기술이 개발되고 있으나 아직까지 유효성분을 효율적으로 전달하기에는 많은 한계점을 가지고 있다.
본 발명의 발명자들은 수많은 실험과 반복을 거듭한 끝에, 발모와 양모에효과를 가지는 유효성분을 효율적으로 전달할 수 있는 에토좀 조성물 및 이의 제조방법을 완성하기에 이르렀다.
[선행기술문헌]
[특허문헌]
(특허문헌 0001) 대한민국 등록특허 제10-0352088호
(특허문헌 0002) 대한민국 공개특허 제10-2015-0044029호
본 발명은 피부 보호막을 투과하여 난용성 유효성분을 효율적으로 전달할 수 있는 에토좀 조성물 및 이의 제조방법을 제공하는 것을 목적으로 한다.
본 발명은 발모/양모에 효능이 인정된 발모/양모 기능성 유효성분이 아닌, 피부 항노화, 항산화, 콜라겐 촉진 등의 효과를 가지는 피부 노화 방지 유효성분을 이용하여 두피에 효율적인 전달을 가능하게 함으로써, 발모, 양모 효과를 촉진하고, 탈모를 방지하는 조성물을 제공하는 것을 목적으로 한다.
상기와 같은 해결과제를 해결하기 위한 본 발명에 따른 에토좀 조성물은, 비타민과 덱스판테놀이 봉입된 에토좀을 포함하는 에토좀 조성물로서,
상기 에토좀은 에탄올, 펩티드, 포스파티틸콜린(Phosphatidyl choline), 아미노산 화합물을 포함한다.
상세하게는, 상기 펩티드는 pal-GHK, Pal-GQPR, Pal-KTTK, Pal-KTTKS, Biotin-GHK, PAL-KVK (Palmiotyl Tripeptide-5), Palmitoyl tripeptide-38, Palmitoyl-Tripeptide(Pal-RFK), Human Oligopeptide-20(Val-Gly-Val-Ala-Pro-Gly), GHK-Cu, (AHK)2Cu, AHK-Cu, Myristic acid-KLAKK-CONH2, Hexapeptide-11, Octapeptide-2, Palmitoyl-hexapeptide, Acetyl tetrapeptide-15, Acetyl Hexapeptide 3, Acetyl Tetrapeptide-2, Acetyl Tetrapeptide-5, Acetyl-Decapeptide-3, Ac-KGHK, rh-Oligopeptide-1(humanEGF) (NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVG YIGERCQYRDLKWWELR), Snake tripeptide(beta-Ala-Pro-Dab-NHBzl), peptide CK+(Ac-Arg-Lys-Arg-NH2), peptide CK(Arg-Lys-Arg), tripeptide-3(Ala-His-Lys.HCl), Ac-KGHK-NH2, Ac-Tyr-Arg-hexadecylester, Argireline로 이루어진 군에서 선택된 하나 이상인 것일 수 있다.
본 발명에 있어서, 상기 비타민은 비타민 E, 비타민 C, 비타민 B, 이들의 염 및 이들의 유사체로 이루어진 군에서 선택된 하나 이상인 것일 수 있다.
본 발명에 있어서, 상기 아미노산 화합물을 아미노산 및 아미노산 유사체로 이루어진 군에서 선택된 하나 이상의 것일 수 있고, 상기 아미노산 및 아미노산 유사체는 NAC(N-Acetyl Cysteine), 아르기닌(Arginin), 로라이신, 라이신 에틸에스터, 히스티딘 및 히스티딘 에틸에스터로 이루어진 군에서 선택된 하나 이상인 것일 수 있다.
본 발명에 있어서, 상기 에토좀 조성물은 비타민 20 내지 70 mg/100ml, 덱스판테놀 150 내지 250 mg/100ml, 에탄올 5 내지 15 ml/100ml, 펩티드 0.1 내지 10 mg/100ml, 포스파티틸콜린 10 내지 1000 mg/100ml, 아미노산 화합물 10 내지 1000 mg/100ml를 포함하는 것하는 것일 수 있다.
본 발명에 있어서, 상기 에토좀은 평균입경이 90 내지 200 nm인 것일 수 있다.
본 발명에 있어서, 상기 에토좀은 표면전하값의 절대값이 10 내지 100 mV인 것일 수 있다.
본 발명은 또한, 상술한 에토좀 조성물의 제조방법으로서,
(a) 정제수에 아미노산 화합물을 가용화하는 단계;
(b) 정제수에 덱스판테놀을 가용화하는 단계;
(c) 에탄올, 비타민, 포스파티딜콜린, 페녹시에탄올을 가용화하는 단계;
(d) 상기 (a) 단계의 용액에 상기 (b) 단계의 용액을 첨가한 후, 혼합하는 단계;
(e) 상기 (d) 단계의 용액에 상기 (c) 단계의 용액을 첨가한 후, 혼합하는 단계;
(f) 상기 (e) 단계의 용액에 pH 조절제를 첨가한 후, 혼합하는 단계; 를 포함하는 에토좀 조성물의 제조방법을 제공한다.
상기 (c) 단계는 계면활성제, 기타 양모 유효성분으로 이루어진 군에서 선택된 하나 이상을 더 포함하는 것일 수 있다.
상기 pH 조절제는 시트르산 및 이의 염으로 이루어진 군에서 선택된 하나 이상을 포함하는 것일 수 있다.
상기 (a) 단계는 정제수 50 내지 70L에 아미노산 화합물을 80 내지 120g 첨가하는 것일 수 있다.
상기 (b) 단계는 정제수 25 내지 35L에 덱스판테놀 100 내지 300 g을 첨가하는 것일 수 있다.
본 발명은 또한, 본 발명에 따른 에토좀 조성물을 포함하는 발모 및/또는 양모 촉진용 조성물을 제공한다.
본 발명은 또한, 본 발명에 따른 에토좀 조성물을 포함하는 휴지기성 탈모 방지용 조성물을 제공한다.
더욱 상세하게는, 상기 휴지기성 탈모 방지용 조성물은 두피 항노화 및/또는 콜라겐 생성 촉진을 통해 휴지기성 탈모를 방지하는 것일 수 있다.
본 발명은 또한, 에토좀 조성물이 올레아놀산(Oleanolic acid) 및/또는 아피제닌(Apigenin)을 더 포함하는 남성용 조성물인 것을 특징으로 하는 발모 및/또는 양모 촉진용 조성물을 제공한다.
또한, 상기 에토좀 조성물이 올레아놀산(Oleanolic acid) 및/또는 아피제닌(Apigenin)을 더 포함하는 남성용 조성물인 것을 특징으로 하는 휴지기성 탈모 방지용 조성물을 제공한다.
본 발명에 따르면, 피부 보호막을 투과하여 난용성 유효성분을 효율적으로 전달할 수 있다.
본 발명에 따르면 피부 항노화, 항산화, 콜라겐 촉진 등의 효과를 가지는 피부 노화 방지 유효성분이 두피에 효율적으로 전달되도록 함으로써, 발모, 양모 효과를 촉진하고, 탈모를 방지하는 효과를 가진다.
본 발명에 따르면 에토좀 모폴로지를 이용하여 발모 유효성분 이외에도 다양한 조성물의 효율적인 전달이 가능하게 함으로써 발모효과 증대가 가능한 효과를 가진다.
도 1은 헤어사이클을 나타낸 모식도이다;
도 2 내지 5는 실시예 1, 5, 10 및 14의 에토좀 크기 및 표면전하값을 측정한 결과이다;
도 6은 Dexpantenol의 피부 침투율을 확인 시험 결과를 나타낸 그래프이다;
도 7은 Vitamin E acetae의 피부 침투율을 확인 실험 결과를 나타낸 그래프이다;
도 8은 피부조직 두께 측정 결과를 나타낸 그래프이다;
도 9는실험예 4-1의 시험 물질 도포 후 모발을 H&E 염색한 실험군의 피부조직 사진이다;
도 10은 실험예 4-1의 실험 기간 동안 모발의 시험물질 도포 후 모발의 재성장 상태를 기록한 사진이다;
도 11은 실험예 4-2의 H&E 염색 후 피부 조직을 촬영한 사진이다;
도 12는 실험예 4-2의 실험 기간 동안 모발의 재성장 상태를 기록한 사진이다;
도13은 성장기 지속/휴지기 억제 효과 시험에서의 피부조직 두께를 나타낸 그래프이다;
도 14는 성장기 지속/휴지기 억제 효과 시험에서의 성장기 모낭비율을 나타낸 그래프이다;
도 15은 성장기 지속/휴지기 억제 효과 시험에서의 시험 시작 후 19일차에 각 그룹 간의 차이를 기록한 사진이다;
도 16는 성장기 지속/휴지기 억제 효과 실험의 성장기 유지 상태를 점수화한 그래프이다.
이하, 본 발명이 속하는 기술 분야에서 통상의 지식을 가진 자가 용이하게 실시할 수 있도록 본 발명의 각 구성을 보다 상세히 설명하나, 이는 하나의 예시에 불과할 뿐, 본 발명의 권리범위가 다음 내용에 의해 제한되지 아니한다.
본 발명에 따른 에토좀 조성물은 비타민과 덱스판테놀과 같은 난용성 물질을 피부에 투과시켜 효율적으로 전달하는 효과를 가진다.
친수성 물질은 물과 같은 용매에는 잘 용해되지만, 피부는 소수성의 보호막으로 구성되어 있어 친수성의 유효성분은 피부 내로 전달되기 어려운 문제점을 가지고, 소수성 물질의 경우, 물과 같은 친수성 용매 내에서는 응집체를 형성하여 용해되지 않아 용매를 이용한 전달 효율이 떨어지는 문제가 있다.
에토좀이란 분자의 피부 및 경피 전달에 사용되는 인지질 나노 소포로서, 발명은 이를 이용하여, 포스파티딜콜린이라는 인지질을 이용하여, 에토좀과 같은 베지클을 형성하고 베지클 내에 유효성분을 봉입한 상태로 피부 보호막으로 이동하여, 유효성분을 피부 보호막 내로 투과시켜 유효성분을 효율적으로 전달할 수 있도록 구성된다.
본 발명은 특히, 발모, 양모에 효능이 있는 것으로 알려진 성분이 아닌, 피부 항노화, 항산화 및 콜라겐 촉진 등에 효과를 가지는 피부 노화 개선용 유효성분을 이용하여, 이를 두피에 효과적으로 전달함으로써, 두피의 항노화, 항산화 효과를 유발함으로써, 발모, 양모를 촉진하며, 탈모를 방지하는 효과를 가진다.
상기 비타민은 비타민 E, 비타민 C, 비타민 B, 이들의 염 및 이들의 유사체로 이루어진 군에서 선택된 하나 이상인 것을 사용할 수 있다. 비타민으로서 기능하는 것이면 그 형태와 무관하게 어떠한 것이든 사용할 수 있으며, 예를 들면, 비타민 E 아세테이트, 지용성 비타민 C 등과 같은 다양한 형태를 사용할 수 있다.
본 발명에 있어서, 상기 에토좀은 에탄올, 펩티드, 포스파티딜콜린, 아미노산 화합물을 포함함으로써, 에토좀 쉘(Shell)의 유연성을 향상시킴으로써, 피부 침투율을 높이고, 이로 인해, 유효성분의 효율적인 전달이 가능한 효과를 가진다.
구체적으로, 상기 펩티드는 pal-GHK, Pal-GQPR, Pal-KTTK, Pal-KTTKS, Biotin-GHK, PAL-KVK (Palmiotyl Tripeptide-5), Palmitoyl tripeptide-38, Palmitoyl-Tripeptide(Pal-RFK), Human Oligopeptide-20(Val-Gly-Val-Ala-Pro-Gly), GHK-Cu, (AHK)2Cu, AHK-Cu, Myristic acid-KLAKK-CONH2, Hexapeptide-11, Octapeptide-2, Palmitoyl-hexapeptide, Acetyl tetrapeptide-15, Acetyl Hexapeptide 3, Acetyl Tetrapeptide-2, Acetyl Tetrapeptide-5, Acetyl-Decapeptide-3, Ac-KGHK, rh-Oligopeptide-1(humanEGF) (NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVG YIGERCQYRDLKWWELR), Snake tripeptide(beta-Ala-Pro-Dab-NHBzl), peptide CK+(Ac-Arg-Lys-Arg-NH2), peptide CK(Arg-Lys-Arg), tripeptide-3(Ala-His-Lys.HCl), Ac-KGHK-NH2, Ac-Tyr-Arg-hexadecylester, Argireline로 이루어진 군에서 선택된 하나 이상의 것을 사용할 수 있다. 상기 펩티드는 피부 항산화 등에 효능을 가지는 것으로는 알려져 있기는 하나, 발모, 양모 효과 등에는 효과가 있는 것으로 알려진 성분은 아니나, 본 발명에서는, 해당 성분을 두피 내로 충분히 효율적으로 전달함으로써, 두피의 항산화/항노화 효과를 극대화시켜 모발의 성장 주기를 조절하여 휴지기를 짧게 하고, 성장기를 지속시킴으로써, 발모, 양모 효과를 유발한다. 상기 펩티드는 바람직하게는, pal-GHK일 수 있다.
상기 포스파티딜 콜린은 레시틴의 하나로서, 레시틴은 인산, 콜린, 지방산, 글리세롤, 당지질, 트리글리세라이드, 인지질로 구성된 동식물 조직에서 발생하는 지방 물질군을 지칭하는 것이다.
이 중에서 포스파티딜 콜린은 헤드 라인으로서 콜린을 포함하는 인지질 클래스로서, 이는 피부 보호막과 같은 인지질로 이루어짐에 따라, 유효성분의 전달 시 피부막을 투과하기 용이한 장점을 가진다.
상기 아미노산 화합물은 아미노산 및 아미노산 유사체로 이루어진 군에서 선택된 하나 이상의 것일 수 있고, 상기 아미노산 및 아미노산 유사체는 구체적으로, NAC(N-Acetyl Cysteine), 아르기닌(Arginin) 및 라이신, 라이신 에틸에스터, 히스티딘, 히스티딘 에틸에스터로 이루어진 군에서 선택된 하나 이상인 것을 포함할 수 있다.
본 발명에 있어서, 상기 에토좀 조성물은 비타민 20 내지 70 mg/100ml, 덱스판테놀 150 내지 250 mg/100ml, 에탄올 5 내지 15 ml/100ml, 펩티드 0.1 내지 10 mg/100ml, 포스파티틸콜린 10 내지 1000 mg/100ml, 아미노산 화합물 10 내지 1000 mg/100ml를 포함하는 것일 수 있다.
상기 비타민은 바람직하게는, 30 내지 60 mg/100ml으로 포함될 수 있고, 상기 함량보다 과량으로 첨가되는 경우, 장기 보관시 비타민이 석출되는 문제가 있고, 상기 함량보다 소량으로 첨가되는 경우에는, 높은 피부 침투율에도 불구하고 충분한 효과를 나타내기 어렵다는 문제가 있다.
상기 덱스판테놀은 바람직하게는, 120 내지 220 mg/100ml로 포함될 수 있는데, 상기 함량보다 과량으로 첨가되는 경우에는, 가용화가 어렵고 안정성이 떨어지는 문제가 있고, 상기 함량보다 소량으로 첨가되는 경우에는, 유효성분이 발휘하는 효과가 미미한 문제가 있다.
상기 에탄올은 바람직하게는, 7 내지 12 mg/100ml로 포함될 수 있는데, 상기 함량보다 과량으로 첨가되는 경우에는, 에토좀을 형성하지 못하고 용해가 된 상태가 되는 문제점이 있고, 상기 함량보다 소량으로 첨가되는 경우에는, 에토좀이 형성되지 않아 난용성 물질의 제형의 안정성이 떨어지는 문제가 있다.
한편, 상기 펩티드는 바람직하게는, 0.1 내지 10 mg/100ml로 포함될 수 있는데, 상기 함량보다 과량으로 첨가되는 경우에는, 제조/생산 단가가 증가하는 문제가 있고, 상기 함량보다 소량으로 첨가되는 경우에는, 높은 피부 침투율에도 불구하고 충분한 효과를 나타내기 어렵다는 문제가 있다.
상기 포스파티딜콜린은 바람직하게는, 10 내지 1000 mg/100ml로 포함될 수 있는데, 상기 함량보다 과량으로 첨가되는 경우에는, 에토좀 형성에 참여하지 않는 과량의 물질이 잔류하여 탁도에 심각한 문제가 있고, 상기 함량보다 소량으로 첨가되는 경우에는, 유효물질을 에토좀화 시키는데 문제가 있다.
상기 아미노산 화합물의 경우, 10 내지 1000 mg/100ml로 포함될 수 있는데, 상기 함량보다 과량으로 첨가되는 경우에는, pH에 상승하거나 낮아지는 문제가 있고, 상기 함량보다 소량으로 첨가되는 경우에는, 이후 pH 조절제를 과량으로 첨가해야 하는 문제가 있다.
상기와 같은 함량을 만족하도록 첨가됨으로써, 에토좀 조성물의 유효성분 전달 효과가 특히 우수한 효과를 가지며, 특히, 본 발명에 있어서는, 두비에의 효과적인 전달을 통해 모발의 성장 주기를 조절하여 휴지기를 짧게 하고, 성장기를 지속시킴으로써 발모, 양모 효과를 가지는 것을 특징으로 한다.
본 발명에 있어서, 상기 에토좀 조성물에 포함되는 상기 에토좀은 평균 입경이 90 내지 200 nm인 것일 수 있다. 바람직하게는, 100 내지 150 nm인 평균 입경을 가짐으로써, 입자들의 크기가 균일한 효과를 가지며, 안정적인 에토좀 조성물을 유지함에 따라 유효성분 전달에 더욱 유리한 효과를 가진다.
상기 에토좀은 또한, 표면 전하값의 절대값이 10 내지 100 mV인 것일 수 있다. 상기 범위를 가질 때, 에토좀이 서로 뭉치지 않고 균일하게 용액 내에 분산될 수 있다.
본 발명에 따른 에토좀 조성물의 제조방법은, (a) 정제수에 아미노산 화합물을 가용화하는 단계;
(b) 정제수에 덱스판테놀을 가용화하는 단계;
(c) 에탄올, 비타민, 포스파티딜콜린, 페녹시에탄올을 가용화하는 단계; (d) 상기 (a) 단계의 용액에 상기 (b) 단계의 용액을 첨가한 후, 혼합하는 단계; (e) 상기 (d) 단계의 용액에 상기 (c) 단계의 용액을 첨가한 후, 혼합하는 단계; (f) 상기 (e) 단계의 용액에 pH 조절제를 첨가한 후, 혼합하는 단계; 를 포함한다.
구체적으로, 상기 (c) 단계는 계면활성제, 기타 양모 유효성분으로 이루어진 군에서 선택된 하나 이상을 더 포함할 수 있다. 상기 계면활성제는 예를 들어, Poloxamer 188, Poloxamer 407, Poloxamer F-127, PEG 60(hydrogenated cateroil), Polysorbate 80, tween 20, tween 60, tween 80 등의 계면활성제를 사용할 수 있다.
상기 기타 양모 유효성분으로는, 어떠한 것이든 특별히 제한되지 않고 사용이 가능하며, 예를 들면, 멜라토닌, 청포 추출물 등과 같은 천연추출물과 화합물 등의 종류를 가리지 않고 필요에 따라 적절히 첨가할 수 있다.
상기 pH 조절제는 시트르산 및 이의 염으로 이루어진 군에서 선택된 하나 이상을 포함하는 것일 수 있다.
상기 (a) 단계는 정제수 50 내지 70L에 아미노산 화합물을 80 내지 120g 첨가하는 것일 수 있다. 바람직하게는, 55 내지 65L의 정제수에 90 내지 110g의 아미노산 화합물을 첨가하는 것일 수 있다.
상기 함량보다 과량으로 첨가되면, 정제수에 충분히 용해되지 못하고, 석출되는 문제가 있고, 상기 함량보다 소량으로 첨가되면, 과량의 pH 조절제를 사용해야 하는 문제가 있다.
한편, 상기 (b) 단계는 정제수 25 내지 35L에 덱스판테놀 100 내지 300 g을 첨가하는 것일 수 있고, 바람직하게는, 27 내지 32 L의 정제수에 덱스판테놀 150 내지 250g을 첨가하는 것일 수 있다.
이 경우, 상기 함량보다 과량으로 첨가되면, 정제수에 충분히 용해되지 못하거나 가용화 시간이 길어지며, 석출되는 문제가 있고, 상기 함량보다 소량으로 첨가되면, 상기 에토좀 조성물을 도포하더라도 효과가 미미한 문제가 있다.
본 발명에 따른 상기 에토좀 조성물은 발모 및/또는 양모 촉진용 조성물로 사용될 수 있는데, 상술한 바와 같이 피부 노화 개선, 노화 방지 효능을 가지는 유효성분을 상기 에토좀 조성물을 이용하여 두피에 효과적으로 투과 시킴으로써, 두피의 노화 개선 효과를 유발하여 휴지기성 탈모를 방지하고, 성장기를 지속 시킴으로써 발모 및/또는 양모 효과를 유발한다.
마찬가지로, 본 발명에 따른 에토좀 조성물을 이용하여, 휴지기성 탈모를 방지할 수 있는 휴지기성 탈모 방지용 조성물을 제공한다.
본 발명에 따른 상기 조성물을 발모, 양모를 유도하거나, 탈모를 개선하거나 방지하는데 사용할 수 있다.
한편, 본 발명은 특히, 사용자의 성별에 따라 최적화된 발모 및/또는 양모 촉진용 조성물과 휴지기성 탈모 방지용 조성물을 제공할 수 있다.
상술한 에토좀 조성물은 여성과 남성의 구별없이 사용될 수 있으나, 남성에게는 추가적으로, 올레아놀산 및/또는 아피제닌을 더 포함하도록 구성함으로써, 남성 사용자에 특히 적합한 조성물을 제공할 수 있다.
상기 올레아놀산은 트리테르페노이드 사포닌으로서, 펜타사이클릭 트리테르페노이드이다. 이를 사용함으로써, 남성에게 특히 적합한 조성물을 제공할 수 있다.
이하, 본 발명이 속하는 기술 분야에서 통상의 지식을 가진 자가 용이하게 실시할 수 있도록 본 발명의 실시예에 대하여 상세히 설명하나, 이는 하나의 예시에 불과할 뿐, 본 발명의 권리범위가 다음 내용에 의해 제한되지 아니한다.
[제조예]
표 1 내지 3의 성분표를 참고하여 다음과 같은 순서로 실시예와 비교예를 제조하였다.
1. 정제수에 아르기닌(Arginin)을 투입/가용화
2. 정제수, NAC, 판테놀 교반/가용화
3. 상기 1의 혼합물에 상기 2의 혼합물을 첨가한 후 혼합
4. 에탄올, 비타민 E 아세테이트, 폴록사머 F-127, 포스파티딜콜린, 페녹시에탄올, 올레아놀산, 아피제닌 교반/가용화
5. 상기 3의 혼합물에 상기 4의 혼합물을 첨가한 후 혼합
6. 정제수, 시트르산, 소듐시트르산염 교반/가용화(pH=7.0)
7. 상기 5의 혼합물에 상기 6의 혼합물을 첨가한 후 혼합
[규칙 제91조에 의한 정정 04.06.2020]　
Figure WO-DOC-TABLE-1
[규칙 제91조에 의한 정정 04.06.2020]　
Figure WO-DOC-TABLE-2
[규칙 제91조에 의한 정정 04.06.2020]　
Figure WO-DOC-TABLE-3
[실험예 1: 에토좀(Ethosome) 크기 및 표면전하 측정]
1) 장비: Marlvern Nano ZS
2) 실험방법: 시험물질을 증류수를 이용하여 0.2% 용액으로 희석한 후 측정하였으며, Disposable cell을 이용하여 측정하였다.
실시예 1, 5, 10 및 14에 대해 에토좀 크기와 표면전하를 측정한 결과를 도 2 내지 5에 나타냈다.
에토좀(Ethosome)의 경우 난용성 물질 및 현탁화제로 인해 100 nm 대의 입도 분포를 갖기 어려운 경우들도 있으나 본 발명의 실시예는 1, 5, 10, 14의 경우 아래 도면과 같이 균일한 입도 분포와 상대적으로 높은 표면 전하를 띄고 있음을 확인할 수 있다.
표면전하값의 경우 절대값이 20 mV 이상일 경우 용액 내 안정성을 유지할 수 있는 것으로 알려져 있다. 실험 결과 -40 ~ -20 mV의 값을 갖는 것을 확인하였는 바, 이로부터 제형의 장기안정성(long term stability)이 우수함을 확인하였다.
[실험예 2: 안정성 시험]
1) 실험 방법
- 실험예 1과 같은 실험 방법으로 입도 및 표면전하의 변화를 0일, 1일, 1주, 4주, 8주, 12주, 그리고 24주를 실험을 진행하였다.
- 각 시료는 37도씨 습도 70% 조건에서 보관하고, 미리 예정된 시간에 시료를 채취하여 희석하여 측정하였다.
ZnO가 첨가되지 않은 실시예 중 1~5와 10~14에 대한 안정성 측정 결과를 아래 표 4에 나타냈다. 제조 공정에 따라 제조된 실시예의 입도 분포는 Z-average size를 기준으로 약 100 nm ~ 160 nm의 입도 분포가 매우 고른 제형이 완성되었으며, Zeta potential의 경우 실시예 3, 실시예 14가 가장 낮은 전하값을 갖는 결과가 나왔으며, 이는 제형의 장기 보관 안정성이 뛰어남을 시사한다. 실시예 1과 10의 경우 시간이 지날수록 입도 분포의 변화는 없으나, 표면전하 값이 증가함을 확인할 수 있었으며, 이는 초기보다는 1~2일 이상 지나고 나서 에토좀의 안정성이 증가하게 됨을 뜻한다.
[규칙 제91조에 의한 정정 04.06.2020]　
Figure WO-DOC-TABLE-4
[실험예 3: 피부 투과 시험]
1) 장비: Biotek사의 Epoch 2
2) 분석 파장: 260 nm
3) Test kit: Pion사의 skin pmapa test kit 사용.
4) 실험 방법: 32℃ incubator를 이용하여 donor 쪽에 시료를 주입(pH=5.4)하고, aceeptor(pH=7.4) 쪽으로 침투된 시료의 량을 microplate reader를 이용하여 측정하였다.
5) 실험 시간: 실험 시간은 6hr을 기준으로 6시간 동안 acceptor쪽으로 이동한 target 물질의 량을 microplate를 이용하여 측정하거나 HPLC를 이용하여 측정하였다. 아래 수식을 이용하여 계산하였다.
6) 계산: 침투율을 아래 수식을 이용하여 계산하였으며, 대표 예시로 ascorbic acid를 이용한 계산법을 넣었다.
Penetration (%) = [(Ascorbic acid amount in acceptor)/(Ascorbic acid amount in donor)] * 100
7) 실험군의 구성: 측정하고자 하는 물질을 Pion 사에서 제공한 buffer solution에 첨가한 실험군을 대조군으로 선정하고, 실험군은 실시예에 해당하는 제형을 사용하여 비교 분석하였다.
상기의 시험법을 이용한 측정한 실험 결과를 도 6 및 7에 나타냈다. 결과는 대조군의 침투율을 100%로 산정하고, 이에 대한 상대적인 침투율을 나타냈다. 도 6은 친수성 물질인 dexpantenol에 대한 피부 침투율을 확인한 실험 결과이며, 수용성 물질임에도 불구하고 ethosomal formulation을 이용하는 경우 에토좀의 높은 penetration rate에 의해 침투율이 올라감을 확인할 수 있었다.
[실험예 4-1: 양모 효과 시험]
1) 시험군 구성
[규칙 제91조에 의한 정정 04.06.2020]　
Figure WO-DOC-TABLE-5
2) 제모: 시험물질의 발모 효능을 평가하기 위해, 등쪽 피부의 색이 pink color를 보이는 42일령의 수컷 C57bl/6 마우스를 사용하였다. Animal clipper(Panasonic ER1431p, Japan)를 이용하여 조심스럽게 등쪽 털을 제거하고 1일간의 안정화 기간을 두었다. 이후 28일 동안 파이펫을 사용하여 200μL/head의 시험물질을 제모 부위에 도포하였다. 양성 대조군으로는 2% 미녹시딜 (ROGAINE SOLUTION 2%)을 동량 도포하였다.
3) 시험방법
3.1) 사진 촬영 및 모발성장주기 변화 관찰
시험물질 도포 시작 후 매일 육안관찰을 실시하여 각 개체별로 피부색 변화(연한 분홍색에서 파란색을)로 대표되는 성장기 도입시기와 모발이 관찰되기 시작하는 모발개시기를 산출하였으며 주기적인 사진 촬영을 실시하였다. 각 군의 모발성장 정도는 scoring system에 의해 각 동물별로 육안적으로 판정하였으며 발모 정도에 따라 0%는 0점, 1~25%는 1점, 26~50%는 2점, 51~75%는 3점, 76~100%는 4점으로 구분하였다.
3.2) 조직학적 검사
조직학적 관찰을 위해 피부조직을 적출하여 filter paper에 부착한 상태로 10% 중성포르말린에 48시간 이상 고정하였다. 고정이 완료된 조직은 머리에서 꼬리 방향으로, 두께 5 ~ 10 mm 두께로 삭정한 후 alcohol, xylene, paraffin의 일반적인 조직처리 과정을 거쳤다. 파리핀으로 포매한 후 회전식박절기를 사용하여 4 μm의 박절편을 만들어 hematoxylin and eosin(H&E) 염색을 실시하였다. 광학현미경으로 관찰하면서 피부조직의 두께(dermis + epidermis)를 측정하였으며 각 동물 당 100개의 모낭 중 성장기 모낭과 휴지기 모낭의 비율을 산출하였다.
4) 결과
4.1) 사진 촬영 및 모발성장주기 변화 관찰
[규칙 제91조에 의한 정정 04.06.2020]　
Figure WO-DOC-TABLE-6
본 실험에서 사용된 C57BL/6 마우스는 멜라닌 생성주기와 모낭의 성장기 도입시기가 일치하기 때문에 육안으로 피부색 변화를 관찰하는 것 만으로도 모낭의 성장기 도입 여부를 판단할 수 있다는 장점을 가지고 있다. 따라서 본 실험에서는 시험물질의 발모 촉진효과를 확인하기 위하여 시험물질 도포를 시작한 직후부터 매일 피부색 변화와 모발이 최초로 관찰되기 시작하는 시점을 측정하였다.
도 9는 실험예 4-1의 시험 물질 도포 후 모발을 H&E 염색한 실험군의 피부조직 사진이고, 도 10은 실험예 4-1의 실험 기간 동안 모발의 시험물질 도포 후 모발의 재성장 상태를 기록한 사진이다.
C57BL/6 마우스의 피부는 성장기 5기(anagen 5)에 진입하면서 회색 빛에서 검은색으로 바뀌기 시작하며 이어 모발의 재성장이 나타나는 것으로 알려져 있다. 본 실험에서는 양성대조군인 Rogaine군 (24.00 ± 7.38)과 비교하여 5군, 7군, 11군, 12군에서 빠른 성장기 이행 속도를 나타냈다. 특히 6군과 7 군에서는 비교하여 평균 7.62일, 4.87일 빠른 성장기 이행 속도를 나타내어 가장 뚜렷한 발모 촉진효과를 나타냈다. 모발의 재성장 시기 관찰 결과에서는 Rogaine군 (26.00 ± 7.37)과 비교하여 6군, 11군에서 평균 8.12일, 4.12일 빠른 효과를 나타냈다.
이러한 결과는 성장기 도입 동물 수를 백분율로 변환하여 표기한 결과에서도 유사한 경향을 나타냄을 확인할 수 있었다. 6군 (100%), 11군 (75%), 12군(75%)군에서 Rogaine군 (60%) 보다 높은 비율의 성장기 도입 동물이 관찰되었다.
4.2) 모발 재성장 면적 비교
모발 재성장 면적을 비교하기 위하여 매일 육안으로 관찰하면서 재성장 면적을 점수화 하여 시험군 간의 차이를 비교하였다. 그 결과 6군 (3.00 + 0.46점)과 12군 (2.13 + 0.61점)에서 Rogaine (1.80 + 0.92점)군보다 높은 점수를 보였다. 또한 7 (1.63+ 0.56)군과 11 (1.75 + 0.31)군에서 Rogaine군과 비슷한 점수를 보였다.
4.3) 조직학적 검사
모낭의 성장주기에 따라 피부조직에는 많은 변화가 나타나게 되는데 성장기가 되면 피부색이 검은색으로 바뀌며 피부색의 변화 외에도 두께의 변화를 동반한다. 모낭이 성장기가 되면 특히 subcutis층의 두께가 증가하며 epidermis층의 두께 또한 증가하게 된다. 따라서 시험물질의 발모 촉진 효과를 확인하기 위하여 조직학적 변화를 관찰하였다. 시험물질 도포 28일차에 피부조직을 채취하여 H&E염색을 실시한 후 성장기 모낭의 비율, 피부조직의 두께 변화를 측정하였다. 모낭의 성장기 비율은 각 동물별로 총 100개의 모낭을 확인한 후 비율을 산출하였다.
그 결과 negative군에서는 4.9 ± 3.3%의 성장기 모낭이 관찰된 반면 Rogaine군에서는 45.5 ± 21.6%로 성장기 모낭 비율의 뚜렷한 증가를 확인할 수 있었다. 시험물질군에서는 6군 (61.4 + 14.1%)과 11군 (48.9 + 13.1%)에서 Rogaine 군보다 높은 성장기 모낭 비율이 확인되었다.
피부조직의 두께 측정 결과를 도 9에 나타냈다. negative군에서는 264.8 ± 17.3 μm인 반면 Rogaine군에서는 476.4 ± 95.3 μm로 뚜렷한 피부두께 증가를 확인할 수 있었다. 시험물질군에서는 6군 (569.9 ± 54.5 μm) Rogaine 군보다 높은 피부 두께가 확인되었다.
[실험예 4-2: 양모 효과 시험]
[규칙 제91조에 의한 정정 04.06.2020]　
Figure WO-DOC-TABLE-7
1) 실험방법
1.1) 사진 촬영 및 모발성장주기 변화 관찰
시험물질 도포 시작 후 매일 육안관찰을 실시하여 각 군별로 피부색 변화(연한 분홍색에서 파란색을)로 대표되는 성장기 도입기와 모발이 관찰되기 시작하는 모발개시기를 산출하였으며 주기적인 사진 촬영을 실시하였다. 또한 각 군의 모발성장 정도는 scoring system에 의해 각 동물별로 육안적으로 판정하였으며 발모 정도에 따라 0%는 0점, 1~25%는 1점, 26~50%는 2점, 51~75%는 3점, 76~100%는 4점으로 구분하였다.
1.2) 피부 조직의 조직학적 검사
조직학적 관찰을 위해 피부조직을 적출한 후 10% 중성포르말린에 고정한 다음 24시간 후 흐르는 물에 수세하고 alcohol, xylene, paraffin으로 탈수, 투명, 침투과정을 거쳐 파라핀에 포매하였다. 포매된 조직을 4 μm의 박절편을 만들어 hematoxylin and eosin(H&E) 염색한 후 광학현미경으로 관찰하였다.
1.3) 성장기 지속기간 측정
시험물질의 성장기 지속기간을 측정하였다. 측정방법은 피부색이 분홍색에서 회색 또는 검정색 등 색소침착이 나타나는 시기를 성장기 도입시기로 하고 이후 모발성장이 일어난 후 매일 1회 피부색 변화를 관찰하여 최초 피부색 변화부위가 다시 분홍색으로 변화하는 시기를 성장기 종료시기로 하여 그 차이(day)를 비교하였다.
모발 재성장 면적을 비교하기 위하여 매일 육안으로 관찰하면서 재성장 면적을 점수화 하여 시험군 간의 차이를 비교하였다. 그 결과 모든 시험물질 도포군에서 음성대조군과 비교하여 높은 점수를 보였다.
도 11은 실험예 4-2의 H&E 염색 후 피부 조직을 촬영한 사진이고, 도 12는 실험예 4-2의 실험 기간 동안 모발의 재성장 상태를 기록한 사진이다.
실험예 4-1과의 비교를 위해 실시예 1을 실험군 3군에 배치하여 실험을 진행하였다. 그 결과, 4, 5, 8 그리고 12군에서 특히 높은 점수를 보였다. 빠른 성장기 이행 속도를 보인 8군, 12군에서는 각각 24일, 21일째부터 모발이 관찰되기 시작하였으며 양성대조물질인 현대약품 마이녹실을 도포한 시험군에서는 23일째부터 모발이 관찰되기 시작하였다. 이후 도포 32일째까지 진행된 평가결과4군은 평균 3.1 ± 0.7점, 12군은 2.5 ± 0.7점 이상으로 현대약품 마이녹실 2.8 ± 1.3점 보다 높은 점수를 나타냈다.
이와 같은 결과를 보다 객관적으로 제시하기 위하여 시험물질 도포 후 일정한 간격으로 모발의 재성장 상태를 사진으로 기록하였으며, 사진촬영 결과를 도 10에 나타냈다. 에서는 4군에서 편차 없이 균일하게 모발이 관찰되어 양성대조군인 마이녹실군 보다 12군(실시예 18번)군의 시험물질을 도포한 군에서 균일하고 넓은 면적에서 모발이 관찰됨을 확인할 수 있었다.
[규칙 제91조에 의한 정정 04.06.2020]　
Figure WO-DOC-TABLE-8
[실험예 5: 성장기 지속/휴지기 억제 효과 시험]
1) 시험군 구성
[규칙 제91조에 의한 정정 04.06.2020]　
Figure WO-DOC-TABLE-9
2) 시험방법
피부 색이 pink color를 보이는 42일령의 수컷 C57BL/6 mouse의 등 부위를 Animal clipper(Panasonic ER1431p, Japan)를 이용하여 조심스럽게 C57BL/6 mouse 등의 털을 제거한 후 제모크림을 도포하여 잔털을 모두 제거하였다. 제모 후 5일이 경과되며 피부색이 연한 검정색(성장기 도입)으로 변하기 시작하는 시점부터 dexamethasone을 격일로 5회 도포하여 인위적인 퇴행기를 유도하였다. 시험군은 시험 물질과 dexamethasone을 제모 후 4일째부터 같이 도포하여 인위적인 퇴행기 유도 억제/성장기 지속 효과를 확인하였다.
3) 평가항목
3.1) 사진 촬영 및 모발성장주기 변화 관찰
성장기 이행 촉진 효과를 판단하기 위하여 시험물질 도포 시작 후 매일 육안관찰을 실시하여 각 군별로 피부색 변화(연한 분홍색에서 파란색을)로 대표되는 성장기를 산출하였으며 주기적인 사진 촬영을 실시하였다. 또한 퇴행기억제 효과 확인을 위하여 특정시점에서 사진촬영을 실시하여 피부색 변화 상태를 관찰하였다.
3.2) 피부 조직의 조직학적 검사
조직학적 관찰을 위해 피부조직을 적출한 후 10% 중성포르말린에 고정한 다음 24시간 후 흐르는 물에 수세하고 alcohol, xylene, paraffin으로 탈수, 투명, 침투과정을 거쳐 파라핀에 포매하였다. 포매된 조직을 4 μm의 박절편을 만들어 hematoxylin and eosin(H&E) 염색한 후 광학현미경으로 관찰하면서 성장기 모낭과 휴지기 모낭의 비율 및 피부조직의 두께 변화를 측정하였다.
본 실험의 목적은 실시예의 성장기 지속/휴지기 억제 효과에 대한 효과를 확인하기 위해서 진행된 실험이다.
도 13은 성장기 지속/휴지기 억제 효과 시험에서의 피부조직 두께를 나타낸 그래프이고, 도 14는 성장기 지속/휴지기 억제 효과 시험에서의 성장기 모낭비율을 나타낸 그래프이다.
도 15은 성장기 지속/휴지기 억제 효과 시험에서의 시험 시작 후 19일차에 각 그룹 간의 차이를 기록한 사진이고, 도 16는 성장기 지속/휴지기 억제 효과 실험의 성장기 유지 상태를 점수화한 그래프이다.
이를 확인하기 위해서 steroid 계열의 약물인 Dexamethasone을 도포하여 빠른 휴지기 도입을 유도하는 동물 모델을 이용하였다. 모발 재성장 면적을 비교하기 위하여 매일 육안으로 관찰하면서 재성장 면적을 점수화 하여 시험군 간의 차이를 비교하여 그 결과를 도 15에 나타냈다. 그 결과 시험물질 도포군에서 약물 처리한 군에 비해 빠른 양모 효과를 나타냄을 확인하였다. 특히 성장기 모낭의 비율은 매우 높은 비율을 나타냄을 확인할 수 있었다.
이와 같은 결과를 보다 객관적으로 제시하기 위하여 시험 물질 도포 후 사진결과를 도면에 나타냈다. 실시예를 처리한 실험군과 처리하지 않은 군의 사진을 통한 육안 비교 시 피부색이 변색이 발생한 시험물질 도포군이 성장기 진입이 오래동안 지속됨을 확인할 수 있었다.

Claims (17)

  1. 비타민과 덱스판테놀이 봉입된 에토좀을 포함하는 에토좀 조성물로서,
    상기 에토좀은 에탄올, 펩티드, 포스파티틸콜린(Phosphatidyl choline), 아미노산 화합물을 포함하는 에토좀 조성물.
  2. 제1항에 있어서,
    상기 펩티드는 pal-GHK, Pal-GQPR, Pal-KTTK, Pal-KTTKS, Biotin-GHK, PAL-KVK (Palmiotyl Tripeptide-5), Palmitoyl tripeptide-38, Palmitoyl-Tripeptide(Pal-RFK), Human Oligopeptide-20(Val-Gly-Val-Ala-Pro-Gly), GHK-Cu, (AHK)2Cu, AHK-Cu, Myristic acid-KLAKK-CONH2, Hexapeptide-11, Octapeptide-2, Palmitoyl-hexapeptide, Acetyl tetrapeptide-15, Acetyl Hexapeptide 3, Acetyl Tetrapeptide-2, Acetyl Tetrapeptide-5, Acetyl-Decapeptide-3, Ac-KGHK, rh-Oligopeptide-1(humanEGF) (NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVG YIGERCQYRDLKWWELR), Snake tripeptide(beta-Ala-Pro-Dab-NHBzl), peptide CK+(Ac-Arg-Lys-Arg-NH2), peptide CK(Arg-Lys-Arg), tripeptide-3(Ala-His-Lys.HCl), Ac-KGHK-NH2, Ac-Tyr-Arg-hexadecylester, Argireline로 이루어진 군에서 선택된 하나 이상인 것을 특징으로 하는 에토좀 조성물.
  3. 제1항에 있어서,
    상기 비타민은 비타민 E, 비타민 C, 비타민 B, 이들의 염 및 이들의 유사체로 이루어진 군에서 선택된 하나 이상인 것을 특징으로 하는 에토좀 조성물.
  4. 제1항에 있어서,
    상기 아미노산 화합물은 아미노산 및 아미노산 유사체로 이루어진 군에서 선택된 하나 이상의 것이고,
    상기 아미노산 및 아미노산 유사체는 NAC(N-Acetyl Cysteine), 아르기닌(Arginin), 로라이신, 라이신 에틸에스터, 히스티딘 및 히스티딘 에틸에스터로 이루어진 군에서 선택된 하나 이상인 것을 특징으로 하는 에토좀 조성물.
  5. 제1항에 있어서,
    상기 에토좀 조성물은 비타민 20 내지 70 mg/100ml, 덱스판테놀 150 내지 250 mg/100ml, 에탄올 5 내지 15 ml/100ml, 펩티드 0.1 내지 10 mg/100ml, 포스파티틸콜린 10 내지 1000 mg/100ml, 아미노산 화합물 10 내지 1000 mg/100ml를 포함하는 것을 특징으로 하는 에토좀 조성물.
  6. 제1항에 있어서,
    상기 에토좀은 평균입경이 90 내지 200 nm인 것을 특징으로 하는 에토좀 조성물.
  7. 제1항에 있어서,
    상기 에토좀은 표면전하값의 절대값이 10 내지 100 mV인 것을 특징으로 하는 에토좀 조성물.
  8. 제1항에 따른 에토좀 조성물의 제조방법으로서,
    (a) 정제수에 아미노산 화합물을 가용화하는 단계;
    (b) 정제수에 덱스판테놀을 가용화하는 단계;
    (c) 에탄올, 비타민, 포스파티딜콜린, 페녹시에탄올을 가용화하는 단계;
    (d) 상기 (a) 단계의 용액에 상기 (b) 단계의 용액을 첨가한 후, 혼합하는 단계;
    (e) 상기 (d) 단계의 용액에 상기 (c) 단계의 용액을 첨가한 후, 혼합하는 단계;
    (f) 상기 (e) 단계의 용액에 pH 조절제를 첨가한 후, 혼합하는 단계; 를 포함하는 에토좀 조성물의 제조방법.
  9. 제8항에 있어서,
    상기 (c) 단계는 계면활성제, 기타 양모 유효성분 및 트리테르페노이드 사포닌으로 이루어진 군에서 선택된 하나 이상을 더 포함하는 것을 특징으로 하는 에토좀 조성물의 제조방법.
  10. 제8항에 있어서,
    상기 pH 조절제는 시트르산 및 이의 염으로 이루어진 군에서 선택된 하나 이상을 포함하는 것을 특징으로 하는 에토좀 조성물의 제조방법.
  11. 제8항에 있어서,
    상기 (a) 단계는 정제수 50 내지 70L에 아미노산 화합물을 80 내지 120g 첨가하는 것을 특징으로 하는 에토좀 조성물의 제조방법.
  12. 제8항에 있어서,
    상기 (b) 단계는 정제수 25 내지 35L에 덱스판테놀 100 내지 300 g을 첨가하는 것을 특징으로 하는 에토좀 조성물의 제조방법.
  13. 제1항 내지 제7항 중 어느 하나에 따른 에토좀 조성물을 포함하는 발모 및/또는 양모 촉진용 조성물.
  14. 제1항 내지 제7항 중 어느 하나에 따른 에토좀 조성물을 포함하는 휴지기성 탈모 방지용 조성물.
  15. 제14항에 있어서,
    상기 휴지기성 탈모 방지용 조성물은 두피 항노화 및/또는 콜라겐 생성 촉진을 통해 휴지기성 탈모를 방지하는 것을 특징으로 하는 휴지기성 탈모 방지용 조성물.
  16. 제13항에 있어서,
    상기 에토좀 조성물이 올레아놀산(Oleanolic acid) 및/또는 아피제닌(Apigenin)을 더 포함하는 남성용 조성물인 것을 특징으로 하는 발모 및/또는 양모 촉진용 조성물.
  17. 제14항에 있어서,
    상기 에토좀 조성물이 올레아놀산(Oleanolic acid) 및/또는 아피제닌(Apigenin)을 더 포함하는 남성용 조성물인 것을 특징으로 하는 휴지기성 탈모 방지용 조성물.
PCT/KR2020/004318 2020-03-30 2020-03-30 비타민과 덱스판테놀이 봉입된 에토좀 조성물 및 이의 제조방법 WO2021201310A1 (ko)

Priority Applications (1)

Application Number Priority Date Filing Date Title
AU2020389480A AU2020389480A1 (en) 2020-03-30 2020-03-30 Ethosomal composition including ethosomes encapsulating vitamin and dexpanthenol and method for preparing the same

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
KR10-2020-0038028 2020-03-30
KR1020200038028A KR102244368B1 (ko) 2020-03-30 2020-03-30 비타민과 덱스판테놀이 봉입된 에토좀 조성물 및 이의 제조방법

Publications (1)

Publication Number Publication Date
WO2021201310A1 true WO2021201310A1 (ko) 2021-10-07

Family

ID=75725888

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/KR2020/004318 WO2021201310A1 (ko) 2020-03-30 2020-03-30 비타민과 덱스판테놀이 봉입된 에토좀 조성물 및 이의 제조방법

Country Status (3)

Country Link
KR (2) KR102244368B1 (ko)
AU (1) AU2020389480A1 (ko)
WO (1) WO2021201310A1 (ko)

Citations (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR100352088B1 (ko) 1999-06-21 2002-09-12 한미약품공업 주식회사 미녹시딜 함유 외용 에멀젼 조성물
JP2003531832A (ja) * 2000-03-28 2003-10-28 コグニス・イベリア・ソシエダッド・リミターダ プロリポソーム封入製剤（ｉｖ）
KR100445146B1 (ko) * 1998-05-27 2004-08-18 유로-셀띠끄 소시에떼 아노님 항염증용 제제, 특히 하부호흡기의 창상치료 촉진용 약제및/또는 소독 약제
KR20100060754A (ko) * 2008-11-28 2010-06-07 (주)아모레퍼시픽 경피 흡수를 통한 모발 성장 촉진용 외용제 조성물
KR20150044029A (ko) 2012-08-31 2015-04-23 바이오랩 세너스 팔마씨우티카 엘티디에이. 중합 피나스테리드 및 미녹시딜 나노입자 및 이의 제조 공정, 이를 포함한 수성 현탁액, 약학적 조성물 및 이 조성물의 용도
KR101810160B1 (ko) * 2017-06-30 2018-01-25 주식회사 셀리제코스메틱 생리활성물질이 봉입된 에토좀 제조 방법, 에토좀 조성물 및 에토좀 조성물을 포함하는 화장료 조성물
KR102025923B1 (ko) * 2011-11-04 2019-09-26 리포텍 에스.에이. 활성화된 수용체를 억제하는 펩티드 및 미용적 또는 약학적 조성물에서의 이의 용도

Family Cites Families (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
AU2016366220B2 (en) * 2015-12-10 2021-03-11 Lubrizol Advanced Materials, Inc. Compounds useful in the treatment and/or care of the skin, hair, nails, and/or mucous membranes
KR101907902B1 (ko) * 2017-02-23 2018-12-10 김현성 펩타이드를 함유하는 리포좀 조성물

Patent Citations (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR100445146B1 (ko) * 1998-05-27 2004-08-18 유로-셀띠끄 소시에떼 아노님 항염증용 제제, 특히 하부호흡기의 창상치료 촉진용 약제및/또는 소독 약제
KR100352088B1 (ko) 1999-06-21 2002-09-12 한미약품공업 주식회사 미녹시딜 함유 외용 에멀젼 조성물
JP2003531832A (ja) * 2000-03-28 2003-10-28 コグニス・イベリア・ソシエダッド・リミターダ プロリポソーム封入製剤（ｉｖ）
KR20100060754A (ko) * 2008-11-28 2010-06-07 (주)아모레퍼시픽 경피 흡수를 통한 모발 성장 촉진용 외용제 조성물
KR102025923B1 (ko) * 2011-11-04 2019-09-26 리포텍 에스.에이. 활성화된 수용체를 억제하는 펩티드 및 미용적 또는 약학적 조성물에서의 이의 용도
KR20150044029A (ko) 2012-08-31 2015-04-23 바이오랩 세너스 팔마씨우티카 엘티디에이. 중합 피나스테리드 및 미녹시딜 나노입자 및 이의 제조 공정, 이를 포함한 수성 현탁액, 약학적 조성물 및 이 조성물의 용도
KR101810160B1 (ko) * 2017-06-30 2018-01-25 주식회사 셀리제코스메틱 생리활성물질이 봉입된 에토좀 제조 방법, 에토좀 조성물 및 에토좀 조성물을 포함하는 화장료 조성물

Also Published As

Publication number Publication date
KR102244368B1 (ko) 2021-04-27
AU2020389480A1 (en) 2021-10-14
KR20210122201A (ko) 2021-10-08

Similar Documents

Publication Publication Date Title
WO2010016686A2 (ko) 국소 투여용 나노에멀젼
WO2010016683A9 (ko) 탈모의 예방, 치료, 또는 육모용 조성물
WO2014163219A1 (ko) 신규한 파이토스핑고신-1-포스페이트 유도체, 그 제조방법, 및 그것을 포함하는 탈모의 예방, 치료, 또는 육모용 조성물
BR9816322B1 (pt) Composição para efetuar mudanças em pigmentação de pele
WO2019093608A1 (en) Pharmaceutical or cosmetic composition for preventing or treating hair loss or promoting hair growth
WO2021029541A1 (ko) 수크로오스계 계면활성제를 포함하는 탄성 리포좀 조성물 및 이를 함유하는 화장료 조성물
WO2010008219A2 (ko) 지방조직 유래 다분화능 줄기세포의 배양물 및 그 추출 단백질을 함유한 화장료용 조성물
WO2020013581A1 (ko) 탈모방지 또는 모발성장 촉진용 조성물
WO2019194470A1 (en) Pharmaceutical or cosmetic composition for preventing or treating hair loss or promoting hair growth
WO2021201310A1 (ko) 비타민과 덱스판테놀이 봉입된 에토좀 조성물 및 이의 제조방법
WO2018070706A1 (ko) 데칸알 또는 이의 약학적으로 허용 가능한 염을 유효성분으로 포함하는 탈모 방지 또는 발모 촉진용 조성물
WO2022045635A1 (ko) 배롱나무 추출물을 유효성분으로 함유하는 탈모 방지 또는 발모 촉진용 조성물
KR19980080680A (ko) 모발 성장기 연장제
WO2019143145A1 (ko) 레졸빈 d2를 유효성분으로 함유하는 피부 염증 치료용 조성물
WO2015037855A1 (en) A composition comprising an extract of combined herbs consisting of acanthopanax koreanum nakai and crinum asiaticum var. japonicum showing preventing activity of baldness and stimulating activity of hair growth
WO2021107381A1 (ko) 페룰산 및 이의 유사체를 포함하는 유전자 돌연변이에 의한 피부질환 예방 및 치료용 조성물
WO2014175676A1 (ko) 진세노사이드 rf를 함유하는 피부 외용제 조성물
WO2018110875A1 (en) Pharmaceutical composition for the prevention or treatment of alopecia comprising eremochloa ophiuroides extract or fractions thereof as an active ingredient
WO2021241786A1 (ko) 양이온성 고분자 접합체 및 리포좀을 포함하는 3중층 리포좀 조성물, 및 이를 포함하는 화장료 조성물
WO2020241925A1 (ko) 세포투과성 물질이 융합된 앱타이드가 포집된 지질 나노 입자 복합체 및 이의 용도
WO2020149538A1 (ko) 클로날 줄기세포를 포함하는 아토피 피부염 예방 또는 치료용 약학적 조성물
WO2010077093A9 (ko) 에리스로포이에틴을 함유하는 발모 촉진 또는 탈모 방지용 조성물
WO2015005700A1 (ko) 발모 및 육모 촉진용 조성물
WO2020130208A1 (ko) 감태추출물을 포함하는 식이조절 조성물 및 이의 제조방법
WO2021125733A1 (ko) 탈모 예방 또는 치료용 약학 조성물

Legal Events

Date Code Title Description
ENP Entry into the national phase

Ref document number: 2021531093

Country of ref document: JP

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2020389480

Country of ref document: AU

Date of ref document: 20200330

Kind code of ref document: A

121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 20891461

Country of ref document: EP

Kind code of ref document: A1

122 Ep: pct application non-entry in european phase

Ref document number: 20891461

Country of ref document: EP

Kind code of ref document: A1

NENP Non-entry into the national phase

Ref country code: DE