WO2021127262A1 - Dual interleukin-2 /tnf receptor agonist for use in therapy - Google Patents
Dual interleukin-2 /tnf receptor agonist for use in therapy Download PDFInfo
- Publication number
- WO2021127262A1 WO2021127262A1 PCT/US2020/065734 US2020065734W WO2021127262A1 WO 2021127262 A1 WO2021127262 A1 WO 2021127262A1 US 2020065734 W US2020065734 W US 2020065734W WO 2021127262 A1 WO2021127262 A1 WO 2021127262A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- cells
- human
- seq
- fusion protein
- disease
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/52—Cytokines; Lymphokines; Interferons
- C07K14/54—Interleukins [IL]
- C07K14/55—IL-2
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/19—Cytokines; Lymphokines; Interferons
- A61K38/191—Tumor necrosis factors [TNF], e.g. lymphotoxin [LT], i.e. TNF-beta
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/19—Cytokines; Lymphokines; Interferons
- A61K38/20—Interleukins [IL]
- A61K38/2013—IL-2
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/39—Medicinal preparations containing antigens or antibodies characterised by the immunostimulating additives, e.g. chemical adjuvants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/62—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being a protein, peptide or polyamino acid
- A61K47/64—Drug-peptide, drug-protein or drug-polyamino acid conjugates, i.e. the modifying agent being a peptide, protein or polyamino acid which is covalently bonded or complexed to a therapeutically active agent
- A61K47/642—Drug-peptide, drug-protein or drug-polyamino acid conjugates, i.e. the modifying agent being a peptide, protein or polyamino acid which is covalently bonded or complexed to a therapeutically active agent the peptide or protein in the drug conjugate being a cytokine, e.g. IL2, chemokine, growth factors or interferons being the inactive part of the conjugate
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/62—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being a protein, peptide or polyamino acid
- A61K47/64—Drug-peptide, drug-protein or drug-polyamino acid conjugates, i.e. the modifying agent being a peptide, protein or polyamino acid which is covalently bonded or complexed to a therapeutically active agent
- A61K47/6425—Drug-peptide, drug-protein or drug-polyamino acid conjugates, i.e. the modifying agent being a peptide, protein or polyamino acid which is covalently bonded or complexed to a therapeutically active agent the peptide or protein in the drug conjugate being a receptor, e.g. CD4, a cell surface antigen, i.e. not a peptide ligand targeting the antigen, or a cell surface determinant, i.e. a part of the surface of a cell
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P29/00—Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
- A61P37/04—Immunostimulants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
- A61P37/06—Immunosuppressants, e.g. drugs for graft rejection
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/52—Cytokines; Lymphokines; Interferons
- C07K14/525—Tumour necrosis factor [TNF]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2878—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the NGF-receptor/TNF-receptor superfamily, e.g. CD27, CD30, CD40, CD95
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
- C12N15/62—DNA sequences coding for fusion proteins
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/85—Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N5/00—Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
- C12N5/06—Animal cells or tissues; Human cells or tissues
- C12N5/0602—Vertebrate cells
- C12N5/0634—Cells from the blood or the immune system
- C12N5/0636—T lymphocytes
- C12N5/0637—Immunosuppressive T lymphocytes, e.g. regulatory T cells or Treg
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2300/00—Mixtures or combinations of active ingredients, wherein at least one active ingredient is fully defined in groups A61K31/00 - A61K41/00
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/75—Agonist effect on antigen
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/30—Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/70—Fusion polypeptide containing domain for protein-protein interaction
- C07K2319/74—Fusion polypeptide containing domain for protein-protein interaction containing a fusion for binding to a cell surface receptor
- C07K2319/75—Fusion polypeptide containing domain for protein-protein interaction containing a fusion for binding to a cell surface receptor containing a fusion for activation of a cell surface receptor, e.g. thrombopoeitin, NPY and other peptide hormones
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2501/00—Active agents used in cell culture processes, e.g. differentation
- C12N2501/20—Cytokines; Chemokines
- C12N2501/23—Interleukins [IL]
- C12N2501/2302—Interleukin-2 (IL-2)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2501/00—Active agents used in cell culture processes, e.g. differentation
- C12N2501/20—Cytokines; Chemokines
- C12N2501/25—Tumour necrosing factors [TNF]
Definitions
- Regulatory T (Treg) cells are a subset of CD4 T cells dedicated to the task of restraining activation and responses of both innate and adaptive immune cells. Deletion or loss ⁇ of ⁇ function mutations in the Foxp3 gene result in an early onset autoimmune disorder called IPEX (Immunodysregulation polyendocrinopathy enteropathy X ⁇ linked) in both humans and mice that manifests in multiple organs and is often fatal.
- IPEX Immunodysregulation polyendocrinopathy enteropathy X ⁇ linked
- Treg cells are required to maintain normal immune homeostasis.
- Several human autoimmune disorders such as Type I diabetes (T1D), multiple sclerosis (MS) and systemic lupus erythematosus (SLE) display defects in either the number or the suppressor function of Treg cells isolated from the peripheral blood. Since Treg cells can impact immune responses in a dominant manner, positively targeting their number, function or stability during autoimmunity is an attractive therapeutic approach. Maintenance of Treg cells is critically dependent on two major signaling pathways: T cell receptor (TCR) and the IL ⁇ 2 receptor signaling and in absence of either of these signaling pathways Treg cell homeostasis and function is severely impaired.
- TCR T cell receptor
- IL ⁇ 2 receptor signaling in absence of either of these signaling pathways Treg cell homeostasis and function is severely impaired.
- Treg cells express elevated levels of the high affinity IL ⁇ 2 receptor subunit (IL ⁇ 2R ⁇ , CD25).
- IL ⁇ 2R ⁇ high affinity IL ⁇ 2 receptor subunit
- GVHD chronic graft ⁇ versus ⁇ host disease
- SLE SLE
- Treg cell numbers along with a concomitant reduction in disease activity.
- IL ⁇ 2 human interleukin ⁇ 2
- TNFR tumor necrosis factor receptor
- the invention is an Fc ⁇ fusion protein comprising an Fc, a human IL ⁇ 2 polypeptide comprising an amino acid sequence that is at least 70% identical to the amino acid sequence set forth in SEQ ID NO:1, and a tumor necrosis factor receptor (TNFR) agonist selected from the group consisting of anti ⁇ OX40, anti ⁇ DR3, and TNF.
- TNFR tumor necrosis factor receptor
- the invention is a method of treating a subject with an inflammatory or autoimmune disease, said method comprising administering to said subject a therapeutically effective amount of a human interleukin ⁇ 2 (IL ⁇ 2) chimeric molecule comprising a human IL ⁇ 2 polypeptide comprising an amino acid sequence that is at least 70% identical to the amino acid sequence set forth in SEQ ID NO:1, and a tumor necrosis factor receptor (TNFR) agonist selected from the group consisting of anti ⁇ OX40, anti ⁇ DR3, and TNF complexes, or an Fc ⁇ fusion protein comprising an Fc, a human IL ⁇ 2 polypeptide comprising an amino acid sequence that is at least 70% identical to the amino acid sequence set forth in SEQ ID NO:1, and a tumor necrosis factor receptor (TNFR) agonist selected from the group consisting of anti ⁇ OX40, anti ⁇ DR3, and TNF.
- IL ⁇ 2 human interleukin ⁇ 2
- TNFR tumor necrosis factor receptor
- Figure 1 shows proliferation of Tregs upon stimulation with IL ⁇ 2 in combination with a TNFR agonist (anti ⁇ OX40, recombinant TNF, or anti ⁇ DR3).
- CTV Cell Trace Violet
- human PBMCs were stimulated with indicated reagents for 4 days followed by flow cytometry analysis. Histograms are arranged in the following order (from bottom to top): Unstimulated, stimulated with 1 ⁇ g/ml anti ⁇ CD3, 20U/ml IL ⁇ 2, IgG, TNFR agonist (anti ⁇ OX40, recombinant TNF, anti ⁇ DR3), TNFR agonist plus IL ⁇ 2.
- FIG. 1 shows histogram plots of anti ⁇ OX40 and IL ⁇ 2 on PBMCs.
- A CTV labeled human PBMCs were stimulated with indicated titrating doses of anti ⁇ OX40 (clone 15A9) for 4 days followed by flow cytometry analysis. Histograms were gated on Treg cells (CD4+Foxp3+). Cells stimulated with CD3 show robust proliferation and serve as a positive control for the assay.
- FIG. 3 shows histogram plots of TNF and IL ⁇ 2 on PBMCs.
- A CTV labeled human PBMCs were stimulated with indicated titrating doses of TNF for 4 days followed by flow cytometry analysis. Histograms were gated on Treg cells (CD4+Foxp3+). No proliferation was observed with any of the indicated doses of TNF alone. However, combined stimulation with TNF and IL2 lead to Treg cell proliferation as seen by CTV dilution.
- B Summary of the data from (A). Graphs show three replicates from one donor for each condition. Response of T cells to these stimulations was also assessed and only very low levels of T cell proliferation were observed at all doses of TNF/IL2 treatment.
- Figure 4 shows histogram plots of anti ⁇ DR3 and IL ⁇ 2 on PBMCs.
- A CTV labeled human PBMCs were stimulated with indicated titrating doses of anti ⁇ DR3 for 4 days followed by flow cytometry analysis. Histograms were gated on Treg cells (CD4+Foxp3+). No proliferation was observed with any doses of the indicated doses of anti ⁇ DR3 alone. However, combined stimulation with anti ⁇ DR3 and IL2 lead to Treg cell proliferation.
- B Summary of the data from (A). Graphs show three replicates from one donor for each condition. Response of T cells to these stimulations was also assessed and only very low levels of T cell proliferation were observed at all doses of anti ⁇ DR3/IL2 treatment.
- Figure 5 shows histogram plots of anti ⁇ GITR and IL ⁇ 2 on PBMCs.
- A CTV labeled human PBMCs were stimulated with indicated titrating doses of anti ⁇ GITR for 4 days followed by flow cytometry analysis. Histograms were gated on Treg cells (CD4+Foxp3+). Very low level of proliferation was observed with anti ⁇ GITR alone. However, combined stimulation with anti ⁇ GITR and IL2 lead to a more pronounced Treg cell proliferation.
- B Summary of the data from (A). Graphs show three replicates from one donor for each condition. Response of T cells to these stimulations was also assessed and only modest levels of T cell proliferation were observed at all doses of anti ⁇ GITR/IL2 treatment.
- Figure 6 shows a diagram of a chimeric OX ⁇ 40 antibody and IL ⁇ 2 molecules in a few different formats.
- Figure 7 shows in vivo mouse studies using an OX ⁇ 40 antibody with IL ⁇ 2 molecules bound to it to measure levels of Tregs, activated CD4+ and CD8+ T cells, and NK cells, measured at day 4 and day 15. The studies show mice administered IL ⁇ 2 alone, anti ⁇ OX ⁇ 40 alone, or the chimeric molecule, as well as control.
- IL ⁇ 2 binds three transmembrane receptor subunits: IL ⁇ 2R ⁇ and IL ⁇ 2R ⁇ which together activate intracellular signaling events upon IL ⁇ 2 binding, and CD25 (IL ⁇ 2R ⁇ ) which serves to stabilize the interaction between IL ⁇ 2 and IL ⁇ 2R ⁇ .
- the signals delivered by IL ⁇ 2R ⁇ ⁇ include those of the PI3 ⁇ kinase, Ras ⁇ MAP ⁇ kinase, and STAT5 pathways.
- T cells require expression of CD25 to respond to the low concentrations of IL ⁇ 2 that typically exist in tissues.
- T cells that express CD25 include both FOXP3+ regulatory T cells (Treg cells), which are essential for suppressing autoimmune inflammation, and FOXP3 ⁇ T cells that have been activated to express CD25.
- FOXP3 ⁇ CD25+ T effector cells (Teff) may be either CD4+ or CD8+ cells, both of which may contribute to inflammation, autoimmunity, organ graft rejection, or graft ⁇ versus ⁇ host disease.
- IL ⁇ 2 ⁇ stimulated STAT5 signaling is crucial for normal T ⁇ reg cell growth and survival and for high FOXP3 expression.
- Treg cells also express higher surface levels of several TNF (tumor necrosis factor) receptor family members, most notably TNFR2, OX40, GITR, 4 ⁇ 1BB, CD30 and DR3. Expression of these TNF receptors, in particular OX40, GITR and TNFR2, on Treg cells directly correlates with the strength of TCR signaling
- TNF tumor necrosis factor
- IL ⁇ 2 signaling also influences expression of these TNFRs.
- TNFR signaling in Treg cells in the periphery is less clear as its modulation has resulted in diverse effects. For instance, engagement of OX40 on Treg cells led to loss of Foxp3 expression and reduced Treg cell function while TNFR2 signaling has been implicated in maintaining Treg cell numbers and function.
- the present invention shows combining agonists of TNFRs such as TNFR2, GITR, OX40 and DR3 with IL ⁇ 2 stimulation increases Treg cell proliferation. Since expression of TNFR ligands is generally upregulated by antigen presenting cells after sensing inflammatory signals and IL ⁇ 2 is secreted by T cells upon activation, they may cooperate to drive robust Treg cell expansion during inflammation. Some embodiments of the present invention are a chimeric fusion molecule between TNFR agonists and IL ⁇ 2 that can be a selective agent for Treg cell expansion. In some embodiments, the chimeric molecule is bound to an Fc ⁇ molecule.
- the invention is a method to increase Tregs by co ⁇ administration of a TNFR agonist and an IL ⁇ 2 molecule or mutein.
- IL ⁇ 2 The IL ⁇ 2 molecules described herein include wildtype and variants of wild ⁇ type human IL ⁇ 2.
- wild ⁇ type human IL ⁇ 2 As used herein, “wild ⁇ type human IL ⁇ 2,” “wild ⁇ type IL ⁇ 2,” or “WT IL ⁇ 2” shall mean the polypeptide having the following amino acid sequence: APTSSSTKKTQLQLEHLLLDLQMILNGINNYKNPKLTRMLTFKFYMPKKATELKHLQCLEEELKPLEEVLNLAQSKNF HLRPRDLISNINVIVLELKGSETTFMCEYADETATIVEFLNRWITFXQSIISTLT Wherein X is C, S, V, or A (SEQ ID NO:1).
- Variants may contain one or more substitutions, deletions, or insertions within the wild ⁇ type IL ⁇ 2 amino acid sequence and include the IL ⁇ 2 mutein variants described in WO2010085495, WO2014153111, WO2016164937, PCT/US2020/046202, WO1999060128, WO2002000243, WO2012107417, WO2005086798 , WO2005086751, and WO2006089064, which are hereby incorporated by reference in their entirety.
- An example of an IL ⁇ 2 mutein contains the mutation V91K having the following amino acid sequence: APTSSSTKKTQLQLEHLLLDLQMILNGINNYKNPKLTRMLTFKFYMPKKATELKHLQCLEEELKPLEEVLNLAQSKNF HLRPRDLISNINKIVLELKGSETTFMCEYADETATIVEFLNRWITFXQSIISTLT
- X is C, S, V, or A (SEQ ID NO:2).
- Residues are designated herein by the one letter amino acid code followed by the IL ⁇ 2 amino acid position, e.g., K35 is the lysine residue at position 35 of SEQ ID NO: 2.
- substitutions are designated herein by the one letter amino acid code followed by the IL ⁇ 2 amino acid position followed by the substituting one letter amino acid code., e.g., K35A is a substitution of the lysine residue at position 35 of SEQ ID NO:2 with an alanine residue.
- IL ⁇ 2 Muteins Provided herein are human IL ⁇ 2 molecules and muteins that, in combination with TNFR agonists, preferentially stimulate T regulatory (Treg) cells.
- T regulatory T regulatory cells
- preferentially stimulates T regulatory cells means the mutein or antibody promotes the proliferation, survival, activation and/or function of CD3+FoxP3+ T cells over CD3+FoxP3 ⁇ T cells.
- Methods of measuring the ability to preferentially stimulate Tregs can be measured by flow cytometry of peripheral blood leukocytes, in which there is an observed increase in the percentage of FOXP3+CD4+ T cells among total CD4+ T cells, an increase in percentage of FOXP3+CD8+ T cells among total CD8+ T cells, an increase in percentage of FOXP3+ T cells relative to NK cells, and/or a greater increase in the expression level of CD25 on the surface of FOXP3+ T cells relative to the increase of CD25 expression on other T cells.
- Preferential growth of Treg cells can also be detected as increased representation of demethylated FOXP3 promoter DNA (i.e.
- Treg ⁇ specific demethylated region or TSDR
- PCR polymerase chain reaction
- IL ⁇ 2 molecules and muteins that, in combination with TNFR agonists, preferentially stimulate Treg cells increase the ratio of CD3+FoxP3+ T cells over CD3+FoxP3 ⁇ T cells in a subject or a peripheral blood sample at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 100%, at least 150%, at least 200%, at least 300%, at least 400%, at least 500%, at least 600%, at least 700%, at least 800%, at least 900%, or at least 1000%.
- IL ⁇ 2 muteins include, but are not limited to, IL ⁇ 2 muteins comprising V91K, N30S, N30D, Y31H, Y31S, K35R, V69A, Q74P, V91K/D20L, D84R/E61Q, V91K/D20A/E61Q/M104T, N88K/M104L, V91H/M104L, V91K/H16E/M104V, V91K/H16R/M104V, V91K/H16R/M104T, V91K/D20A/M104T, V91K/H16E/M104T, V91K/H16E/E61Q/M104T, V91K/H16R/E61Q/M104T, V91K/H16E, V91H/D20A/M104T, H16E/V91H/M104V, V91H/D20A/E61Q/M104T, V91H/H16
- H16E/V91H/E61Q/M104T V91K/E61Q/H16E, V91K/H16R/M104L, H16E/V91H/E16Q, V91K/E61Q/H16R, D20W/V91K/E61Q, V91H/H16R, V91K/H16R, D20W/V91K/E61Q/M104T, V91K/D20A, V91H/D20A/E16Q, V91K/D20A/M104L, V91H/D20A, V91K/E61Q/D20A, V91H/M104T, V91H/M104V, V91K/E61Q, V91K/N88K/E61Q/M104T, V91K/N88K/E61Q, V91H/E61Q, V91H/N88K, D20A/H16E/M104T, D20A/M104T, H16E/N88K
- IL ⁇ 2 molecules and muteins of the present invention optionally comprise a C125A substitution.
- the invention includes IL ⁇ 2 muteins also including truncations and/or additional insertions, deletions, and/or substitutions in addition to the V91K, N30S, N30D, Y31H, Y31S, K35R, V69A, Q74P, V91K/D20L, D84R/E61Q, V91K/D20A/E61Q/M104T, N88K/M104L, V91H/M104L, V91K/H16E/M104V, V91K/H16R/M104V, V91K/H16R/M104T, V91K/D20A/M104T, V91K/H16E/M104T, V91K/H16E/E61Q/M104T, V91K/H16R/E61Q
- embodiments include IL ⁇ 2 muteins that preferentially stimulate Treg cells and comprise an amino acid sequence having a V91K, N30S, N30D, Y31H, Y31S, K35R, V69A, Q74P, V91K/D20L, D84R/E61Q, V91K/D20A/E61Q/M104T, N88K/M104L, V91H/M104L, V91K/H16E/M104V, V91K/H16R/M104V, V91K/H16R/M104T, V91K/D20A/M104T, V91K/H16E/M104T, V91K/H16E/E61Q/M104T, V91K/H16R/E61Q/M104T, V91K/H16E, V91H/D20A/M104T, H16E/V91H/M104V, V91H/D20A/E61Q/M104T, V91H/
- such IL ⁇ 2 muteins comprise an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence set forth in SEQ ID NO:1.
- sequence identity and/or similarity is determined by using standard techniques known in the art, including, but not limited to, the local sequence identity algorithm of Smith and Waterman, 1981, Adv. Appl. Math. 2:482, the sequence identity alignment algorithm of Needleman and Wunsch, 1970, J. Mol. Biol. 48:443, the search for similarity method of Pearson and Lipman, 1988, Proc. Nat. Acad. Sci. U.S.A. 85:2444, computerized implementations of
- PILEUP creates a multiple sequence alignment from a group of related sequences using progressive, pairwise alignments. It can also plot a tree showing the clustering relationships used to create the alignment. PILEUP uses a simplification of the progressive alignment method of Feng & Doolittle, 1987, J. Mol. Evol. 35:351 ⁇ 360; the method is similar to that described by Higgins and Sharp, 1989, CABIOS 5:151 ⁇ 153.
- Useful PILEUP parameters including a default gap weight of 3.00, a default gap length weight of 0.10, and weighted end gaps.
- Another example of a useful algorithm is the BLAST algorithm, described in: Altschul et al., 1990, J. Mol. Biol.
- BLAST program is the WU ⁇ BLAST ⁇ 2 program which was obtained from Altschul et al., 1996, Methods in Enzymology 266:460 ⁇ 480.
- WU ⁇ BLAST ⁇ 2 uses several search parameters, most of which are set to the default values.
- T word threshold
- the HSP S and HSP S2 parameters are dynamic values and are established by the program itself depending upon the composition of the particular sequence and composition of the particular database against which the sequence of interest is being searched; however, the values may be adjusted to increase sensitivity.
- An additional useful algorithm is gapped BLAST as reported by Altschul et al., 1993, Nucl. Acids Res. 25:3389 ⁇ 3402. Gapped BLAST uses BLOSUM ⁇ 62 substitution scores; threshold T parameter set to 9; the two ⁇ hit method to trigger ungapped extensions, charges gap lengths of k a cost of 10+k; X u set to 16, and X g set to 40 for database search stage and to 67 for the output stage of the algorithms.
- Gapped alignments are triggered by a score corresponding to about 22 bits. While the site or region for introducing an amino acid sequence variation may be predetermined, the mutation per se need not be predetermined. For example, in order to optimize the performance of a mutation at a given site, random mutagenesis may be conducted at the target codon or region and the expressed IL ⁇ 2 mutein screened for the optimal combination of desired activity. Techniques for making substitution mutations at predetermined sites in DNA having a known sequence are well known, for example, M13 primer mutagenesis and PCR mutagenesis. Screening of the mutants may be done using assays described herein, for example.
- Amino acid substitutions are typically of single residues; insertions usually will be on the order of from about one (1) to about twenty (20) amino acid residues, although considerably larger insertions may be tolerated. Deletions range from about one (1) to about twenty (20) amino acid residues, although in some cases deletions may be much larger. Substitutions, deletions, insertions or any combination thereof may be used to arrive at a final derivative or variant. Generally these changes are done on a few amino acids to minimize the alteration of the molecule, particularly the immunogenicity and specificity of the antigen binding protein. However, larger changes may be tolerated in certain circumstances. Conservative substitutions are generally made in accordance with the following chart depicted as TABLE 1. Table 1 Substantial cha are less conservative than those shown in TABLE 1. For example, substitutions may be made which
- substitutions which in general are expected to produce the greatest changes in the polypeptide’s properties are those in which (a) a hydrophilic residue, e.g., seryl or threonyl, is substituted for (or by) a hydrophobic residue, e.g., leucyl, isoleucyl, phenylalanyl, valyl or alanyl; (b) a cysteine or proline is substituted for (or by) any other residue; (c) a residue having an electropositive side chain, e.g., lysyl, arginyl, or histidyl, is substituted for (or by) an electronegative residue, e.g., glutamyl or aspartyl; or (d)
- a hydrophilic residue e.g., seryl or threonyl
- a hydrophobic residue e.g., leucyl, isoleucyl, phenylalanyl,
- the variants typically exhibit the same qualitative biological activity and will elicit the same immune response as the naturally ⁇ occurring analogue, although variants also are selected to modify the characteristics of the IL ⁇ 2 mutein as needed.
- the variant may be designed such that the biological activity of the IL ⁇ 2 mutein is altered. For example, glycosylation sites may be altered or removed as discussed herein.
- TNFR agonists The tumor necrosis factor receptor (TNFR) superfamily is a family of cytokine receptors that form trimeric complexes in the plasma membrane and bind tumor necrosis factors (TNFs) by an extracellular cysteine ⁇ rich domain. Some members of the TNFR family contain a death domain and have been termed death receptors.
- TNFR agonists of the present invention in combination with IL ⁇ 2 molecules and muteins of the present invention, preferentially stimulate T regulatory (Treg) cells.
- TNFR agonists of the present invention include tumor necrosis factor receptor 1 (TNFR1); tumor necrosis factor receptor 2 (TNFR2); lymphotoxin beta receptor (LTBR); OX40; CD40; Fas receptor; Decoy receptor 3; CD27; CD30; 4 ⁇ 1BB; Death receptor 1, 2, 3, 4, 5, and 6; RANK, osteoprotegrin; TWEAK receptor; TACI; BAFF receptor; Herpesvirus entry mediator; Nerve growth factor receptor; B ⁇ cell maturation antigen; Glucocorticoid ⁇ induced TNFR ⁇ related protein; TROY; and ectodysplasin A2 receptor, and agonist antibodies to the receptors, such as an OX40 agonistic antibody.
- TNFR1 tumor necrosis factor receptor 1
- TNFR2 tumor necrosis factor receptor 2
- Treg cells at baseline, express several different TNFR family member such as GITR, 4 ⁇ 1BB (CD137), OX40, DR3, TNFR2 at much higher levels as compared to other immune cell populations.
- Expression of TNFRs on different T cell subsets were determined from single cell RNA data. For example, levels of TNFRs on various immune cells subsets can be extracted from human single cell RNA sequencing data, such as in http://crc.cancer ⁇ pku.cn/index.php.
- TNFR GITR, 4 ⁇ 1BB (CD137), OX40, DR3, TNFR2
- the TNFR agonist can be a ligand for a TNFR member.
- TNF ⁇ alpha lymphotoxin ⁇ beta (TNF ⁇ C); OX40L; CD154; FasL; LIGHT; TL1A; CD70; Siva; CD153; 4 ⁇ 1BB ligand; TRAIL; RANKL; TWEAK; APRIL; BAFF; CAMLG; NGF; BDNF; NT ⁇ 3; NT ⁇ 4; GITR ligand; and EDA ⁇ A2.
- antibodies against OX40 include those found in WO2007062245A2, WO2010096418A2, WO2013008171A1, WO2013028231A1, WO2013038191A2, WO2013068563A2, WO2014148895A1, WO2015153513A1, WO2016057667A1, WO2016179517A1, WO2016196228A1, and WO2018112346A1 that act as agonistic antibodies.
- antibodies against OX40 that can act as agonists of OX40 receptor are useful for the invention.
- antibodies against OX40 receptor include those found in WO2003106498A2.
- an anti ⁇ OX40 antibody has a heavy chain sequence of: QVQLVESGGGVVQPGRSLRLSCAASGFTFSSNGMHWVRQAPGKGLEWVAVIWHDGSKKNYADSVKGRFTISRD TSKNTLFLQMNSLRAEDTAVYYCAREGGYGDYTLDYWGQGTLLTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLV KDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKT HTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNST YRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPP
- Examples of antibodies against death receptor 3 include those found in WO2011106707A2 and WO2015152430A1. In some embodiments, antibodies against DR3 that can act as agonists of DR3 receptor are useful for the invention.
- Examples of DR3 ligand include TNF ⁇ like protein 1A (TL1A). All of the above references are incorporated by reference in their entirety.
- Combination molecules The combination of an IL ⁇ 2 molecule or mutein and a TNFR agonist, as in the present invention, can be administered in combination, or as a single molecule.
- the IL ⁇ 2 molecules or muteins in combination with TNFR agonists provided herein may be constructed as a single molecular construction.
- IL ⁇ 2 molecules or muteins and TNFR agonists of the present invention can be constructed as a single molecule, such as with an Fc molecule.
- the Fc molecule has an IL ⁇ 2 molecule or mutein on one arm and a TNFR agonist on the other arm or as a fusion protein.
- the Fc ⁇ bound IL ⁇ 2/TNFR agonist molecule extends the serum half ⁇ life of the Fc ⁇ bound IL ⁇ 2/TNFR agonist molecule. In some instances, this is done without increasing the risk that such half ⁇ life extension would increase the likelihood or the intensity of a side ⁇ effect or adverse event in a patient. Subcutaneous dosing of such an extended serum half ⁇ life mutein may allow for prolonged target coverage with lower systemic maximal exposure (C max ). Extended serum half ⁇ life may allow a lower or less frequent dosing regimen of the mutein.
- the serum half ⁇ life of the IL ⁇ 2/TNFR agonist molecule provided herein may be extended by essentially any method known in the art.
- Such methods include altering the sequence of the IL ⁇ 2/TNFR agonist molecule to include a peptide that binds to the neonatal Fc ⁇ receptor or bind to a protein having extended serum half ⁇ life, e.g., IgG or human serum albumin.
- the IL ⁇ 2/TNFR agonist molecule is fused to a polypeptide that confers extended half ⁇ life on the fusion molecule.
- polypeptides include an IgG Fc or other polypeptides that bind to the neonatal Fc ⁇ receptor, human serum albumin, or polypeptides that bind to a protein having extended serum half ⁇ life.
- the Fc ⁇ bound IL ⁇ 2/TNFR agonist molecule is fused to an IgG Fc molecule.
- the IL ⁇ 2/TNFR agonist portions of the molecule may be fused to the N ⁇ terminus or the C ⁇ terminus of the IgG Fc region.
- One embodiment of the present invention is directed to a dimer comprising two Fc ⁇ fusion polypeptides created by fusing an IL ⁇ 2 molecule or mutein to one Fc region of an antibody and a TNFR agonist to another region.
- the dimer can be made by, for example, inserting a gene fusion encoding the fusion protein into an appropriate expression vector, expressing the gene fusion in host cells transformed with the recombinant expression vector, and allowing the expressed fusion protein to assemble much like antibody molecules, whereupon interchain bonds form between the Fc moieties to yield the dimer.
- Fc polypeptide or “Fc region” as used herein includes native and mutein forms of polypeptides derived from the Fc region of an antibody and can be part of either the IL ⁇ 2 mutein fusion proteins or the anti ⁇ IL ⁇ 2 antibodies of the invention. Truncated forms of such polypeptides containing the hinge region that promotes dimerization also are included. In certain embodiments, the Fc region comprises an antibody CH2 and CH3 domain.
- fusion proteins comprising Fc moieties (and oligomers formed therefrom) offer the advantage of facile purification by affinity chromatography over Protein A or Protein G columns.
- Preferred Fc regions are derived from human IgG, which includes IgG1, IgG2, IgG3, and IgG4.
- specific residues within the Fc are identified by position. All Fc positions are based on the EU numbering scheme.
- One of the functions of the Fc portion of an antibody is to communicate to the immune system when the antibody binds its target. This is considered “effector function.” Communication leads to antibody ⁇ dependent cellular cytotoxicity (ADCC), antibody ⁇ dependent cellular phagocytosis (ADCP), and/or complement dependent cytotoxicity (CDC). ADCC and ADCP are mediated through the binding of the Fc to Fc receptors on the surface of cells of the immune system.
- CDC is mediated through the binding of the Fc with proteins of the complement system, e.g., C1q.
- the IgG subclasses vary in their ability to mediate effector functions. For example, IgG1 is much superior to IgG2 and IgG4 at mediating ADCC and CDC. Thus, in embodiments wherein effector function is undesirable, an IgG2 Fc would be preferred.
- IgG2 Fc ⁇ containing molecules are known to be more difficult to manufacture and have less attractive biophysical properties, such as a shorter half ⁇ life, as compared to IgG1 Fc ⁇ containing molecules.
- the effector function of an antibody can be increased, or decreased, by introducing one or more mutations into the Fc.
- Embodiments of the invention include IL ⁇ 2 mutein Fc fusion proteins having an Fc engineered to increase effector function (U.S. 7,317,091 and Strohl, Curr. Opin. Biotech., 20:685 ⁇ 691, 2009; both incorporated herein by reference in its entirety).
- IgG1 Fc molecules having increased effector function include those having the following substitutions: S239D; S239E; S239K, F241A; V262A; V264D; V264L; V264A; V264S; D265A; D265S; D265V; F296A; Y296A; R301A; I332E; S239D/I332E; S239D/A330S/I332E; S239D/A330L/I332E; S298A/D333A/K334A; P247I/A339D; P247I/A339Q; D280H/K290S; D280H/K290S/S298D; D280H/K290S/S298V; F243L/R292P/Y300L; F243L/R292P/Y300L/P396L; F243L/R292P/Y300L/V305I/P396
- Another method of increasing effector function of IgG Fc ⁇ containing proteins is by reducing the fucosylation of the Fc.
- Removal of the core fucose from the biantennary complex ⁇ type oligosachharides attached to the Fc greatly increased ADCC effector function without altering antigen binding or CDC effector function.
- Several ways are known for reducing or abolishing fucosylation of Fc ⁇ containing molecules, e.g., antibodies.
- FUT8 knockout cell line including a FUT8 knockout cell line, variant CHO line Lec13, rat hybridoma cell line YB2/0, a cell line comprising a small interfering RNA specifically against the FUT8 gene, and a cell line coexpressing ⁇ 1,4 ⁇ N ⁇ acetylglucosaminyltransferase III and Golgi ⁇ mannosidase II.
- the Fc ⁇ containing molecule may be expressed in a non ⁇ mammalian cell such as a plant cell, yeast, or prokaryotic cell, e.g., E. coli.
- the IL ⁇ 2 mutein Fc ⁇ fusion proteins or anti ⁇ IL ⁇ 2 antibodies of the invention comprise an Fc engineered to decrease effector function.
- Exemplary Fc molecules having decreased effector function include those having the following substitutions: N297A or N297Q (IgG1); L234A/L235A (IgG1); V234A/G237A (IgG2); L235A/G237A/E318A (IgG4); H268Q/V309L/A330S/A331S (IgG2); C220S/C226S/C229S/P238S (IgG1); C226S/C229S/E233P/L234V/L235A (IgG1); L234F/L235E/P331S (IgG1); or S267E/L328F (IgG1).
- IgG1 has a glycosylation site at N297 (EU numbering system) and glycosylation contributes to the effector function of IgG1 antibodies.
- An exemplary IgG1 sequence is provided in SEQ ID NO:3: DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQY NSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFY PSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSPGK ( SEQ ID NO:3) Groups have mutated N297 in an effort to make aglycosylated antibodies.
- N297Q glutamine
- N297A alanine
- amino acids that resemble asparagine in physiochemical nature such as glutamine (N297Q) or with alanine (N297A) which mimics asparagines without polar groups.
- amino acids that resemble asparagine in physiochemical nature such as glutamine (N297Q) or with alanine (N297A) which mimics asparagines without polar groups.
- N297Q glutamine
- N297A alanine
- the IL ⁇ 2 mutein Fc ⁇ fusion protein comprises a human IgG1 Fc having a N297G substitution.
- the Fc comprising the N297G substitution is useful in any context wherein a molecule comprises a human IgG1 Fc, and is not limited to use in the context of an IL ⁇ 2 mutein Fc ⁇ fusion.
- an antibody comprises the Fc having a N297G substitution.
- an Fc comprising a human IgG1 Fc having the N297G mutation may also comprise further insertions, deletions, and substitutions.
- the human IgG1 Fc comprises the N297G substitution and is at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, or at least 99% identical to the amino acid sequence set forth in SEQ ID NO:3.
- the C ⁇ terminal lysine residue is substituted or deleted.
- the amino acid sequence of human IgG1 comprising the N297G substitution and deletion of the C ⁇ terminal lysine is set forth in SEQ ID NO:4, having the following amino acid sequence: DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQY GSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFY PSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG (SEQ ID NO:4)
- a glycosylated IgG1 Fc ⁇ containing molecules were shown to be less stable than glycosylated IgG1 Fc ⁇ containing molecules.
- the Fc region may be further engineered to increase the stability of the aglycosylated molecule.
- one or more amino acids are substituted to cysteine so to form di ⁇ sulfide bonds in the dimeric state.
- Residues V259, A287, R292, V302, L306, V323, or I332 of the amino acid sequence set forth in SEQ ID NO:3 may be substituted with cysteine.
- specific pairs of residues are substitution such that they preferentially form a di ⁇ sulfide bond with each other, thus limiting or preventing di ⁇ sulfide bond scrambling.
- Preferred pairs include, but are not limited to, A287C and L306C, V259C and L306C, R292C and V302C, and V323C and I332C.
- Fc ⁇ containing molecules wherein one or more of residues V259, A287, R292, V302, L306, V323, or I332 are substituted with cysteine, examples of which include those
- Fc region is engineering to create “knobs” and “holes” which facilitate heterodimer formation of two different Fc ⁇ containing polypeptide chains when co ⁇ expressed in a cell.
- the Fc region is altered to use electrostatic steering to encourage heterodimer formation while discouraging homodimer formation of two different Fc ⁇ containing polypeptide when co ⁇ expressed in a cell.
- Preferred heterodimeric Fc include those wherein one chain of the Fc comprises D399K and E356K substitutions and the other chain of the Fc comprises K409D and K392D substitutions. In other embodiments, one chain of the Fc comprises D399K, E356K, and E357K substitutions and the other chain of the Fc comprises K409D, K392D, and K370D substitutions.
- the Fc ⁇ bound IL ⁇ 2/TNFR agonist molecule comprises a linker between the Fc and the IL ⁇ 2 molecule or mutein and/or a linker between the Fc and the TNFR agonist.
- the Fc ⁇ bound IL ⁇ 2/TNFR agonist molecule comprises one or more copies of a peptide consisting of GGGGS (SEQ ID NO:5), GGNGT (SEQ ID NO: 6), or YGNGT (SEQ ID NO: 7) between the Fc and the IL ⁇ 2 mutein.
- the polypeptide region between the Fc and the IL ⁇ 2 molecule or mutein and/or the Fc and the TNFR agonist regions comprises a single copy of GGGGS (SEQ ID NO: 5), GGNGT (SEQ ID NO: 6), or YGNGT (SEQ ID NO: 7).
- the linkers GGNGT (SEQ ID NO: 6) or YGNGT (SEQ ID NO: 7) are glycosylated when expressed in the appropriate cells and such glycosylation may help stabilize the protein in solution and/or when administered in vivo.
- an IL ⁇ 2 mutein fusion protein comprises a glycosylated linker between the Fc region and the IL ⁇ 2 mutein region.
- the C ⁇ terminal portion of the Fc and/or the amino terminal portion of the IL ⁇ 2 molecule or mutein may contain one or more mutations that alter the glycosylation profile of the Fc ⁇ bound IL ⁇ 2/TNFR agonist molecule when expressed in mammalian cells.
- the Fc ⁇ bound IL ⁇ 2/TNFR agonist molecule further comprises a T3 substitution, e.g., T3N or T3A.
- the Fc ⁇ bound IL ⁇ 2/TNFR agonist molecule may further comprise an S5 substitution, such as S5T.
- Covalent modifications of Fc ⁇ bound IL ⁇ 2/TNFR agonist molecules are included within the scope of this invention, and are generally, but not always, done post ⁇ translationally.
- several types of covalent modifications are introduced into the molecule by reacting certain of its amino acid residues with an organic derivatizing agent that is capable of reacting with selected side chains or the N ⁇ or C ⁇ terminal residues.
- Cysteinyl residues most commonly are reacted with ⁇ haloacetates (and corresponding amines), such as chloroacetic acid or chloroacetamide, to give carboxymethyl or carboxyamidomethyl derivatives.
- Cysteinyl residues also are derivatized by reaction with bromotrifluoroacetone, ⁇ bromo ⁇ (5 ⁇ imidozoyl)propionic acid, chloroacetyl phosphate, N ⁇ alkylmaleimides, 3 ⁇ nitro ⁇ 2 ⁇ pyridyl disulfide, methyl 2 ⁇ pyridyl disulfide, p ⁇ chloromercuribenzoate, 2 ⁇ chloromercuri ⁇ 4 ⁇ nitrophenol, or chloro ⁇ 7 ⁇ nitrobenzo ⁇ 2 ⁇ oxa ⁇ 1,3 ⁇ diazole.
- Histidyl residues are derivatized by reaction with diethylpyrocarbonate at pH 5.5 ⁇ 7.0 because this agent is relatively specific for the histidyl side chain.
- Para ⁇ bromophenacyl bromide also is useful; the reaction is preferably performed in 0.1M sodium cacodylate at pH 6.0. Lysinyl and amino terminal residues are reacted with succinic or other carboxylic acid anhydrides. Derivatization with these agents has the effect of reversing the charge of the lysinyl residues.
- Suitable reagents for derivatizing alpha ⁇ amino ⁇ containing residues include imidoesters such as methyl picolinimidate; pyridoxal phosphate; pyridoxal; chloroborohydride; trinitrobenzenesulfonic acid; O ⁇ methylisourea; 2,4 ⁇ pentanedione; and transaminase ⁇ catalyzed reaction with glyoxylate.
- Arginyl residues are modified by reaction with one or several conventional reagents, among them phenylglyoxal, 2,3 ⁇ butanedione, 1,2 ⁇ cyclohexanedione, and ninhydrin.
- arginine residues require that the reaction be performed in alkaline conditions because of the high pK a of the guanidine functional group. Furthermore, these reagents may react with the groups of lysine as well as the arginine epsilon ⁇ amino group.
- the specific modification of tyrosyl residues may be made, with particular interest in introducing spectral labels into tyrosyl residues by reaction with aromatic diazonium compounds or tetranitromethane. Most commonly, N ⁇ acetylimidizole and tetranitromethane are used to form O ⁇ acetyl tyrosyl species and 3 ⁇ nitro derivatives, respectively.
- Tyrosyl residues are iodinated using 125 I or 131 I to prepare labeled proteins for use in radioimmunoassay, the chloramine T method described above being suitable.
- aspartyl and glutamyl residues are converted to asparaginyl and glutaminyl residues by reaction with ammonium ions.
- Derivatization with bifunctional agents is useful for crosslinking antigen binding proteins to a water ⁇ insoluble support matrix or surface for use in a variety of methods.
- Commonly used crosslinking agents include, e.g., 1,1 ⁇ bis(diazoacetyl) ⁇ 2 ⁇ phenylethane, glutaraldehyde, N ⁇ hydroxysuccinimide esters, for example, esters with 4 ⁇ azidosalicylic acid, homobifunctional imidoesters, including disuccinimidyl esters such as 3,3' ⁇ dithiobis(succinimidylpropionate), and bifunctional maleimides such as bis ⁇ N ⁇ maleimido ⁇ 1,8 ⁇ octane.
- Derivatizing agents such as methyl ⁇ 3 ⁇ [(p ⁇ azidophenyl)dithio]propioimidate yield photoactivatable intermediates that are capable of forming crosslinks in the presence of light.
- reactive water ⁇ insoluble matrices such as cyanogen bromide ⁇ activated carbohydrates and the reactive substrates described in U.S. Pat. Nos. 3,969,287; 3,691,016; 4,195,128; 4,247,642; 4,229,537; and 4,330,440 are employed for protein immobilization. Glutaminyl and asparaginyl residues are frequently deamidated to the corresponding glutamyl and aspartyl residues, respectively.
- these residues are deamidated under mildly acidic conditions. Either form of these residues falls within the scope of this invention.
- Other modifications include hydroxylation of proline and lysine, phosphorylation of hydroxyl groups of seryl or threonyl residues, methylation of the ⁇ amino groups of lysine, arginine, and histidine side chains (T. E. Creighton, Proteins: Structure and Molecular Properties, W. H. Freeman & Co., San Francisco, 1983, pp. 79 ⁇ 86), acetylation of the N ⁇ terminal amine, and amidation of any C ⁇ terminal carboxyl group.
- Another type of covalent modification of the IL ⁇ 2 mutein, IL ⁇ 2 mutein Fc ⁇ fusion, or anti ⁇ IL ⁇ 2 antibody included within the scope of this invention comprises altering the glycosylation pattern of the protein.
- glycosylation patterns can depend on both the sequence of the protein (e.g., the presence or absence of particular glycosylation amino acid residues, discussed below), or the host cell or organism in which the protein is produced. Particular expression systems are discussed below.
- Glycosylation of polypeptides is typically either N ⁇ linked or O ⁇ linked. N ⁇ linked refers to the attachment of the carbohydrate moiety to the side chain of an asparagine residue.
- O ⁇ linked glycosylation refers to the attachment of one of the sugars N ⁇ acetylgalactosamine, galactose, or xylose, to a hydroxyamino acid, most commonly serine or threonine, although 5 ⁇ hydroxyproline or 5 ⁇ hydroxylysine may also be used.
- Addition of glycosylation sites to the IL ⁇ 2 mutein, IL ⁇ 2 mutein Fc ⁇ fusion, or anti ⁇ IL ⁇ 2 antibody may be conveniently accomplished by altering the amino acid sequence such that it contains one or more of the above ⁇ described tri ⁇ peptide sequences (for N ⁇ linked glycosylation sites).
- the alteration may also be made by the addition of, or substitution by, one or more serine or threonine residues to the starting sequence (for O ⁇ linked glycosylation sites).
- the IL ⁇ 2 mutein, IL ⁇ 2 mutein Fc ⁇ fusion, or anti ⁇ IL ⁇ 2 antibody amino acid sequence is preferably altered through changes at the DNA level, particularly by mutating the DNA encoding the target polypeptide at preselected bases such that codons are generated that will translate into the desired amino acids.
- Another means of increasing the number of carbohydrate moieties on the IL ⁇ 2 mutein, IL ⁇ 2 mutein Fc ⁇ fusion, or anti ⁇ IL ⁇ 2 antibody is by chemical or enzymatic coupling of glycosides to the protein. These procedures are advantageous in that they do not require production of the protein in a host cell that has glycosylation capabilities for N ⁇ and O ⁇ linked glycosylation.
- the sugar(s) may be attached to (a) arginine and histidine, (b) free carboxyl groups, (c) free sulfhydryl groups such as those of cysteine, (d) free hydroxyl groups such as those of serine, threonine, or hydroxyproline, (e) aromatic residues such as those of phenylalanine, tyrosine, or tryptophan, or (f) the amide group of glutamine.
- Removal of carbohydrate moieties present on the starting IL ⁇ 2 mutein, IL ⁇ 2 mutein Fc ⁇ fusion, or anti ⁇ IL ⁇ 2 antibody may be accomplished chemically or enzymatically.
- Chemical deglycosylation requires exposure of the protein to the compound trifluoromethanesulfonic acid, or an equivalent compound. This treatment results in the cleavage of most or all sugars except the linking sugar (N ⁇ acetylglucosamine or N ⁇ acetylgalactosamine), while leaving the polypeptide intact.
- Chemical deglycosylation is described by Hakimuddin et al., 1987, Arch. Biochem. Biophys. 259:52 and by Edge et al., 1981, Anal. Biochem. 118:131.
- Enzymatic cleavage of carbohydrate moieties on polypeptides can be achieved by the use of a variety of endo ⁇ and exo ⁇ glycosidases as described by Thotakura et al., 1987, Meth. Enzymol. 138:350. Glycosylation at potential glycosylation sites may be prevented
- Another type of covalent modification of the IL ⁇ 2/TNFR agonist molecule comprises linking the protein to various nonproteinaceous polymers, including, but not limited to, various polyols such as polyethylene glycol, polypropylene glycol or polyoxyalkylenes, in the manner set forth in U.S. Pat. Nos. 4,640,835; 4,496,689; 4,301,144; 4,670,417; 4,791,192 or 4,179,337.
- amino acid substitutions may be made in various positions within the IL ⁇ 2/TNFR agonist molecule to facilitate the addition of polymers such as PEG.
- embodiments of the invention include PEGylated IL ⁇ 2/TNFR agonist molecule.
- PEGylated proteins may have increased half ⁇ life and/or reduced immunogenicity over their non ⁇ PEGylated forms.
- Polynucleotides Encoding IL ⁇ 2/TNFR agonist molecules Encompassed within the invention are nucleic acids encoding IL ⁇ 2/TNFR agonist molecules. Aspects of the invention include polynucleotide variants (e.g., due to degeneracy) that encode the amino acid sequences described herein.
- Nucleotide sequences corresponding to the amino acid sequences described herein, to be used as probes or primers for the isolation of nucleic acids or as query sequences for database searches, can be obtained by “back ⁇ translation” from the amino acid sequences.
- the well ⁇ known polymerase chain reaction (PCR) procedure can be employed to isolate and amplify a DNA sequence encoding IL ⁇ 2 muteins and IL ⁇ 2 mutein Fc ⁇ fusion protein.
- Oligonucleotides that define the desired termini of the combination of DNA fragments are employed as 5' and 3' primers.
- the oligonucleotides can additionally contain recognition sites for restriction endonucleases, to facilitate insertion of the amplified combination of DNA fragments into an expression vector.
- Nucleic acid molecules of the invention include DNA and RNA in both single ⁇ stranded and double ⁇ stranded form, as well as the corresponding complementary sequences.
- isolated nucleic acid is a nucleic acid that has been separated from adjacent genetic sequences present in the genome of the organism from which the nucleic acid was isolated, in the case of nucleic acids isolated from naturally ⁇ occurring sources.
- nucleic acids synthesized enzymatically from a template or chemically, such as PCR products, cDNA molecules, or oligonucleotides for example it is understood that the nucleic acids resulting from such processes are isolated nucleic
- An isolated nucleic acid molecule refers to a nucleic acid molecule in the form of a separate fragment or as a component of a larger nucleic acid construct.
- the nucleic acids are substantially free from contaminating endogenous material.
- the nucleic acid molecule has preferably been derived from DNA or RNA isolated at least once in substantially pure form and in a quantity or concentration enabling identification, manipulation, and recovery of its component nucleotide sequences by standard biochemical methods (such as those outlined in Sambrook et al., Molecular Cloning: A Laboratory Manual, 2nd ed., Cold Spring Harbor Laboratory, Cold Spring Harbor, NY (1989)).
- sequences are preferably provided and/or constructed in the form of an open reading frame uninterrupted by internal non ⁇ translated sequences, or introns, that are typically present in eukaryotic genes. Sequences of non ⁇ translated DNA can be present 5' or 3' from an open reading frame, where the same do not interfere with manipulation or expression of the coding region.
- the IL ⁇ 2 muteins according to the invention are ordinarily prepared by site specific mutagenesis of nucleotides in the DNA encoding the IL ⁇ 2/TNFR agonist molecule, using cassette or PCR mutagenesis or other techniques well known in the art, to produce DNA encoding the variant, and thereafter expressing the recombinant DNA in cell culture as outlined herein.
- an IL ⁇ 2/TNFR agonist molecule may be prepared by in vitro synthesis using established techniques.
- the variants typically exhibit the same qualitative biological activity as the naturally occurring analogue, e.g., Treg expansion, although variants can also be selected which have modified characteristics as will be more fully outlined below.
- each IL ⁇ 2/TNFR agonist molecule of the present invention is encoded by an extremely large number of nucleic acids, each of which is within the scope of the invention and can be made using standard techniques.
- the present invention also provides expression systems and constructs in the form of plasmids, expression vectors, transcription or expression cassettes which comprise at least one polynucleotide as above.
- the invention provides host cells comprising such expression systems or constructs.
- expression vectors used in any of the host cells will contain sequences for plasmid maintenance and for cloning and expression of exogenous nucleotide sequences. Such sequences,
- flanking sequences in certain embodiments will typically include one or more of the following nucleotide sequences: a promoter, one or more enhancer sequences, an origin of replication, a transcriptional termination sequence, a complete intron sequence containing a donor and acceptor splice site, a sequence encoding a leader sequence for polypeptide secretion, a ribosome binding site, a polyadenylation sequence, a polylinker region for inserting the nucleic acid encoding the polypeptide to be expressed, and a selectable marker element.
- a promoter one or more enhancer sequences
- an origin of replication a transcriptional termination sequence
- a complete intron sequence containing a donor and acceptor splice site a sequence encoding a leader sequence for polypeptide secretion
- ribosome binding site a sequence encoding a leader sequence for polypeptide secretion
- polyadenylation sequence a polylinker region for inserting the nucleic acid encoding the poly
- the vector may contain a "tag” ⁇ encoding sequence, i.e., an oligonucleotide molecule located at the 5' or 3' end of the IL ⁇ 2/TNFR agonist molecule ⁇ encoding sequence; the oligonucleotide sequence encodes polyHis (such as hexaHis: HHHHHH (SEQ ID NO: 8)), or another "tag” such as FLAG, HA (hemaglutinin influenza virus), or myc, for which commercially available antibodies exist.
- This tag is typically fused to the polypeptide upon expression of the polypeptide, and can serve as a means for affinity purification or detection of it from the host cell.
- Affinity purification can be accomplished, for example, by column chromatography using antibodies against the tag as an affinity matrix.
- the tag can subsequently be removed by various means such as using certain peptidases for cleavage.
- Flanking sequences may be homologous (i.e., from the same species and/or strain as the host cell), heterologous (i.e., from a species other than the host cell species or strain), hybrid (i.e., a combination of flanking sequences from more than one source), synthetic or native.
- flanking sequence may be any prokaryotic or eukaryotic organism, any vertebrate or invertebrate organism, or any plant, provided that the flanking sequence is functional in, and can be activated by, the host cell machinery.
- Flanking sequences useful in the vectors of this invention may be obtained by any of several methods well known in the art. Typically, flanking sequences useful herein will have been previously identified by mapping and/or by restriction endonuclease digestion and can thus be isolated from the proper tissue source using the appropriate restriction endonucleases. In some cases, the full nucleotide sequence of a flanking sequence may be known.
- flanking sequence may be synthesized using the methods described herein for nucleic acid synthesis or cloning. Whether all or only a portion of the flanking sequence is known, it may be obtained using polymerase chain reaction (PCR) and/or by screening a genomic library with a suitable probe such as an oligonucleotide and/or flanking sequence fragment from the same or another species. Where the flanking sequence is not known, a fragment of DNA containing a flanking sequence may be
- Isolation may be accomplished by restriction endonuclease digestion to produce the proper DNA fragment followed by isolation using agarose gel purification, Qiagen ® column chromatography (Chatsworth, CA), or other methods known to the skilled artisan.
- the selection of suitable enzymes to accomplish this purpose will be readily apparent to one of ordinary skill in the art.
- An origin of replication is typically a part of those prokaryotic expression vectors purchased commercially, and the origin aids in the amplification of the vector in a host cell. If the vector of choice does not contain an origin of replication site, one may be chemically synthesized based on a known sequence, and ligated into the vector.
- the origin of replication from the plasmid pBR322 (New England Biolabs, Beverly, MA) is suitable for most gram ⁇ negative bacteria, and various viral origins (e.g., SV40, polyoma, adenovirus, vesicular stomatitus virus (VSV), or papillomaviruses such as HPV or BPV) are useful for cloning vectors in mammalian cells.
- the origin of replication component is not needed for mammalian expression vectors (for example, the SV40 origin is often used only because it also contains the virus early promoter).
- a transcription termination sequence is typically located 3' to the end of a polypeptide coding region and serves to terminate transcription.
- a transcription termination sequence in prokaryotic cells is a G ⁇ C rich fragment followed by a poly ⁇ T sequence. While the sequence is easily cloned from a library or even purchased commercially as part of a vector, it can also be readily synthesized using methods for nucleic acid synthesis such as those described herein.
- a selectable marker gene encodes a protein necessary for the survival and growth of a host cell grown in a selective culture medium. Typical selection marker genes encode proteins that (a) confer resistance to antibiotics or other toxins, e.g., ampicillin, tetracycline, or kanamycin for prokaryotic host cells; (b) complement auxotrophic deficiencies of the cell; or (c) supply critical nutrients not available from complex or defined media.
- selectable markers are the kanamycin resistance gene, the ampicillin resistance gene, and the tetracycline resistance gene.
- a neomycin resistance gene may also be used for selection in both prokaryotic and eukaryotic host cells.
- Other selectable genes may be used to amplify the gene that will be expressed. Amplification is the process wherein genes that are required for production of a protein critical for growth or cell survival are reiterated in tandem within the chromosomes of successive generations of recombinant cells. Examples of suitable selectable markers for mammalian cells include
- DHFR dihydrofolate reductase
- DHFR dihydrofolate reductase
- promoterless thymidine kinase genes Mammalian cell transformants are placed under selection pressure wherein only the transformants are uniquely adapted to survive by virtue of the selectable gene present in the vector. Selection pressure is imposed by culturing the transformed cells under conditions in which the concentration of selection agent in the medium is successively increased, thereby leading to the amplification of both the selectable gene and, consequently, of a gene that encodes a desired polypeptide, such as an IL ⁇ 2/TNFR agonist molecule. As a result, increased quantities of the polypeptide are synthesized from the amplified DNA.
- a ribosome ⁇ binding site is usually necessary for translation initiation of mRNA and is characterized by a Shine ⁇ Dalgarno sequence (prokaryotes) or a Kozak sequence (eukaryotes).
- the element is typically located 3' to the promoter and 5' to the coding sequence of the polypeptide to be expressed.
- one or more coding regions may be operably linked to an internal ribosome binding site (IRES), allowing translation of two open reading frames from a single RNA transcript.
- IRS internal ribosome binding site
- the final protein product may have, in the ⁇ 1 position (relative to the first amino acid of the mature protein) one or more additional amino acids incident to expression, which may not have been totally removed.
- the final protein product may have one or two amino acid residues found in the peptidase cleavage site, attached to the amino ⁇ terminus.
- use of some enzyme cleavage sites may result in a slightly truncated form of the desired polypeptide, if the enzyme cuts at such area within the mature polypeptide.
- Expression and cloning vectors of the invention will typically contain a promoter that is recognized by the host organism and operably linked to the molecule encoding the IL ⁇ 2/TNFR agonist molecule. Promoters are untranscribed sequences located upstream (i.e., 5') to the start codon of a structural gene (generally within about 100 to 1000 bp) that control transcription of the structural gene. Promoters are conventionally grouped into one of two classes: inducible promoters and constitutive promoters. Inducible promoters initiate increased levels of transcription from DNA under their control in response to some change in culture conditions, such as the presence or absence of a nutrient or a change in temperature.
- Constitutive promoters on the other hand, uniformly transcribe gene to which they are operably linked, that is, with little or no control over gene expression.
- a large number of promoters recognized by a variety of potential host cells, are well known. Suitable promoters for use with yeast hosts are also well known in the art. Yeast enhancers are advantageously used with yeast promoters.
- Suitable promoters for use with mammalian host cells are well known and include, but are not limited to, those obtained from the genomes of viruses such as polyoma virus, fowlpox virus, adenovirus (such as Adenovirus 2), bovine papilloma virus, avian sarcoma virus, cytomegalovirus, retroviruses, hepatitis ⁇ B virus and most preferably Simian Virus 40 (SV40).
- viruses such as polyoma virus, fowlpox virus, adenovirus (such as Adenovirus 2), bovine papilloma virus, avian sarcoma virus, cytomegalovirus, retroviruses, hepatitis ⁇ B virus and most preferably Simian Virus 40 (SV40).
- adenovirus such as Adenovirus 2
- bovine papilloma virus such as Adenovirus 2
- avian sarcoma virus such as Adenovirus
- Additional promoters which may be of interest include, but are not limited to: SV40 early promoter (Benoist and Chambon, 1981, Nature 290:304 ⁇ 310); CMV promoter (Thornsen et al., 1984, Proc. Natl. Acad. U.S.A. 81:659 ⁇ 663); the promoter contained in the 3' long terminal repeat of Rous sarcoma virus (Yamamoto et al., 1980, Cell 22:787 ⁇ 797); herpes thymidine kinase promoter (Wagner et al., 1981, Proc. Natl. Acad. Sci. U.S.A.
- elastase I gene control region that is active in pancreatic acinar cells (Swift et al., 1984, Cell 38:639 ⁇ 646; Ornitz et al., 1986, Cold Spring Harbor Symp. Quant. Biol.
- mice mammary tumor virus control region that is active in testicular, breast, lymphoid and mast cells (Leder et al., 1986, Cell 45:485 ⁇ 495); the albumin gene control region that is active in liver (Pinkert et al., 1987, Genes and Devel. 1 :268 ⁇ 276); the alpha ⁇ feto ⁇ protein gene control region that is active in liver (Krumlauf et al., 1985, Mol. Cell. Biol. 5:1639 ⁇ 1648; Hammer et al., 1987, Science 253:53 ⁇ 58); the alpha 1 ⁇ antitrypsin gene control region that is active in liver (Kelsey et al., 1987, Genes and Devel.
- Enhancers are cis ⁇ acting elements of DNA, usually about 10 ⁇ 300 bp in length, that act on the promoter to increase transcription. Enhancers are relatively orientation and position independent, having been found at positions both 5' and 3' to the transcription unit.
- enhancer sequences available from mammalian genes are known (e.g., globin, elastase, albumin, alpha ⁇ feto ⁇ protein and insulin).
- an enhancer from a virus is used.
- the SV40 enhancer, the cytomegalovirus early promoter enhancer, the polyoma enhancer, and adenovirus enhancers known in the art are exemplary enhancing elements for the activation of eukaryotic promoters. While an enhancer may be positioned in the vector either 5' or 3' to a coding sequence, it is typically located at a site 5' from the promoter. A sequence encoding an appropriate native or heterologous signal sequence (leader sequence or signal peptide) can be incorporated into an expression vector, to promote extracellular secretion of the IL ⁇ 2/TNFR agonist molecule.
- signal peptide or leader depends on the type of host cells in which the protein is to be produced, and a heterologous signal sequence can replace the native signal sequence.
- Examples of signal peptides that are functional in mammalian host cells include the following: the signal sequence for interleukin ⁇ 7 (IL ⁇ 7) described in US Patent No. 4,965,195; the signal sequence for interleukin ⁇ 2 receptor described in Cosman et al.,1984, Nature 312:768; the interleukin ⁇ 4 receptor signal peptide described in EP Patent No. 0367 566; the type I interleukin ⁇ 1 receptor signal peptide described in U.S. Patent No. 4,968,607; the type II interleukin ⁇ 1 receptor signal peptide described in EP Patent No.
- the vector may contain one or more elements that facilitate expression when the vector is integrated into the host cell genome. Examples include an EASE element (Aldrich et al. 2003 Biotechnol Prog. 19:1433 ⁇ 38) and a matrix attachment region (MAR). MARs mediate structural organization of the chromatin and may insulate the integrated vector from “position” effect. Thus, MARs are particularly useful when the vector is used to create stable transfectants.
- EASE element Aldrich et al. 2003 Biotechnol Prog. 19:1433 ⁇ 38
- MARs matrix attachment region
- a number of natural and synthetic MAR ⁇ containing nucleic acids are known in the art, e.g., U.S. Pat. Nos.
- Expression vectors of the invention may be constructed from a starting vector such as a commercially available vector. Such vectors may or may not contain all of the desired flanking sequences. Where one or more of the flanking sequences described herein are not already present
- the vector may be individually obtained and ligated into the vector. Methods used for obtaining each of the flanking sequences are well known to one skilled in the art.
- the completed vector may be inserted into a suitable host cell for amplification and/or polypeptide expression.
- the transformation of an expression vector into a selected host cell may be accomplished by well ⁇ known methods including transfection, infection, calcium phosphate co ⁇ precipitation, electroporation, microinjection, lipofection, DEAE ⁇ dextran mediated transfection, or other known techniques. The method selected will in part be a function of the type of host cell to be used.
- a host cell when cultured under appropriate conditions, synthesizes an IL ⁇ 2/TNFR agonist molecule that can subsequently be collected from the culture medium (if the host cell secretes it into the medium) or directly from the host cell producing it (if it is not secreted).
- the selection of an appropriate host cell will depend upon various factors, such as desired expression levels, polypeptide modifications that are desirable or necessary for activity (such as glycosylation or phosphorylation) and ease of folding into a biologically active molecule.
- a host cell may be eukaryotic or prokaryotic.
- Mammalian cell lines available as hosts for expression are well known in the art and include, but are not limited to, immortalized cell lines available from the American Type Culture Collection (ATCC) and any cell lines used in an expression system known in the art can be used to make the recombinant polypeptides of the invention.
- host cells are transformed with a recombinant expression vector that comprises DNA encoding a desired IL ⁇ 2/TNFR agonist molecule.
- the host cells that may be employed are prokaryotes, yeast or higher eukaryotic cells.
- Prokaryotes include gram negative or gram positive organisms, for example E. coli or bacilli.
- Higher eukaryotic cells include insect cells and established cell lines of mammalian origin.
- suitable mammalian host cell lines include the COS ⁇ 7 line of monkey kidney cells (ATCC CRL 1651) (Gluzman et al., 1981, Cell 23:175), L cells, 293 cells, C127 cells, 3T3 cells (ATCC CCL 163), Chinese hamster ovary (CHO) cells, or their derivatives such as Veggie CHO and related cell lines which grow in serum ⁇ free media (Rasmussen et al., 1998, Cytotechnology 28: 31), HeLa cells, BHK (ATCC CRL 10) cell lines, and the CVI/EBNA cell line derived from the African green monkey kidney cell line CVI (ATCC CCL 70) as described by McMahan et al., 1991, EMBO J. 10: 2821, human embryonic kidney cells such as 293, 293 EBNA or MSR 293, human epidermal A431 cells, human Colo205 cells, other
- transformed primate cell lines normal diploid cells, cell strains derived from in vitro culture of primary tissue, primary explants, HL ⁇ 60, U937, HaK or Jurkat cells.
- mammalian cell lines such as HepG2/3B, KB, NIH 3T3 or S49, for example, can be used for expression of the polypeptide when it is desirable to use the polypeptide in various signal transduction or reporter assays.
- Suitable yeasts include Saccharomyces cerevisiae, Schizosaccharomyces pombe, Kluyveromyces strains, Candida, or any yeast strain capable of expressing heterologous polypeptides.
- Suitable bacterial strains include Escherichia coli, Bacillus subtilis, Salmonella typhimurium, or any bacterial strain capable of expressing heterologous polypeptides. If the polypeptide is made in yeast or bacteria, it may be desirable to modify the polypeptide produced therein, for example by phosphorylation or glycosylation of the appropriate sites, in order to obtain the functional polypeptide. Such covalent attachments can be accomplished using known chemical or enzymatic methods.
- the polypeptide can also be produced by operably linking the isolated nucleic acid of the invention to suitable control sequences in one or more insect expression vectors, and employing an insect expression system.
- suitable control sequences in one or more insect expression vectors, and employing an insect expression system.
- Materials and methods for baculovirus/insect cell expression systems are commercially available in kit form from, e.g., Invitrogen, San Diego, Calif., U.S.A. (the MaxBac ⁇ kit), and such methods are well known in the art, as described in Summers and Smith, Texas Agricultural Experiment Station Bulletin No. 1555 (1987), and Luckow and Summers, Bio/Technology 6:47 (1988).
- Cell ⁇ free translation systems could also be employed to produce polypeptides using RNAs derived from nucleic acid constructs disclosed herein.
- the Fc portion and an IL ⁇ 2/TNFR agonist molecule are encoded within a single open ⁇ reading frame, optionally with a linker encoded between the Fc region and the IL ⁇ 2/TNFR agonist molecule.
- expression vectors comprising the above IL ⁇ 2/TNFR agonist molecule ⁇ encoding nucleic acids operably linked to a promoter.
- host cells comprising the isolated nucleic acids encoding the above IL ⁇ 2/TNFR agonist molecule.
- the host cell may be a prokaryotic cell, such as E. coli, or may be a eukaryotic cell, such as a mammalian cell.
- the host cell is a Chinese hamster ovary (CHO) cell line.
- methods of making an IL ⁇ 2/TNFR agonist molecule comprising culturing a host cell under conditions in which a promoter operably linked to a IL ⁇ 2/TNFR agonist molecule Fc ⁇ fusion protein is expressed.
- the IL ⁇ 2/TNFR agonist molecule Fc ⁇ fusion protein is harvested from said culture.
- the IL ⁇ 2/TNFR agonist molecule Fc ⁇ fusion protein may be harvested from the culture media and/or host cell lysates.
- Pharmaceutical Compositions In some embodiments, the invention provides a pharmaceutical composition comprising a therapeutically effective amount of an IL ⁇ 2/TNFR agonist molecule together with a pharmaceutically effective diluents, carrier, solubilizer, emulsifier, preservative, and/or adjuvant.
- the IL ⁇ 2 mutein is within the context of an IL ⁇ 2/TNFR agonist molecule Fc ⁇ fusion protein.
- compositions of the invention include, but are not limited to, liquid, frozen, and lyophilized compositions.
- formulation materials are nontoxic to recipients at the dosages and concentrations employed.
- pharmaceutical compositions comprising a therapeutically effective amount of an IL ⁇ 2/TNFR agonist molecule containing therapeutic molecule, e.g, an IL ⁇ 2/TNFR agonist molecule Fc ⁇ fusion, are provided.
- the pharmaceutical composition may contain formulation materials for modifying, maintaining or preserving, for example, the pH, osmolarity, viscosity, clarity, color, isotonicity, odor, sterility, stability, rate of dissolution or release, adsorption or penetration of the composition.
- suitable formulation materials include, but are not limited to, amino acids (such as glycine, glutamine, asparagine, arginine, proline, or lysine); antimicrobials; antioxidants (such as ascorbic acid, sodium sulfite or sodium hydrogen ⁇ sulfite); buffers (such as borate, bicarbonate, Tris ⁇ HCl, citrates, phosphates or other organic acids); bulking agents (such as mannitol or glycine); chelating agents (such as ethylenediamine tetraacetic acid (EDTA)); complexing agents (such as caffeine, polyvinylpyrrolidone, beta ⁇ cyclodextrin or hydroxypropyl ⁇ beta ⁇ cyclodextrin); fillers; monosaccharides; disaccharides; and other carbohydrates (such as glucose, mannose or dextrins); proteins (such as serum albumin, gelatin or immunoglobulins); coloring, flavoring and diluting agents; e
- amino acids
- polyvinylpyrrolidone low molecular weight polypeptides
- salt ⁇ forming counterions such as sodium
- preservatives such as benzalkonium chloride, benzoic acid, salicylic acid, thimerosal, phenethyl alcohol, methylparaben, propylparaben, chlorhexidine, sorbic acid or hydrogen peroxide
- solvents such as glycerin, propylene glycol or polyethylene glycol
- sugar alcohols such as mannitol or sorbitol
- suspending agents such as pluronics, PEG, sorbitan esters, polysorbates such as polysorbate 20, polysorbate, triton, tromethamine, lecithin, cholesterol, tyloxapal
- stability enhancing agents such as sucrose or sorbitol
- tonicity enhancing agents such as alkali metal halides, preferably sodium or potassium chloride, mannitol sorbitol
- the optimal pharmaceutical composition will be determined by one skilled in the art depending upon, for example, the intended route of administration, delivery format and desired dosage. See, for example, REMINGTON'S PHARMACEUTICAL SCIENCES, supra.
- such compositions may influence the physical state, stability, rate of in vivo release and rate of in vivo clearance of the antigen binding proteins of the invention.
- the primary vehicle or carrier in a pharmaceutical composition may be either aqueous or non ⁇ aqueous in nature.
- a suitable vehicle or carrier may be water for injection, physiological saline solution or artificial cerebrospinal fluid, possibly supplemented with other materials common in compositions for parenteral administration.
- Neutral buffered saline or saline mixed with serum albumin are further exemplary vehicles.
- pharmaceutical compositions comprise Tris buffer of about pH 7.0 ⁇ 8.5, or acetate buffer of about pH 4.0 ⁇ 5.5, and may further include sorbitol or a suitable substitute therefor.
- the therapeutic compositions for use in this invention may be provided in the form of a pyrogen ⁇ free, parenterally acceptable aqueous solution comprising the desired IL ⁇ 2/TNFR agonist molecule composition in a pharmaceutically acceptable vehicle.
- a particularly suitable vehicle for parenteral injection is sterile distilled water in which the IL ⁇ 2/TNFR agonist molecule composition is formulated as a sterile, isotonic solution, properly preserved.
- the preparation can involve the formulation of the desired molecule with an agent, such as injectable microspheres, bio ⁇ erodible particles, polymeric compounds (such as polylactic acid or polyglycolic acid), beads or liposomes, that may provide controlled or sustained release of the product which can be delivered via depot injection.
- an agent such as injectable microspheres, bio ⁇ erodible particles, polymeric compounds (such as polylactic acid or polyglycolic acid), beads or liposomes, that may provide controlled or sustained release of the product which can be delivered via depot injection.
- hyaluronic acid may also be used, having the effect of promoting sustained duration in the circulation.
- implantable drug delivery devices may be used to introduce the IL ⁇ 2/TNFR agonist molecule. Additional pharmaceutical compositions will be evident to those skilled in the art, including formulations involving IL ⁇ 2/TNFR agonist molecule compositions in sustained ⁇ or controlled ⁇ delivery formulations.
- sustained ⁇ or controlled ⁇ delivery means such as liposome carriers, bio ⁇ erodible microparticles or porous beads and depot injections. See, for example, International Patent Application No. PCT/US93/00829, which is incorporated by reference and describes controlled release of porous polymeric microparticles for delivery of pharmaceutical compositions.
- Sustained ⁇ release preparations may include semipermeable polymer matrices in the form of shaped articles, e.g., films, or microcapsules.
- Sustained release matrices may include polyesters, hydrogels, polylactides (as disclosed in U.S. Pat. No. 3,773,919 and European Patent Application Publication No.
- Sustained release compositions may also include liposomes that can be prepared by any of several methods known in the art. See, e.g., Eppstein et al., 1985, Proc. Natl. Acad. Sci. U.S.A. 82:3688 ⁇ 3692; European Patent Application Publication Nos. EP 036,676; EP 088,046 and EP 143,949, incorporated by reference.
- compositions used for in vivo administration are typically provided as sterile preparations. Sterilization can be accomplished by filtration through sterile filtration membranes. When the composition is lyophilized, sterilization using this method may be conducted either prior to or following lyophilization and reconstitution.
- Compositions for parenteral administration can be stored in lyophilized form or in a solution. Parenteral compositions generally are placed into a container having a sterile access port, for example, an intravenous solution bag or vial having a stopper pierceable by a hypodermic injection needle.
- IL ⁇ 2/TNFR agonist molecule formulations which can be used as pharmaceutical compositions, as described in international patent application WO 06138181A2 (PCT/US2006/022599), which is incorporated by reference in its entirety herein.
- certain embodiments provide IL ⁇ 2/TNFR agonist molecule compositions, particularly pharmaceutical IL ⁇ 2/TNFR agonist molecule Fc ⁇ fusion proteins, that comprise, in addition to the IL ⁇ 2/TNFR agonist molecule composition, one or more excipients such as those illustratively described in this section and elsewhere herein.
- Excipients can be used in the invention in this regard for a wide variety of purposes, such as adjusting physical, chemical, or biological properties of formulations, such as adjustment of viscosity, and or processes of the invention to improve effectiveness and or to stabilize such formulations and processes against degradation and spoilage due to, for instance, stresses that occur during manufacturing, shipping, storage, pre ⁇ use preparation, administration, and thereafter.
- a variety of expositions are available on protein stabilization and formulation materials and methods useful in this regard, such as Arakawa et al., "Solvent interactions in pharmaceutical formulations," Pharm Res.
- Salts may be used in accordance with certain embodiments of the invention to, for example, adjust the ionic strength and/or the isotonicity of a formulation and/or to improve the solubility
- ions can stabilize the native state of proteins by binding to charged residues on the protein's surface and by shielding charged and polar groups in the protein and reducing the strength of their electrostatic interactions, attractive, and repulsive interactions. Ions also can stabilize the denatured state of a protein by binding to, in particular, the denatured peptide linkages ( ⁇ CONH) of the protein. Furthermore, ionic interaction with charged and polar groups in a protein also can reduce intermolecular electrostatic interactions and, thereby, prevent or reduce protein aggregation and insolubility. Ionic species differ significantly in their effects on proteins.
- Hofmeister series which ranks ionic and polar non ⁇ ionic solutes by their effect on the conformational stability of proteins in solution.
- Stabilizing solutes are referred to as "kosmotropic.”
- Destabilizing solutes are referred to as “chaotropic.”
- Kosmotropes commonly are used at high concentrations (e.g., >1 molar ammonium sulfate) to precipitate proteins from solution (“salting ⁇ out”).
- Chaotropes commonly are used to denture and/or to solubilize proteins ("salting ⁇ in”).
- Free amino acids can be used in IL ⁇ 2/TNFR agonist molecule formulations in accordance with various embodiments of the invention as bulking agents, stabilizers, and antioxidants, as well as other standard uses.
- Lysine, proline, serine, and alanine can be used for stabilizing proteins in a formulation.
- Glycine is useful in lyophilization to ensure correct cake structure and properties.
- Arginine may be useful to inhibit protein aggregation, in both liquid and lyophilized formulations.
- Methionine is useful as an antioxidant.
- Polyols include sugars, e.g., mannitol, sucrose, and sorbitol and polyhydric alcohols such as, for instance, glycerol and propylene glycol, and, for purposes of discussion herein, polyethylene glycol (PEG) and related substances.
- Polyols are kosmotropic. They are useful stabilizing agents in both liquid and lyophilized formulations to protect proteins from physical and chemical degradation processes. Polyols also are useful for adjusting the tonicity of formulations.
- mannitol commonly used to ensure structural stability of the cake in lyophilized formulations. It ensures structural stability to the cake. It is generally used with a lyoprotectant, e.g., sucrose. Sorbitol and sucrose are among
- preferred agents for adjusting tonicity and as stabilizers to protect against freeze ⁇ thaw stresses during transport or the preparation of bulks during the manufacturing process Reducing sugars (which contain free aldehyde or ketone groups), such as glucose and lactose, can glycate surface lysine and arginine residues. Therefore, they generally are not among preferred polyols for use in accordance with the invention.
- sugars that form such reactive species such as sucrose, which is hydrolyzed to fructose and glucose under acidic conditions, and consequently engenders glycation, also is not among preferred polyols of the invention in this regard.
- PEG is useful to stabilize proteins and as a cryoprotectant and can be used in the invention in this regard.
- Embodiments of IL ⁇ 2/TNFR agonist molecule formulations further comprise surfactants.
- Protein molecules may be susceptible to adsorption on surfaces and to denaturation and consequent aggregation at air ⁇ liquid, solid ⁇ liquid, and liquid ⁇ liquid interfaces. These effects generally scale inversely with protein concentration. These deleterious interactions generally scale inversely with protein concentration and typically are exacerbated by physical agitation, such as that generated during the shipping and handling of a product.
- Surfactants routinely are used to prevent, minimize, or reduce surface adsorption.
- Useful surfactants in the invention in this regard include polysorbate 20, polysorbate 80, other fatty acid esters of sorbitan polyethoxylates, and poloxamer 188.
- surfactants also are commonly used to control protein conformational stability.
- the use of surfactants in this regard is protein ⁇ specific since, any given surfactant typically will stabilize some proteins and destabilize others.
- Polysorbates are susceptible to oxidative degradation and often, as supplied, contain sufficient quantities of peroxides to cause oxidation of protein residue side ⁇ chains, especially methionine. Consequently, polysorbates should be used carefully, and when used, should be employed at their lowest effective concentration. In this regard, polysorbates exemplify the general rule that excipients should be used in their lowest effective concentrations.
- Embodiments of IL ⁇ 2/TNFR agonist molecule formulations further comprise one or more antioxidants.
- Antioxidant excipients can be used as well to prevent oxidative degradation of proteins.
- useful antioxidants in this regard are reducing agents, oxygen/free ⁇ radical scavengers, and chelating agents.
- Antioxidants for use in therapeutic protein formulations in accordance with the invention preferably are water ⁇ soluble and maintain their activity throughout
- Magnesium ions (10 ⁇ 120 mM) can be used to inhibit isomerization of aspartic acid to isoaspartic acid.
- Ca +2 ions (up to 100 mM) can increase the stability of human deoxyribonuclease. Mg +2 , Mn +2 , and Zn +2 , however, can destabilize rhDNase.
- Ca +2 and Sr +2 can stabilize Factor VIII, it can be destabilized by Mg +2 , Mn +2 and Zn +2 , Cu +2 and Fe +2 , and its aggregation can be increased by Al +3 ions.
- Embodiments of IL ⁇ 2/TNFR agonist molecule formulations further comprise one or more preservatives.
- Preservatives are necessary when developing multi ⁇ dose parenteral formulations that involve more than one extraction from the same container. Their primary function is to inhibit microbial growth and ensure product sterility throughout the shelf ⁇ life or term of use of the drug product. Commonly used preservatives include benzyl alcohol, phenol and m ⁇ cresol. Although preservatives have a long history of use with small ⁇ molecule parenterals, the development of protein formulations that includes preservatives can be challenging. Preservatives almost always have a destabilizing effect (aggregation) on proteins, and this has become a major factor in limiting their use in multi ⁇ dose protein formulations. To date, most protein drugs have been formulated for single ⁇ use only.
- hGH human growth hormone
- the effective preservative concentration in the drug product must be optimized. This requires testing a given preservative in the dosage form with concentration ranges that confer anti ⁇ microbial effectiveness without compromising protein stability.
- the present invention provides IL ⁇ 2/TNFR agonist molecules, or Fc ⁇ fusions of IL ⁇ 2/TNFR agonist molecules, in lyophilized formulations. Freeze ⁇ dried products can be lyophilized without the preservative and reconstituted with a preservative containing diluent at the time of use. This shortens the time for which a preservative is in contact with the protein, significantly minimizing the associated stability risks.
- IL ⁇ 2/TNFR agonist molecule formulations generally will be designed for specific routes and methods of administration, for specific administration dosages and frequencies of administration, for specific treatments of specific diseases, with ranges of bio ⁇ availability and persistence, among other things.
- Formulations thus may be designed in accordance with the invention for delivery by any suitable route, including but not limited to orally, aurally, opthalmically, rectally, and vaginally, and by parenteral routes, including intravenous and intraarterial injection, intramuscular injection, and subcutaneous injection.
- kits for producing a single ⁇ dose administration unit may each contain both a first container having a dried protein and a second container having an aqueous formulation.
- kits containing single and multi ⁇ chambered pre ⁇ filled syringes e.g., liquid syringes and lyosyringes are provided.
- an IL ⁇ 2/TNFR agonist molecule ⁇ containing pharmaceutical composition to be employed will depend, for example, upon the therapeutic context and objectives.
- dosage levels for treatment will vary depending, in part, upon the molecule delivered, the indication for which the IL ⁇ 2/TNFR agonist molecule is being used, the route of administration, and the size (body weight, body
- a typical dosage may range from about 0.1 ⁇ g /kg to up to about 1 mg/kg or more, depending on the factors mentioned above. In specific embodiments, the dosage may range from 0.5 ⁇ g /kg up to about 100 ⁇ g /kg, optionally from 2.5 ⁇ g /kg up to about 50 ⁇ g /kg.
- a therapeutic effective amount of an IL ⁇ 2/TNFR agonist molecule preferably results in a decrease in severity of disease symptoms, in an increase in frequency or duration of disease symptom ⁇ free periods, or in a prevention of impairment or disability due to the disease affliction.
- compositions may be administered using a medical device.
- medical devices for administering pharmaceutical compositions are described in U.S. Patent Nos. 4,475,196; 4,439,196; 4,447,224; 4,447, 233; 4,486,194; 4,487,603; 4,596,556; 4,790,824; 4,941,880; 5,064,413; 5,312,335; 5,312,335; 5,383,851; and 5,399,163, all incorporated by reference herein.
- a pharmaceutical composition is provided comprising Methods of Treating Autoimmune or Inflammatory Disorders
- an IL ⁇ 2/TNFR agonist molecule of the invention is used to treat an autoimmune or inflammatory disorder.
- an IL ⁇ 2/TNFR agonist molecule Fc ⁇ fusion protein is used.
- Disorders that are particularly amenable to treatment with IL ⁇ 2 mutein or anti ⁇ IL ⁇ 2 antibody disclosed herein include, but are not limited to, inflammation, autoimmune disease, atopic diseases, paraneoplastic autoimmune diseases, cartilage inflammation, arthritis, rheumatoid arthritis, juvenile arthritis, juvenile rheumatoid arthritis, pauciarticular juvenile rheumatoid arthritis, polyarticular juvenile rheumatoid arthritis, systemic onset juvenile rheumatoid arthritis, juvenile ankylosing spondylitis, juvenile enteropathic arthritis, juvenile reactive arthritis, juvenile Reiter's Syndrome, SEA Syndrome (Seronegativity, Enthesopathy, Arthropathy Syndrome), juvenile dermatomyositis, juvenile psoriatic arthritis, juvenile scleroderma, juvenile systemic lupus erythematosus, juvenile vasculitis, pauciarticular r
- erythrodermic psoriasis erythrodermic psoriasis, dermatitis, atopic dermatitis, atherosclerosis, lupus, Still's disease, Systemic Lupus Erythematosus (SLE), myasthenia gravis, inflammatory bowel disease (IBD), Crohn's disease, ulcerative colitis, celiac disease, multiple sclerosis (MS), asthma, COPD, , rhinosinusitis, rhinosinusitis with polyps, eosinophilic esophogitis, eosinophilic bronchitis, Guillain ⁇ Barre disease, Type I diabetes mellitus, thyroiditis(e.g., Graves' disease), Addison's disease, Raynaud's phenomenon, autoimmune hepatitis, GVHD, transplantation rejection, kidney damage, hepatitis C ⁇ induced vasculitis, spontaneous loss of pregnancy, and the like.
- the autoimmune or inflammatory disorder is Systemic Lupus Erythematosus (SLE), graft ⁇ versus ⁇ host disease, hepatitis C ⁇ induced vasculitis, Type I diabetes, rheumatoid arthritis, multiple sclerosis, spontaneous loss of pregnancy, atopic diseases, and inflammatory bowel diseases, including ulcerative colitis, celiac disease.
- SLE Systemic Lupus Erythematosus
- graft ⁇ versus ⁇ host disease hepatitis C ⁇ induced vasculitis
- Type I diabetes rheumatoid arthritis
- multiple sclerosis multiple sclerosis
- spontaneous loss of pregnancy atopic diseases
- inflammatory bowel diseases including ulcerative colitis, celiac disease.
- a patient having or at risk for developing an autoimmune or inflammatory disorder is treated with an IL ⁇ 2/TNFR agonist molecule (for example, an IL ⁇ 2/TNFR agonist molecule disclosed herein, such as an IL ⁇ 2/TNFR agonist molecule Fc ⁇ fusion as disclosed here
- the patient’s response that is monitored can be any detectable or measurable response of the patient to the treatment, or any combination of such responses.
- the response can be a change in a physiological state of the patient, such as body temperature or fever, appetence, sweating, headache, nausea, fatigue, hunger, thirst, mental acuity, or the like.
- the response can be a change in the amount of a cell type or gene product (for example, a protein, peptide, or nucleic acid), for example, in a sample of peripheral blood taken from the patient.
- the patient’s treatment regimen is altered if the patient has a detectable or measurable response to the treatment, or if such response crosses a particular threshold.
- the alteration can be a reduction or increase in the frequency in dosing, or a reduction or increase in the amount of the IL ⁇ 2/TNFR agonist molecule administered per dose, or a “holiday” from dosing (i.e., a temporary cessation of treatment, either for a specified period of time, or until a treating physician determines that treatment should continue, or until a monitored response of the patient indicates that treatment should or can resume), or the termination of treatment.
- the response is a change in the patient’s temperature or CRP levels.
- the response can be an increase in the patient’s body temperature, or an increase of the CRP levels in a sample of peripheral blood, or both.
- the patient’s treatment is reduced, suspended, or terminated if the patient’s body temperature increases during the course of treatment by at least 0.1°, 0.2°, 0.3°, 0.4°, 0.5°, 0.7°, 1°, 1.5°, 2°, or 2.5° C. . In another particular embodiment, the patient’s treatment is reduced,
- NK cells NK cells
- Treg cells FOXP3 ⁇ CD4 T cells
- FOXP3 + CD4 T cells FOXP3 ⁇ CD8 T cells
- eosinophils eosinophils
- Increases of these cell types can be detected, for example, as an increase in the number of such cells per unit of peripheral blood (for example, expressed as an increase in cells per milliliter of blood) or as an increase in the percentage of such cell type compared to another type of cell or cells in the blood sample.
- Another patient reaction that can be monitored is an increase in the amount of cell surface ⁇ bound IL ⁇ 2/TNFR agonist molecule on CD25 + cells in a sample of the patient’s peripheral blood.
- Methods of Expanding Treg Cells The IL ⁇ 2/TNFR agonist molecule, or IL ⁇ 2/TNFR agonist molecule Fc ⁇ fusion protein may be used to expand Treg cells within a subject or sample.
- Provided herein are methods of increasing the ratio of Tregs to non ⁇ regulatory T cells. The method comprises contacting a population of T cells with an effective amount of a human IL ⁇ 2/TNFR agonist molecule or IL ⁇ 2/TNFR agonist molecule Fc ⁇ fusion.
- the ratio may be measured by determining the ratio of CD3+FOXP3+ cells to CD3+FOXP3 ⁇ cells within the population of T cells.
- the typical Treg frequency in human blood is 5 ⁇ 10% of total CD4+CD3+ T cells, however, in the diseases listed above this percentage may be lower or higher.
- the percentage of Treg increases at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 100%, at least 200%, at least 300%, at least 400%, at least 500%, at least 600%, at least 700%, at least 800%, at least 900%,or at least 1000%.
- a maximal Treg frequency that might be obtained through IL ⁇ 2 mutein treatment is 50% or 60% of total CD4+CD3+ T cells.
- the IL ⁇ 2/TNFR agonist molecule, or IL ⁇ 2/TNFR agonist molecule Fc ⁇ fusion protein is administered to a subject and the ratio of regulatory T cells (Tregs) to non ⁇ regulatory T cells within peripheral blood of a subject increases.
- IL ⁇ 2/TNFR agonist molecule and IL ⁇ 2/TNFR agonist molecule Fc ⁇ fusion proteins and other combinations of IL ⁇ 2 and TNFR preferentially expand Tregs over other cell types, they also are useful for increasing the ratio of regulatory T cells (Tregs) to natural killer (NK) cells and/or the ratio of Tregs to cytotoxic T cells (Tcons) within the peripheral blood of a subject.
- the ratio may be measured by determining the ratio of CD3+FOXP3+ cells to CD16+ and/or CD56+ lymphocytes that are CD19 ⁇ and CD3 ⁇ .
- the IL ⁇ 2/TNFR agonist molecule, and IL ⁇ 2/TNFR agonist molecule Fc ⁇ fusion proteins and combinations of IL ⁇ 2 and TNFR not only preferentially expand Tregs over other cell types, but also decreases the levels of other cell types, including Tcons, for example CD4+ and/or CD8+ Tcons and/or NK cells.
- Tcons for example CD4+ and/or CD8+ Tcons and/or NK cells.
- the levels of Tcons, for example CD4+ and/or CD8+ Tcons and/or NK cells is lower than the levels of those cells following administration of IL ⁇ 2 alone.
- the level of decrease is by 10%, 20%, 30%, 40%, 50%, 60%, 70% or more.
- the levels of Tcons for example CD4+ and/or CD8+ Tcons and/or NK cells is lower than the levels at baseline (for example, control in Example 2 and Figure 6).
- the level of decrease is by 10%, 20%, 30%, 40%, 50%, 60%, 70% or more. It is contemplated that the IL ⁇ 2/TNFR agonist molecule, or IL ⁇ 2/TNFR agonist molecule Fc ⁇ fusion protein may have a therapeutic effect on a disease or disorder within a patient without significantly expanding the ratio of Tregs to non ⁇ regulatory T cells or NK cells within the peripheral blood of the patient.
- the therapeutic effect may be due to localized activity of the IL ⁇ 2/TNFR agonist molecule, or IL ⁇ 2/TNFR agonist molecule Fc ⁇ fusion protein at the site of inflammation or autoimmunity.
- Example 1 Combined agonism of TNFR and IL ⁇ 2R promotes Treg cell expansion
- human peripheral blood mononuclear cells were labeled with cell trace violet and treated with various TNFR agonists (anti ⁇ OX40, anti ⁇ DR3, TNF) along with IL ⁇ 2 and analyzed 4 days later.
- Cells stimulated with anti ⁇ CD3 show robust proliferation and serve as a positive control for the assay. Stimulation with IL2 or control IgG did not result in any CTV dilution. No proliferation was observed with any of the indicated TNFR
- PBMC from healthy human donors were labeled with cell trace violet (Invitrogen) according to the manufacturer’s instructions and cultured in x ⁇ vivo 15 media (Lonza). Reagents were obtained from following sources: TNF (R&D systems), anti ⁇ DR3 (Biolegend) and anti ⁇ OX40 (having heavy chain sequence of SEQ ID NO:9 and light chain sequence of SEQ ID NO:10). Samples were analyzed on Symphony flowcytometer (BD biosciences) and data were analyzed using Flojo software.
- Figure 1 shows proliferation of Tregs upon stimulation with IL ⁇ 2 in combination with a TNFR agonist (anti ⁇ OX40, recombinant TNF, or anti ⁇ DR3).
- CTV Cell Trace Violet
- human PBMCs were stimulated with indicated reagents for 4 days followed by flow cytometry analysis. Histograms are arranged in the following order (from bottom to top): Unstimulated, stimulated with 1 ⁇ g/ml anti ⁇ CD3, 20U/ml IL ⁇ 2, IgG, TNFR agonist (anti ⁇ OX40, recombinant TNF, anti ⁇ DR3), TNFR agonist plus IL ⁇ 2. Histograms were gated on Treg cells (CD4+Foxp3+).
- FIG. 1 shows histogram plots of anti ⁇ OX40 and IL ⁇ 2 on PBMCs.
- Figure 3 shows histogram plots of TNF and IL ⁇ 2 on PBMCs.
- Figure 4 shows histogram plots of anti ⁇ DR3 and IL ⁇ 2 on PBMCs.
- Figure 5 shows histogram plots of anti ⁇ GITR and IL ⁇ 2 on PBMCs.
- Tregs were identified as CD4+Foxp3+, activated T cells as CD4+Foxp3 ⁇ CD25+, activated CD8 as CD8+CD44+ and NK/ILC as CD4 ⁇ CD8 ⁇ NK1.1+. Results are representative of two independent experiments. Data are shown as fold expansion over control (value set to 1). The results are shown in Figure 7. Treatment with IL2 alone resulted in expansion of Treg cells in several tissues; however, increased frequencies of activated CD4 and CD8 cells as well as NK cells were also observed. Anti ⁇ OX40 treatment also resulted in Treg expansion on a similar scale as compared to IL2 without much effect on other immune cell types. Anti ⁇ OX40 ⁇ IL2 fusion administration lead to a much higher fold expansion of Treg cells as compared to IL2 or anti ⁇ OX40 alone with minimal effect on other cells. Furthermore, anti ⁇ OX40 ⁇ IL2 fusion mediated Treg cell
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Engineering & Computer Science (AREA)
- Organic Chemistry (AREA)
- Immunology (AREA)
- Genetics & Genomics (AREA)
- General Health & Medical Sciences (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Medicinal Chemistry (AREA)
- Zoology (AREA)
- Biomedical Technology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Molecular Biology (AREA)
- Biochemistry (AREA)
- Veterinary Medicine (AREA)
- Pharmacology & Pharmacy (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Biotechnology (AREA)
- Biophysics (AREA)
- Wood Science & Technology (AREA)
- Gastroenterology & Hepatology (AREA)
- General Engineering & Computer Science (AREA)
- Microbiology (AREA)
- Epidemiology (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Toxicology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Cell Biology (AREA)
- Hematology (AREA)
- Plant Pathology (AREA)
- Physics & Mathematics (AREA)
- Mycology (AREA)
- Rheumatology (AREA)
- Pain & Pain Management (AREA)
- Transplantation (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
Priority Applications (15)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| AU2020407208A AU2020407208A1 (en) | 2019-12-17 | 2020-12-17 | Dual interleukin-2 /tnf receptor agonist for use in therapy |
| BR112022011949A BR112022011949A2 (pt) | 2019-12-17 | 2020-12-17 | Dupla de interleucina-2/agonista do receptor tnf para uso em terapia |
| US17/786,375 US20230040604A1 (en) | 2019-12-17 | 2020-12-17 | Interleukin-2 in combination with tnf receptor family members for the expansion of t-regulatory cells |
| PH1/2022/551428A PH12022551428A1 (en) | 2019-12-17 | 2020-12-17 | Dual interleukin-2 /tnf receptor agonist for use in therapy |
| CR20220341A CR20220341A (es) | 2019-12-17 | 2020-12-17 | Agonista doble de interleucina-2/receptor de tnf para uso en terapia |
| KR1020227023807A KR20220114595A (ko) | 2019-12-17 | 2020-12-17 | 치료에서의 사용을 위한 이중 인터류킨-2/tnf 수용체 효현제 |
| PE2022001107A PE20221506A1 (es) | 2019-12-17 | 2020-12-17 | Agonista doble de interleucina-2/receptor de tnf para uso en terapia |
| CN202080087668.8A CN114867749A (zh) | 2019-12-17 | 2020-12-17 | 用于疗法中的双重白介素-2/tnf受体激动剂 |
| MX2022007712A MX2022007712A (es) | 2019-12-17 | 2020-12-17 | Agonista doble de interleucina-2/receptor de tnf para uso en terapia. |
| EP20842768.2A EP4077383A1 (en) | 2019-12-17 | 2020-12-17 | Dual interleukin-2 /tnf receptor agonist for use in therapy |
| IL293471A IL293471A (en) | 2019-12-17 | 2020-12-17 | Dual interleukin-2 / tnf receptor agonist for use in medicine |
| JP2022536572A JP7755581B2 (ja) | 2019-12-17 | 2020-12-17 | 治療における使用のためのデュアルインターロイキン-2/tnf受容体アゴニスト |
| CA3162705A CA3162705A1 (en) | 2019-12-17 | 2020-12-17 | Dual interleukin-2 /tnf receptor agonist for use in therapy |
| JOP/2022/0151A JOP20220151A1 (ar) | 2019-12-17 | 2020-12-17 | ناهض مستقبل إنترلوكين -2 / tnf المزدوج للاستخدام في العلاج |
| CONC2022/0008768A CO2022008768A2 (es) | 2019-12-17 | 2022-06-23 | Agonista doble de interleucina-2/receptor de tnf para uso en terapia |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201962949380P | 2019-12-17 | 2019-12-17 | |
| US62/949,380 | 2019-12-17 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2021127262A1 true WO2021127262A1 (en) | 2021-06-24 |
Family
ID=74191856
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2020/065734 Ceased WO2021127262A1 (en) | 2019-12-17 | 2020-12-17 | Dual interleukin-2 /tnf receptor agonist for use in therapy |
Country Status (17)
| Country | Link |
|---|---|
| US (1) | US20230040604A1 (enExample) |
| EP (1) | EP4077383A1 (enExample) |
| JP (1) | JP7755581B2 (enExample) |
| KR (1) | KR20220114595A (enExample) |
| CN (1) | CN114867749A (enExample) |
| AU (1) | AU2020407208A1 (enExample) |
| BR (1) | BR112022011949A2 (enExample) |
| CA (1) | CA3162705A1 (enExample) |
| CL (1) | CL2022001638A1 (enExample) |
| CO (1) | CO2022008768A2 (enExample) |
| CR (1) | CR20220341A (enExample) |
| IL (1) | IL293471A (enExample) |
| JO (1) | JOP20220151A1 (enExample) |
| MX (1) | MX2022007712A (enExample) |
| PE (1) | PE20221506A1 (enExample) |
| PH (1) | PH12022551428A1 (enExample) |
| WO (1) | WO2021127262A1 (enExample) |
Cited By (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP4385573A3 (en) * | 2019-08-13 | 2024-09-11 | Amgen Inc. | Interleukin-2 muteins for the expansion of t-regulatory cells |
| WO2026006809A1 (en) * | 2024-06-27 | 2026-01-02 | Odyssey Therapeutics, Inc. | Multispecific molecules binding tnfr2 and cd25 and uses thereof |
Citations (74)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US233A (en) | 1837-06-14 | Improvement in plows | ||
| US4447A (en) | 1846-04-04 | Car- wheel | ||
| US3691016A (en) | 1970-04-17 | 1972-09-12 | Monsanto Co | Process for the preparation of insoluble enzymes |
| US3773919A (en) | 1969-10-23 | 1973-11-20 | Du Pont | Polylactide-drug mixtures |
| US3969287A (en) | 1972-12-08 | 1976-07-13 | Boehringer Mannheim Gmbh | Carrier-bound protein prepared by reacting the protein with an acylating or alkylating compound having a carrier-bonding group and reacting the product with a carrier |
| US4179337A (en) | 1973-07-20 | 1979-12-18 | Davis Frank F | Non-immunogenic polypeptides |
| US4195128A (en) | 1976-05-03 | 1980-03-25 | Bayer Aktiengesellschaft | Polymeric carrier bound ligands |
| US4229537A (en) | 1978-02-09 | 1980-10-21 | New York University | Preparation of trichloro-s-triazine activated supports for coupling ligands |
| US4247642A (en) | 1977-02-17 | 1981-01-27 | Sumitomo Chemical Company, Limited | Enzyme immobilization with pullulan gel |
| EP0036676A1 (en) | 1978-03-24 | 1981-09-30 | The Regents Of The University Of California | Method of making uniformly sized liposomes and liposomes so made |
| US4301144A (en) | 1979-07-11 | 1981-11-17 | Ajinomoto Company, Incorporated | Blood substitute containing modified hemoglobin |
| US4330440A (en) | 1977-02-08 | 1982-05-18 | Development Finance Corporation Of New Zealand | Activated matrix and method of activation |
| EP0058481A1 (en) | 1981-02-16 | 1982-08-25 | Zeneca Limited | Continuous release pharmaceutical compositions |
| EP0088046A2 (de) | 1982-02-17 | 1983-09-07 | Ciba-Geigy Ag | Lipide in wässriger Phase |
| US4439196A (en) | 1982-03-18 | 1984-03-27 | Merck & Co., Inc. | Osmotic drug delivery system |
| US4447224A (en) | 1982-09-20 | 1984-05-08 | Infusaid Corporation | Variable flow implantable infusion apparatus |
| US4475196A (en) | 1981-03-06 | 1984-10-02 | Zor Clair G | Instrument for locating faults in aircraft passenger reading light and attendant call control system |
| US4486194A (en) | 1983-06-08 | 1984-12-04 | James Ferrara | Therapeutic device for administering medicaments through the skin |
| US4487603A (en) | 1982-11-26 | 1984-12-11 | Cordis Corporation | Implantable microinfusion pump system |
| US4496689A (en) | 1983-12-27 | 1985-01-29 | Miles Laboratories, Inc. | Covalently attached complex of alpha-1-proteinase inhibitor with a water soluble polymer |
| EP0133988A2 (de) | 1983-08-02 | 1985-03-13 | Hoechst Aktiengesellschaft | Regulatorische Peptide enthaltende pharmazeutische Präparate mit protrahierter Freisetzung und Verfahren zu deren Herstellung |
| EP0143949A1 (en) | 1983-11-01 | 1985-06-12 | TERUMO KABUSHIKI KAISHA trading as TERUMO CORPORATION | Pharmaceutical composition containing urokinase |
| US4596556A (en) | 1985-03-25 | 1986-06-24 | Bioject, Inc. | Hypodermic injection apparatus |
| US4640835A (en) | 1981-10-30 | 1987-02-03 | Nippon Chemiphar Company, Ltd. | Plasminogen activator derivatives |
| US4670417A (en) | 1985-06-19 | 1987-06-02 | Ajinomoto Co., Inc. | Hemoglobin combined with a poly(alkylene oxide) |
| WO1987005330A1 (en) | 1986-03-07 | 1987-09-11 | Michel Louis Eugene Bergh | Method for enhancing glycoprotein stability |
| US4790824A (en) | 1987-06-19 | 1988-12-13 | Bioject, Inc. | Non-invasive hypodermic injection device |
| US4791192A (en) | 1986-06-26 | 1988-12-13 | Takeda Chemical Industries, Ltd. | Chemically modified protein with polyethyleneglycol |
| EP0367566A1 (en) | 1988-10-31 | 1990-05-09 | Immunex Corporation | Interleukin-4 receptors |
| US4941880A (en) | 1987-06-19 | 1990-07-17 | Bioject, Inc. | Pre-filled ampule and non-invasive hypodermic injection device assembly |
| US4965195A (en) | 1987-10-26 | 1990-10-23 | Immunex Corp. | Interleukin-7 |
| US4968607A (en) | 1987-11-25 | 1990-11-06 | Immunex Corporation | Interleukin-1 receptors |
| US5064413A (en) | 1989-11-09 | 1991-11-12 | Bioject, Inc. | Needleless hypodermic injection device |
| EP0460846A1 (en) | 1990-06-05 | 1991-12-11 | Immunex Corporation | Type II interleukin-1 receptors |
| US5312335A (en) | 1989-11-09 | 1994-05-17 | Bioject Inc. | Needleless hypodermic injection device |
| US5383851A (en) | 1992-07-24 | 1995-01-24 | Bioject Inc. | Needleless hypodermic injection device |
| US5783665A (en) | 1993-07-23 | 1998-07-21 | Immunex Corporation | Cytokine which is a ligand for OX40 |
| WO1999060128A1 (en) | 1998-05-15 | 1999-11-25 | Bayer Corporation | Il-2 selective agonists and antagonists |
| US6037525A (en) | 1996-08-01 | 2000-03-14 | North Carolina State University | Method for reducing expression variability of transgenes in plant cells |
| US6177612B1 (en) | 1998-07-31 | 2001-01-23 | Her Majesty The Queen In Right Of Canada, As Represented By The Department Of Agriculture And Agri-Food Canada | Matrix attachment regions |
| US6239328B1 (en) | 1992-10-05 | 2001-05-29 | North Carolina State University | Method for reducing expression variability of transgenes in plant cells |
| US6245974B1 (en) | 1997-08-06 | 2001-06-12 | North Carolina State University | Matrix attachment regions |
| WO2002000243A2 (en) | 2000-06-28 | 2002-01-03 | Bayer Corporation | Stabilized interleukin 2 |
| US6388066B1 (en) | 1998-09-29 | 2002-05-14 | Pioneer Hi-Bred International, Inc. | MAR/SAR elements flanking RSYN7-driven construct |
| WO2003106498A2 (en) | 2002-06-13 | 2003-12-24 | Crucell Holland, B.V. | Agonistic binding molecules to the human ox40 receptor |
| WO2005086798A2 (en) | 2004-03-05 | 2005-09-22 | Chiron Corporation | Improved interleukin-2 muteins |
| WO2006089064A1 (en) | 2005-02-15 | 2006-08-24 | Novartis Vaccines And Diagnostics Inc. | Methods for treating lymphomas using a combination of a chemotherapeutic agent and il-2 and optionally an anti-cd20 antibody |
| US7129062B2 (en) | 2001-01-26 | 2006-10-31 | Selexis Sa | Matrix attachment regions and methods for use thereof |
| WO2006138181A2 (en) | 2005-06-14 | 2006-12-28 | Amgen Inc. | Self-buffering protein formulations |
| WO2007062245A2 (en) | 2005-11-25 | 2007-05-31 | Kirin Pharma Kabushiki Kaisha | Human monoclonal antibody human cd134 (ox40) and methods of making and using same |
| US7259010B2 (en) | 2000-12-15 | 2007-08-21 | Pangen Biotech Inc. | Expression vector for animal cell containing nuclear matrix attachment region of interferon beta |
| US7317091B2 (en) | 2002-03-01 | 2008-01-08 | Xencor, Inc. | Optimized Fc variants |
| US7326567B2 (en) | 2003-11-12 | 2008-02-05 | Schering Corporation | Plasmid system for multigene expression |
| US7422874B2 (en) | 2000-07-29 | 2008-09-09 | Mogam Biotechnology Research Institute | Expression vector for animal cell |
| WO2009089004A1 (en) | 2008-01-07 | 2009-07-16 | Amgen Inc. | Method for making antibody fc-heterodimeric molecules using electrostatic steering effects |
| US7695963B2 (en) | 2007-09-24 | 2010-04-13 | Cythera, Inc. | Methods for increasing definitive endoderm production |
| WO2010085495A1 (en) | 2009-01-21 | 2010-07-29 | Amgen Inc. | Compositions and methods of treating inflammatory and autoimmune diseases |
| WO2010096418A2 (en) | 2009-02-17 | 2010-08-26 | Ucb Pharma S.A. | Antibody molecules having specificity for human ox40 |
| WO2011106707A2 (en) | 2010-02-26 | 2011-09-01 | Human Genome Sciences, Inc. | Antibodies that specifically bind to dr3 |
| WO2012107417A1 (en) | 2011-02-10 | 2012-08-16 | Roche Glycart Ag | Mutant interleukin-2 polypeptides |
| WO2013008171A1 (en) | 2011-07-11 | 2013-01-17 | Glenmark Pharmaceuticals S.A. | Antibodies that bind to ox40 and their uses |
| WO2013028231A1 (en) | 2011-08-23 | 2013-02-28 | Board Of Regents, The University Of Texas System | Anti-ox40 antibodies and methods of using the same |
| WO2013038191A2 (en) | 2011-09-16 | 2013-03-21 | Bioceros B.V. | Anti-cd134 (ox40) antibodies and uses thereof |
| WO2013068563A2 (en) | 2011-11-11 | 2013-05-16 | Ucb Pharma S.A. | Antibody molecules having specificity for human ox40 |
| WO2014148895A1 (en) | 2013-03-18 | 2014-09-25 | Biocerox Products B.V. | Humanized anti-cd134 (ox40) antibodies and uses thereof |
| WO2014153111A2 (en) | 2013-03-14 | 2014-09-25 | Amgen Inc. | Interleukin-2 muteins for the expansion of t-regulatory cells |
| WO2015152430A1 (en) | 2014-04-04 | 2015-10-08 | Kyowa Hakko Kirin Co., Ltd. | Anti-death receptor 3 (dr3) antagonistic antibodies with reduced agonistic activity |
| WO2015153513A1 (en) | 2014-03-31 | 2015-10-08 | Genentech, Inc. | Anti-ox40 antibodies and methods of use |
| US9300829B2 (en) | 2014-04-04 | 2016-03-29 | Canon Kabushiki Kaisha | Image reading apparatus and correction method thereof |
| WO2016057667A1 (en) | 2014-10-10 | 2016-04-14 | Medimmune, Llc | Humanized anti-ox40 antibodies and uses thereof |
| WO2016164937A2 (en) | 2015-04-10 | 2016-10-13 | Amgen Inc. | Interleukin-2 muteins for the expansion of t-regulatory cells |
| WO2016179517A1 (en) | 2015-05-07 | 2016-11-10 | Agenus Inc. | Anti-ox40 antibodies and methods of use thereof |
| WO2016196228A1 (en) | 2015-05-29 | 2016-12-08 | Bristol-Myers Squibb Company | Antibodies against ox40 and uses thereof |
| WO2018112346A1 (en) | 2016-12-15 | 2018-06-21 | Abbvie Biotherapeutics Inc. | Anti-ox40 antibodies and their uses |
Family Cites Families (11)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN1204147C (zh) | 1998-02-25 | 2005-06-01 | 利思进药品公司 | 提高以抗体为基础的融合蛋白的循环半衰期的方法 |
| CN101146823A (zh) | 2005-02-15 | 2008-03-19 | 阿波罗生命科学有限公司 | 分子及其嵌合分子 |
| WO2008003473A2 (en) | 2006-07-06 | 2008-01-10 | Merck Patent Gmbh | Compositions and methods for enhancing the efficacy of il-2 mediated immune responses |
| WO2012027328A2 (en) * | 2010-08-23 | 2012-03-01 | Board Of Regents, The University Of Texas System | Anti-ox40 antibodies and methods of using the same |
| EP3148573A4 (en) * | 2014-05-29 | 2017-11-15 | Medimmune, LLC | Ox40l fusion proteins and uses thereof |
| WO2017136818A2 (en) | 2016-02-05 | 2017-08-10 | Washington University | Compositions and methods for targeted cytokine delivery |
| US11407806B2 (en) * | 2017-04-06 | 2022-08-09 | Albert Einstein College Of Medicine | Precision activation of HIV-specific CTLS to eliminate reactivated latent T cells |
| JP2019122373A (ja) * | 2018-01-12 | 2019-07-25 | アムジエン・インコーポレーテツド | 抗pd−1抗体及び治療方法 |
| CN112105632A (zh) * | 2018-01-24 | 2020-12-18 | 北京智康博药肿瘤医学研究有限公司 | 细胞因子融合蛋白 |
| CN108285490A (zh) * | 2018-01-26 | 2018-07-17 | 西南交通大学 | 一种高亲和性结合i型胶原蛋白的gst融合蛋白制备及其应用 |
| KR20220035122A (ko) * | 2019-06-14 | 2022-03-21 | 큐진 인크. | 신규한 인터루킨-2 변이체 및 이의 이작용성 융합 분자 |
-
2020
- 2020-12-17 CN CN202080087668.8A patent/CN114867749A/zh active Pending
- 2020-12-17 MX MX2022007712A patent/MX2022007712A/es unknown
- 2020-12-17 AU AU2020407208A patent/AU2020407208A1/en active Pending
- 2020-12-17 CR CR20220341A patent/CR20220341A/es unknown
- 2020-12-17 JP JP2022536572A patent/JP7755581B2/ja active Active
- 2020-12-17 JO JOP/2022/0151A patent/JOP20220151A1/ar unknown
- 2020-12-17 PH PH1/2022/551428A patent/PH12022551428A1/en unknown
- 2020-12-17 BR BR112022011949A patent/BR112022011949A2/pt not_active IP Right Cessation
- 2020-12-17 KR KR1020227023807A patent/KR20220114595A/ko not_active Ceased
- 2020-12-17 PE PE2022001107A patent/PE20221506A1/es unknown
- 2020-12-17 EP EP20842768.2A patent/EP4077383A1/en active Pending
- 2020-12-17 WO PCT/US2020/065734 patent/WO2021127262A1/en not_active Ceased
- 2020-12-17 IL IL293471A patent/IL293471A/en unknown
- 2020-12-17 CA CA3162705A patent/CA3162705A1/en active Pending
- 2020-12-17 US US17/786,375 patent/US20230040604A1/en active Pending
-
2022
- 2022-06-16 CL CL2022001638A patent/CL2022001638A1/es unknown
- 2022-06-23 CO CONC2022/0008768A patent/CO2022008768A2/es unknown
Patent Citations (76)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US233A (en) | 1837-06-14 | Improvement in plows | ||
| US4447A (en) | 1846-04-04 | Car- wheel | ||
| US3773919A (en) | 1969-10-23 | 1973-11-20 | Du Pont | Polylactide-drug mixtures |
| US3691016A (en) | 1970-04-17 | 1972-09-12 | Monsanto Co | Process for the preparation of insoluble enzymes |
| US3969287A (en) | 1972-12-08 | 1976-07-13 | Boehringer Mannheim Gmbh | Carrier-bound protein prepared by reacting the protein with an acylating or alkylating compound having a carrier-bonding group and reacting the product with a carrier |
| US4179337A (en) | 1973-07-20 | 1979-12-18 | Davis Frank F | Non-immunogenic polypeptides |
| US4195128A (en) | 1976-05-03 | 1980-03-25 | Bayer Aktiengesellschaft | Polymeric carrier bound ligands |
| US4330440A (en) | 1977-02-08 | 1982-05-18 | Development Finance Corporation Of New Zealand | Activated matrix and method of activation |
| US4247642A (en) | 1977-02-17 | 1981-01-27 | Sumitomo Chemical Company, Limited | Enzyme immobilization with pullulan gel |
| US4229537A (en) | 1978-02-09 | 1980-10-21 | New York University | Preparation of trichloro-s-triazine activated supports for coupling ligands |
| EP0036676A1 (en) | 1978-03-24 | 1981-09-30 | The Regents Of The University Of California | Method of making uniformly sized liposomes and liposomes so made |
| US4301144A (en) | 1979-07-11 | 1981-11-17 | Ajinomoto Company, Incorporated | Blood substitute containing modified hemoglobin |
| EP0058481A1 (en) | 1981-02-16 | 1982-08-25 | Zeneca Limited | Continuous release pharmaceutical compositions |
| US4475196A (en) | 1981-03-06 | 1984-10-02 | Zor Clair G | Instrument for locating faults in aircraft passenger reading light and attendant call control system |
| US4640835A (en) | 1981-10-30 | 1987-02-03 | Nippon Chemiphar Company, Ltd. | Plasminogen activator derivatives |
| EP0088046A2 (de) | 1982-02-17 | 1983-09-07 | Ciba-Geigy Ag | Lipide in wässriger Phase |
| US4439196A (en) | 1982-03-18 | 1984-03-27 | Merck & Co., Inc. | Osmotic drug delivery system |
| US4447224A (en) | 1982-09-20 | 1984-05-08 | Infusaid Corporation | Variable flow implantable infusion apparatus |
| US4487603A (en) | 1982-11-26 | 1984-12-11 | Cordis Corporation | Implantable microinfusion pump system |
| US4486194A (en) | 1983-06-08 | 1984-12-04 | James Ferrara | Therapeutic device for administering medicaments through the skin |
| EP0133988A2 (de) | 1983-08-02 | 1985-03-13 | Hoechst Aktiengesellschaft | Regulatorische Peptide enthaltende pharmazeutische Präparate mit protrahierter Freisetzung und Verfahren zu deren Herstellung |
| EP0143949A1 (en) | 1983-11-01 | 1985-06-12 | TERUMO KABUSHIKI KAISHA trading as TERUMO CORPORATION | Pharmaceutical composition containing urokinase |
| US4496689A (en) | 1983-12-27 | 1985-01-29 | Miles Laboratories, Inc. | Covalently attached complex of alpha-1-proteinase inhibitor with a water soluble polymer |
| US4596556A (en) | 1985-03-25 | 1986-06-24 | Bioject, Inc. | Hypodermic injection apparatus |
| US4670417A (en) | 1985-06-19 | 1987-06-02 | Ajinomoto Co., Inc. | Hemoglobin combined with a poly(alkylene oxide) |
| WO1987005330A1 (en) | 1986-03-07 | 1987-09-11 | Michel Louis Eugene Bergh | Method for enhancing glycoprotein stability |
| US4791192A (en) | 1986-06-26 | 1988-12-13 | Takeda Chemical Industries, Ltd. | Chemically modified protein with polyethyleneglycol |
| US4941880A (en) | 1987-06-19 | 1990-07-17 | Bioject, Inc. | Pre-filled ampule and non-invasive hypodermic injection device assembly |
| US4790824A (en) | 1987-06-19 | 1988-12-13 | Bioject, Inc. | Non-invasive hypodermic injection device |
| US4965195A (en) | 1987-10-26 | 1990-10-23 | Immunex Corp. | Interleukin-7 |
| US4968607A (en) | 1987-11-25 | 1990-11-06 | Immunex Corporation | Interleukin-1 receptors |
| EP0367566A1 (en) | 1988-10-31 | 1990-05-09 | Immunex Corporation | Interleukin-4 receptors |
| US5064413A (en) | 1989-11-09 | 1991-11-12 | Bioject, Inc. | Needleless hypodermic injection device |
| US5312335A (en) | 1989-11-09 | 1994-05-17 | Bioject Inc. | Needleless hypodermic injection device |
| EP0460846A1 (en) | 1990-06-05 | 1991-12-11 | Immunex Corporation | Type II interleukin-1 receptors |
| US5383851A (en) | 1992-07-24 | 1995-01-24 | Bioject Inc. | Needleless hypodermic injection device |
| US5399163A (en) | 1992-07-24 | 1995-03-21 | Bioject Inc. | Needleless hypodermic injection methods and device |
| US6239328B1 (en) | 1992-10-05 | 2001-05-29 | North Carolina State University | Method for reducing expression variability of transgenes in plant cells |
| US5783665A (en) | 1993-07-23 | 1998-07-21 | Immunex Corporation | Cytokine which is a ligand for OX40 |
| US6037525A (en) | 1996-08-01 | 2000-03-14 | North Carolina State University | Method for reducing expression variability of transgenes in plant cells |
| US6245974B1 (en) | 1997-08-06 | 2001-06-12 | North Carolina State University | Matrix attachment regions |
| WO1999060128A1 (en) | 1998-05-15 | 1999-11-25 | Bayer Corporation | Il-2 selective agonists and antagonists |
| US6177612B1 (en) | 1998-07-31 | 2001-01-23 | Her Majesty The Queen In Right Of Canada, As Represented By The Department Of Agriculture And Agri-Food Canada | Matrix attachment regions |
| US6388066B1 (en) | 1998-09-29 | 2002-05-14 | Pioneer Hi-Bred International, Inc. | MAR/SAR elements flanking RSYN7-driven construct |
| WO2002000243A2 (en) | 2000-06-28 | 2002-01-03 | Bayer Corporation | Stabilized interleukin 2 |
| US7422874B2 (en) | 2000-07-29 | 2008-09-09 | Mogam Biotechnology Research Institute | Expression vector for animal cell |
| US7259010B2 (en) | 2000-12-15 | 2007-08-21 | Pangen Biotech Inc. | Expression vector for animal cell containing nuclear matrix attachment region of interferon beta |
| US7129062B2 (en) | 2001-01-26 | 2006-10-31 | Selexis Sa | Matrix attachment regions and methods for use thereof |
| US7317091B2 (en) | 2002-03-01 | 2008-01-08 | Xencor, Inc. | Optimized Fc variants |
| WO2003106498A2 (en) | 2002-06-13 | 2003-12-24 | Crucell Holland, B.V. | Agonistic binding molecules to the human ox40 receptor |
| US7326567B2 (en) | 2003-11-12 | 2008-02-05 | Schering Corporation | Plasmid system for multigene expression |
| WO2005086751A2 (en) | 2004-03-05 | 2005-09-22 | Chiron Corporation | Combinatorial interleukin-2 muteins |
| WO2005086798A2 (en) | 2004-03-05 | 2005-09-22 | Chiron Corporation | Improved interleukin-2 muteins |
| WO2006089064A1 (en) | 2005-02-15 | 2006-08-24 | Novartis Vaccines And Diagnostics Inc. | Methods for treating lymphomas using a combination of a chemotherapeutic agent and il-2 and optionally an anti-cd20 antibody |
| WO2006138181A2 (en) | 2005-06-14 | 2006-12-28 | Amgen Inc. | Self-buffering protein formulations |
| WO2007062245A2 (en) | 2005-11-25 | 2007-05-31 | Kirin Pharma Kabushiki Kaisha | Human monoclonal antibody human cd134 (ox40) and methods of making and using same |
| US7695963B2 (en) | 2007-09-24 | 2010-04-13 | Cythera, Inc. | Methods for increasing definitive endoderm production |
| WO2009089004A1 (en) | 2008-01-07 | 2009-07-16 | Amgen Inc. | Method for making antibody fc-heterodimeric molecules using electrostatic steering effects |
| WO2010085495A1 (en) | 2009-01-21 | 2010-07-29 | Amgen Inc. | Compositions and methods of treating inflammatory and autoimmune diseases |
| WO2010096418A2 (en) | 2009-02-17 | 2010-08-26 | Ucb Pharma S.A. | Antibody molecules having specificity for human ox40 |
| WO2011106707A2 (en) | 2010-02-26 | 2011-09-01 | Human Genome Sciences, Inc. | Antibodies that specifically bind to dr3 |
| WO2012107417A1 (en) | 2011-02-10 | 2012-08-16 | Roche Glycart Ag | Mutant interleukin-2 polypeptides |
| WO2013008171A1 (en) | 2011-07-11 | 2013-01-17 | Glenmark Pharmaceuticals S.A. | Antibodies that bind to ox40 and their uses |
| WO2013028231A1 (en) | 2011-08-23 | 2013-02-28 | Board Of Regents, The University Of Texas System | Anti-ox40 antibodies and methods of using the same |
| WO2013038191A2 (en) | 2011-09-16 | 2013-03-21 | Bioceros B.V. | Anti-cd134 (ox40) antibodies and uses thereof |
| WO2013068563A2 (en) | 2011-11-11 | 2013-05-16 | Ucb Pharma S.A. | Antibody molecules having specificity for human ox40 |
| WO2014153111A2 (en) | 2013-03-14 | 2014-09-25 | Amgen Inc. | Interleukin-2 muteins for the expansion of t-regulatory cells |
| WO2014148895A1 (en) | 2013-03-18 | 2014-09-25 | Biocerox Products B.V. | Humanized anti-cd134 (ox40) antibodies and uses thereof |
| WO2015153513A1 (en) | 2014-03-31 | 2015-10-08 | Genentech, Inc. | Anti-ox40 antibodies and methods of use |
| WO2015152430A1 (en) | 2014-04-04 | 2015-10-08 | Kyowa Hakko Kirin Co., Ltd. | Anti-death receptor 3 (dr3) antagonistic antibodies with reduced agonistic activity |
| US9300829B2 (en) | 2014-04-04 | 2016-03-29 | Canon Kabushiki Kaisha | Image reading apparatus and correction method thereof |
| WO2016057667A1 (en) | 2014-10-10 | 2016-04-14 | Medimmune, Llc | Humanized anti-ox40 antibodies and uses thereof |
| WO2016164937A2 (en) | 2015-04-10 | 2016-10-13 | Amgen Inc. | Interleukin-2 muteins for the expansion of t-regulatory cells |
| WO2016179517A1 (en) | 2015-05-07 | 2016-11-10 | Agenus Inc. | Anti-ox40 antibodies and methods of use thereof |
| WO2016196228A1 (en) | 2015-05-29 | 2016-12-08 | Bristol-Myers Squibb Company | Antibodies against ox40 and uses thereof |
| WO2018112346A1 (en) | 2016-12-15 | 2018-06-21 | Abbvie Biotherapeutics Inc. | Anti-ox40 antibodies and their uses |
Non-Patent Citations (58)
| Title |
|---|
| "Macromolecule Sequencing and Synthesis, Selected Methods and Applications", 1988, ALAN R. LISS, INC., article "Current Methods in Sequence Comparison and Analysis", pages: 127 - 149 |
| "PCR Protocols: A Guide to Methods and Applications", 1990, MACK PUBLISHING COMPANY |
| ALDRICH ET AL., BIOTECHNOL PROG, vol. 19, 2003, pages 1433 - 38 |
| ALEXANDER ET AL., MOL. CELL. BIOL., vol. 7, 1987, pages 1436 - 1444 |
| ALTSCHUL ET AL., J. MOL. BIOL., vol. 215, 1990, pages 403 - 410 |
| ALTSCHUL ET AL., METHODS IN ENZYMOLOGY, vol. 266, 1996, pages 460 - 480 |
| ALTSCHUL ET AL., NUCL. ACIDS RES., vol. 25, 1993, pages 3389 - 3402 |
| ALTSCHUL ET AL., NUCLEIC ACIDS RES, vol. 25, 1997, pages 3389 - 3402 |
| APLINWRISTON, CRC CRIT. REV. BIOCHEM., 1981, pages 259 - 306 |
| ARAKAWA ET AL.: "Solvent interactions in pharmaceutical formulations", PHARM RES, vol. 8, no. 3, 1991, pages 285 - 91, XP009052919, DOI: 10.1023/A:1015825027737 |
| ARENAS-RAMIREZ NATALIA ET AL: "Interleukin-2: Biology, Design and Application", TRENDS IN IMMUNOLOGY, ELSEVIER LTD. * TRENDS JOURNALS, GB, vol. 36, no. 12, 10 November 2015 (2015-11-10), pages 763 - 777, XP029348694, ISSN: 1471-4906, DOI: 10.1016/J.IT.2015.10.003 * |
| BENOISTCHAMBON, NATURE, vol. 290, 1981, pages 304 - 310 |
| COSMAN ET AL., NATURE, vol. 312, 1984, pages 768 |
| DEBOER ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 80, 1983, pages 21 - 25 |
| DEVEREUX ET AL., NUCL. ACID RES., vol. 12, 1984, pages 387 - 395 |
| DUSKIN ET AL., J. BIOL. CHEM., vol. 257, 1982, pages 3105 |
| EDGE ET AL., ANAL. BIOCHEM., vol. 118, 1981, pages 131 |
| EPPSTEIN ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 82, 1985, pages 3688 - 3692 |
| FENGDOOLITTLE, J. MOL. EVOL., vol. 35, 1987, pages 351 - 360 |
| GLUZMAN ET AL., CELL, vol. 23, 1981, pages 175 |
| GROSSCHEDL ET AL., CELL, vol. 38, 1984, pages 647 - 658 |
| HAKIMUDDIN ET AL., ARCH. BIOCHEM. BIOPHYS., vol. 259, 1987, pages 52 |
| HAMMER ET AL., SCIENCE, vol. 253, 1987, pages 53 - 58 |
| HIGGINSSHARP, CABIOS, vol. 5, 1989, pages 151 - 153 |
| J. SEHOULI ET AL., EPIGENETICS, vol. 6, no. 2, 2011, pages 236 - 246 |
| KARIN ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 90, 1993, pages 5873 - 5787 |
| KENDRICK ET AL.: "Pharmaceutical Biotechnology", vol. 13, 2002, article "Physical stabilization of proteins in aqueous solution,'' in: RATIONAL DESIGN OF STABLE PROTEIN FORMULATIONS: THEORY AND PRACTICE", pages: 61 - 84 |
| KOLLIAS ET AL., CELL, vol. 46, 1986, pages 485 - 495 |
| KRUMLAUF ET AL., MOL. CELL. BIOL., vol. 5, 1985, pages 1639 - 1648 |
| LANGER ET AL., J. BIOMED. MATER. RES., vol. 15, 1981, pages 167 - 277 |
| LANGER, CHEM. TECH., vol. 12, 1982, pages 98 - 105 |
| LUCKOWSUMMERS, BIO/TECHNOLOGY, vol. 6, 1988, pages 47 |
| MACDONALD, HEPATOLOGY, vol. 7, 1987, pages 425 - 515 |
| MASON ET AL., SCIENCE, vol. 234, 1986, pages 1372 - 1378 |
| MCMAHAN ET AL., EMBO J, vol. 10, 1991, pages 2821 |
| MOGRAM ET AL., NATURE, vol. 314, 1985, pages 283 - 286 |
| NEEDLEMANWUNSCH, J. MOL. BIOL., vol. 48, 1970, pages 443 |
| ORNITZ ET AL., COLD SPRING HARBOR SYMP. QUANT. BIOL., vol. 50, 1986, pages 399 - 409 |
| PEARSONLIPMAN, PROC. NAT. ACAD. SCI. U.S.A., vol. 85, 1988, pages 2444 |
| PINKERT ET AL., GENES AND DEVEL, vol. 1, 1987, pages 161 - 171 |
| PRINSTER ET AL., NATURE, vol. 296, 1982, pages 39 - 42 |
| RANDOLPH ET AL.: "Surfactant-protein interactions", PHARM BIOTECHNOL, vol. 13, 2002, pages 159 - 75, XP055647590, DOI: 10.1007/978-1-4615-0557-0_7 |
| RASMUSSEN ET AL., CYTOTECHNOLOGY, vol. 28, 1998, pages 31 |
| READHEAD ET AL., CELL, vol. 48, 1987, pages 703 - 712 |
| SAIKI ET AL., SCIENCE, vol. 239, 1988, pages 487 |
| SAMBROOK ET AL.: "Molecular Cloning: A Laboratory Manual", 1989, COLD SPRING HARBOR LABORATORY, pages: 189 - 196 |
| SAMBROOK ET AL.: "Molecular Cloning: A Laboratory Manuel", 2001, COLD SPRING HARBOR LABORATORY PRESS |
| See also references of EP4077383A1 |
| SIDMAN ET AL., BIOPOLYMERS, vol. 2, 1983, pages 547 - 556 |
| SMITHWATERMAN, ADV. APPL. MATH., vol. 2, 1981, pages 482 |
| STROHL, CURR. OPIN. BIOTECH., vol. 20, 2009, pages 685 - 691 |
| SUMMERSSMITH, TEXAS AGRICULTURAL EXPERIMENT STATION BULLETIN, 1987 |
| THORNSEN ET AL., PROC. NATL. ACAD. U.S.A., vol. 81, 1984, pages 659 - 663 |
| THOTAKURA ET AL., METH. ENZYMOL., vol. 138, 1987, pages 350 |
| VILLA-KAMAROFF ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 75, 1978, pages 3727 - 3731 |
| WAGNER ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 78, 1981, pages 1444 - 1445 |
| WILLIAM L. REDMOND ET AL: "Dual Anti-OX40/IL-2 Therapy Augments Tumor Immunotherapy via IL-2R-Mediated Regulation of OX40 Expression", PLOS ONE, vol. 7, no. 4, 4 April 2012 (2012-04-04), pages e34467, XP055214862, DOI: 10.1371/journal.pone.0034467 * |
| YAMAMOTO ET AL., CELL, vol. 22, 1980, pages 787 - 797 |
Cited By (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP4385573A3 (en) * | 2019-08-13 | 2024-09-11 | Amgen Inc. | Interleukin-2 muteins for the expansion of t-regulatory cells |
| US12600758B2 (en) | 2019-08-13 | 2026-04-14 | Amgen Inc. | Interleukin-2 muteins for the expansion of T-regulatory cells |
| WO2026006809A1 (en) * | 2024-06-27 | 2026-01-02 | Odyssey Therapeutics, Inc. | Multispecific molecules binding tnfr2 and cd25 and uses thereof |
Also Published As
| Publication number | Publication date |
|---|---|
| CA3162705A1 (en) | 2021-06-24 |
| JOP20220151A1 (ar) | 2023-01-30 |
| JP7755581B2 (ja) | 2025-10-16 |
| JP2023507115A (ja) | 2023-02-21 |
| IL293471A (en) | 2022-08-01 |
| CL2022001638A1 (es) | 2023-02-03 |
| CR20220341A (es) | 2022-08-19 |
| BR112022011949A2 (pt) | 2022-11-22 |
| KR20220114595A (ko) | 2022-08-17 |
| PH12022551428A1 (en) | 2023-11-20 |
| EP4077383A1 (en) | 2022-10-26 |
| CO2022008768A2 (es) | 2022-07-19 |
| PE20221506A1 (es) | 2022-10-04 |
| MX2022007712A (es) | 2022-09-26 |
| US20230040604A1 (en) | 2023-02-09 |
| AU2020407208A1 (en) | 2022-06-02 |
| CN114867749A (zh) | 2022-08-05 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| TWI784288B (zh) | Fc區之多肽及包含其之Fc融合蛋白 | |
| US12600758B2 (en) | Interleukin-2 muteins for the expansion of T-regulatory cells | |
| EP4077383A1 (en) | Dual interleukin-2 /tnf receptor agonist for use in therapy | |
| HK40112585A (en) | Interleukin-2 muteins for the expansion of t-regulatory cells | |
| EA048038B1 (ru) | Мутеины интерлейкина-2 для экспансии регуляторных т-клеток | |
| BR112015023145B1 (pt) | Polipeptídeos contendo fc aglicosilados e anticorpo ou proteína de fusão fc | |
| HK1220695B (en) | Aglycosylated fc-containing polypeptides | |
| NZ712066B2 (en) | Interleukin-2 muteins for the expansion of t-regulatory cells |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 20842768 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 3162705 Country of ref document: CA |
|
| ENP | Entry into the national phase |
Ref document number: 2020407208 Country of ref document: AU Date of ref document: 20201217 Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2022536572 Country of ref document: JP Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: NC2022/0008768 Country of ref document: CO |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112022011949 Country of ref document: BR |
|
| ENP | Entry into the national phase |
Ref document number: 20227023807 Country of ref document: KR Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: DZP2022000487 Country of ref document: DZ |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| WWP | Wipo information: published in national office |
Ref document number: NC2022/0008768 Country of ref document: CO |
|
| ENP | Entry into the national phase |
Ref document number: 2020842768 Country of ref document: EP Effective date: 20220718 |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01E Ref document number: 112022011949 Country of ref document: BR Free format text: COM BASE NA PORTARIA 405 DE 21/12/2020, SOLICITA-SE QUE SEJA APRESENTADO, EM ATE 60 (SESSENTA) DIAS, NOVO CONTEUDO DE LISTAGEM DE SEQUENCIA POIS O CONTEUDO APRESENTADO NA PETICAO NO 870220052904 DE 15/06/2022 POSSUI INFORMACOES DIVERGENTES AO PEDIDO EM QUESTAO (DIVERGENCIA NOS CAMPOS 141 E 151 .) |
|
| ENP | Entry into the national phase |
Ref document number: 112022011949 Country of ref document: BR Kind code of ref document: A2 Effective date: 20220615 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 522433052 Country of ref document: SA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 522433052 Country of ref document: SA |
|
| WWW | Wipo information: withdrawn in national office |
Ref document number: 788295 Country of ref document: NZ |