WO2021119508A1 - Anti-mertk antibodies and methods of use thereof - Google Patents
Anti-mertk antibodies and methods of use thereof Download PDFInfo
- Publication number
- WO2021119508A1 WO2021119508A1 PCT/US2020/064640 US2020064640W WO2021119508A1 WO 2021119508 A1 WO2021119508 A1 WO 2021119508A1 US 2020064640 W US2020064640 W US 2020064640W WO 2021119508 A1 WO2021119508 A1 WO 2021119508A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- seq
- amino acid
- acid sequence
- hvr
- antibody
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/40—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against enzymes
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P29/00—Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
- C07K16/2818—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against CD28 or CD152
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
- C07K16/2827—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against B7 molecules, e.g. CD80, CD86
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
- A61K2039/507—Comprising a combination of two or more separate antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/33—Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/52—Constant or Fc region; Isotype
- C07K2317/53—Hinge
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
- C07K2317/62—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
- C07K2317/622—Single chain antibody (scFv)
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/71—Decreased effector function due to an Fc-modification
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
- G01N2333/90—Enzymes; Proenzymes
- G01N2333/91—Transferases (2.)
- G01N2333/912—Transferases (2.) transferring phosphorus containing groups, e.g. kinases (2.7)
- G01N2333/91205—Phosphotransferases in general
- G01N2333/9121—Phosphotransferases in general with an alcohol group as acceptor (2.7.1), e.g. general tyrosine, serine or threonine kinases
Definitions
- the present disclosure relates to anti-MerTK antibodies and uses (e.g., therapeutic uses) of such antibodies.
- Mer Tyrosine Kinase belongs to the TAM (Tyro3, Axl, and MerTK) family of receptor tyrosine kinases.
- MerTK is a single-pass type 1 transmembrane protein with an extracellular domain having two immunoglobulin (Ig)-like and two fibronectin (FN) type III motifs (Graham et al, 2014, Nat Rev Cancer, 14:769-785; Rothlin et al, 2015, Annu Rev Immunol, 33:355-391).
- MerTK transduces signals from the extracellular space via activation following ligand binding, leading to MerTK tyrosine auto-phosphorylation (Cummings et al, 2013, Clin Cancer Res, 19:5275-5280; Verma et al, 2011, Mol Cancer Ther, 10: 1763-1773) and subsequent ERK and AKT-associated signal transduction.
- MerTK regulates various physiological processes including cell survival, migration, and differentiation.
- MerTK ligands ProS and Gas6 contribute to several oncogenic processes, such as cell survival, invasion, migration, chemo-resistance, and metastasis, in which their expression often correlates with poor clinical outcomes. Additionally, MerTK is implicated in numerous cancers, and MerTK or ProS deficiency is associated with anti-tumor effects (Cook et al, 2013, J Clin Invest, 123:3231-3242; Ubil et al, 2018, J Clin Invest, 128:2356-2369; Huey et al, 2016, Cancers, 8:101).
- MerTK is also expressed on retinal pigment epithelial cells and plays a critical role in clearing shed photoreceptor outer segment in the eye; loss of function mutations in MerTK result in retinitis pigmentosa and other retinal dystrophies (see, e.g. Al-khersan et al, Graefes Arch Clim Exp Ophthalmol, 2017, 255: 1613-1619; Lorach et al, Nature Scientific Reports, 2018, 8: 11312; Audo et al, Human Mutation, Wiley, 2018, 39:997-913; LaVail et al, Adv Exp Med Biol, 2016, 854:487-493).
- MerTK plays an essential role in phagocytosis of apoptotic cells (efferocytosis) by phagocytic cells, leading to M2-like macrophage polarization, production of anti-inflammatory cytokines, and promoting an immunosuppressive tumor microenvironment. Reducing efferocytosis by phagocytic cells increases Ml -like macrophage polarization, leading to the production of pro-inflammatory cytokines and an immune-active milieu. Modulating efferocytosis can provide an effective means for anti-tumor activity.
- Anti-MerTK antibodies have been previously described in, e.g., International Patent Application Publication Nos: W02020/214995, W02020/076799, W02020/106461, WO2020/176497, WO2019/084307, W02019/005756, WO2016/ 106221, W02016/001830, W02009/062112, and W02006/058202; and in, e.g., Dayoub and Brekken, 2020, Cell Communications and Signaling, 18:29; Zhou et al, 2020, Immunity, 52:1-17; Kedage et al, 2020, MABS, 12:el685832; Cummings et al, 2014, Oncotarget, 5:10434-10445.
- the present disclosure is generally directed to anti- Mer Tyrosine Kinase (MerTK) antibodies and methods of using such antibodies.
- the methods provided herein find use in treating an individual having cancer.
- the present disclosure provides a method for treating an individual having cancer, the method including administering to the individual in need thereof a therapeutically effective amount of an anti-MerTK antibody.
- the present disclosure relates to an isolated anti-MerTK antibody that binds to a MerTK protein, wherein the antibody comprises a heavy chain variable region and a light chain variable region, wherein the heavy chain variable region comprises: a) an HVR-H1 comprising the amino acid sequence of SEQ ID NO:83; b) an HVR-H2 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 329, 330, 331, 332, and 333; and c) an HVR-H3 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 138, 334, 335, 336, 337, 338, and 339; and wherein the light chain variable region comprises: d) an HVR-L1 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 158, 340, 341, 342, 343, and 344; e) an HVR-L2 comprising the amino acid sequence of SEQ ID NO: 187;
- the present disclosure relates to an isolated anti-MerTK antibody that binds to a MerTK protein, wherein the antibody comprises: (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO:83; (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO:99; (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO: 138; (d) HVR-L1 comprising the amino acid sequence of SEQ ID NO: 158; (e) HVR-L2 comprising the amino acid sequence of SEQ ID NO: 187; and (f) HVR-L3 comprising the amino acid sequence of SEQ ID NO:210; (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO:83; (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO:329; (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO:334; (d) HVR-L1 comprising the amino acid sequence of SEQ ID NO
- the present disclosure relates to an isolated anti-MerTK antibody that binds to a MerTK protein, wherein the antibody comprises a heavy chain variable domain (VH) and a light chain variable domain (VL), wherein the VH and VL are selected from the group consisting of: VH comprising the amino acid sequence of SEQ ID NO: 19 and VL comprising the amino acid sequence of SEQ ID NO:54; VH comprising the amino acid sequence of SEQ ID NO:234 and VL comprising the amino acid sequence of SEQ ID NO:247; VH comprising the amino acid sequence of SEQ ID NO:235 and VL comprising the amino acid sequence of SEQ ID NO:247; VH comprising the amino acid sequence of SEQ ID NO:236 and VL comprising the amino acid sequence of SEQ ID NO:248; VH comprising the amino acid sequence of SEQ ID NO:236 and VL comprising the amino acid sequence of SEQ ID NO:249; VH comprising the amino acid sequence of SEQ ID NO:
- the present disclosure relates to an isolated anti-MerTK antibody that binds to a MerTK protein, wherein the antibody comprises a heavy chain variable region and a light chain variable region, wherein the heavy chain variable region comprises: a) an HVR-Hl comprising the amino acid sequence of SEQ ID NO: 84; b) an HVR-H2 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 99 and 329; and c) an HVR-H3 comprising the amino acid sequence of SEQ ID NO: 139; and wherein the light chain variable region comprises: d) an HVR-Ll comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 169 and 345; e) an HVR- L2 comprising the amino acid sequence of SEQ ID NO: 195; and f) an HVR-L3 comprising the amino acid sequence of SEQ ID NO:219.
- the present disclosure relates to an isolated anti-MerTK antibody that binds to a MerTK protein, wherein the antibody comprises (a) HVR-Hl comprising the amino acid sequence of SEQ ID NO:84; (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO:329; (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO: 139; (d) HVR-Ll comprising the amino acid sequence of SEQ ID NO: 169; (e) HVR-L2 comprising the amino acid sequence of SEQ ID NO: 195; and (f) HVR-L3 comprising the amino acid sequence of SEQ ID NO:219; or (a) HVR-Hl comprising the amino acid sequence of SEQ ID NO: 84; (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO:99; (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO: 139; (d) HVR-Ll comprising
- the present disclosure relates to an isolated anti-MerTK antibody that binds to a MerTK protein, wherein the antibody comprises a heavy chain variable domain (VH) and a light chain variable domain (VL), wherein the VH and VL are selected from the group consisting of: VH comprising the amino acid sequence of SEQ ID NO:255 and VL comprising the amino acid sequence of SEQ ID NO:257; and VH comprising the amino acid sequence of SEQ ID NO:256 and VL comprising the amino acid sequence of SEQ ID NO:258.
- VH heavy chain variable domain
- VL light chain variable domain
- the present disclosure relates to an isolated anti-MerTK antibody that binds to a MerTK protein, wherein the antibody comprises a heavy chain variable region and a light chain variable region, wherein the heavy chain variable region comprises: a) an HVR-H1 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs:95, 346, and 347; b) an HVR-H2 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 119, 348, 349, 350, 351, 352, 353, and 354; and c) an HVR-H3 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 151, 355, and 356; and wherein the light chain variable region comprises: d) an HVR-L1 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 181, 341, 357, and 358; e) an HVR-L2 comprising an amino acid sequence selected from the group consisting
- the present disclosure relates to an isolated anti-MerTK antibody that binds to a MerTK protein, wherein the antibody comprises (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO:95; (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO: 119; (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO: 151; (d) HVR-L1 comprising the amino acid sequence of SEQ ID NO: 181; (e) HVR-L2 comprising the amino acid sequence of SEQ ID NO: 187; and (f) HVR-L3 comprising the amino acid sequence of SEQ ID NO:208; (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO:346; (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO:348; (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO:355; (d) HVR-L1 comprising the
- the present disclosure relates to an isolated anti-MerTK antibody that binds to a MerTK protein, wherein the antibody comprises a heavy chain variable domain (VH) and a light chain variable domain (VL), wherein the VH and VL are selected from the group consisting of: VH comprising the amino acid sequence of SEQ ID NO:33 and VL comprising the amino acid sequence of SEQ ID NO:68; VH comprising the amino acid sequence of SEQ ID NO:259 and VL comprising the amino acid sequence of SEQ ID NO:274; VH comprising the amino acid sequence of SEQ ID NO:260 and VL comprising the amino acid sequence of SEQ ID NO:275; VH comprising the amino acid sequence of SEQ ID NO:261 and VL comprising the amino acid sequence of SEQ ID NO:276; VH comprising the amino acid sequence of SEQ ID NO:262 and VL comprising the amino acid sequence of SEQ ID NO:277; VH comprising the amino acid sequence of SEQ ID NO:
- the present disclosure relates to an isolated anti-MerTK antibody that binds to a MerTK protein, wherein the antibody comprises a heavy chain variable region and a light chain variable region, wherein the heavy chain variable region comprises: a) an HVR-H1 comprising the amino acid sequence of SEQ ID NO:90; b) an HVR-H2 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 122, 364, 365, 366, 367, and 368; and c) an HVR-H3 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 155, 373, 374, and 375; and wherein the light chain variable region comprises: d) an HVR-L1 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 184, 376, 377, 378, 379, 380, 381, 382, 383, 384, 385, 386, and 387; e) an HVR-L1 comprising an amino acid sequence
- the present disclosure relates to an isolated anti-MerTK antibody that binds to a MerTK protein, wherein the antibody comprises (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO:90; (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO: 122; (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO: 155; (d) HVR-L1 comprising the amino acid sequence of SEQ ID NO: 184; (e) HVR-L2 comprising the amino acid sequence of SEQ ID NO:203; and (f) HVR-L3 comprising the amino acid sequence of SEQ ID NO:231; (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO:90; (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO:364; (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO:373; (d) HVR-L1 comprising the amino amino acid sequence of SEQ ID
- the present disclosure relates to an isolated anti-MerTK antibody that binds to a MerTK protein, wherein the antibody comprises a heavy chain variable domain (VH) and a light chain variable domain (VL), wherein the VH and VL are selected from the group consisting of: VH comprising the amino acid sequence of SEQ ID NO:37 and VL comprising the amino acid sequence of SEQ ID NO:72; VH comprising the amino acid sequence of SEQ ID NO:290 and VL comprising the amino acid sequence of SEQ ID NO:309; VH comprising the amino acid sequence of SEQ ID NO:291 and VL comprising the amino acid sequence of SEQ ID NO:310; VH comprising the amino acid sequence of SEQ ID NO:292 and VL comprising the amino acid sequence of SEQ ID NO:311; VH comprising the amino acid sequence of SEQ ID NO:293 and VL comprising the amino acid sequence of SEQ ID NO:312; VH comprising the amino acid sequence of SEQ ID NO:
- the present disclosure relates to an isolated anti-MerTK antibody that binds to a MerTK protein, wherein the antibody includes a heavy chain variable region and a light chain variable region, wherein the heavy chain variable region includes: an HVR-Hl comprising an amino acid sequence selected from the group consisting of SEQ ID NOs:75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, and 98; an HVR-H2 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs:99, 100, 101, 102, 103, 104, 105, 106, 107, 108,
- an HVR-H3 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, 150, 151, 152, 153, 154, 155, 156, and 157; and the light chain variable region includes: an HVR- L1 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 158, 159, 160, 161, 162, 163, 164, 165, 166, 167, 168, 169, 170, 171, 172, 173, 174, 175, 176, 177, 178
- an HVR-L2 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204, and 205; and an HVR-L3 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs:207, 208, 209, 210, 211, 212, 213, 214, 215, 216, 217, 218, 219, 220, 221, 222, 223, 224, 225, 226, 227, 228, 229, 230, 231, 232, and 233.
- the present disclosure relates to an isolated anti-MerTK antibody that binds to a MerTK protein, wherein the antibody comprises an HVR-H1, HVR-H2, HVR-H3, HVR-L1, HVR-L2, and HVR-L3 comprising the amino acid sequences of (i) SEQ ID NOs: 75, 99, 125, 158, 187, and 207, respectively; (ii) SEQ ID NOs: 76, 100, 126, 159, 187, and 208, respectively; (iii) SEQ ID NOs: 77, 101, 127, 160, 188, and 209, respectively; (iv) SEQ ID NOs: 75, 99, 128, 158, 187, and 210, respectively; (v) SEQ ID NOs: 78, 102, 129, 161, 189, and 211, respectively; (vi) SEQ ID NOs: 75,
- an anti-MerTK antibody of the present disclosure is an isolated antibody that binds to a MerTK protein, wherein the antibody comprises the HVR-H1, HVR-H2, HVR-H3, HVR-L1, HVR-L2 and HVR-L3 sequences of MTK-01, MTK-02, MTK-03, MTK-04, MTK-05, MTK-06, MTK-07, MTK-08, MTK-09, MTK-10, MTK-11, MTK-12, MTK-13, MTK-14, MTK-15, MTK-16, MTK-17, MTK-18, MTK-19, MTK-20, MTK-21, MTK-22, MTK-23, MTK-24, MTK-25, MTK-26, MTK-27, MTK-28, MTK-29, MTK-30, MTK-31, MTK-32, MTK-33, MTK-34, MTK-35, or MTK-36 antibody.
- the antibody comprises the HVR-H1, HVR-H2, HVR-H3, HVR-
- an anti-MerTK antibody of the present disclosure is an isolated antibody that binds to a MerTK protein, wherein the antibody comprises the HVR-H1, HVR-H2, HVR-H3, HVR-L1, HVR-L2 and HVR-L3 sequences of MTK-15.1, MTK-15.2, MTK-15.3, MTK-15.4, MTK-15.5, MTK-15.6, MTK-15.7, MTK- 15.8, MTK-15.9, MTK-15.10, MTK-15.11, MTK-15.12, MTK-15.13, MTK-15.14, and MTK-15.15, MTK-16.1 and MTK-16.2, MTK-29.1, MTK-29.2, MTK-29.3, MTK-29.4, MTK-29.5, MTK-29.6, MTK-29.7, MTK-29.8, MTK-29.9, MTK-29.10, MTK-29.11, MTK-29.
- an anti-MerTK antibody of the present disclosure is an isolated antibody that binds to a MerTK protein, wherein the antibody includes a heavy chain variable region, wherein the heavy chain variable region includes an amino acid sequence selected from the group consisting of SEQ ID NOs:5, 6, 7, 8, 9, 10,
- an anti-MerTK antibody of the present disclosure is an isolated antibody that binds to a MerTK protein, wherein the antibody includes a heavy chain variable region, wherein the heavy chain variable region includes an amino acid sequence selected from the group consisting of SEQ ID NOs:234-246, 255, 256, 259-379, and 290-308.
- an anti-MerTK antibody of the present disclosure is an isolated antibody that binds to a MerTK protein, wherein the antibody includes a light chain variable region, wherein the light chain variable region includes an amino acid sequence selected from the group consisting of SEQ ID NOs:40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, and 74.
- an anti-MerTK antibody of the present disclosure is an isolated antibody that binds to a MerTK protein, wherein the antibody includes a light chain variable region, wherein the light chain variable region includes an amino acid sequence selected from the group consisting of SEQ ID NOs:247-254, 257, 258, 274-289, and 309-328.
- an anti-MerTK antibody of the present disclosure is an isolated antibody that binds to a MerTK protein, wherein the antibody includes a heavy chain variable region and a light chain variable region, wherein the heavy chain variable region includes an amino acid sequence selected from SEQ ID NOs:5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, and 39, and the light chain variable region includes an amino acid sequence selected from SEQ ID NOs: 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, and 74.
- an anti-MerTK antibody of the present disclosure is an isolated antibody that binds to a MerTK protein, wherein the antibody includes a heavy chain variable region and a light chain variable region, wherein the heavy chain variable region includes an amino acid sequence selected from 234-246, 255, 256, 259- 379, and 290-308, and the light chain variable region includes an amino acid sequence selected from SEQ ID NOs: 247-254, 257, 258, 274-289, and 309-328.
- an anti-MerTK antibody of the present disclosure is an isolated antibody that binds to a MerTK protein, wherein the antibody a heavy chain variable region and a light chain variable region comprising the amino acid sequences of SEQ ID NOs:5 and 40, respectively ; SEQ ID NOs:6 and 41, respectively;
- the present disclosure relates to an isolated antibody that binds to a MerTK protein, wherein the antibody competitively inhibits binding of one or more of the antibodies of any of the embodiments herein for binding to MerTK.
- the present disclosure relates to an isolated antibody that binds to a MerTK protein, wherein the antibody binds essentially the same or an overlapping epitope on MerTK as an antibody of any of the embodiments herein.
- the MerTK protein is a mammalian protein or a human protein. In certain embodiments that may be combined with any of the embodiments herein, the MerTK protein is a wild-type protein. In certain embodiments that may be combined with any of the embodiments herein, the MerTK protein is a naturally occurring variant. In certain embodiments that may be combined with any of the embodiments herein, an anti- MerTK antibody binds to human MerTK and to cynomolgus monkey MerTK and/or murine MerTK.
- an anti-MerTK antibody binds to human MerTK and murine MerTK, binds to human MerTK and cynomolgus MerTK, or binds to human MerTK, murine MerTK, and cynomolgus MerTK.
- an anti- MerTK antibody of the present disclosure inhibits or reduces binding of one or more ligands to MerTK. In some embodiments that may be combined with any of the embodiments herein, an anti-MerTK antibody of the present disclosure inhibits or reduces binding of ProS to MerTK. In some embodiments that may be combined with any of the embodiments herein, an anti-MerTK antibody of the present disclosure inhibits or reduces binding of ProS to MerTK by at least 20%, by at least 25%, by at least 30%, by at least 40%, by at least 50%, by at least 60%, by at least 70%, by at least 80%, by at least 90%, or by at least 95%.
- an anti-MerTK antibody of the present disclosure inhibits or reduces binding of ProS to MerTK with an IC50 value of 0.58 nM to 25.9 nM. %. In some embodiments that may be combined with any of the embodiments herein, an anti-MerTK antibody of the present disclosure inhibits or reduces binding of ProS to MerTK with an IC50 value of 0.58 nM to 1 nM, 1 nM to 2.5 nM, 2.5 nM to 5 nM, 5 nM to 10 nM, or 10 nM to 25 nM.
- an anti- MerTK antibody of the present disclosure inhibits or reduces binding of Gas6 to MerTK.
- an anti-MerTK antibody of the present disclosure inhibits or reduces binding of Gas6 to MerTK by at least 20%, by at least 25%, by at least 30%, by at least 40%, by at least 50%, by at least 60%, by at least 70%, by at least 80%, by at least 90%, or by at least 95%.
- an anti-MerTK antibody of the present disclosure inhibits or reduces binding of Gas6 to MerTK with an IC50 value of 0.29 nM to 32 nM. In some embodiments that may be combined with any of the embodiments herein, an anti-MerTK antibody of the present disclosure inhibits or reduces binding of Gas6 to MerTK with an IC50 value of 0.29 nM to 1 nM, 1 nM to 5 nM, 5 nM to 10 nM, 10 nM to 25 nM, or 25 nM to 32 nM.
- an anti- MerTK antibody of the present disclosure inhibits or reduces binding of Gas6 to MerTK and inhibits or reduces binding of ProS to MerTK.
- an anti-MerTK antibody of the present disclosure inhibits or reduces binding of Gas6 to MerTK and inhibits or reduces binding of ProS to MerTK by at least 20%, by at least 25%, by at least 30%, by at least 40%, by at least 50%, by at least 60%, by at least 70%, by at least 80%, by at least 90%, or by at least 95% and wherein the antibody reduces or inhibits binding of Gas6 to MerTK by at least 20%, by at least 25%, by at least 30%, by at least 40%, by at least 50%, by at least 60%, by at least 70%, by at least 80%, by at least 90%, or by at least 95%.
- an anti-MerTK antibody of the present disclosure inhibits or reduces binding of Gas6 to MerTK and inhibits or reduces binding of ProS to MerTK with an IC50 value of 0.58 nM to 25.9 nM and wherein the antibody reduces or inhibits binding of Gas6 to MetTK with an IC50 value of 0.29 nM to 32 nM.
- an anti- MerTK antibody of the present disclosure inhibits or reduces binding of ProS to MerTK and does not inhibit or reduce binding of Gas6 to MerTK.
- an anti- MerTK antibody of the present disclosure does not inhibit or reduce binding of ProS to MerTK and does not inhibit binding of Gas6 to MerTK. [0043] In some embodiments that may be combined with any of the embodiments herein, an anti- MerTK antibody of the present disclosure reduces Gas6-mediated phosphorylation of AKT. In some embodiments that may be combined with any of the embodiments herein, an anti-MerTK antibody of the present disclosure reduces Gas6-mediated phosphorylation of AKT with an IC50 value of 0.019 nM to 7.74 nM.
- an anti- MerTK antibody of the present disclosure reduces Gas6-mediated phosphorylation of AKT with an IC50 value of 0.019 nM to 0.25 nM, 0.25 nM to 0.5 nM, 0.5 nM to 1 nM, 1 nM to 2.5 nM, 2.5 nM to 5 nM, or 5 nM to 7.74 nM.
- an anti- MerTK antibody of the present disclosure binds to human MerTK with a binding affinity of 1.4 nM to 81 nM. In some embodiments that may be combined with any of the embodiments herein, an anti- MerTK antibody of the present disclosure binds to human MerTK with a binding affinity of 1.6 nM to 107 nM. In some embodiments that may be combined with any of the embodiments herein, an anti- MerTK antibody of the present disclosure binds to human MerTK with a binding affinity of 30 nM to 186 nM.
- an anti- MerTK antibody of the present disclosure is at least 1.7 times, at least 2.3 times, at least 2.4 times, at least 5 times, at least 7.7 times, or at least 8.5 times more effective at reducing or inhibiting the binding of ProS to MerTK than at reducing or inhibiting the binding of Gas6 to MerTK.
- an anti-MerTK antibody of the present disclosure decreases or reduces efferocytosis by phagocytic cells (e.g., by at least 50%). In some embodiments that may be combined with any of the embodiments provided here, an anti-MerTK antibody of the present disclosure decreases or reduces efferocytosis by phagocytic cells by at least 60%, by at least 70%, by at least 80%, by at least 90%, or by at least 95%.%).
- an anti-MerTK antibody of the present disclosure decreases or reduces efferocytosis by phagocytic cells with an IC50 value of 0.13 nM to 30 nM. In some embodiments that may be combined with any of the embodiments provided here, an anti-MerTK antibody of the present disclosure decreases or reduces efferocytosis by phagocytic cells with an IC50 value of of 0.13 nM to 1 nM, 1 nM to 5 nM, 5 nM to 10 nM, or 10 nM to 30 nM.
- the phagocytic cells are macrophages. In some embodiments, the phagocytic cells are tumore-associated macrophages. In some embodiments, the phagocytic cells are dendritic cells.
- an anti-MerTK antibody of the present disclosure increases or induces Ml-like macrophage polarization.
- an anti- MerTK antibody of the present disclosure increases production, expression, and/or secretion of pro- inflammatory cytokines.
- the pro-inflammatory cytokines are tumor necrosis factor (TNF), interferon (IFN), or interleukin- 12 (IL-12).
- the pro- inflammatory cytokines are chemokine (C-X-C motif) ligand 1 (CXCL-1, KC), monocyte chemoattractant protein- 1 (MCP1, CCL2), macrophage inflammatory protein- 1 -alpha (MlP-lot, CCL3), macrophage inflammatory protein- 1 -beta (MIR-Ib, CCL4), or interleukin-6 (IL-6).
- an anti-MerTK antibody of the present disclosure increases production, expression, and/or secretion of pro- inflammatory cytokines in vitro.
- an anti-MerTK antibody of the present disclosure increases production, expression, and/or secretion of pro-inflammatory cytokines in vivo.
- the anti- MerTK antibody of the present disclosure is a monoclonal antibody.
- the antibody is a human antibody.
- the antibody is a humanized antibody.
- the antibody is a bispecific antibody.
- the antibody is a multivalent antibody.
- the antibody is a chimeric antibody.
- the present disclosure relates to an isolated anti-MerTK antibody that binds to a MerTK protein, wherein the antibody is a humanized form of an anti-MerTK antibody provided herein.
- the anti- MerTK antibody of the present disclosure is of the IgG class, the IgM class, or the IgA class.
- the antibody is of the IgG class and has an IgGl, IgG2, or IgG4 isotype.
- the antibody is of an IgGl isotype with an Fc amino acid sequence selected from the group consisting of SEQ ID NOs: 396, 397, 398, 399, 400, and 401.
- the antibody is a full-length antibody. In certain embodiments that may be combined with any of the embodiments herein, the antibody is an antibody fragment. In certain embodiments that may be combined with any of the embodiments herein, the antibody is an antibody fragment that binds to an epitope on human MerTK or a mammalian MerTK protein. In certain embodiments that may be combined with any of the embodiments herein, the antibody fragment is a Fab, Fab’, Fab’-SH, F(ab’)2, Fv, or scFv fragment.
- the present disclosure relates to an isolated nucleic acid including a nucleic acid sequence encoding an anti-MerTK antibody of any of the preceding embodiments.
- the present disclosure relates to a vector including the nucleic acid of any of the preceding embodiments.
- the present disclosure relates to an isolated host cell including the nucleic acid of any of the preceding embodiments or the vector of any of the preceding embodiments.
- the present disclosure relates to an isolated host cell comprising (i) a nucleic acid comprising a nucleic acid sequence encoding the VH of an anti-MerTK antibody of any of the preceding embodiments and (ii) a nucleic acid comprising a nucleic acid sequence encoding the VL of the anti-MerTK antibody.
- the present disclosure relates to a method of producing an antibody that binds to human MerTK antibody, including culturing the host cell of any of the preceding embodiments so that the anti-MerTK antibody is produced. In certain embodiments, the method further includes recovering the anti-MerTK antibody produced by the cell.
- the present disclosure relates to a pharmaceutical composition including an anti-MerTK antibody of any one of the preceding embodiments and a pharmaceutically acceptable carrier.
- the present disclosure relates to a method of treating an individual having cancer, the method comprising administering to an individual in need thereof a therapeutically effective amount of an anti-MerTK antibody of any of the preceding embodiments.
- the cancer is colon cancer, ovarian cancer, liver cancer, or endometrial cancer.
- the cancer is selected from sarcoma, bladder cancer, breast cancer, colon cancer, endometrial cancer, kidney cancer, renal cancer, leukemia, lung cancer, non-small cell lung cancer, melanoma, lymphoma, pancreatic cancer, prostate cancer, ovarian cancer, stomach cancer, thyroid cancer, cancer of the uterus, liver cancer, cervical cancer, testicular cancer, squamous cell carcinoma, glioma, glioblastoma, adenoma, and neuroblastoma.
- the cancer is selected from glioblastoma multiforme, bladder carcinoma, and esophageal carcinoma.
- the cancer is triple-negative breast carcinoma.
- the cancer may be a primary tumor. In some embodiments, the cancer may be a metastatic tumor at a second site derived from any of the above types of cancer.
- an anti-MerTK antibody of the present disclosure is useful for treating cancer in s subject in need thereof, wherein the cancer expresses MerTK. In some embodiments, the administration of an anti-MerTK antibody of the present disclosure which reduces efferocytosis does not lead to a retinal pathology in the individual. In some embodiments, the method further comprises administering an anti-PD-Ll antibody, an anti-PD-L2 antibody, or anti-PD antibody (e.g., simultaneously or sequentially) to the individual.
- the present disclosure relates to a method of detecting MerTK in a sample comprising contacting said sample with an anti-MerTK antibody of any of the preceding embodiments, optionally wherein the method further comprises detecting the binding of the antibody to MerTK in the sample.
- FIG. 1 sets forth data showing FACS analysis of human MerTK expression on dendritic cells (DCs) and macrophages from two human donors.
- FIG. 2 sets forth data showing FACS analysis of human MerTK expression on various cell lines, including A375, THP-1, U937, SK-MEL-5, and CHO-huMerTK OE cells.
- FIG. 3 sets forth data showing FACS analysis of human MerTK expression in monocytes, macrophages, and dendritic cells obtained from healthy human subjects or obtained from ovary, liver, or endometrial tumors obtained from human subjects.
- FIG. 4 sets forth data showing the effect of anti-MerTK antibodies of the present disclosure on reducing efferocytosis in human macrophages.
- FIG. 5 sets forth data showing the effect of anti-MerTK antibodies of the present disclosure on reducing efferocytosis in mouse bone marrow-derived macrophages.
- FIG. 6 sets forth data showing anti-MerTK antibodies of the present disclosure bind SK-MEL- 5 cells.
- FIG. 7 sets forth data showing anti-MerTK antibodies of the present disclosure blocked Gas6 ligand binding to human MerTK in a dose-dependent manner.
- FIG. 8 sets forth data showing anti-MerTK antibodies of the present disclosure blocked ProS ligand binding to human MerTK in a dose-dependent manner.
- FIG. 9 sets forth data showing epitope binning results of anti-MerTK antibodies of the present disclosure.
- FIGs. 10A and 10B set forth data showing anti-MerTK antibody treatment alone or in combination with anti-PD-Ll antibody treatment reduced tumor growth in vivo.
- FIGs. 11A, 11B, 11C, and 11D set forth data showing changes in the level of MCP1, MlP-lot, MIR-Ib, and TNF in human macrophages following overnight treatment with anti-MerTK antibodies of the present disclosure.
- FIGs. 12A and 12B set forth data showing reduced tumor growth in mice administered anti- PDL1 antibody in combination with anti-MerTK antibodies of the present disclosure.
- FIG. 13 sets forth data showing reduced tumor growth in mice administered anti-PDLl antibody in combination with anti-MerTK antibodies of the present disclosure.
- FIGs. 14A, 14B, 14C, and 14D set forth data showing differences in tumor growth rate in mice administered anti-PDLl antibody in combination with anti-MerTK antibodies of the present disclosure, plotted using a linear scale y-axis.
- FIGs. 15A, 15B, 15C, and 15D set forth data showing differences in tumor growth rate in mice administered anti-PDLl antibody in combination with anti-MerTK antibodies of the present disclosure, plotted using a log2 scale y-axis.
- FIG. 16 sets forth data showing survival curves of tumor-bearing mice administered anti-PDLl antibody in combination with anti-MerTK antibodies of the present disclosure.
- FIGs. 17A, 17B, 17C, 17D, and 17E set forth data showing changes in levels of chemokine (C-X-C motif) ligand 1 (CXCL-1, KC), monocyte chemoattractant protein- 1 (MCP1, CCL2), macrophage inflammatory protein- 1 -alpha (MlP-lot, CCL3), macrophage inflammatory protein- 1 -beta (MIR-Ib, CCL4), and interleukin-6 (IL-6) in plasma from mice following administration of anti-MerTK antibodies of the present disclosure.
- CXCL-1, KC chemokine (C-X-C motif) ligand 1
- MCP1, CCL2 monocyte chemoattractant protein- 1
- MlP-lot macrophage inflammatory protein- 1 -alpha
- MIR-Ib macrophage inflammatory protein- 1 -beta
- IL-6 interleukin-6
- FIGs. 18A, 18B, 18C, and 18D set forth data showing changes in levels of MCP1, MIR-Ib, tumor necrosis factor (TNF), and interferon (IFN) in plasma from cynomolgus monkeys administered anti-MerTK antibodies of the present disclosure.
- FIGs. 19A and 19B set forth data showing changes in the ratio of phosphor-AKT (pAKT) to total AKT (tAKT) in cells treated with various anti-MerTK antibodies of the present disclosure.
- FIGs. 20A, 20B, 20C, 20D, and 20E set forth data showing changes in tumor volume in a MC38 tumor mouse model in vivo in animals administered anti-PDL-1 antibody in combination with various anti-MerTK antibodies of the present disclosure.
- FIG. 21 sets forth data showing binding equilibrium dissociation constants (K D ) of anti-MerTK antibodies of the present disclosure to human (hu), murine (mu), and cynomolgus (cy) MerTK protein.
- anti-MerTK antibodies e.g., monoclonal antibodies
- methods of making and using such antibodies pharmaceutical compositions comprising such antibodies; nucleic acids encoding such antibodies; and host cells comprising nucleic acids encoding such antibodies.
- MerTK or “MerTK polypeptide” or “MerTK protein” are used interchangeably herein refer herein to any native MerTK from any vertebrate source, including mammals such as primates (e.g., humans and cynomolgus monkeys (cynos)) and rodents (e.g., mice and rats), unless otherwise indicated.
- MerTK is also referred to as c-mer, MER, Proto-oncogene c-Mer, Receptor Tyrosine Kinase MerTK, Tyrosine-protein Kinase Mer, STK Kinase, RP38, and MGC133349.
- the term encompasses both wild-type sequences and naturally occurring variant sequences, e.g., splice variants or allelic variants. In some embodiments, the term encompasses "full- length,” unprocessed MerTK as well as any form of MerTK that results from processing in the cell. In some embodiments, the MerTK is human MerTK. As used herein, the term “human MerTK” refers to a polypeptide with the amino acid sequence of SEQ ID NO: 1.
- anti-MerTK antibody an “antibody that binds to MerTK,” and “antibody that specifically binds MerTK” refer to an antibody that is capable of binding MerTK with sufficient affinity such that the antibody is useful as a diagnostic and/or therapeutic agent in targeting MerTK.
- the extent of binding of an anti-MerTK antibody to an unrelated, non-MerTK polypeptide is less than about 10% of the binding of the antibody to MerTK as measured, e.g., by a radioimmunoassay (RIA).
- RIA radioimmunoassay
- an antibody that binds to MerTK has a dissociation constant (KD) of ⁇ 1 ⁇ M, ⁇ 100 nM, ⁇ 10 nM, ⁇ 1 nM, ⁇ 0.1 nM, ⁇ 0.01 nM, or ⁇ 0.001 nM (e.g., 10 -8 M or less, e.g. from 10 8 M to 10 -13 M, e.g. , from 10 9 M to 10 13 M).
- KD dissociation constant
- an anti- MerTK antibody binds to an epitope of MerTK that is conserved among MerTK from different species.
- the term "specific binding” or “specifically binds” or is "specific for" a particular polypeptide or an epitope on a particular polypeptide target means binding that is measurably different from a non-specific interaction.
- Specific binding can be measured, for example, by determining binding of a molecule compared to binding of a control molecule. For example, specific binding can be determined by competition with a control molecule that is similar to the target, for example, an excess of non-labeled target. In this case, specific binding is indicated if the binding of the labeled target to a probe is competitively inhibited by excess unlabeled target.
- telomere binding or “specifically binds to” or is “specific for” a particular polypeptide or an epitope on a particular polypeptide target as used herein can be exhibited, for example, by a molecule having a KD for the target of about any of 10 -4 M or lower, 10 -5 M or lower, 10 -6 M or lower, 10 -7 M or lower, 10 -8 M or lower, 10 -9 M or lower, 10 -10 M or lower, 10 -11 M or lower, 10 -12 M or lower or a KD in the range of 10 -4 M to 10 -6 M or 10 -6 M to 10 10 M or 10 7 M to 10 -9 M.
- affinity and KD values are inversely related.
- binding refers to binding where a molecule binds to a particular polypeptide or epitope on a particular polypeptide without substantially binding to any other polypeptide or polypeptide epitope.
- immunoglobulin (Ig) is used interchangeably with “ antibody ” herein.
- antibody herein is used in the broadest sense and specially covers monoclonal antibodies, polyclonal antibodies, multispecific antibodies (e.g., bispecific antibodies) including those formed from at least two intact antibodies, and antigen-binding antibody fragments so long as they exhibit the desired biological activity.
- Native antibodies are usually heterotetrameric glycoproteins of about 150,000 Daltons, composed of two identical light (“L”) chains and two identical heavy (“H”) chains. Each light chain is linked to a heavy chain by one covalent disulfide bond, while the number of disulfide linkages varies among the heavy chains of different immunoglobulin isotypes. Each heavy and light chain also has regularly spaced intra-chain disulfide bridges. Each heavy chain has at one end a variable domain (VH) followed by a number of constant domains.
- VH variable domain
- Each light chain has a variable domain at one end (V L ) and a constant domain at its other end; the constant domain of the light chain is aligned with the first constant domain of the heavy chain, and the light chain variable domain is aligned with the variable domain of the heavy chain. Particular amino acid residues are believed to form an interface between the light chain and heavy chain variable domains.
- the light chain from any vertebrate species can be assigned to one of two clearly distinct types, called kappa (“K”) and lambda (“ ⁇ ”), based on the amino acid sequences of their constant domains.
- immunoglobulins can be assigned to different classes or isotypes. There are five classes of immunoglobulins: IgA, IgD, IgE, IgG, and IgM, having heavy chains designated alpha (“a”), delta (“d”), epsilon (“e”), gamma (“g”), and mu ( " m “ ). respectively.
- the g and a classes are further divided into subclasses (isotypes) on the basis of relatively minor differences in the CH sequence and function, e.g., humans express the following subclasses: IgGl, IgG2, IgG3, IgG4, IgAl, and IgA2.
- subclasses immunoglobulins
- the subunit structures and three-dimensional configurations of different classes of immunoglobulins are well known and described generally in, for example, Abbas et al, Cellular and Molecular Immunology, 4 th ed.
- variable region refers to the amino-terminal domains of the heavy or light chain of the antibody.
- the variable domains of the heavy chain and light chain may be referred to as “VH” and “VL”, respectively. These domains are generally the most variable parts of the antibody (relative to other antibodies of the same class) and contain the antigen binding sites.
- variable refers to the fact that certain segments of the variable domains differ extensively in sequence among antibodies, such as anti-MerTK antibodies of the present disclosure.
- the variable domain mediates antigen binding and defines the specificity of a particular antibody for its particular antigen.
- HVRs hypervariable regions
- FR framework regions
- the variable domains of native heavy and light chains each comprise four FR regions, largely adopting a beta-sheet configuration, connected by three HVRs, which form loops connecting, and in some cases forming part of, the beta-sheet structure.
- the HVRs in each chain are held together in close proximity by the FR regions and, with the HVRs from the other chain, contribute to the formation of the antigen-binding site of antibodies (see Rabat et al., Sequences of Immunological Interest, Fifth Edition, National Institute of Health, Bethesda, MD (1991)).
- the constant domains are not involved directly in the binding of antibody to an antigen, but exhibit various effector functions, such as participation of the antibody in antibody-dependent-cellular toxicity.
- monoclonal antibody refers to an antibody, such as a monoclonal anti-MerTK antibody of the present disclosure, obtained from a population of substantially homogeneous antibodies, i.e., the individual antibodies comprising the population are identical except for possible naturally occurring mutations and/or post-translation modifications (e.g., isomerizations, amidations, etc.) that may be present in minor amounts.
- Monoclonal antibodies are highly specific, being directed against a single antigenic site. In contrast to polyclonal antibody preparations which typically include different antibodies directed against different determinants (epitopes), each monoclonal antibody is directed against a single determinant on the antigen.
- the monoclonal antibodies are advantageous in that they are synthesized by the hybridoma culture, uncontaminated by other immunoglobulins.
- the modifier “monoclonal” indicates the character of the antibody as being obtained from a substantially homogeneous population of antibodies, and is not to be construed as requiring production of the antibody by any particular method.
- the monoclonal antibodies to be used in accordance with the present invention may be made by a variety of techniques, including, but not limited to one or more of the following methods, immunization methods of animals including, but not limited to rats, mice, rabbits, guinea pigs, hamsters and/or chickens with one or more of DNA(s), virus-like particles, polypeptide(s), and/or cell(s), the hybridoma methods, B- cell cloning methods, recombinant DNA methods, and technologies for producing human or human-like antibodies in animals that have parts or all of the human immunoglobulin loci or genes encoding human immunoglobulin sequences.
- full-length antibody “ intact antibody ” or “ whole antibody” are used interchangeably to refer to an antibody, such as an anti-MerTK antibody of the present disclosure, in its substantially intact form, as opposed to an antibody fragment.
- whole antibodies include those with heavy and light chains including an Fc region.
- the constant domains may be native sequence constant domains (e.g., human native sequence constant domains) or amino acid sequence variants thereof.
- the intact antibody may have one or more effector functions.
- an “ antibody fragment” refers to a molecule other than an intact antibody that comprises a portion of an intact antibody that binds the antigen to which the intact antibody binds.
- antibody fragments include Fab, Fab', F(ab') 2 and Fv fragments; diabodies; linear antibodies ( see U.S. Patent 5641870, Example 2; Zapata et ah, Protein Eng. 8(10): 1057-1062 (1995)); single-chain antibody molecules and multispecific antibodies formed from antibody fragments.
- Papain digestion of antibodies produces two identical antigen-binding fragments, called “ Fab ” fragments, and a residual “Ac” fragment, a designation reflecting the ability to crystallize readily.
- the Fab fragment consists of an entire light chain along with the variable region domain of the heavy chain (VH), and the first constant domain of one heavy chain (C H I).
- VH variable region domain of the heavy chain
- C H I first constant domain of one heavy chain
- Each Fab fragment is monovalent with respect to antigen binding, i.e., it has a single antigen-binding site.
- Pepsin treatment of an antibody yields a single large F(ab') 2 fragment which roughly corresponds to two disulfide linked Fab fragments having different antigen binding activity and is still capable of cross-linking antigen.
- Fab' fragments differ from Fab fragments by having a few additional residues at the carboxy terminus of the C H I domain including one or more cysteines from the antibody hinge region.
- Fab'-SH is the designation herein for Fab' in which the cysteine residue(s) of the constant domains bear a free thiol group.
- F(ab') 2 antibody fragments originally were produced as pairs of Fab' fragments which have hinge cysteines between them. Other chemical couplings of antibody fragments are also known.
- the Fc fragment comprises the carboxy -terminal portions of both heavy chains held together by disulfides.
- the effector functions of antibodies are determined by sequences in the Fc region, the region which is also recognized by Fc receptors (FcR) found on certain types of cells.
- Functional fragments of antibodies comprise a portion of an intact antibody, generally including the antigen binding or variable region of the intact antibody or the Fc region of an antibody which retains or has modified FcR binding capability.
- antibody fragments include linear antibody, single-chain antibody molecules and multispecific antibodies formed from antibody fragments.
- diabodies refers to small antibody fragments prepared by constructing sFv fragments (see preceding paragraph) with short linkers (about 5-10) residues) between the V H and V L domains such that inter-chain but not intra-chain pairing of the variable domains is achieved, thereby resulting in a bivalent fragment, i.e., a fragment having two antigen-binding sites.
- Bispecific diabodies are heterodimers of two “crossover” sFv fragments in which the V H and V L domains of the two antibodies are present on different polypeptide chains.
- a “chimeric antibody ” refers to an antibody (immunoglobulin), such as a chimeric anti-MerTK antibody of the present disclosure, in which a portion of the heavy and/or light chain is identical with or homologous to corresponding sequences in antibodies derived from a particular species or belonging to a particular antibody class or subclass, while the remainder of the chain(s) is(are) identical with or homologous to corresponding sequences in antibodies derived from another species or belonging to another antibody class or subclass, as well as fragments of such antibodies, so long as they exhibit the desired biological activity.
- an antibody immunoglobulin
- a chimeric anti-MerTK antibody of the present disclosure in which a portion of the heavy and/or light chain is identical with or homologous to corresponding sequences in antibodies derived from a particular species or belonging to a particular antibody class or subclass, while the remainder of the chain(s) is(are) identical with or homologous to corresponding sequences in antibodies derived from another species or belonging to another antibody class
- Chimeric antibodies of interest herein include PRIMATIZED ® antibodies wherein the antigen-binding region of the antibody is derived from an antibody produced by, e.g., immunizing macaque monkeys with an antigen of interest.
- “humanized antibody” is used a subset of “chimeric antibodies.”
- “Humanized” forms of non-human (e.g., murine) antibodies are chimeric antibodies comprising amino acid residues from non-human HVRs and amino acid residues from human FRs.
- a humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the HVRs (e.g., CDRs) correspond to those of a non-human antibody, and all or substantially all of the FRs correspond to those of a human antibody.
- a humanized antibody optionally may comprise at least a portion of an antibody constant region derived from a human antibody.
- a "humanized form" of an antibody, e.g., a non-human antibody refers to an antibody that has undergone humanization.
- a “human antibody ” is one that possesses an amino-acid sequence corresponding to that of an antibody, such as an anti-MerTK antibody of the present disclosure, produced by a human and/or has been made using any of the techniques for making human antibodies as disclosed herein. This definition of a human antibody specifically excludes a humanized antibody comprising non-human antigen binding residues. Human antibodies can be produced using various techniques known in the art, including phage-display libraries and yeast-display libraries.
- Human antibodies can be prepared by administering the antigen to a transgenic animal that has been modified to produce such antibodies in response to antigenic challenge, but whose endogenous loci have been disabled, e.g., immunized xenomice as well as generated via a human B-cell hybridoma technology.
- hypervariable region refers to the regions of an antibody -variable domain, such as that of an anti-MerTK antibody of the present disclosure, that are hypervariable in sequence and/or form structurally defined loops.
- antibodies comprise six HVRs; three in the VH (H1, H2, H3), and three in the VL (LI, L2, L3).
- H3 and L3 display the most diversity of the six HVRs, and H3 in particular is believed to play a unique role in conferring fine specificity to antibodies.
- Naturally occurring came lid antibodies consisting of a heavy chain only are functional and stable in the absence of light chain.
- the HVRs may be Kabat complementarity-determining regions (CDRs) based on sequence variability and are the most commonly used (Kabat et al., supra).
- the HVRs may be Chothia CDRs. Chothia refers instead to the location of the structural loops (Chothia and Lesk J. Mol. Biol. 196:901-917
- the HVRs may be AbM HVRs.
- the AbM HVRs represent a compromise between the Kabat CDRs and Chothia structural loops, and are used by Oxford Molecular's AbM antibody-modeling software.
- the HVRs may be “contact” HVRs. The “contact”
- HVRs are based on an analysis of the available complex crystal structures. The residues from each of these HVRs are noted below.
- HVRs may comprise “extended HVRs” as follows: 24-36 or 24-34 (LI), 46-56 or 50-56 (L2), and 89-97 or 89-96 (L3) in the VL, and 26-35 (HI), 50-65 or 49-65 (a preferred embodiment) (H2), and 93- 102, 94-102, or 95-102 (H3) in the VH.
- the variable-domain residues are numbered according to Kabat et al., supra, for each of these extended-HVR definitions.
- Framework or “FR” residues are those variable-domain residues other than the HVR residues as herein defined.
- acceptor human framework is a framework comprising the amino acid sequence of a VL or VH framework derived from a human immunoglobulin framework or a human consensus framework.
- An acceptor human framework “derived from” a human immunoglobulin framework or a human consensus framework may comprise the same amino acid sequence thereof, or it may comprise pre-existing amino acid sequence changes. In some embodiments, the number of pre existing amino acid changes are 10 or less, 9 or less, 8 or less, 7 or less, 6 or less, 5 or less, 4 or less, 3 or less, or 2 or less.
- VL acceptor human framework is identical in sequence to the VL human immunoglobulin framework sequence or human consensus framework sequence.
- a “human consensus framework ” is a framework that represents the most commonly occurring amino acid residues in a selection of human immunoglobulin VL or VH framework sequences.
- the selection of human immunoglobulin VL or VH sequences is from a subgroup of variable domain sequences.
- the subgroup of sequences is a subgroup as in Rabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, MD (1991). Examples include for the VL, the subgroup may be subgroup kappa I, kappa II, kappa III or kappa IV as in Rabat et al, supra. Additionally, for the VH, the subgroup may be subgroup I, subgroup II, or subgroup III as in Rabat et al, supra.
- amino-acid modification at a specified position, e.g. , of an anti-MerTR antibody of the present disclosure, refers to the substitution or deletion of the specified residue, or the insertion of at least one amino acid residue adjacent the specified residue. Insertion “adjacent” to a specified residue means insertion within one to two residues thereof. The insertion may be N-terminal or C-terminal to the specified residue.
- the preferred amino acid modification herein is a substitution.
- TV is the minimum antibody fragment which comprises a complete antigen-recognition and - binding site. This fragment consists of a dimer of one heavy- and one light-chain variable region domain in tight, non-covalent association. From the folding of these two domains emanate six hypervariable loops (3 loops each from the H and L chain) that contribute the amino acid residues for antigen binding and confer antigen binding specificity to the antibody. However, even a single variable domain (or half of an Fv comprising only three HVRs specific for an antigen) has the ability to recognize and bind antigen, although at a lower affinity than the entire binding site.
- Single-chain Fv also abbreviated as “sFv” or “scFv ” are antibody fragments that comprise the VH and VL antibody domains connected into a single polypeptide chain.
- the sFv polypeptide further comprises a polypeptide linker between the VH and VL domains, which enables the sFv to form the desired structure for antigen binding.
- Antibody effector functions refer to those biological activities attributable to the Fc region (a native sequence Fc region or amino acid sequence variant Fc region) of an antibody, and vary with the antibody isotype.
- Fc region herein is used to define a C-terminal region of an immunoglobulin heavy chain, including native -sequence Fc regions and variant Fc regions.
- the human IgG heavy-chain Fc region is usually defined to stretch from an amino acid residue at position Cys226, or from Pro230, to the carboxyl- terminus thereof.
- the C-terminal lysine (residue 447 according to the EU numbering system) of the Fc region may be removed, for example, during production or purification of the antibody, or by recombinantly engineering the nucleic acid encoding a heavy chain of the antibody.
- composition of intact antibodies may comprise antibody populations with all K447 residues removed, antibody populations with no K447 residues removed, and antibody populations having a mixture of antibodies with and without the K447 residue.
- Suitable native-sequence Fc regions for use in the antibodies of the present disclosure include human IgGl, IgG2, IgG3 and IgG4.
- a “ native sequence Fc region ” comprises an amino acid sequence identical to the amino acid sequence of an Fc region found in nature.
- Native sequence human Fc regions include a native sequence human IgGl Fc region (non-A and A allotypes); native sequence human IgG2 Fc region; native sequence human IgG3 Fc region; and native sequence human IgG4 Fc region as well as naturally occurring variants thereof.
- a “ variant Fc region ” comprises an amino acid sequence which differs from that of a native sequence Fc region by virtue of at least one amino acid modification, preferably one or more amino acid substitution(s).
- the variant Fc region has at least one amino acid substitution compared to a native sequence Fc region or to the Fc region of a parent polypeptide, e.g. from about one to about ten amino acid substitutions, and preferably from about one to about five amino acid substitutions in a native sequence Fc region or in the Fc region of the parent polypeptide.
- the variant Fc region herein will preferably possess at least 80% homology with a native sequence Fc region and/or with an Fc region of a parent polypeptide, and most preferably at least 90% homology therewith, more preferably at least 95% homology therewith.
- Fc receptor or “ FcR ” describes a receptor that binds to the Fc region of an antibody.
- the preferred FcR is a native sequence human FcR.
- a preferred FcR is one which binds an IgG antibody (a gamma receptor) and includes receptors of the FcyRI, FcyRII. and FcyRIII subclasses, including allelic variants and alternatively spliced forms of these receptors, FcyRII receptors include FcyRIIA (an “activating receptor”) and FcyRIIB (an “inhibiting receptor”), which have similar amino acid sequences that differ primarily in the cytoplasmic domains thereof.
- Activating receptor FcyRIIA contains an immunoreceptor tyrosine-based activation motif (“ITAM”) in its cytoplasmic domain.
- Inhibiting receptor FcyRIIB contains an immunoreceptor tyrosine-based inhibition motif (“ITIM”) in its cytoplasmic domain.
- ITAM immunoreceptor tyrosine-based activation motif
- ITIM immunoreceptor tyrosine-based inhibition motif
- Other FcRs including those to be identified in the future, are encompassed by the term “FcR” herein. FcRs can also increase the serum half-life of antibodies.
- percent (%) amino acid sequence identity and “ homology ” with respect to a peptide, polypeptide or antibody sequence refers to the percentage of amino acid residues in a candidate sequence that are identical with the amino acid residues in the specific peptide or polypeptide sequence, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity, and not considering any conservative substitutions as part of the sequence identity. Alignment for purposes of determining percent amino acid sequence identity can be achieved in various ways that are within the skill in the art, for instance, using publicly available computer software such as BLAST, BLAST-2, ALIGN or MEGALIGNTM (DNASTAR) software. Those skilled in the art can determine appropriate parameters for measuring alignment, including any algorithms known in the art needed to achieve maximal alignment over the full-length of the sequences being compared.
- compete when used in the context of antibodies that compete for the same epitope or overlapping epitopes means competition between antibody as determined by an assay in which the antibody being tested prevents or inhibits (e.g ., reduces) specific binding of a reference molecule (e.g., a ligand, or a reference antibody) to a common antigen (e.g. , MerTK or a fragment thereof).
- a reference molecule e.g., a ligand, or a reference antibody
- a common antigen e.g. , MerTK or a fragment thereof.
- RIA solid phase direct or indirect radioimmunoassay
- EIA solid phase direct or indirect enzyme immunoassay
- sandwich competition assay see, e.g., Stahli et ah, 1983, Methods in Enzymology 9:242-253
- solid phase direct biotin-avidin EIA see, e.g., Kirkland et ah, 1986, J. Immunol.
- solid phase direct labeled assay solid phase direct labeled sandwich assay (see, e.g., Harlow and Lane, 1988, Antibodies, A Laboratory Manual, Cold Spring Harbor Press); solid phase direct label RIA using 1-125 label (see, e.g., Morel et ah, 1988, Molec. Immunol. 25:7-15); solid phase direct biotin-avidin EIA (see, e.g., Cheung, et ah, 1990, Virology 176:546-552); and direct labeled RIA (Moldenhauer et ah, 1990, Scand. J. Immunol. 32:77-82).
- such an assay involves the use of purified antigen bound to a solid surface or cells bearing either of these, an unlabeled test antibody and a labeled reference antibody.
- Competitive inhibition is measured by determining the amount of label bound to the solid surface or cells in the presence of the test antibody.
- the test antibody is present in excess.
- Antibodies identified by competition assay include antibodies binding to the same epitope as the reference antibody and antibodies binding to an adjacent epitope sufficiently proximal to the epitope bound by the reference antibody for steric hindrance to occur.
- a competing antibody when present in excess, it will inhibit (e.g., reduce) specific binding of a reference antibody to a common antigen by at least 20%, 30%, 40%, 50%, 60%, 70%, 80%, 85%, 90%, 95%, 97.5%, and/or near 100%.
- an “ interaction ” between a MerTK polypeptide and a second polypeptide encompasses, without limitation, protein-protein interaction, a physical interaction, a chemical interaction, binding, covalent binding, and ionic binding.
- an antibody “inhibits interaction” between two polypeptides when the antibody disrupts, reduces, or completely eliminates an interaction between the two polypeptides.
- the interaction can be inhibited by at least any of 20%, 30%, 40%, 50%, 60%, 70%, 80%, 85%, 90%, 95%, 97.5%, and/or near 100%.
- epitope includes any determinant capable of being bound by an antibody.
- An epitope is a region of an antigen that is bound by an antibody that targets that antigen, and when the antigen is a polypeptide, includes specific amino acids that directly contact the antibody. Most often, epitopes reside on polypeptides, but in some instances, can reside on other kinds of molecules, such as nucleic acids.
- Epitope determinants can include chemically active surface groupings of molecules such as amino acids, sugar side chains, phosphoryl or sulfonyl groups, and can have specific three dimensional structural characteristics, and/or specific charge characteristics.
- antibodies specific for a particular target antigen will preferentially recognize an epitope on the target antigen in a complex mixture of polypeptides and/or macromolecules.
- an “isolated” antibody such as an isolated anti -MerTK antibody of the present disclosure, is one that has been identified, separated and/or recovered from a component of its production environment (e.g., naturally or recombinantly).
- the isolated antibody is free of association with all other contaminant components from its production environment.
- Contaminant components from its production environment such as those resulting from recombinant transfected cells, are materials that would typically interfere with research, diagnostic or therapeutic uses for the antibody, and may include enzymes, hormones, and other proteinaceous or non-proteinaceous solutes.
- the antibody will be purified: (1) to greater than 95% by weight of antibody as determined by, for example, the Lowry method, and in some embodiments, to greater than 99% by weight; (2) to a degree sufficient to obtain at least 15 residues of N-terminal or internal amino acid sequence by use of a spinning cup sequenator, or (3) to homogeneity by SDS-PAGE under non-reducing or reducing conditions using Coomassie blue or, preferably, silver stain.
- Isolated antibody includes the antibody in situ within recombinant T-cells since at least one component of the antibody’s natural environment will not be present. Ordinarily, however, an isolated polypeptide or antibody will be prepared by at least one purification step.
- An “isolated” nucleic acid molecule encoding an antibody is a nucleic acid molecule that is identified and separated from at least one contaminant nucleic acid molecule with which it is ordinarily associated in the environment in which it was produced. Preferably, the isolated nucleic acid is free of association with all components associated with the production environment.
- the isolated nucleic acid molecules encoding the polypeptides and antibodies herein is in a form other than in the form or setting in which it is found in nature. Isolated nucleic acid molecules therefore are distinguished from nucleic acid encoding the polypeptides and antibodies herein existing naturally in cells.
- vector is intended to refer to a nucleic acid molecule capable of transporting another nucleic acid to which it has been linked.
- plasmid refers to a circular double stranded DNA into which additional DNA segments may be ligated.
- phage vector refers to a viral vector, wherein additional DNA segments may be ligated into the viral genome.
- viral vector capable of autonomous replication in a host cell into which they are introduced (e.g., bacterial vectors having abacterial origin of replication and episomal mammalian vectors).
- vectors e.g., non-episomal mammalian vectors
- vectors can be integrated into the genome of a host cell upon introduction into the host cell, and thereby are replicated along with the host genome.
- certain vectors are capable of directing the expression of genes to which they are operatively linked.
- Such vectors are referred to herein as “recombinant expression vectors,” or simply, “expression vectors.”
- expression vectors of utility in recombinant DNA techniques are often in the form of plasmids.
- plasmid and “vector” may be used interchangeably as the plasmid is the most commonly used form of vector.
- Polynucleotide refers to polymers of nucleotides of any length, and include DNA and RNA.
- the nucleotides can be deoxyribonucleotides, ribonucleotides, modified nucleotides or bases, and/or their analogs, or any substrate that can be incorporated into a polymer by DNA or RNA polymerase or by a synthetic reaction.
- a “host cell ” includes an individual cell or cell culture that can be or has been a recipient for vector(s) for incorporation of polynucleotide inserts.
- Host cells include progeny of a single host cell, and the progeny may not necessarily be completely identical (in morphology or in genomic DNA complement) to the original parent cell due to natural, accidental, or deliberate mutation.
- a host cell includes cells transfected in vivo with a polynucleotide(s) of this invention.
- Carriers as used herein include pharmaceutically acceptable carriers, excipients, or stabilizers that are nontoxic to the cell or mammal being exposed thereto at the dosages and concentrations employed.
- treatment refers to clinical intervention designed to alter the natural course of the individual being treated during the course of clinical pathology. Desirable effects of treatment include decreasing the rate of progression, ameliorating or palliating the pathological state, and remission or improved prognosis of a particular disease, disorder, or condition.
- An individual is successfully “treated”, for example, if one or more symptoms associated with a particular disease, disorder, or condition are mitigated or eliminated.
- An “effective amount ” refers to at least an amount effective, at dosages and for periods of time necessary, to achieve the desired therapeutic result. An effective amount can be provided in one or more administrations.
- an effective amount is also one in which any toxic or detrimental effects of the treatment are outweighed by the therapeutically beneficial effects.
- beneficial or desired results include clinical results such as decreasing one or more symptoms resulting from the disease, increasing the quality of life of those suffering from the disease, decreasing the dose of other medications required to treat the disease, enhancing effect of another medication such as via targeting, delaying the progression of the disease, and/or prolonging survival.
- An effective amount of drug, compound, or pharmaceutical composition is an amount sufficient to accomplish therapeutic treatment either directly or indirectly.
- an effective amount of a drug, compound, or pharmaceutical composition may or may not be achieved in conjunction with another drug, compound, or pharmaceutical composition.
- an “effective amount” may be considered in the context of administering one or more therapeutic agents, and a single agent may be considered to be given in an effective amount if, in conjunction with one or more other agents, a desirable result may be or is achieved.
- An “individual ” for purposes of treatment refers to any animal classified as a mammal, including humans, domestic and farm animals, and zoo, sport, or pet animals, such as dogs, horses, rabbits, cattle, pigs, hamsters, gerbils, mice, ferrets, rats, cats, and the like. In some embodiments, the individual is human.
- administration “in conjunction ” with another compound or composition includes simultaneous administration and/or administration at different times.
- Administration in conjunction also encompasses administration as a co-formulation or administration as separate compositions, including at different dosing frequencies or intervals, and using the same route of administration or different routes of administration.
- administration in conjunction is administration as a part of the same treatment regimen.
- anti-MerTK antibodies are useful, e.g., for the diagnosis or treatment of the MerTK associated disorders.
- the present disclosure provides isolated (e.g., monoclonal) antibodies that bind to an epitope within a MerTK protein or polypeptide of the present disclosure.
- MerTK proteins or polypeptides of the present disclosure include, without limitation, a mammalian MerTK protein or polypeptide, human MerTK protein or polypeptide, mouse (murine) MerTK protein or polypeptide, and cynomogus MerTK protein or polypeptide.
- MerTK proteins and polypeptides of the present disclosure include naturally occurring variants of MerTK.
- MerTK proteins and polypeptides of the present disclosure are membrane bound.
- MerTK proteins and polypeptides of the present disclosure are a soluble extracellular domain of MerTK.
- MerTK is expressed in a cell.
- MerTK is expressed in phagocytic cells, including without limitation, macrophages and dendritic cells.
- MerTK is expressed in monocytes, natural killer cells, natural killer T cells, microglia, endothelial cells, megakaryocytes, and platelets.
- high levels of MerTK expression are also found in ovary, prostate, testis, lung, retina, and kidney. Additionally, MerTK displays ectopic or overexpression in numerous cancers (Linger et al, 2008, Adv Cancer Res, 100:35-83).
- an anti-MerTK antibody that binds to human MerTK but does not bind to cynomolgus MerTK. In some embodiments, an anti-MerTK antibody is provided that binds to human MerTK but does not bind to murine MerTK. In some embodiments, an anti-MerTK antibody is provided that binds to human MerTK but does not bind to cynomolgus MerTK and does not bind to murine MerTK. In some embodiments, an anti-MerTK antibody is provided that binds to human MerTK and binds to cynomolgus MerTK.
- an anti-MerTK antibody that binds to human MerTK and binds to cynomolgus MerTK but does not bind to murine MerTK. In some embodiments, an anti-MerTK antibody is provide that binds to human MerTK and binds to murine MerTK. In some embodiments, an anti-MerTK antibody is provide that binds to human MerTK and binds to murine MerTK but does not bind cynomolgus MerTK. In some embodiments, an anti-MerTK antibody is provide that binds to human MerTK, cynomolgus MerTK, and murine MerTK.
- An anti-MerTk antibody that binds to human, cynomolgus, and murine MerTK is advantageous for performing in vivo studies in mammalian animal models of disease (e.g., cancer) as well as studies in non-human primates.
- MerTK proteins of the present disclosure interact with (e.g., bind) one or more ligands or binding partners, including, without limitation, Protein S (ProS or ProSl), Growth arrest specific gene 6 (Gas6), Tubby, Tubby-like protein 1 (TULP-1), and Galectin-3.
- ligands or binding partners including, without limitation, Protein S (ProS or ProSl), Growth arrest specific gene 6 (Gas6), Tubby, Tubby-like protein 1 (TULP-1), and Galectin-3.
- Anti-MerTK antibodies of the present disclosure can affect the interaction of MerTK with one or more of its various ligands and binding partners.
- an anti-MerTK antibody of the present disclosure inhibits (i.e., blocks) or reduces binding between MerTK and one or more MerTK ligands.
- an anti-MerTK antibody of the present disclosure inhibits or reduces binding of ProS to MerTK. In some embodiments, an anti-MerTK antibody of the present disclosure inhibits or reduces binding of ProS to MerTK but does not inhibit or reduce binding of Gas6 to MerTK. In some embodiments, an anti-MerTK antibody of the present disclosure inhibits or reduces binding of Gas6 to MerTK. In some embodiments, an anti-MerTK antibody of the present disclosure inhibits or reduces binding to Gas6 to MerTK but does not inhibit or reduce binding of ProS to MerTK. In yet other embodiments, an anti-MerTK antibody of the present disclosure inhibits or reduces binding of ProS to MerTK and inhibits or reduces binding of Gas6 to MerTK.
- an anti-MerTK antibody of the present disclosure does not inhibit or reduce binding of ProS to MerTK and does not inhibit or reduce binding of Gas6 to MerTK.
- An IC50 value for inhibition or blocking of Gas6 ligand binding to MerTK or for inhibition or blocking of ProS ligand binding to MerTK can be determined using methods known by one of skill in the art, such as that described herein in the Example below (e.g., Example 13).
- an anti-MerTK antibody of the present disclosure inhibits or reduces Gas6 ligand binding or inhibits or reduces ProS ligand binding to MerTK in vitro.
- an anti-MerTK antibody of the present disclosure inhibits or reduces Gas6 ligand binding to human MerTK with an IC50 value in the range of 0.29 nM to 32 nM. In some embodiments, an anti-MerTK antibody of the present disclosure inhibits or reduces Gas6 ligand binding to human MerTK with an IC50 value in the range of 0.29 nM to 1.0 nM, in the range of 1.0 nM to 5 nM, in the range of 5 nM to 10 nM, in the range of 10 nM to 25 nM, or in the range of 25 nM to 32 nM.
- an anti-MerTK antibody of the present disclosure inhibits or reduces ProS ligand binding to human MerTK with an IC50 value in the range of 0.58 nM to 25.9 nM. In some embodiments, an anti-MerTK antibody of the present disclosure inhibits or reduces ProS ligand binding to human MerTK with an IC50 value in the range of 0.58 nM to 1 nM, in the range of 1 nM to 2.5 nM, in the range of 2.5 nM to 5 nM, in the range of 5 nM to 10 nM, in the range of 10 nM to 25 nM.
- the relative effectiveness of an antibody at reducing or inhibiting the binding of ProS and Gas6 to MerTK can be determined using such IC50 values.
- an antibody that inhibits binding of Gas6 to MerTK at an IC50 value that is 1.7 times greater than its IC50 value for inhibiting binding of ProS to MerTK is 1.7 times more effective at reducing or inhibiting the binding of ProS to MerTK than at reducing or inhibiting the binding of Gas6 to MerTK.
- an anti-MerTK antibody is at least 1.7 times, at least 2.3 times, at least 2.4 times, at least 5 times, at least 7.7 times, or at least 8.5 times more effective at reducing or inhibiting the binding of ProS to MerTK than at reducing or inhibiting the binding of Gas6 to MerTK.
- an anti-MerTK antibody of the present disclosure inhibits or reduces Gas6 ligand binding to MerTK by at least 20%, by at least 25, by at least 30%, by at least 40%, by at least 50%, by at least 60%, by at least 70%, by at least 80%, by at least 90%, or by at least 95% compared to Gas6 ligand binding to MerTK in the absence of an anti-MerTK antibody of the present disclosure.
- an anti-MerTK antibody of the present disclosure inhibits or reduces ProS ligand binding to MerTK by at least 20%, by at least 25%, by at least 30%, by at least 40%, by at least 50%, by at least 60%, by at least 70%, by at least 80%, by at least 90%, or by at least 95% compared to ProS ligand binding to MerTK in the absence of an anti-MerTK antibody of the present disclosure.
- Percent inhibition or reduction of Gas6 ligand binding to MerTK or of ProS ligand binding to MerTK can be determined by measuring IC50 values using standard methods known by one of skill in the art, such as described herein in Example 13.
- AKT activity is a downstream target of Gas6 binding to MerTK, Axl, or Tyro-3 receptors.
- the binding of MerTK ligand Gas6 to MerTK induces AKT phosphorylation (pAKT) (see, e.g., Angelillo-Scherrer et al, 2008, J Clin Invest, 118:583-596; Moody et al, 2016, Int J Cancer, 139: 1340- 1349).
- Anti-MerTK antibodies of the present disclosure were effective at inhibiting Gas6-mediated phospho-AKT (pAKT) activity in human macrophages (e.g., M2c macrophages) in a dose-dependent manner.
- anti-MerTK antibodies of the present disclosure were effective at inhibiting Gas6- mediated MerTK signaling as evidenced by inhibition of pAKT levels.
- an anti- MerTK antibody of the present disclosure inhibits or reduces Gas6-mediated pAKT activity in vitro.
- the relative effectiveness of an anti-MerTK antibody at reducing or inhibiting pAKT activity in a cell can be determined by measuring the IC50 values.
- IC50 values for inhibition of Gas6-mediated pAKT activity can be determined using methods known by one of skill in the art, such as that described herein in Example 22 below.
- an anti-MerTK antibody of the present disclosure inhibits Gas6-mediated pAKT activity in macrophages (e.g., M2c macrophages) with an IC50 value ranging from 0.019 nM to 7.74 nM.
- an anti-MerTK antibody of the present disclosure inhibits Gas6-mediated pAKT activity in macrophages (e.g., M2c macrophages) with an IC50 value of 0.019 nM to 0.25 nM, 0.25 nM to 0.50 nM, 0.50 nM to 1.0 nM, 1.0 nM to 2.5 nM, 2.5 nM to 5.0 nM, or 5.0 nM to 10 nM.
- Efferocytosis refers to phagocytic clearance of dying or apoptotic cells. Efferocytosis can be accomplished by professional phagocytes (e.g., macrophages, dendritic cells, microglia), non-professional phagocytes (e.g., epithelial cells, fibroblasts, retinal pigment epithelial cells), or specialized phagocytes. (Elliott et al, 2017, J Immunol, 198: 1387-1394). Efferocytosis leads to the removal of dead or dying cells before their membrane integrity is breached and their cellular contents leak into the surrounding tissue, thus preventing exposure of tissue to toxic enzymes, oxidants, and other intracellular components.
- professional phagocytes e.g., macrophages, dendritic cells, microglia
- non-professional phagocytes e.g., epithelial cells, fibroblasts, retinal pigment epithelial cells
- specialized phagocytes
- Apoptotic cells expose a variety of molecules on their cell surface (“eat-me” signals) that are recognized by receptors on phagocytic cells.
- One such “eat me” signaling molecules is phosphatidylserine (PtdSer), which is normally confined to the inner leaflet of the cell membrane. During apoptosis, PtdSer is exposed to the outer leaflet of the cell membrane.
- PtdSer phosphatidylserine
- MerTK ligands ProS and Gas6 contain gamma- carboxylated glutamic acid residues near their N-terminal domains; gamma-carboxylation of the glutamic acid domain enables binding to phosphatidylserine.
- Anti-MerTK antibodies of the present disclosure were effective at reducing or decreasing efferocytosis in various phagocytic cells. Anti-MerTK antibodies that that block ProS only binding to MerTK showed robust inhibition of efferocytosis, having an IC50 comparable to anti-MerTK antibodies that block both ProS and Gas6 binding to MerTK.
- anti-MerTK antibodies that are ProS-specific blockers may provide improved therapeutic index for use in anti-tumor responses without inducing eye toxicity issues.
- an anti-MerTK antibody of the present disclosure decreases or reduces efferocytosis by phagocytic cells. In some embodiments, an anti-MerTK antibody of the present disclosure decreases or reduces efferocytosis by macrophages. In some embodiments, an anti- MerTK antibody of the present disclosure decreases or reduces efferocytosis by dendritic cells. In some embodiments, an anti-MerTK antibody of the present disclosure decreases or reduces efferocytosis by bone marrow-derived macrophages.
- an anti-MerTK antibody of the present disclosure decreases or reduces efferocytosis by phagocytic cells by at least 10%, by at least 20%, by at least 25%, by at least 30%, by at least 40%, by at least 50%, by at least 60%, by at least 70%, by at least 80%, by at least 90%, or by at least 95% compared to the level of efferocytosis in phagocytic cells in the absence of an anti-MerTK antibody. Percent reduction of efferocytosis can be determined using standard methods known to one of skill in the art, such as described herein in Example 11.
- an anti-MerTK antibody of the present disclosure decreases or reduces efferocytosis by a phagocytic cell (e.g., a human macrophage) with an IC50 in the range of about 0.13 nM to about 30 nM, as assessed by methods described herein in the Example below (e.g., Example 11).
- a phagocytic cell e.g., a human macrophage
- an anti-MerTK antibody of the present disclosure decreases or reduces efferocytosis by a phagocytic cell with an IC50 value in the range of 0.13 nM to 1.0 nM, in the range of 1 nM to 5 nM, in the range of 5 nM to 10 nM, or in the range of 10 nM to 30 nM.
- Blocking efferocytosis drives Ml -like macrophage polarization, resulting in increased production of pro-inflammatory cytokines (e.g., TNF, IFN, IL-12) and recruitment of cytotoxic cells, such as CD8+
- pro-inflammatory cytokines e.g., TNF, IFN, IL-12
- cytotoxic cells such as CD8+
- anti-MerTK antibodies of the present disclosure are effective at increasing Ml -like macrophage polarization and at increasing production, expression, and/or secretion of pro-inflammatory cytokines/chemokines, including TNF, IFN, IL-6, IL-1, IL-12, chemokine (C-X-C motif) ligand 1 (CXCL-1, KC), monocyte chemoattractant protein- 1 (MCP1, CCL2), macrophage inflammatory protein- 1 -alpha (MIP-la, CCL3), and/or macrophage inflammatory protein- 1 -beta (MIR-Ib, CCL4).
- pro-inflammatory cytokines/chemokines including TNF, IFN, IL-6, IL-1, IL-12, chemokine (C-X-C motif) ligand 1 (CXCL-1, KC), monocyte chemoattractant protein- 1 (MCP1, CCL2), macrophage inflammatory protein- 1 -alpha (MIP
- an anti-MerTK antibody of the present disclosure increases Ml -like macrophage polarization. In some embodiments, an anti-MerTK antibody of the present disclosure increases macrophage production, expression, or secretion of one or more pro-inflammatory cytokines. In some embodiments, an anti-MerTK antibody of the present disclosure increases macrophage production, expression, or secretion of TNF, IFN, IL-6, IL-1, IL-12, CXCL-1, MCP1, MIP-la, and/or MIR-1b.
- a method for increasing pro-inflammatory cytokine production, expression, and/or secretion in a subject in need thereof comprising administering to the subject an anti-MerTK antibody of the present disclosure such that the production, expression, and/or secretion of one or more pro-inflammatory cytokines in the subject is increased.
- the production, expression, and/or secretion of TNF is increased.
- the production, expression, and/or secretion of IFN is increased.
- the production, expression, and/or secretion of IL-12 is increased.
- the production, expression, and/or secretion of CXCL-1 is increased.
- the production, expression, and/or secretion of MCP1 is increased. In some embodiments, the production, expression, and/or secretion of MIP-la is increased. In some embodiments, the production, expression, and/or secretion of MIP-Ib is increased.
- a method for increasing Ml -like macrophage polarization in a subject in need thereof comprising administering to the subject an anti- MerTK antibody of the present disclosure such that Ml -like macrophage polarization in the subject is increased.
- Increased Ml -like macrophage polarization is measured by various methods known to one of skill in the art, such as increased production, expression, or secretion of one or more pro-inflammatory cytokines, including TNF, IFN, IL-12, CXCL1, MCP1, MIP-la, and/or MIR-1b.
- a link between efferocytosis and cancer progression has been described.
- blockade of efferocytosis using Annexin V which blocks PtdSer from interacting with the efferocytosis machinery of phagocytes, sufficiently reduces tumor progression and metastasis (Stach et al, 2000, Cell Death Diff, 7:911; Bondanza et al, 2004, J Exp Med, 200: 1157; Werfel and Cook, 2018, Sem Immunopathology, 40:545-554).
- MerTK correlates with poor prognosis and survival in numerous human cancers, as does its PtdSer bridging ligand Gas6 (Graham et al, 2014, Nat Rev Cancer, 14:769; Linger et al, 2010, Expert Opin Ther Targets, 14: 1073-1090; Wang et al, 2013, Oncogene, 32:872; Jansen et al, 2011, J Proteome Res, 11:728-735; Tworkoski et al, 2011, Mol Cancer Res, p.molcanres-0512; Graham et al, 2006, Clin Cancer Res, 12:2662-2669; Keating et al, 2006, Oncogene, 25:6092). Accordingly, anti- MerTK antibodies of the present disclosure, which reduce efferocytosis by phagocytic cells, are thus effective at reducing tumor progression and metastasis.
- an anti-MertK antibody of the present disclosure that blocks binding of both Gas6 and ProS to MerTK may display less systemic in vivo toxitiy compared to an anti -MerTK antibody of the present disclosure that blocks binding of ProS to MerTK but does not block binding of Gas6 to MerTK.
- Anti-MerTk antibody MTK-16 (which blocks binding of both Gas6 and ProS to MerTK) binds to the Igl domain of MerTK protein, while anti -MerTK antibodies MTK-15 and MTK-29 (which block binding of ProS to MerTK but which do not block binding of Gas6 to MerTK) bind to both the Ig2 and the FN1 domain of MerTK protein.
- an anti-MerTK antibody that binds to the Ig 1 domain of MerTK may display less systemic in vivo toxicity than an anti-MerTK antibody that binds to both the Ig2 and FN 1 domains of MerTK.
- anti-MerTK antibodies comprising at least one, two, three, four, five, or six HVRs selected from: (a) HVR-H1 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs:75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, and 98; (b) HVR-H2 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs:99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, and 124; (c) HVR-H3 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs:99, 100,
- HVR-L2 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs:187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204, and 205; and
- HVR-L3 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs:207, 208, 209, 210, 211, 212, 213, 214, 215, 216, 217, 218, 219, 220, 221, 222, 223, 224, 225, 226, 227, 228, 229, 230, 231, 232, and 233.
- anti-MerTK antibodies comprising at least one, at least two, or all three V H HVR sequences selected from (a) HVR-H1 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, and 98; (b) HVR-H2 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, and 124; and (c) HVR-H3 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 99, 100,
- anti-MerTK antibodies comprising at least one, at least two, or all three V L HVR sequences selected from (a) HVR-L1 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 158, 159, 160, 161, 162, 163, 164, 165, 166, 167,
- HVR-L2 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 202, 203, 204, and 205; and
- HVR-L3 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 207, 208, 209, 210, 211, 212, 213, 214, 215, 216, 217, 218, 219, 220, 221, 222, 223, 224, 225, 226, 227, 228, 229, 230, 231, 232, and 233.
- anti-MerTK antibodies comprising (a) a V H domain comprising at least one, at least two, or all three V H HVR sequences selected from (i) HVR-H1 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 75, 76, 77, 78,
- HVR-H2 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, and 124
- HVR-H3 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148
- HVR-L2 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs:
- HVR-L3 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs:
- anti-MerTK antibodies comprising: (a) HVR-Hl comprising the amino acid sequence of SEQ ID NO:75; (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO:99; (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO: 125; (d) HVR-Ll comprising the amino acid sequence of SEQ ID NO: 158; (e) HVR-L2 comprising the amino acid sequence of SEQ ID NO: 187; and (f) HVR-L3 comprising the amino acid sequence of SEQ ID NO:207; (a) HVR-Hl comprising the amino acid sequence of SEQ ID NO:76; (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO: 100; (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO: 126; (d) HVR-Ll comprising the amino acid sequence of SEQ ID NO: 159; (e) HVR-L
- HVR-H1 comprising the amino acid sequence of SEQ ID NO:85;
- HVR-H2 comprising the amino acid sequence of SEQ ID NO:99;
- HVR-H3 comprising the amino acid sequence of SEQ ID NO: 140;
- HVR-L1 comprising the amino acid sequence of SEQ ID NO: 170;
- HVR-L2 comprising the amino acid sequence of SEQ ID NO: 196; and
- HVR-L3 comprising the amino acid sequence of SEQ ID NO:222;
- HVR-H1 comprising the amino acid sequence of SEQ ID NO:86;
- HVR-H2 comprising the amino acid sequence of SEQ ID NO:99;
- HVR-H3 comprising the amino acid sequence of SEQ ID NO: 141;
- HVR-L1 comprising the amino acid sequence of SEQ ID NO: 171;
- HVR-L2 comprising the amino acid sequence of SEQ ID NO: 191; and
- HVR-H2 comprising the amino acid sequence of SEQ ID NO:99;
- HVR-H3 comprising the amino acid sequence of SEQ ID NO: 143;
- HVR-L1 comprising the amino acid sequence of SEQ ID NO: 173;
- HVR-L2 comprising the amino acid sequence of SEQ ID NO: 191;
- HVR-L3 comprising the amino acid sequence of SEQ ID NO:223;
- HVR-H2 comprising the amino acid sequence of SEQ ID NO: 111;
- HVR-H3 comprising the amino acid sequence of SEQ ID NO: 143;
- HVR-L1 comprising the amino acid sequence of SEQ ID NO: 173;
- HVR-L2 comprising the amino acid sequence of SEQ ID NO: 198; and
- HVR-L3 comprising the amino acid sequence of SEQ ID NO:221;
- HVR-L1 comprising the amino acid sequence of SEQ ID NO: 177; (e) HVR-L2 comprising the amino acid sequence of SEQ ID NO: 195; and (f) HVR-L3 comprising the amino acid sequence of SEQ ID NO:227; (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO:93; (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO: 116; (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO: 148; (d) HVR-L1 comprising the amino acid sequence of SEQ ID NO: 178; (e) HVR-L2 comprising the amino acid sequence of SEQ ID NO: 188; and (f) HVR-L3 comprising the amino acid sequence of SEQ ID NO:209; (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO:94; (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO: 117; (c
- HVR-L2 comprising the amino acid sequence of SEQ ID NO: 195; and (f) HVR-L3 comprising the amino acid sequence of SEQ ID NO:228; (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO:95; (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO: 118; (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO: 150; (d) HVR-L1 comprising the amino acid sequence of SEQ ID NO: 180; (e) HVR-L2 comprising the amino acid sequence of SEQ ID NO: 187; and (f) HVR-L3 comprising the amino acid sequence of SEQ ID NO:229; (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO:95; (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO: 119; (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO: 151; (d) HVR-
- HVR-L1 comprising the amino acid sequence of SEQ ID NO: 181; (e) HVR-L2 comprising the amino acid sequence of SEQ ID NO: 187; and (f) HVR-L3 comprising the amino acid sequence of SEQ ID NO:210; (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO:90; (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO: 122; (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO: 155; (d) HVR-L1 comprising the amino acid sequence of SEQ ID NO: 184; (e) HVR-L2 comprising the amino acid sequence of SEQ ID NO:203; and (f) HVR-L3 comprising the amino acid sequence of SEQ ID NO:231; (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO:97; (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO: 123; (c) HVR-
- HVR-L2 comprising the amino acid sequence of SEQ ID NO:204; and (f) HVR-L3 comprising the amino acid sequence of SEQ ID NO:232;
- HVR-H1 comprising the amino acid sequence of SEQ ID NO:98;
- HVR-H2 comprising the amino acid sequence of SEQ ID NO: 124;
- HVR-H3 comprising the amino acid sequence of SEQ ID NO: 157;
- HVR-L1 comprising the amino acid sequence of SEQ ID NO: 186;
- HVR-L2 comprising the amino acid sequence of SEQ ID NO:205; and
- HVR-L3 comprising the amino acid sequence of SEQ ID NO:233.
- an anti-MerTK antibody comprises a heavy chain variable domain (V H ) sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to an amino acid sequence selected from the group consisting of SEQ ID NOs:5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, and 39.
- V H heavy chain variable domain
- a V H sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity to an amino acid sequence selected from the group consisting of SEQ ID NOs: 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, and 39 contains substitutions ( e.g ., conservative substitutions), insertions, or deletions relative to the reference sequence, but an anti-MerTK antibody comprising that sequence retains the ability to bind to MerTK.
- a total of 1 to 10 amino acids have been substituted, inserted, and/or deleted in SEQ ID NO: 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25,
- substitutions, insertions, or deletions occur in regions outside the HVRs (i.e.. in the FRs).
- the anti-MerTK antibody comprises the VH sequence of SEQ ID NO: 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, or 39. including post- translational modifications of that sequence.
- the VH comprises one, two or three HVRs selected from: (a) HVR-H1 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs:75-98, (b) HVR-H2 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs:99-124, and (c) HVR-H3 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 125-157.
- an anti-MerTK antibody comprising a light chain variable domain (V L ) having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to an amino acid sequence selected from the group consisting of SEQ ID NOs:40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, and 74.
- V L light chain variable domain
- a VL sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity to an amino acid sequence selected from the group consisting of SEQ ID NOs: 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, and 74, and contains substitutions (e.g., conservative substitutions), insertions, or deletions relative to the reference sequence, but an anti-MerTK antibody comprising that sequence retains the ability to bind to MerTK.
- substitutions e.g., conservative substitutions
- a total of 1 to 10 amino acids have been substituted, inserted and/or deleted in SEQ ID NO: 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, or 74.
- a total of 1 to 5 amino acids have been substituted, inserted and/or deleted in SEQ ID NO: 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63,
- the anti-MerTK antibody comprises the V L sequence of SEQ ID NO: 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55,
- the VL comprises one, two or three HVRs selected from (a) HVR-Ll comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 158-186, (b) HVR-L2 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 187-205, and (c) HVR-L3 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 207-233.
- an anti-MerTK antibody comprising a VH as in any of the embodiments provided above, and a VL as in any of the embodiments provided above.
- anti-MerTK antibodies wherein the antibody comprises a V H as in any of the embodiments provided above, and a V L as in any of the embodiments provided above.
- the antibody comprises the V H and V L sequences in SEQ ID NOs:5-39 and SEQ ID NOs:40-74, respectively, including post-translational modifications of those sequences.
- anti-MerTK antibodies comprising a heavy chain variable domain (V H ) and a light chain variable domain (V L ), wherein the V H and V L are selected from the group consisting of: V H comprising the amino acid sequence of SEQ ID NO:5 and V L comprising the amino acid sequence of SEQ ID NO:40; V H comprising the amino acid sequence of SEQ ID NO:6 and V L comprising the amino acid sequence of SEQ ID NO:41; V H comprising the amino acid sequence of SEQ ID NO:7 and V L comprising the amino acid sequence of SEQ ID NO:42; V H comprising the amino acid sequence of SEQ ID NO:8 and V L comprising the amino acid sequence of SEQ ID NO:43; V H comprising the amino acid sequence of SEQ ID NO:9 and V L comprising the amino acid sequence of SEQ ID NO:44; V H comprising the amino acid sequence of SEQ ID NO: 10 and V L comprising the amino acid sequence of SEQ ID NO:45; V H H comprising the amino acid sequence of SEQ ID NO
- anti-MerTK antibodies comprising at least one, two, three, four, five, or six HVRs selected from: (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO:83; (b) HVR-H2 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs:99, 329, 330, 331, 332, and 333; (c) HVR-H3 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 138, 334, 335, 336, 337, 338, and 339; (d) HVR-L1 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 158, 340, 341, 342, 343, and 344; (e) HVR-L2 comprising the amino acid sequence of SEQ ID NO: 187; and (f) HVR-L3 comprising the amino acid sequence of SEQ ID NO:210.
- anti-MerTK antibodies comprising at least one, at least two, or all three V H HVR sequences selected from (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO:83; (b) HVR-H2 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs:99, 329, 330, 331, 332, and 333; and (c) HVR-H3 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 138, 334, 335, 336, 337, 338, and 339.
- anti-MerTK antibodies comprising at least one, at least two, or all three V L HVR sequences selected from (a) HVR-L1 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 158, 340, 341, 342, 343, and 344; (b) HVR-L2 comprising the amino acid sequence of SEQ ID NO: 187; and (c) HVR-L3 comprising the amino acid sequence of SEQ ID NO:210.
- anti-MerTK antibodies comprising (a) aV H domain comprising at least one, at least two, or all three V H HVR sequences selected from (i) HVR-Hl comprising the amino acid sequence of SEQ ID NO: 83, (ii) HVR-H2 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 99, 329, 330, 331, 332, and 333, and (iii) HVR-H3 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 138, 334, 335, 336, 337, 338, and 339, and (b) aV L domain comprising at least one, at least two, or all three V L HVR sequences selected from (i) HVR-Ll comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 158, 340, 341, 342, 343, and 344, (ii) HVR-L2 comprising the amino
- anti-MerTK antibodies comprising: (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO:83; (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO:99; (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO: 138; (d) HVR-L1 comprising the amino acid sequence of SEQ ID NO: 158; (e) HVR-L2 comprising the amino acid sequence of SEQ ID NO: 187; and (f) HVR-L3 comprising the amino acid sequence of SEQ ID NO:210; (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO:83; (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO:329; (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO:334;
- HVR-L1 comprising the amino acid sequence of SEQ ID NO: 158; (e) HVR-L2 comprising the amino acid sequence of SEQ ID NO: 187; and (f) HVR-L3 comprising the amino acid sequence of SEQ ID NO:210; (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO:83; (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO:330; (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO: 138; (d) HVR-L1 comprising the amino acid sequence of SEQ ID NO: 158; (e) HVR-L2 comprising the amino acid sequence of SEQ ID NO: 187; and (f) HVR-L3 comprising the amino acid sequence of SEQ ID NO:210; (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO:83; (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO:329; (c) HVR-L
- HVR-L2 comprising the amino acid sequence of SEQ ID NO: 187; and (f) HVR-L3 comprising the amino acid sequence of SEQ ID NO:210;
- HVR-H1 comprising the amino acid sequence of SEQ ID NO:83;
- HVR-H2 comprising the amino acid sequence of SEQ ID NO:329;
- HVR-H3 comprising the amino acid sequence of SEQ ID NO: 138;
- HVR-L1 comprising the amino acid sequence of SEQ ID NO:341;
- HVR-L2 comprising the amino acid sequence of SEQ ID NO: 187; and
- HVR-L3 comprising the amino acid sequence of SEQ ID NO:210;
- HVR-H1 comprising the amino acid sequence of SEQ ID NO:83;
- HVR-H2 comprising the amino acid sequence of SEQ ID NO:329;
- HVR-H3 comprising the amino acid sequence of SEQ ID NO:335;
- HVR-L3 comprising the amino acid sequence of S
- HVR-L1 comprising the amino acid sequence of SEQ ID NO:341; (e) HVR-L2 comprising the amino acid sequence of SEQ ID NO: 187; and (f) HVR-L3 comprising the amino acid sequence of SEQ ID NO:210; (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO:83; (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO:329; (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO:337; (d) HVR-L1 comprising the amino acid sequence of SEQ ID NO:343; (e) HVR-L2 comprising the amino acid sequence of SEQ ID NO: 187; and (f) HVR-L3 comprising the amino acid sequence of SEQ ID NO:210; (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO:83; (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO:332; (c) HVR-
- HVR-L2 comprising the amino acid sequence of SEQ ID NO: 187; and (f) HVR-L3 comprising the amino acid sequence of SEQ ID NO:210;
- HVR-H1 comprising the amino acid sequence of SEQ ID NO:83;
- HVR-H2 comprising the amino acid sequence of SEQ ID NO:333;
- HVR-H3 comprising the amino acid sequence of SEQ ID NO:334;
- HVR-L1 comprising the amino acid sequence of SEQ ID NO: 158;
- HVR-L2 comprising the amino acid sequence of SEQ ID NO: 187; and
- HVR-L3 comprising the amino acid sequence of SEQ ID NO:210;
- HVR-H1 comprising the amino acid sequence of SEQ ID NO:83;
- HVR-H2 comprising the amino acid sequence of SEQ ID NO:332;
- HVR-H3 comprising the amino acid sequence of SEQ ID NO:336;
- HVR-H3 comprising the amino acid sequence of SEQ
- an anti-MerTK antibody comprises a heavy chain variable domain (V H ) sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to an amino acid sequence selected from the group consisting of SEQ ID NOs: 19, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, and 246.
- V H heavy chain variable domain
- a V H sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity to an amino acid sequence selected from the group consisting of SEQ ID NOs: 19, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, and 246 contains substitutions (e.g., conservative substitutions), insertions, or deletions relative to the reference sequence, but an anti-MerTK antibody comprising that sequence retains the ability to bind to MerTK.
- a total of 1 to 10 amino acids have been substituted, inserted, and/or deleted in SEQ ID NO: 19, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, or 246.
- a total of 1 to 5 amino acids have been substituted, inserted and/or deleted in SEQ ID NO: 19, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, or 246.
- substitutions, insertions, or deletions occur in regions outside the HVRs (i.e.. in the FRs).
- the anti-MerTK antibody comprises the V H sequence of SEQ ID NO: 19, 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, or 246, including post- translational modifications of that sequence.
- the V H comprises one, two or three HVRs selected from: (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO: 83, (b) HVR-H2 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs:99, 329, 330, 331, 332, and 333, and (c) HVR-H3 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 138, 334, 335, 336, 337, 338, and 339.
- an anti-MerTK antibody comprising a light chain variable domain (V L ) having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to an amino acid sequence selected from the group consisting of SEQ ID NOs:54, 247, 248, 249, 250, 251, 252, 253, and 254.
- V L light chain variable domain
- a V L sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity to an amino acid sequence selected from the group consisting of SEQ ID NOs: 54, 247, 248, 249, 250, 251, 252, 253, and 254, and contains substitutions (e.g., conservative substitutions), insertions, or deletions relative to the reference sequence, but an anti-MerTK antibody comprising that sequence retains the ability to bind to MerTK.
- a total of 1 to 10 amino acids have been substituted, inserted and/or deleted in SEQ ID NO: 54, 247, 248, 249, 250, 251, 252, 253, or 254.
- the anti-MerTK antibody comprises the V L sequence of SEQ ID NO: 54, 247, 248, 249, 250, 251, 252, 253, or 254, including post-translational modifications of that sequence.
- the V L comprises one, two or three HVRs selected from (a) HVR-Ll comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 158, 340, 341, 342, 343, and 344, (b) HVR-L2 comprising the amino acid sequence of SEQ ID NO: 187, and (c) HVR-L3 comprising the amino acid sequence of SEQ ID NO: 210.
- an anti-MerTK antibody comprising a V H as in any of the embodiments provided above, and a V L as in any of the embodiments provided above.
- provided herein are anti-MerTK antibodies, wherein the antibody comprises a V H as in any of the embodiments provided above, and a V L as in any of the embodiments provided above.
- the antibody comprises the V H and V L sequences in SEQ ID NOs: 19, 234, 235, 236,
- anti-MerTK antibodies comprising a heavy chain variable domain (V H ) and a light chain variable domain (V L ), wherein the V H and V L are selected from the group consisting of: V H comprising the amino acid sequence of SEQ ID NO: 19 and V L comprising the amino acid sequence of SEQ ID NO:54; V H comprising the amino acid sequence of SEQ ID NO:234 and V L comprising the amino acid sequence of SEQ ID NO:247; V H comprising the amino acid sequence of SEQ ID NO:235 and V L comprising the amino acid sequence of SEQ ID NO:247; V H comprising the amino acid sequence of SEQ ID NO:236 and V L comprising the amino acid sequence of SEQ ID NO:248; V H comprising the amino acid sequence of SEQ ID NO:236 and V L comprising the amino acid sequence of SEQ ID NO:249; V H comprising the amino acid sequence of SEQ ID NO:237 and V L comprising the amino acid sequence of S
- anti-MerTK antibodies comprising at least one, two, three, four, five, or six HVRs selected from: (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO: 84; (b) HVR-H2 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs:99 and 329; (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO: 139; (d) HVR-L1 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 169 and 345; (e) HVR-L2 comprising the amino acid sequence of SEQ ID NO: 195; and (f) HVR-L3 comprising the amino acid sequence of SEQ ID NO:219.
- anti-MerTK antibodies comprising at least one, at least two, or all three V H HVR sequences selected from (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO: 84; (b) HVR-H2 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs:99 and 329; and (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO: 139.
- anti-MerTK antibodies comprising at least one, at least two, or all three V L HVR sequences selected from (a) HVR-L1 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 169 and 345; (b) HVR-L2 comprising the amino acid sequence of SEQ ID NO: 195; and (c) HVR-L3 comprising the amino acid sequence of SEQ ID NO:219.
- anti-MerTK antibodies comprising (a) a V H domain comprising at least one, at least two, or all three V H HVR sequences selected from (i) HVR-H1 comprising the amino acid sequence of SEQ ID NO: 84, (ii) HVR-H2 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 99, 329, and (iii) HVR-H3 comprising the amino acid sequence of SEQ ID NO: 139, and (b) a V L domain comprising at least one, at least two, or all three V L HVR sequences selected from (i) HVR-L1 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 169 and 345, (ii) HVR-L2 comprising the amino acid sequence of SEQ ID NO: 195, and (iii) HVR-L3 comprising the amino acid sequence of SEQ ID NO: 219.
- anti-MerTK antibodies comprising: (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO: 84; (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO:99; (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO: 139; (d) HVR-L1 comprising the amino acid sequence of SEQ ID NO: 169; (e) HVR-L2 comprising the amino acid sequence of SEQ ID NO: 195; and (f) HVR-L3 comprising the amino acid sequence of SEQ ID NO:219; (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO: 84; (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO:329; (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO: 139; (d) HVR-L1 comprising the amino acid sequence of SEQ ID NO: 169; (e) HVR-L
- an anti-MerTK antibody comprises a heavy chain variable domain (V H ) sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to an amino acid sequence selected from the group consisting of SEQ ID NOs:20, 255, and 256.
- V H heavy chain variable domain
- a V H sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%,
- amino acid sequence selected from the group consisting of SEQ ID NOs: 20, 255, and 256 contains substitutions (e.g., conservative substitutions), insertions, or deletions relative to the reference sequence, but an anti-MerTK antibody comprising that sequence retains the ability to bind to MerTK.
- a total of 1 to 10 amino acids have been substituted, inserted, and/or deleted in SEQ ID NO: 20, 255, or 256.
- a total of 1 to 5 amino acids have been substituted, inserted and/or deleted in SEQ ID NO: 20, 255, or 256.
- the anti-MerTK antibody comprises the V H sequence of SEQ ID NO: 20, 255, or 256, including post- translational modifications of that sequence.
- the V H comprises one, two or three HVRs selected from: (a) HVR-Hl comprising the amino acid sequence of SEQ ID NO: 84, (b) HVR-H2 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs:99 and 329, and (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO: 139.
- an anti-MerTK antibody comprising a light chain variable domain (V L ) having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to an amino acid sequence selected from the group consisting of SEQ ID NOs:55, 257, and 258.
- V L light chain variable domain
- a V L sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity to an amino acid sequence selected from the group consisting of SEQ ID NOs: 55, 257, and 258, and contains substitutions ( e.g ., conservative substitutions), insertions, or deletions relative to the reference sequence, but an anti-MerTK antibody comprising that sequence retains the ability to bind to MerTK.
- a total of 1 to 10 amino acids have been substituted, inserted and/or deleted in SEQ ID NO: 55, 257, or 258.
- the anti-MerTK antibody comprises the V L sequence of SEQ ID NO: 55, 257, or 258, including post-translational modifications of that sequence.
- the V L comprises one, two or three HVRs selected from (a) HVR-L1 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 169 and 345, (b) HVR-L2 comprising the amino acid sequence of SEQ ID NO: 195, and (c) HVR-L3 comprising the amino acid sequence of SEQ ID NO: 219.
- an anti-MerTK antibody comprising a V H as in any of the embodiments provided above, and a V L as in any of the embodiments provided above.
- provided herein are anti-MerTK antibodies, wherein the antibody comprises a V H as in any of the embodiments provided above, and a V L as in any of the embodiments provided above.
- the antibody comprises the V H and V L sequences in SEQ ID NOs:20, 255, and 256 and SEQ ID NOs:55, 257, and 258, respectively, including post-translational modifications of those sequences.
- anti-MerTK antibodies comprising a heavy chain variable domain (V H ) and a light chain variable domain (V L ), wherein the V H and V L are selected from the group consisting of: V H comprising the amino acid sequence of SEQ ID NO:20 and V L comprising the amino acid sequence of SEQ ID NO:55; V H comprising the amino acid sequence of SEQ ID NO:255 and V L comprising the amino acid sequence of SEQ ID NO:257; and V H comprising the amino acid sequence of SEQ ID NO:256 and V L comprising the amino acid sequence of SEQ ID NO:258.
- anti-MerTK antibodies comprising at least one, two, three, four, five, or six HVRs selected from: (a) HVR-Hl comprising an amino acid sequence selected from the group consisting of SEQ ID NOs:95, 346, and 347; (b) HVR-H2 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 119, 348, 349, 350, 351, 352, 353, and 354; (c) HVR-H3 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 151, 355, and 356; (d) HVR-Ll comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 181, 341, 357, and 358; (e) HVR-L2 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 187 and 359; and (f) HVR-L3 comprising an amino acid sequence selected from the group consisting of S
- anti-MerTK antibodies comprising at least one, at least two, or all three V H HVR sequences selected from (a) HVR-H1 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs:95, 346, and 347; (b) HVR-H2 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 119, 348, 349, 350, 351, 352, 353, and 354; and (c) HVR-H3 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs:151, 355, and 356.
- anti-MerTK antibodies comprising at least one, at least two, or all three V L HVR sequences selected from (a) HVR-L1 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 181, 341, 357, and 358; (b) HVR-L2 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 187 and 359; and (c) HVR-L3 comprising an amino acid sequence selected from the group consisting of SEQ ID NO:208. 360, 361, and 362.
- anti-MerTK antibodies comprising (a) a V H domain comprising at least one, at least two, or all three V H HVR sequences selected from (i) HVR-Hl comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 95, 346, and 347,
- HVR-H2 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs:
- HVR-H3 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 151, 355, and 356, and (b) a V L domain comprising at least one, at least two, or all three V L HVR sequences selected from (i) HVR-Ll comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 181, 341, 357, and 358, (ii) HVR-L2 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 187 and 359, and
- HVR-L3 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs:
- anti-MerTK antibodies comprising: (a) HVR-Hl comprising the amino acid sequence of SEQ ID NO:95; (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO: 119; (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO: 151; (d) HVR-Ll comprising the amino acid sequence of SEQ ID NO: 181; (e) HVR-L2 comprising the amino acid sequence of SEQ ID NO: 187; and (f) HVR-L3 comprising the amino acid sequence of SEQ ID NO:208; (a) HVR-Hl comprising the amino acid sequence of SEQ ID NO:346; (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO:348; (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO:355; (d) HVR-Ll comprising the amino acid sequence of SEQ ID NO:341; (e) H
- an anti-MerTK antibody comprises a heavy chain variable domain (V H ) sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to an amino acid sequence selected from the group consisting of SEQ ID NOs:33, 259, 260, 261, 262, 263, 264, 265, 266, 267, 268, 269, 270, 271, 272, and 273.
- V H heavy chain variable domain
- a V H sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity to an amino acid sequence selected from the group consisting of SEQ ID NOs: 33, 259, 260, 261, 262, 263, 264, 265, 266, 267, 268, 269, 270, 271, 272, and 273 contains substitutions ( e.g ., conservative substitutions), insertions, or deletions relative to the reference sequence, but an anti-MerTK antibody comprising that sequence retains the ability to bind to MerTK.
- a total of 1 to 10 amino acids have been substituted, inserted, and/or deleted in SEQ ID NO: 33, 259, 260, 261, 262, 263, 264, 265, 266, 267, 268, 269, 270, 271, 272, or 273..
- a total of 1 to 5 amino acids have been substituted, inserted and/or deleted in SEQ ID NO: 33, 259, 260, 261, 262, 263, 264, 265, 266, 267, 268, 269, 270, 271, 272, or 273.
- substitutions, insertions, or deletions occur in regions outside the HVRs (i.e., in the FRs).
- the anti-MerTK antibody comprises the V H sequence of SEQ ID NO: 33, 259, 260, 261, 262, 263, 264, 265, 266, 267, 268, 269, 270, 271, 272, or 273, including post- translational modifications of that sequence.
- the V H comprises one, two or three HVRs selected from: (a) HVR-H1 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs:95, 346, and 347, (b) HVR-H2 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 119, 348, 349, 350, 351, 352, 353, and 354, and (c) HVR-H3 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 151, 355, and [0186]
- an anti-MerTK antibody is provided, wherein the antibody comprises a light chain variable domain (V L ) having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to an amino acid sequence selected from the group consisting of SEQ ID NOs:68, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283, 284, 28
- V L sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity to an amino acid sequence selected from the group consisting of SEQ ID NOs: 68, 274, 275, 276,
- the anti-MerTK antibody comprises the V L sequence of SEQ ID NO: 68, 274, 275, 276, 277, 278, 279, 280, 281, 282,
- the V L comprises one, two or three HVRs selected from (a) HVR-L1 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 181, 341, 357, and 358, (b) HVR-L2 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 187 and 359, and (c) HVR-L3 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 208, 360, 361, and 362.
- an anti-MerTK antibody comprising a VH as in any of the embodiments provided above, and a VL as in any of the embodiments provided above.
- provided herein are anti-MerTK antibodies, wherein the antibody comprises a VH as in any of the embodiments provided above, and a VL as in any of the embodiments provided above.
- the antibody comprises the VH and VL sequences in SEQ ID NOs: 33, 259, 260, 261, 262, 263, 264, 265, 266, 267, 268, 269, 270, 271, 272, and 273 and SEQ ID NOs: 68, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283, 284, 285, 286, 287, 288, and 289, respectively, including post-translational modifications of those sequences.
- anti-MerTK antibodies comprising a heavy chain variable domain (V H ) and a light chain variable domain (V L ), wherein the V H and V L are selected from the group consisting of: V H comprising the amino acid sequence of SEQ ID NO:33 and V L comprising the amino acid sequence of SEQ ID NO:68; V H comprising the amino acid sequence of SEQ ID NO:259 and V L comprising the amino acid sequence of SEQ ID NO:274; V H comprising the amino acid sequence of SEQ ID NO:260 and V L comprising the amino acid sequence of SEQ ID NO:275; V H comprising the amino acid sequence of SEQ ID NO:261 and V L comprising the amino acid sequence of SEQ ID NO:276; V H comprising the amino acid sequence of SEQ ID NO:262 and V L comprising the amino acid sequence of SEQ ID NO:277; V H comprising the amino acid sequence of SEQ ID NO:263 and V L comprising the amino acid sequence of SEQ
- anti-MerTK antibodies comprising at least one, two, three, four, five, or six HVRs selected from: (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO:90; (b) HVR-H2 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 122, 364, 365, 366, 367, and 368; (c) HVR-H3 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 155, 373, 374, and 375; (d) HVR-L1 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 184, 376, 377, 378, 379, 380, 381, 382, 383, 384, 385, 386, and 387; (e) HVR-L2 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs:203, 388, 389, 390, and 391; and
- anti-MerTK antibodies comprising at least one, at least two, or all three VH HVR sequences selected from (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO:90; (b) HVR-H2 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 122, 364, 365, 366, 367, and 368; and (c) HVR-H3 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 155, 373, 374, and 375.
- anti-MerTK antibodies comprising at least one, at least two, or all three V L HVR sequences selected from (a) HVR-L1 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 184, 376, 377, 378, 379, 380, 381, 382, 383, 384,
- HVR-L2 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 203, 388, 389, 390, and 391
- HVR-L3 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 203, 388, 389, 390, and 391
- anti-MerTK antibodies comprising (a) a V H domain comprising at least one, at least two, or all three V H HVR sequences selected from (i) HVR-H1 comprising the amino acid sequence of SEQ ID NO: 90, (ii) HVR-H2 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 122, 364, 365, 366, 367, and 368, and (iii) HVR-H3 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 155, 373, 374, and 375, and (b) a V L domain comprising at least one, at least two, or all three V L HVR sequences selected from (i) HVR-L1 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 184, 376, 377, 378, 379, 380, 381, 382, 383, 384, 385, 386, and 387,
- anti-MerTK antibodies comprising: (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO:90; (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO: 122; (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO: 155; (d) HVR-L1 comprising the amino acid sequence of SEQ ID NO: 184; (e) HVR-L2 comprising the amino acid sequence of SEQ ID NO:203; and (f) HVR-L3 comprising the amino acid sequence of SEQ ID NO:231; (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO:90; (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO:364; (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO:373;
- HVR-L1 comprising the amino acid sequence of SEQ ID NO:376; (e) HVR-L2 comprising the amino acid sequence of SEQ ID NO: 388; and (f) HVR-L3 comprising the amino acid sequence of SEQ ID NO:231; (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO:90; (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO:364; (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO: 155; (d) HVR-L1 comprising the amino acid sequence of SEQ ID NO:377; (e) HVR-L2 comprising the amino acid sequence of SEQ ID NO:203; and (f) HVR-L3 comprising the amino acid sequence of SEQ ID NO:231; (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO:90; (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO:364; (c)
- HVR-L2 comprising the amino acid sequence of SEQ ID NO:203; and (f) HVR-L3 comprising the amino acid sequence of SEQ ID NO:231; (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO:95; (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO: 119; (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO:356; (d) HVR-L1 comprising the amino acid sequence of SEQ ID NO:341; (e) HVR-L2 comprising the amino acid sequence of SEQ ID NO:359; and (f) HVR-L3 comprising the amino acid sequence of SEQ ID NO:362; (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO:90; (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO:365; (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO: 155; (d) H
- HVR-L1 comprising the amino acid sequence of SEQ ID NO:380; (e) HVR-L2 comprising the amino acid sequence of SEQ ID NO:203; and (f) HVR-L3 comprising the amino acid sequence of SEQ ID NO:231; (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO:90; (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO:364; (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO:373; (d) HVR-L1 comprising the amino acid sequence of SEQ ID NO:381; (e) HVR-L2 comprising the amino acid sequence of SEQ ID NO:203; and (f) HVR-L3 comprising the amino acid sequence of SEQ ID NO:231; (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO:90; (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO:367; (c) HVR-L
- HVR-L2 comprising the amino acid sequence of SEQ ID NO:203; and (f) HVR-L3 comprising the amino acid sequence of SEQ ID NO:231;
- HVR-H1 comprising the amino acid sequence of SEQ ID NO:90;
- HVR-H2 comprising the amino acid sequence of SEQ ID NO:368;
- HVR-H3 comprising the amino acid sequence of SEQ ID NO: 155;
- HVR-L1 comprising the amino acid sequence of SEQ ID NO:383;
- HVR-L2 comprising the amino acid sequence of SEQ ID NO:203; and
- HVR-L3 comprising the amino acid sequence of SEQ ID NO:231;
- HVR-H1 comprising the amino acid sequence of SEQ ID NO:90;
- HVR-H2 comprising the amino acid sequence of SEQ ID NO:364;
- HVR-H3 comprising the amino acid sequence of SEQ ID NO:374;
- HVR-L1 comprising the amino acid sequence of SEQ ID NO:376; (e) HVR-L2 comprising the amino acid sequence of SEQ ID NO:203; and (f) HVR-L3 comprising the amino acid sequence of SEQ ID NO:231; (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO:90; (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO:369; (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO: 155; (d) HVR-L1 comprising the amino acid sequence of SEQ ID NO:378; (e) HVR-L2 comprising the amino acid sequence of SEQ ID NO:203; and (f) HVR-L3 comprising the amino acid sequence of SEQ ID NO:394; (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO:90; (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO:370; (c) HVR-L
- HVR-L2 comprising the amino acid sequence of SEQ ID NO:203; and (f) HVR-L3 comprising the amino acid sequence of SEQ ID NO:394;
- HVR-H1 comprising the amino acid sequence of SEQ ID NO:90;
- HVR-H2 comprising the amino acid sequence of SEQ ID NO:371;
- HVR-H3 comprising the amino acid sequence of SEQ ID NO: 155;
- HVR-L1 comprising the amino acid sequence of SEQ ID NO: 178;
- HVR-L2 comprising the amino acid sequence of SEQ ID NO:203; and
- HVR-L3 comprising the amino acid sequence of SEQ ID NO:394;
- HVR-H1 comprising the amino acid sequence of SEQ ID NO:90;
- HVR-H2 comprising the amino acid sequence of SEQ ID NO:368;
- HVR-H3 comprising the amino acid sequence of SEQ ID NO: 155;
- an anti-MerTK antibody comprises a heavy chain variable domain (VH) sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to an amino acid sequence selected from the group consisting of SEQ ID NOs:37, 290, 291, 292, 293, 294, 295, 296, 297, 298, 299, 300, 301, 302, 303, 304, 305, 306, 307, and 308.
- VH heavy chain variable domain
- a VH sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity to an amino acid sequence selected from the group consisting of SEQ ID NOs: 37, 290, 291, 292, 293, 294, 295, 296, 297, 298, 299, 300, 301, 302, 303, 304, 305, 306, 307, and 308 contains substitutions (e.g., conservative substitutions), insertions, or deletions relative to the reference sequence, but an anti- MerTK antibody comprising that sequence retains the ability to bind to MerTK.
- a total of 1 to 10 amino acids have been substituted, inserted, and/or deleted in SEQ ID NO: 37, 290, 291,
- the anti-MerTK antibody comprises the V H sequence of SEQ ID NO: 37, 290, 291, 292, 293, 294, 295, 296, 297, 298, 299, 300, 301, 302, 303, 304, 305, 306, 307, or 308.
- a total of 1 to 5 amino acids have been substituted, inserted and/or deleted in SEQ ID NO: 37, 290, 291, 292, 293, 294, 295, 296, 297, 298, 299, 300, 301, 302, 303, 304, 305, 306, 307, or 308.
- substitutions, insertions, or deletions occur in regions outside the HVRs (i.e., in the FRs).
- the anti-MerTK antibody comprises the V H sequence of SEQ ID NO: 37, 290, 291, 292,
- the VH comprises one, two or three HVRs selected from: (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO:90, (b) HVR-H2 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 122,
- HVR-H3 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 155, 373, 374, and 375.
- an anti-MerTK antibody comprising a light chain variable domain (V L ) having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to an amino acid sequence selected from the group consisting of SEQ ID NOs:72,
- V L sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity to an amino acid sequence selected from the group consisting of SEQ ID NOs: 72, 309,
- 310, 311, 312, 313, 314, 315, 316, 316, 318, 319, 320, 321, 322, 323, 324, 325, 326, 327, and 328 and contains substitutions (e.g., conservative substitutions), insertions, or deletions relative to the reference sequence, but an anti-MerTK antibody comprising that sequence retains the ability to bind to MerTK.
- a total of 1 to 10 amino acids have been substituted, inserted and/or deleted in SEQ ID NO: 72, 309, 310, 311, 312, 313, 314, 315, 316, 316, 318, 319, 320, 321, 322, 323, 324, 325, 326, 327, or 328.
- a total of 1 to 5 amino acids have been substituted, inserted and/or deleted in SEQ ID NO: 72, 309, 310, 311, 312, 313, 314, 315, 316, 316, 318, 319, 320, 321, 322, 323,
- the anti-MerTK antibody comprises the V L sequence of SEQ ID NO: 72, 309, 310, 311, 312, 313, 314, 315, 316, 316, 318, 319, 320, 321, 322, 323, 324, 325, 326, 327, or 328, including post-translational modifications of that sequence.
- the V L comprises one, two or three HVRs selected from (a) HVR-L1 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs:184, 376, 377, 378, 379, 380, 381, 382, 383, 384, 385, 386, and 387, (b) HVR-L2 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 203, 388, 389, 390, and 391, and (c) HVR-L3 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 231, 392, 393, and 394.
- HVR-L1 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs:184, 376, 377, 378, 379, 380, 381, 382, 383, 384, 385, 386, and 387
- HVR-L2 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 203, 388, 389, 3
- an anti-MerTK antibody comprising a V H as in any of the embodiments provided above, and a V L as in any of the embodiments provided above.
- provided herein are anti-MerTK antibodies, wherein the antibody comprises a V H as in any of the embodiments provided above, and a V L as in any of the embodiments provided above.
- the antibody comprises the V H and V L sequences in SEQ ID NOs: 37, 290, 291, 292, 293, 294, 295, 296, 297, 298, 299, 300, 301, 302, 303, 304, 305, 306, 307, and 308 and SEQ ID NOs: 72, 309, 310, 311, 312, 313, 314, 315, 316, 316, 318, 319, 320, 321, 322, 323, 324, 325, 326, 327, and 328, respectively, including post-translational modifications of those sequences.
- anti-MerTK antibodies comprising a heavy chain variable domain (V H ) and a light chain variable domain (V L ), wherein the V H and V L are selected from the group consisting of: V H comprising the amino acid sequence of SEQ ID NO:37 and V L comprising the amino acid sequence of SEQ ID NO:72; V H comprising the amino acid sequence of SEQ ID NO:290 and V L comprising the amino acid sequence of SEQ ID NO:309; V H comprising the amino acid sequence of SEQ ID NO:291 and V L comprising the amino acid sequence of SEQ ID NO:310; V H comprising the amino acid sequence of SEQ ID NO:292 and V L comprising the amino acid sequence of SEQ ID NO:311; V H comprising the amino acid sequence of SEQ ID NO:293 and V L comprising the amino acid sequence of SEQ ID NO:312; V H comprising the amino acid sequence of SEQ ID NO:294 and V L comprising the amino acid sequence of SEQ
- an anti-MerTK antibody of the present disclosure competitively inhibits binding of at least one reference antibody selected from MTK-01, MTK-02, MTK-03, MTK-04, MTK-05, MTK-06, MTK-07, MTK-08, MTK-09, MTK-10, MTK-11, MTK-12, MTK-13, MTK-14, MTK-15 (including MTK-15.1, MTK-15.2, MTK-15.3, MTK-15.4, MTK-15.5, MTK-15.6, MTK-15.7, MTK- 15.8, MTK-15.9, MTK-15.10, MTK-15.11, MTK-15.12, MTK-15.13, MTK-15.14, and MTK-15.15), MTK-16 (including MTK-16.1 and MTK-16.2), MTK-17, MTK-18, MTK-19, MTK-20, MTK-21, MTK- 22, MTK-23, MTK-24, MTK-25, MTK-26, MTK-27, MTK-28, MTK-
- an anti-MerTK antibody of the present disclosure binds to an epitope of human MerTK that is the same as or overlaps with the MerTK epitope bound by at least one reference antibody selected from MTK-01, MTK-02, MTK-03, MTK-04, MTK-05, MTK-06, MTK-07, MTK-08, MTK-09, MTK-10, MTK-11, MTK-12, MTK-13, MTK-14, MTK-15 (including MTK-15.1, MTK-15.2, MTK-15.3, MTK-15.4, MTK-15.5, MTK-15.6, MTK-15.7, MTK-15.8, MTK-15.9, MTK-15.10, MTK- 15.11, MTK-15.12, MTK-15.13, MTK-15.14, and MTK-15.15), MTK-16 (including MTK-16.1 and MTK-16.2), MTK-17, MTK-18, MTK-19, MTK-20, MTK-21, MTK-22, MTK-23, MTK-24
- an anti-MerTK antibody of the present disclosure competitively inhibits binding of at least one reference antibody, or binds to an epitope of human MerTK that is the same as or overlaps with the MerTK epitope bound by at least one reference antibody, wherein the reference antibody is an anti-MerTK antibody comprising a heavy chain variable domain (V H ) and a light chain variable domain (V L ), wherein the V H and V L are selected from the group consisting of: V H comprising the amino acid sequence of SEQ ID NO:5 and V L comprising the amino acid sequence of SEQ ID NO:40; V H comprising the amino acid sequence of SEQ ID NO:6 and V L comprising the amino acid sequence of SEQ ID NO:41; V H comprising the amino acid sequence of SEQ
- an anti-MerTK antibody of the present disclosure comprises a full-length heavy chain amino acid sequence comprising a variable heavy chain amino acid sequence of SEQ ID NO: 234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, or 246, and a heavy chain Fc selected from the group consisting of SEQ ID NOs: 396-411; and comprises a full-length light chain amino acid sequence comprising a variable light chain amino acid sequence of SEQ ID NO:247, 248, 249, 250, 251, 252, 253, or 254, and a light chain Fc comprising the amino acid sequence of SEQ ID NO:412.
- an anti-MerTK antibody of the present disclosure comprises a full-length heavy chain amino acid sequence comprising a variable heavy chain amino acid sequence of SEQ ID NO:255 or 256 and a heavy chain Fc selected from the group consisting of SEQ ID NOs: 396-411; and comprises a full-length light chain amino acid sequence comprising a variable light chain amino acid sequence of SEQ ID NO:257 or 258 and a light chain Fc comprising the amino acid sequence of SEQ ID NO:412.
- an anti-MerTK antibody of the present disclosure comprises a full-length heavy chain amino acid sequence of SEQ ID NO:413, 414, 415, 416, 417, 418, 419, or 420 and a full- length light chain amino acid sequence of SEQ ID NO: 421.
- an anti- MerTK antibody comprises the heavy chain amino acid sequence of SEQ ID NO:413 and the light chain amino acid sequence of SEQ ID NO:421; the heavy chain amino acid sequence of SEQ ID NO:414 and the light chain amino acid sequence of SEQ ID NO:421; the heavy chain amino acid sequence of SEQ ID NO:415 and the light chain amino acid sequence of SEQ ID NO: 421; the heavy chain amino acid sequence of SEQ ID NO:416 and the light chain amino acid sequence of SEQ ID NO:421; the heavy chain amino acid sequence of SEQ ID NO:417 and the light chain amino acid sequence of SEQ ID NO:421; the heavy chain amino acid sequence of SEQ ID NO:418 and the light chain amino acid sequence of SEQ ID NO:421; the heavy chain amino acid sequence of SEQ ID NO:419 and the light chain amino acid sequence of SEQ ID NO:421; or the heavy chain amino acid sequence of SEQ ID NO:420 and the light chain amino acid sequence of SEQ ID NO:421.
- an anti-MerTK antibody of the present disclosure comprises a full-length heavy chain amino acid sequence of SEQ ID NO:422, 423, 424, 425, 426, 427, 428, or 429 and a full- length light chain amino acid sequence of SEQ ID NO: 430.
- an anti- MerTK antibody comprises the heavy chain amino acid sequence of SEQ ID NO: 422 and the light chain amino acid sequence of SEQ ID NO:430; the heavy chain amino acid sequence of SEQ ID NO:423 and the light chain amino acid sequence of SEQ ID NO:430; the heavy chain amino acid sequence of SEQ ID NO:424 and the light chain amino acid sequence of SEQ ID NO:430; the heavy chain amino acid sequence of SEQ ID NO:425 and the light chain amino acid sequence of SEQ ID NO:430; the heavy chain amino acid sequence of SEQ ID NO:426 and the light chain amino acid sequence of SEQ ID NO:430; the heavy chain amino acid sequence of SEQ ID NO:427 and the light chain amino acid sequence of SEQ ID NO:430; the heavy chain amino acid sequence of SEQ ID NO:428 and the light chain amino acid sequence of SEQ ID NO:430; or the heavy chain amino acid sequence of SEQ ID NO:429 and the light chain amino acid sequence of SEQ ID NO:430.
- an anti-MerTK antibody of the present disclosure comprises a full-length heavy chain amino acid sequence comprising a variable heavy chain amino acid sequence of SEQ ID NO:259, 260, 261, 262, 263, 264, 265, 266, 267, 268, 269, 270, 271, 272, or 273, and a heavy chain Fc selected from the group consisting of SEQ ID NOs: 396-411; and comprises a full-length light chain amino acid sequence comprising a variable light chain amino acid sequence of SEQ ID NO:274, 275,
- an anti-MerTK antibody of the present disclosure comprises a full-length heavy chain amino acid sequence comprising a variable heavy chain amino acid sequence of SEQ ID NO: 290, 291, 292, 293, 294, 295, 296, 297, 298, 299, 300, 301, 302, 303, 304, 305, 306, 307, or 308, and a heavy chain Fc selected from the group consisting of SEQ ID NOs: 396-411; and comprises a full-length light chain amino acid sequence comprising a variable light chain amino acid sequence of SEQ ID NO:309, 310, 311, 312, 313, 314, 315, 316, 317, 318, 319, 320, 321, 322, 323, 324, 325, 326, 327, or
- an anti-MerTK antibody of the present disclosure comprises a full-length heavy chain amino acid sequence of SEQ ID NO: 431, 432, 433, 434, 435, 436, 437, or 438 and a full- length light chain amino acid sequence of SEQ ID NO:439.
- an anti- MerTK antibody comprises the heavy chain amino acid sequence of SEQ ID NO:431 and the light chain amino acid sequence of SEQ ID NO:439; the heavy chain amino acid sequence of SEQ ID NO:432 and the light chain amino acid sequence of SEQ ID NO:439; the heavy chain amino acid sequence of SEQ ID NO:433 and the light chain amino acid sequence of SEQ ID NO:439; the heavy chain amino acid sequence of SEQ ID NO:434 and the light chain amino acid sequence of SEQ ID NO:439; the heavy chain amino acid sequence of SEQ ID NO:435 and the light chain amino acid sequence of SEQ ID NO:439; the heavy chain amino acid sequence of SEQ ID NO:436 and the light chain amino acid sequence of SEQ ID NO:439; the heavy chain amino acid sequence of SEQ ID NO:437 and the light chain amino acid sequence of SEQ ID NO:439; or the heavy chain amino acid sequence of SEQ ID NO:438 and the light chain amino acid sequence of SEQ ID NO:439.
- an anti-MerTK antibody of the present disclosure comprises a full-length heavy chain amino acid sequence of SEQ ID NO: 464, 465, 466, 467, 468, 469, 470, and 471 and a full- length light chain amino acid sequence of SEQ ID NO:472.
- an anti- MerTK antibody comprises the heavy chain amino acid sequence of SEQ ID NO:464 and the light chain amino acid sequence of SEQ ID NO:472; the heavy chain amino acid sequence of SEQ ID NO:465 and the light chain amino acid sequence of SEQ ID NO:472; the heavy chain amino acid sequence of SEQ ID NO:466 and the light chain amino acid sequence of SEQ ID NO:472; the heavy chain amino acid sequence of SEQ ID NO:467 and the light chain amino acid sequence of SEQ ID NO:472; the heavy chain amino acid sequence of SEQ ID NO:468 and the light chain amino acid sequence of SEQ ID NO:472; the heavy chain amino acid sequence of SEQ ID NO:469 and the light chain amino acid sequence of SEQ ID NO:472; the heavy chain amino acid sequence of SEQ ID NO:470 and the light chain amino acid sequence of SEQ ID NO:472; or the heavy chain amino acid sequence of SEQ ID NO:471 and the light chain amino acid sequence of SEQ ID NO:472.
- an anti-MerTK antibody of the present disclosure comprises a full-length heavy chain amino acid sequence of SEQ D NO: 440, 441, 442, 443, 444, 445, 446, or 447 and a full- length light chain amino acid sequence of SEQ ID NO:448.
- an anti- MerTK antibody comprises the heavy chain amino acid sequence of SEQ ID NO:440 and the light chain amino acid sequence of SEQ ID NO:448; the heavy chain amino acid sequence of SEQ ID NO:441 and the light chain amino acid sequence of SEQ ID NO:448; the heavy chain amino acid sequence of SEQ ID NO: 442 and the light chain amino acid sequence of SEQ ID NO: 448; the heavy chain amino acid sequence of SEQ ID NO:443 and the light chain amino acid sequence of SEQ ID NO:448; the heavy chain amino acid sequence of SEQ ID NO:444 and the light chain amino acid sequence of SEQ ID NO:448; the heavy chain amino acid sequence of SEQ ID NO:445 and the light chain amino acid sequence of SEQ ID NO:448; the heavy chain amino acid sequence of SEQ ID NO:446 and the light chain amino acid sequence of SEQ ID NO:448; or the heavy chain amino acid sequence of SEQ ID NO:447 and the light chain amino acid sequence of SEQ ID NO:448.
- an anti-MerTK antibody of the present disclosure competitively inhibits binding of at least one reference antibody, or binds to an epitope of human MerTK that is the same as or overlaps with the MerTK epitope bound by at least one reference antibody, wherein the reference antibody is an anti-MerTK antibody comprising a heavy chain variable domain (V H ) and a light chain variable domain (V L ), wherein the V H and V L are selected from the group consisting of: V H comprising the amino acid sequence of SEQ ID NO: 19 and V L comprising the amino acid sequence of SEQ ID NO:54; V H comprising the amino acid sequence of SEQ ID NO:234 and V L comprising the amino acid sequence of SEQ ID NO:247; V H comprising the amino acid sequence of SEQ ID NO:235 and V L comprising the amino acid sequence of SEQ ID NO:247; V H comprising the amino acid sequence of SEQ ID NO:236 and V L comprising the amino acid sequence of SEQ ID NO:248
- an anti-MerTK antibody of the present disclosure competitively inhibits binding of at least one reference antibody, or binds to an epitope of human MerTK that is the same as or overlaps with the MerTK epitope bound by at least one reference antibody, wherein the reference antibody is an anti-MerTK antibody comprising a heavy chain variable domain (V H ) and a light chain variable domain (V L ), wherein the V H and V L are selected from the group consisting of: V H comprising the amino acid sequence of SEQ ID NO:20 and V L comprising the amino acid sequence of SEQ ID NO:55; V H comprising the amino acid sequence of SEQ ID NO:255 and V L comprising the amino acid sequence of SEQ ID NO:257; and V H comprising the amino acid sequence of SEQ ID NO:256 and V L comprising the amino acid sequence of SEQ ID NO:258.
- an anti-MerTK antibody of the present disclosure competitively inhibits binding of at least one reference antibody, or binds to an epitope of human MerTK that is the same as or overlaps with the MerTK epitope bound by at least one reference antibody, wherein the reference antibody is an anti-MerTK antibody comprising a heavy chain variable domain (V H ) and a light chain variable domain (V L ), wherein the V H and V L are selected from the group consisting of: V H comprising the amino acid sequence of SEQ ID NO:33 and V L comprising the amino acid sequence of SEQ ID NO:68; V H comprising the amino acid sequence of SEQ ID NO:259 and V L comprising the amino acid sequence of SEQ ID NO:274; V H comprising the amino acid sequence of SEQ ID NO:260 and V L comprising the amino acid sequence of SEQ ID NO:275; V H comprising the amino acid sequence of SEQ ID NO:261 and V L comprising the amino acid sequence of SEQ ID NO:276;
- an anti-MerTK antibody of the present disclosure competitively inhibits binding of at least one reference antibody, or binds to an epitope of human MerTK that is the same as or overlaps with the MerTK epitope bound by at least one reference antibody, wherein the reference antibody is an anti-MerTK antibody comprising a heavy chain variable domain (V H ) and a light chain variable domain (V L ), wherein the V H and V L are selected from the group consisting of: V H comprising the amino acid sequence of SEQ ID NO:37 and V L comprising the amino acid sequence of SEQ ID NO:72; V H comprising the amino acid sequence of SEQ ID NO:290 and V L comprising the amino acid sequence of SEQ ID NO:309; V H comprising the amino acid sequence of SEQ ID NO:291 and V L comprising the amino acid sequence of SEQ ID NO: 310; V H comprising the amino acid sequence of SEQ ID NO:292 and V L comprising the amino acid sequence of SEQ ID NO:311
- an anti-MerTK antibody of the present disclosure comprises: (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO:90; (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO:368; (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO: 155; (d) HVR-L1 comprising the amino acid sequence of SEQ ID NO:383; (e) HVR-L2 comprising the amino acid sequence of SEQ ID NO:203; and (f) HVR-L3 comprising the amino acid sequence of SEQ ID NO:232.
- an anti-MerTK antibody of the present disclosure comprises a heavy chain variable domain (VH) and a light chain variable domain (VL), wherein the VH comprises the amino acid sequence of SED ID NO: 298 and the VL comprises the amino acid sequence of SEQ ID NO:318.
- an anti-MerTK antibody of the present disclosure comprises a heavy chain and a light chain, wherein the heavy chain comprises the amino acid sequence of SEQ ID NO: 464 and the light chain comprises the amino acid sequence of SEQ ID NO:472.
- an anti-MerTK antibody of the present disclosure comprises a heavy chain and a light chain, wherein the heavy chain comprises the amino acid sequence of SEQ ID NO: 465 and the light chain comprises the amino acid sequence of SEQ ID NO:472.
- an anti-MerTK antibody of the present disclosure comprises a heavy chain and a light chain, wherein the heavy chain comprises the amino acid sequence of SEQ ID NO: 466 and the light chain comprises the amino acid sequence of SEQ ID NO:472.
- an anti-MerTK antibody of the present disclosure comprises a heavy chain and a light chain, wherein the heavy chain comprises the amino acid sequence of SEQ ID NO: 467 and the light chain comprises the amino acid sequence of SEQ ID NO:472.
- an anti-MerTK antibody of the present disclosure comprises a heavy chain and a light chain, wherein the heavy chain comprises the amino acid sequence of SEQ ID NO: 468 and the light chain comprises the amino acid sequence of SEQ ID NO:472. In some embodiments, an anti-MerTK antibody of the present disclosure comprises a heavy chain and a light chain, wherein the heavy chain comprises the amino acid sequence of SEQ ID NO: 469 and the light chain comprises the amino acid sequence of SEQ ID NO:472.
- an anti-MerTK antibody of the present disclosure comprises: (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO: 84; (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO:99; (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO: 139; (d) HVR-L1 comprising the amino acid sequence of SEQ ID NO:345; (e) HVR-L2 comprising the amino acid sequence of SEQ ID NO: 195; and (f) HVR-L3 comprising the amino acid sequence of SEQ ID NO:219.
- an anti-MerTK antibody of the present disclosure comprises a heavy chain variable domain (VH) and a light chain variable domain (VL), wherein the VH comprises the amino acid sequence of SED ID NO: 256 and the VL comprises the amino acid sequence of SEQ ID NO:258.
- an anti-MerTK antibody of the present disclosure comprises a heavy chain and a light chain, wherein the heavy chain comprises the amino acid sequence of SEQ ID NO: 422 and the light chain comprises the amino acid sequence of SEQ ID NO:430.
- an anti-MerTK antibody of the present disclosure comprises a heavy chain and a light chain, wherein the heavy chain comprises the amino acid sequence of SEQ ID NO: 423 and the light chain comprises the amino acid sequence of SEQ ID NO:430.
- an anti-MerTK antibody of the present disclosure comprises a heavy chain and a light chain, wherein the heavy chain comprises the amino acid sequence of SEQ ID NO: 424 and the light chain comprises the amino acid sequence of SEQ ID NO:430.
- an anti-MerTK antibody of the present disclosure comprises a heavy chain and a light chain, wherein the heavy chain comprises the amino acid sequence of SEQ ID NO: 425 and the light chain comprises the amino acid sequence of SEQ ID NO:430.
- an anti-MerTK antibody of the present disclosure comprises a heavy chain and a light chain, wherein the heavy chain comprises the amino acid sequence of SEQ ID NO: 426 and the light chain comprises the amino acid sequence of SEQ ID NO:430. In some embodiments, an anti-MerTK antibody of the present disclosure comprises a heavy chain and a light chain, wherein the heavy chain comprises the amino acid sequence of SEQ ID NO: 427 and the light chain comprises the amino acid sequence of SEQ ID NO:430.
- an anti-MerTK antibody of the present disclosure comprises: (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO:90; (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO:368; (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO: 155; (d) HVR-L1 comprising the amino acid sequence of SEQ ID NO:376; (e) HVR-L2 comprising the amino acid sequence of SEQ ID NO:203; and (f) HVR-L3 comprising the amino acid sequence of SEQ ID NO:393.
- an anti-MerTK antibody of the present disclosure comprises a heavy chain variable domain (VH) and a light chain variable domain (VL), wherein the VH comprises the amino acid sequence of SED ID NO: 299 and the VL comprises the amino acid sequence of SEQ ID NO:320.
- an anti-MerTK antibody of the present disclosure comprises a heavy chain and a light chain, wherein the heavy chain comprises the amino acid sequence of SEQ ID NO: 440 and the light chain comprises the amino acid sequence of SEQ ID NO:448.
- an anti-MerTK antibody of the present disclosure comprises a heavy chain and a light chain, wherein the heavy chain comprises the amino acid sequence of SEQ ID NO: 441 and the light chain comprises the amino acid sequence of SEQ ID NO:448.
- an anti-MerTK antibody of the present disclosure comprises a heavy chain and a light chain, wherein the heavy chain comprises the amino acid sequence of SEQ ID NO: 442 and the light chain comprises the amino acid sequence of SEQ ID NO:448.
- an anti-MerTK antibody of the present disclosure comprises a heavy chain and a light chain, wherein the heavy chain comprises the amino acid sequence of SEQ ID NO: 443 and the light chain comprises the amino acid sequence of SEQ ID NO:448.
- an anti-MerTK antibody of the present disclosure comprises a heavy chain and a light chain, wherein the heavy chain comprises the amino acid sequence of SEQ ID NO: 444 and the light chain comprises the amino acid sequence of SEQ ID NO:448. In some embodiments, an anti-MerTK antibody of the present disclosure comprises a heavy chain and a light chain, wherein the heavy chain comprises the amino acid sequence of SEQ ID NO: 445 and the light chain comprises the amino acid sequence of SEQ ID NO:448.
- an anti-MerTK antibody of the present disclosure comprises: (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO: 84; (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO:329; (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO: 139; (d) HVR-L1 comprising the amino acid sequence of SEQ ID NO: 169; (e) HVR-L2 comprising the amino acid sequence of SEQ ID NO: 195; and (f) HVR-L3 comprising the amino acid sequence of SEQ ID NO:219.
- an anti-MerTK antibody of the present disclosure comprises a heavy chain variable domain (VH) and a light chain variable domain (VL), wherein the VH comprises the amino acid sequence of SED ID NO: 225 and the VL comprises the amino acid sequence of SEQ ID NO:257.
- an anti-MerTK antibody of the present disclosure comprises a heavy chain and a light chain, wherein the heavy chain comprises the amino acid sequence of SEQ ID NO: 413 and the light chain comprises the amino acid sequence of SEQ ID NO:421.
- an anti-MerTK antibody of the present disclosure comprises a heavy chain and a light chain, wherein the heavy chain comprises the amino acid sequence of SEQ ID NO: 414 and the light chain comprises the amino acid sequence of SEQ ID NO:421.
- an anti-MerTK antibody of the present disclosure comprises a heavy chain and a light chain, wherein the heavy chain comprises the amino acid sequence of SEQ ID NO: 415 and the light chain comprises the amino acid sequence of SEQ ID NO:421.
- an anti-MerTK antibody of the present disclosure comprises a heavy chain and a light chain, wherein the heavy chain comprises the amino acid sequence of SEQ ID NO: 416 and the light chain comprises the amino acid sequence of SEQ ID NO:421.
- an anti-MerTK antibody of the present disclosure comprises a heavy chain and a light chain, wherein the heavy chain comprises the amino acid sequence of SEQ ID NO: 417 and the light chain comprises the amino acid sequence of SEQ ID NO:421.
- an anti-MerTK antibody of the present disclosure comprises a heavy chain and a light chain, wherein the heavy chain comprises the amino acid sequence of SEQ ID NO: 418 and the light chain comprises the amino acid sequence of SEQ ID NO:421.
- an anti-MerTK antibody of the present dsclosure binds to the extracellular domain (ECD) of human MerTK. In some embodiments, an anti-MerTK antibody of the present disclosure binds to the N-terminal domain of human MerTK. In some embodiments, an anti-MerTK antibody of the present disclosure binds to one or more amino acids within the amino acid sequence of SEQ ID NO:449. In some embodiments, an anti-MerTK antibody of the present disclosure binds to the immunoglobulin-like domain 1 (Igl) of human MerTK. In some embodiments, an anti-MerTK antibody of the present disclosure binds to one or more amino acid residues within the amino acid sequence of SED ID NO:450.
- an anti-MerTK antibody of the present disclosure binds to the immunoglobulin-like domain 2 (Ig2) of human MerTK. In some embodiments, an anti-MerTK antibody of the present disclosure binds to one or more amino acid residues within the amino acid sequence of SEQ ID NO:451. In some embodiments, an anti-MerTK antibody of the present disclosure binds to the fibronectin type III domain 1 (FN1) of human MerTK. In some embodiments, an anti-MerTK antibody of the present isclosure binds to one or more amino acid residues within the amino acid sequence of SEQ ID NO: 452.
- an anti-MerTK antibody of the present disclosure binds to the juxta membrane domain (JM) of human MerTK. In some embodiments, an anti-MerTK antibody of the present disclosure binds to one or more amino acid residues within the amino acid sequence of SEQ ID NO:454.
- an anti-MerTK antibody of the present disclosure binds to the extracellular domain of human MerTK protein but does not bind to the extracellular domain of human Axl protein.
- an anti-MerTK antibody of the present disclosure binds to one or more domains within the extracellular domain of human MerTK. In some embodiments, an anti-MerTK antibod of the present disclosure binds to the immunoglobulin-like 1 domain 1 (Igl) and the fibronectin type III domain 1 (FN1) of human MerTK. In some embodiments, an anti-MerTK antibody of the present disclosure binds to the immunoglobulin-like domain 2 (Ig2) and the fibronectin type III domain 1 (FN 1) of human MerTK.
- the anti-MerTK antibody according to any of the above embodiments is a monoclonal antibody, including a humanized and/or human antibody.
- the anti- MerTK antibody is an antibody fragment, e.g., a Fv, Fab, Fab', scFv, diabody, or F(ab')2 fragment.
- the anti-MerTK antibody is a substantially full-length antibody, e.g., an IgGl antibody, IgG2a antibody or other antibody class or isotype as defined herein.
- an anti-MerTK antibody may incorporate any of the features, singly or in combination, as described in Sections 1-7 below:
- the antibody has a dissociation constant (K D ) of ⁇ 1 ⁇ M, ⁇ 100 nM, ⁇ 10 nM, ⁇ 1 nM, ⁇ 0.1 nM, ⁇ 0.01 nM, or ⁇ 0.001 nM (e.g., 10 8 M or less, e.g., from 10 -8 M to 10 -13 M, e.g. , from 10 -9 M to 10 -13 M).
- K D dissociation constant
- Dissociation constants may be determined through any analytical technique, including any biochemical or biophysical technique such as ELISA, surface plasmon resonance (SPR), bio-layer interferometry (see, e.g., Octet System by ForteBio), isothermal titration calorimetry (ITC), differential scanning calorimetry (DSC), circular dichroism (CD), stopped-flow analysis, and colorimetric or fluorescent protein melting analyses.
- Kd is measured by a radiolabeled antigen binding assay (RIA).
- RIA radiolabeled antigen binding assay
- an RIA is performed with the Fab version of an antibody of interest and its antigen, for example as described in Chen et al. J. Mol. Biol. 293:865-881(1999)).
- K D is measured using a BIACORE surface plasmon resonance assay, for example, an assay using a BIACORE -2000 or a BIACORE -3000 (BIAcore, Inc., Piscataway, NJ) is performed at 25°C with immobilized antigen CM5 chips at ⁇ 10 response units (RU).
- a BIACORE surface plasmon resonance assay for example, an assay using a BIACORE -2000 or a BIACORE -3000 (BIAcore, Inc., Piscataway, NJ) is performed at 25°C with immobilized antigen CM5 chips at ⁇ 10 response units (RU).
- the K D is determined using a monovalent antibody (e.g, a Fab) or a full-length antibody. In some embodiments, the K D is determined using a full-length antibody in a monovalent form.
- an anti-MerTK antibody of the present disclosure binds to human MerTK, wherein the K D of binding to human MerTK is from about 1.4 nM to about 81 nM. In some embodiments, an anti-MerTK antibody binds to cyno MerTK, wherein the K D of binding to cyno MerTK is from about 1.6 nM to about 107 nM. In some embodiments, an anti-MerTK antibody of the present disclosure binds to murine MerTK, wherein the K D of binding to murine MerTK is from about 30 nM to about 186 nM.
- the antibody is an antibody fragment.
- Antibody fragments include, but are not limited to, Fab, Fab', Fab'-SH, F(ab')2, Fv, and scFv fragments, and other fragments described below.
- Fab fragment antigen
- Fab' fragment antigen binding domain
- Fab'-SH fragment antigen binding domain antigen binding domain antigen binding domain antigen binding domain antigen binding domain antigen binding domain antigen binding to antibodies.
- F(ab')2 Fv
- scFv fragments fragments include, but are not limited to, Fab, Fab', Fab'-SH, F(ab')2, Fv, and scFv fragments, and other fragments described below.
- scFv fragments see, e.g., WO 93/16185; and U.S. Patent Nos. 5571894 and 5587458.
- Diabodies are antibody fragments with two antigen-binding sites that may be bivalent or bispecific. See, for example, EP404097; WO 1993/01161; Hudson et al. Nat. Med. 9: 129-134 (2003). Triabodies and tetrabodies are also described in Hudson et al. Nat. Med. 9: 129-134 (2003).
- Single-domain antibodies are antibody fragments comprising all or a portion of the heavy chain variable domain or all or a portion of the light chain variable domain of an antibody.
- a single-domain antibody is a human single-domain antibody (see, e.g., U.S. Patent No. 6248516).
- Antibody fragments can be made by various techniques, including but not limited to proteolytic digestion of an intact antibody as well as production by recombinant host cells (e.g., E. coli or phage), as described herein.
- recombinant host cells e.g., E. coli or phage
- the antibody is a chimeric antibody.
- Certain chimeric antibodies are described, e.g., in U.S. Patent No. 4816567.
- a chimeric antibody comprises a non-human variable region (e.g. , a variable region derived from a mouse, rat, hamster, rabbit, or non-human primate, such as a monkey) and a human constant region.
- a chimeric antibody is a "class switched" antibody in which the class or subclass has been changed from that of the parent antibody. Chimeric antibodies include antigen-binding fragments thereof.
- the antibody is a humanized antibody.
- a non-human antibody is humanized to reduce immunogenicity to humans, while retaining the specificity and affinity of the parental non-human antibody.
- a humanized antibody is substantially non-immunogenic in humans.
- a humanized antibody has substantially the same affinity for a target as an antibody from another species from which the humanized antibody is derived. See, e.g., U.S. Pat. No. 5530101, 5693761; 5693762; and 5585089.
- amino acids of an antibody variable domain that can be modified without diminishing the native affinity of the antigen binding domain while reducing its immunogenicity are identified.
- a humanized antibody comprises one or more variable domains in which HVRs (or portions thereof) are derived from a non-human antibody, and FRs (or portions thereof) are derived from human antibody sequences.
- a humanized antibody optionally will also comprise at least a portion of a human constant region.
- some FR residues in a humanized antibody are substituted with corresponding residues from a non-human antibody (e.g, the antibody from which the HVR residues are derived), for example, to restore or improve antibody specificity or affinity.
- Human framework regions that may be used for humanization include but are not limited to: framework regions selected using the "best- fit" method (see, e.g., Sims et al. J. Immunol. 151:2296 (1993)); framework regions derived from the consensus sequence of human antibodies of a particular subgroup of light or heavy chain variable regions (see, e.g.. Carter et al. Proc. Natl. Acad. Sci. USA 89:4285 (1992); and Presta et al., J. Immunol. 151 :2623 (1993)); human mature (somatically mutated) framework regions or human germline framework regions (see. e.g., Almagro and Fransson Front.
- the antibody is a human antibody.
- Human antibodies can be produced using various techniques known in the art. Human antibodies are described generally in van Dijk et al. Curr. Opin. Pharmacol. 5:368-74 (2001) and Lonberg Curr. Opin. Immunol. 20:450-459 (2008).
- Human antibodies may be prepared by administering an immunogen to a transgenic animal that has been modified to produce intact human antibodies or intact antibodies with human variable regions in response to antigenic challenge.
- Large human Ig fragments can preserve the large variable gene diversity as well as the proper regulation of antibody production and expression.
- the reproduced human antibody repertoire in these mouse strains can yield high affinity fully human antibodies against any antigen of interest, including human antigens.
- antigen-specific human MAbs with the desired specificity can be produced and selected.
- Human antibodies can also be made by hybridoma-based methods. Human myeloma and mouse- human heteromyeloma cell lines for the production of human monoclonal antibodies have been described. (See, e.g., Kozbor J. Immunol. 133:3001 (1984) and Boemer et al. J. Immunol. 147:86 (1991)). Human antibodies generated via human B-cell hybridoma technology are also described in Li et al. Proc. Natl. Acad. Sci. USA, 1 03:3557-3562 (2006). Additional methods include those described, for example, in U.S. Patent No. 7189826 (describing production of monoclonal human IgM antibodies from hybridoma cell lines).
- Human hybridoma technology (Trioma technology) is also described in Vollmers et al. Histology and Histopathology 20(3) :927-937 (2005) and Vollmers et al. Methods and Findings in Experimental and Clinical Pharmacology 27(3): 185-91 (2005).
- Human antibodies may also be generated by isolating Fv clone variable domain sequences selected from human-derived phage display libraries. Such variable domain sequences may then be combined with a desired human constant domain. Techniques for selecting human antibodies from antibody libraries are described below.
- the antibody is a human antibody isolated by in vitro methods and/or screening combinatorial libraries for antibodies with the desired activity or activities. Suitable examples include but are not limited to phage display (CAT, Morphosys, Dyax, Biosite/Medarex, Xoma, Symphogen, Alexion (formerly Proliferon), Affimed) ribosome display (CAT), yeast display (Adimab), and the like.
- repertoires of VH and VL genes are separately cloned by polymerase chain reaction (PCR) and recombined randomly in phage libraries, which can then be screened for antigen-binding phage as described in Winter et al. Ann. Rev. Immunol. 12: 433-455 (1994).
- PCR polymerase chain reaction
- a variety of methods are known in the art for generating phage display libraries and screening such libraries for antibodies possessing the desired binding characteristics. See also Sidhu et al. J. Mol. Biol. 338(2): 299-310, 2004; Lee et al. J. Mol. Biol. 340(5): 1073-1093, 2004; Fellouse Proc. Natl. Acad Sci.
- Phage typically display antibody fragments, either as single chain Fv (scFv) fragments or as Fab fragments.
- Libraries from immunized sources provide high-affinity antibodies to the immunogen without the requirement of constructing hybridomas.
- the naive repertoire can be cloned (e.g., from human) to provide a single source of antibodies to a wide range of non-self and also self-antigens without any immunization as described by Griffiths et al. EMBO J. 12: 725-734 (1993).
- naive libraries can also be made synthetically by cloning unrearranged V-gene segments from stem cells, and using PCR primers comprising random sequence to encode the highly variable HVR3 regions and to accomplish rearrangement in vitro, as described by Hoogenboom et al . J. Mol. Biol., 227: 381-388, 1992.
- Patent publications describing human antibody phage libraries include, for example: US Patent No. 5750373, and US Patent Publication Nos. 2007/0292936 and 2009/0002360.
- Antibodies isolated from human antibody libraries are considered human antibodies or human antibody fragments herein.
- the antibody comprises an Fc.
- the Fc is a human IgGl, IgG2, IgG3, and/or IgG4 isotype.
- the antibody is of the IgG class, the IgM class, or the IgA class.
- the antibody has an IgG2 isotype. In some embodiments, the antibody contains a human IgG2 constant region. In some embodiments, the human IgG2 constant region includes an Fc region. In some embodiments, the antibody induces the one or more MerTK activities or independently of binding to an Fc receptor. In some embodiments, the antibody binds an inhibitory Fc receptor. In certain embodiments, the inhibitory Fc receptor is inhibitory Fc-gamma receptor IIB (Fc ⁇ llB). [0236] In certain embodiments of any of the antibodies provided herein, the antibody has an IgGl isotype. In some embodiments, the antibody contains a mouse IgGl constant region.
- the antibody contains a human IgGl constant region.
- the human IgGl constant region includes an Fc region.
- the antibody binds an inhibitory Fc receptor.
- the inhibitory Fc receptor is inhibitory Fc-gamma receptor IIB (FcyllB).
- the antibody has an IgG4 isotype.
- the antibody contains a human IgG4 constant region.
- the human IgG4 constant region includes an Fc region.
- the antibody binds an inhibitory Fc receptor.
- the inhibitory Fc receptor is inhibitory Fc- gamma receptor IIB (FcyllB).
- the antibody has a hybrid IgG2/4 isotype.
- the antibody includes an amino acid sequence comprising amino acids 118 to 260 according to EU numbering of human IgG2 and amino acids 261-447 according to EU numbering of human IgG4 (WO 1997/11971; WO 2007/106585).
- the Fc region increases clustering without activating complement as compared to a corresponding antibody comprising an Fc region that does not comprise the amino acid substitutions.
- the antibody induces one or more activities of a target specifically bound by the antibody.
- the antibody binds to MerTK.
- an anti-MerTK antibody of the present disclosure may also be desirable to modify effector function and/or to increase serum half-life of the antibody.
- the Fc receptor binding site on the constant region may be modified or mutated to remove or reduce binding affinity to certain Fc receptors, such as FcyRI, FcyRII, and/or FcyRIII to reduce Antibody-dependent cell-mediated cytotoxicity.
- the effector function is impaired by removing N-glycosylation of the Fc region (e.g., in the CH2 domain of IgG) of the antibody.
- the effector function is impaired by modifying regions such as 233-236, 297, and/or 327-331 of human IgG as described in WO 99/58572 and Armour et al. Molecular Immunology 40: 585-593 (2003); Reddy et al. J. Immunology 164: 1925-1933 (2000).
- salvage receptor binding epitope refers to an epitope of the Fc region of an IgG molecule (e.g., IgGi, IgG2, IgG 3 , or IgG 4 ) that is responsible for increasing the in vivo serum half-life of the IgG molecule.
- IgGi an epitope of the Fc region of an IgG molecule
- IgG 4 an epitope of the Fc region of an IgG molecule
- amino acid sequence variants of the antibodies are contemplated. For example, it may be desirable to improve the binding affinity and/or other biological properties of the antibody.
- amino acid sequence variants of an antibody may be prepared by introducing appropriate modifications into the nucleotide sequence encoding the antibody, or by peptide synthesis. Such modifications include, for example, deletions from, and/or insertions into and/or substitutions of residues within the amino acid sequences of the antibody.
- substitutions that differ significantly in their effect on maintaining (a) the structure of the polypeptide backbone in the area of the substitution, for example, as a sheet or helical conformation, (b) the charge or hydrophobicity of the molecule at the target site, or (c) the bulk of the side chain.
- Naturally occurring residues are divided into groups based on common side-chain properties:
- non-conservative substitutions can involve the exchange of a member of one of these classes for a member from another class.
- Such substituted residues can be introduced, for example, into regions of a human antibody that are homologous with non-human antibodies, or into the non- homologous regions of the molecule.
- the hydropathic index of amino acids can be considered.
- Each amino acid has been assigned a hydropathic index on the basis of its hydrophobicity and charge characteristics. They are: isoleucine (+4.5); valine (+4.2); leucine (+3.8); phenylalanine (+2.8); cysteine/cystine (+2.5); methionine (+1.9); alanine (+1.8); glycine (-0.4); threonine (-0.7); serine (-0.8); tryptophan (-0.9); tyrosine (-1.3); proline (-1.6); histidine (-3.2); glutamate (-3.5); glutamine (-3.5); aspartate (-3.5); asparagine (-3.5); lysine (-3.9); and arginine (-4.5).
- the substitution of like amino acids can be made effectively on the basis of hydrophilicity, particularly where the biologically functional protein or peptide thereby created is intended for use in immunological embodiments, as in the present case.
- the greatest local average hydrophilicity of a protein as governed by the hydrophilicity of its adjacent amino acids, correlates with its immunogenicity and antigenicity, i.e., with a biological property of the protein.
- hydrophilicity values have been assigned to these amino acid residues: arginine (+3.0); lysine (+3.0 ⁇ 1); aspartate (+3.0 ⁇ 1); glutamate (+3.0 ⁇ 1); serine (+0.3); asparagine (+0.2); glutamine (+0.2); glycine (0); threonine (-0.4); proline (-0.5 ⁇ 1); alanine (-0.5); histidine (-0.5); cysteine (-1.0); methionine (-1.3); valine (-1.5); leucine (-1.8); isoleucine (-1.8); tyrosine (-2.3); phenylalanine (-2.5) and tryptophan (-3.4).
- the substitution of amino acids whose hydrophilicity values are within ⁇ 2 is included, in certain embodiments, those which are within ⁇ 1 are included, and in certain embodiments, those within ⁇ 0.5 are included.
- each HVR is unaltered.
- Amino acid sequence insertions include amino- and/or carboxyl-terminal fusions ranging in length from one residue to polypeptides comprising a hundred or more residues, as well as intrasequence insertions of single or multiple amino acid residues.
- terminal insertions include an antibody with an N-terminal methionyl residue.
- Other insertional variants of the antibody molecule include the fusion to the N- or C-terminus of the antibody to an enzyme (e.g. , for ADEPT) or a polypeptide which increases the serum half-life of the antibody.
- cysteine residue outside the HVRs and not involved in maintaining the proper conformation of the antibody also may be substituted, generally with serine, to improve the oxidative stability of the molecule and prevent aberrant crosslinking.
- cysteine bond(s) may be added to the antibody to improve its stability (particularly where the antibody is an antibody fragment, such as an Fv fragment).
- the antibody is altered to increase or decrease the extent to which the antibody is glycosylated.
- Addition or deletion of glycosylation sites to an antibody may be conveniently accomplished by altering the amino acid sequence such that one or more glycosylation sites is created or removed.
- N-linked refers to the attachment of the carbohydrate moiety to the side chain of an asparagine residue.
- the tripeptide sequences asparagine-X-serine and asparagine-X-threonine, where X is any amino acid except proline, are the recognition sequences for enzymatic attachment of the carbohydrate moiety to the asparagine side chain.
- X is any amino acid except proline
- O-linked glycosylation refers to the attachment of one of the sugars N- acetylgalactosamine, galactose, or xylose to a hydroxyamino acid, most commonly serine or threonine, although 5-hydroxyproline or 5 -hydroxy lysine may also be used.
- Addition of glycosylation sites to the antibody is conveniently accomplished by altering the amino acid sequence such that it contains one or more of the above-described tripeptide sequences (for N- linked glycosylation sites). The alteration may also be made by the addition of, or substitution by, one or more serine or threonine residues to the sequence of the original antibody (for O-linked glycosylation sites).
- the antibody comprises an Fc region
- the carbohydrate attached thereto may be altered.
- Native antibodies produced by mammalian cells typically comprise a branched, biantennary oligosaccharide that is generally attached by an N-linkage to Asn297 according to Kabat numbering of the CH2 domain of the Fc region.
- the oligosaccharide may include various carbohydrates, for example, mannose, N-acetyl glucosamine (GlcNAc), galactose, and sialic acid, as well as a fticose attached to a GlcNAc in the "stem" of the biantennary oligosaccharide structure.
- modifications of the oligosaccharide in an antibody of the disclosure may be made in order to create antibody variants with certain improved properties.
- antibody variants are provided having a carbohydrate structure that lacks fticose attached (directly or indirectly) to an Fc region. See, e.g.. US Patent Publication Nos. 2003/0157108 and 2004/0093621.
- Examples of publications related to "defucosylated” or "fticose- deficient" antibody variants include: US 2003/0157108; US 2003/0115614; US 2002/0164328; US 2004/0093621; US 2004/0132140; US 2004/0110704; US 2004/0110282; US 2004/0109865; Okazaki et al. J. Mol. Biol.
- cell lines capable of producing defucosylated antibodies include Led 3 CHO cells deficient in protein fucosylation (Ripka et al. Arch. Biochem. Biophys. 249:533-545 (1986); US 2003/0157108), and knockout cell lines, such as alpha- 1,6-fucosyltransferase gene, FUT8, knockout CHO cells (see. e.g., Yamane-Ohnuki et al. Biotech. Bioeng. 87: 614 (2004) and Kanda et al. Biotechnol. Bioeng. 94(4):680- 688 (2006)).
- the antibody Fc is an antibody Fc isotypes and/or modifications. In some embodiments, the antibody Fc isotype and/or modification is capable of binding to Fc gamma receptor.
- the modified antibody Fc is an IgGl modified Fc.
- the IgGl modified Fc comprises one or more modifications.
- the IgGl modified Fc comprises one or more amino acid substitutions (e.g., relative to a wild-type Fc region of the same isotype).
- the one or more amino acid substitutions are selected from N297A (Bolt S et al. (1993) Eur J Immunol 23:403- 411), D265A (Shields et al. (2001) R. J. Biol. Chem.
- the Fc comprises N297A mutation according to EU numbering. In some embodiments of any of the IgGl modified Fc, the Fc comprises D265A and N297A mutations according to EU numbering. In some embodiments of any of the IgGl modified Fc, the Fc comprises D270A mutations according to EU numbering. In some embodiments, the IgGl modified Fc comprises F234A and F235A mutations according to EU numbering. In some embodiments of any of the IgGl modified Fc, the Fc comprises F234A and G237A mutations according to EU numbering.
- the Fc comprises F234A, F235A and G237A mutations according to EU numbering. In some embodiments of any of the IgGl modified Fc, the Fc comprises one or more (including all) of P238D, F328E, E233, G237D, H268D, P271G and A33 OR mutations according to EU numbering. In some embodiments of any of the IgGl modified Fc, the Fc comprises one or more of S267E/F328F mutations according to EU numbering.
- the Fc comprises P238D, F328E, E233D, G237D, H268D, P271G and A330R mutations according to EU numbering. In some embodiments of any of the IgGl modified Fc, the Fc comprises P238D, F328E, G237D, H268D, P271G and A33 OR mutations according to EU numbering. In some embodiments of any of the IgGl modified Fc, the Fc comprises P238D, S267E, F328E, E233D, G237D, H268D, P271G and A33 OR mutations according to EU numbering.
- the Fc comprises P238D, S267E, F328E, G237D, H268D, P271G and A33 OR mutations according to EU numbering. In some embodiments of any of the IgGl modified Fc, the Fc comprises C226S, C229S, E233P, F234V, and F235A mutations according to EU numbering. In some embodiments of any of the IgGl modified Fc, the Fc comprises F234F, F235E, and P331S mutations according to EU numbering. In some embodiments of any of the IgGl modified Fc, the Fc comprises S267E and F328F mutations according to EU numbering.
- the Fc comprises N325S and F328F mutations according to EU numbering. In some embodiments of any of the IgGl modified Fc, the Fc comprises S267E mutations according to EU numbering. In some embodiments of any of the IgGl modified Fc, the Fc comprises a substitute of the constant heavy 1 (CHI) and hinge region of IgGl with CHI and hinge region of IgG2 (amino acids 118-230 of IgG2 according to EU numbering) with a Kappa light chain.
- CHI constant heavy 1
- the Fc includes two or more amino acid substitutions that increase antibody clustering without activating complement as compared to a corresponding antibody having an Fc region that does not include the two or more amino acid substitutions.
- the IgGl modified Fc is an antibody comprising an Fc region, where the antibody comprises an amino acid substitution at position E430G and one or more amino acid substitutions in the Fc region at a residue position selected from: F234F, F235A, F235E, S267E, K322A, F328F, A330S, P331S, and any combination thereof according to EU numbering.
- the IgGl modified Fc comprises an amino acid substitution at positions E430G, F243A, F235A, and P33 IS according to EU numbering. In some embodiments, the IgGl modified Fc comprises an amino acid substitution at positions E430G and P33 IS according to EU numbering. In some embodiments, the IgGl modified Fc comprises an amino acid substitution at positions E430G and K322A according to EU numbering. In some embodiments, the IgGl modified Fc comprises an amino acid substitution at positions E430G, A330S, and P33 IS according to EU numbering. In some embodiments, the IgGl modified Fc comprises an amino acid substitution at positions E430G, K322A, A330S, and P331S according to EU numbering.
- the IgGl modified Fc comprises an amino acid substitution at positions E430G, K322A, and A330S according to EU numbering. In some embodiments, the IgGl modified Fc comprises an amino acid substitution at positions E430G, K322A, and P331S according to EU numbering.
- the IgGl modified Fc may further comprise herein may be combined with an A330L mutation (Lazar et al. Proc Natl Acad Sci USA, 103:4005-4010 (2006)), or one or more of L234F, L235E, and/or P331S mutations (Sazinsky et al. Proc Natl Acad Sci USA, 105:20167-20172 (2008)), according to the EU numbering convention, to eliminate complement activation.
- A330L mutation Lazar et al. Proc Natl Acad Sci USA, 103:4005-4010 (2006)
- L234F, L235E, and/or P331S mutations Sazinsky et al. Proc Natl Acad Sci USA, 105:20167-20172 (2008)
- the IgGl modified Fc may further comprise one or more of A330L, A330S, L234F, L235E, and/or P33 IS according to EU numbering. In some embodiments of any of the IgGl modified Fc, the IgGl modified Fc may further comprise one or more mutations to enhance the antibody half-life in human serum (e.g., one or more (including all) of M252Y, S254T, and T256E mutations according to the EU numbering convention).
- the IgGl modified Fc may further comprise one or more of E430G, E430S, E430F, E430T, E345K, E345Q, E345R, E345Y, S440Y, and/or S440W according to EU numbering.
- Fc regions modified constant regions
- An antibody dependent on binding to FcgR receptor to activate targeted receptors may lose its agonist activity if engineered to eliminate FcgR binding (see, e.g., Wilson et al. Cancer Cell 19: 101- 113 (2011); Armour at al. Immunology 40:585-593 (2003); and White et al. Cancer Cell 27: 138-148 (2015)).
- an anti-MerTK antibody of the present disclosure with the correct epitope specificity can activate the target antigen, with minimal adverse effects, when the antibody has an Fc domain from a human IgG2 isotype (CHI and hinge region) or another type of Fc domain that is capable of preferentially binding the inhibitory FcgRIIB r receptors, or a variation thereof.
- the modified antibody Fc is an IgG2 modified Fc.
- the IgG2 modified Fc comprises one or more modifications.
- the IgG2 modified Fc comprises one or more amino acid substitutions (e.g., relative to a wild-type Fc region of the same isotype).
- the one or more amino acid substitutions are selected from V234A (Alegre et al. Transplantation 57:1537-1543 (1994); Xu et al. Cell Immunol, 200: 16-26 (2000)); G237A (Cole et al.
- the Fc comprises an amino acid substitution at positions V234A and G237A according to EU numbering. In some embodiments of any of the IgG2 modified Fc, the Fc comprises an amino acid substitution at positions C219S or C220S according to EU numbering. In some embodiments of any of the IgG2 modified Fc, the Fc comprises an amino acid substitution at positions A330S and P33 IS according to EU numbering. In some embodiments of any of the IgG2 modified Fc, the Fc comprises an amino acid substitution at positions S267E and L328F according to EU numbering.
- the Fc comprises a C127S amino acid substitution according to the EU numbering convention (White et al., (2015) Cancer Cell 27, 138-148; Lightle et al. Protein Sci. 19:753-762 (2010); and WO 2008/079246).
- the antibody has an IgG2 isotype with a Kappa light chain constant domain that comprises a C214S amino acid substitution according to the EU numbering convention (White et al. Cancer Cell 27: 138-148 (2015); Lightle et al. Protein Sci. 19:753-762 (2010); and WO 2008/079246).
- the Fc comprises a C220S amino acid substitution according to the EU numbering convention.
- the antibody has an IgG2 isotype with a Kappa light chain constant domain that comprises a C214S amino acid substitution according to the EU numbering convention.
- the Fc comprises a C219S amino acid substitution according to the EU numbering convention.
- the antibody has an IgG2 isotype with a Kappa light chain constant domain that comprises a C214S amino acid substitution according to the EU numbering convention.
- the Fc includes an IgG2 isotype heavy chain constant domain 1(CH1) and hinge region (White et al. Cancer Cell 27:138-148 (2015)).
- the IgG2 isotype CHI and hinge region comprise the amino acid sequence of 118-230 according to EU numbering.
- the antibody Fc region comprises a S267E amino acid substitution, a L328F amino acid substitution, or both, and/or a N297A or N297Q amino acid substitution according to the EU numbering convention.
- the Fc further comprises one or more amino acid substitution at positions E430G, E430S, E430F, E430T, E345K, E345Q, E345R, E345Y, S440Y, and S440W according to EU numbering.
- the Fc may further comprise one or more mutations to enhance the antibody half-life in human serum (e.g., one or more (including all) of M252Y, S254T, and T256E mutations according to the EU numbering convention).
- the Fc may further comprise A330S and P331S.
- the Fc is an IgG2/4 hybrid Fc.
- the IgG2/4 hybrid Fc comprises IgG2 aa 118 to 260 and IgG4 aa 261 to 447.
- the Fc comprises one or more amino acid substitutions at positions H268Q, V309L, A330S, and P331S according to EU numbering.
- the Fc comprises one or more additional amino acid substitutions selected from A330L, L234F; L235E, or P331S according to EU numbering; and any combination thereof.
- the Fc comprises one or more amino acid substitutions at a residue position selected from C127S, L234A, L234F, L235A, L235E, S267E, K322A, L328F, A330S, P33 IS, E345R, E430G, S440Y, and any combination thereof according to EU numbering.
- the Fc comprises an amino acid substitution at positions E430G, L243A, L235A, and P33 IS according to EU numbering.
- the Fc comprises an amino acid substitution at positions E430G and P33 IS according to EU numbering. In some embodiments of any of the IgGl and/or IgG2 modified Fc, the Fc comprises an amino acid substitution at positions E430G and K322A according to EU numbering. In some embodiments of any of the IgGl and/or IgG2 modified Fc, the Fc comprises an amino acid substitution at positions E430G, A330S, and P33 IS according to EU numbering.
- the Fc comprises an amino acid substitution at positions E430G, K322A, A330S, and P33 IS according to EU numbering. In some embodiments of any of the IgGl and/or IgG2 modified Fc, the Fc comprises an amino acid substitution at positions E430G, K322A, and A330S according to EU numbering. In some embodiments of any of the IgGl and/or IgG2 modified Fc, the Fc comprises an amino acid substitution at positions E430G, K322A, and P331S according to EU numbering.
- the Fc comprises an amino acid substitution at positions S267E and L328F according to EU numbering. In some embodiments of any of the IgGl and/or IgG2 modified Fc, the Fc comprises an amino acid substitution at position C127S according to EU numbering. In some embodiments of any of the IgGl and/or IgG2 modified Fc, the Fc comprises an amino acid substitution at positions E345R, E430G and S440Y according to EU numbering.
- the modified antibody Fc is an IgG4 modified Fc.
- the IgG4 modified Fc comprises one or more modifications.
- the IgG4 modified Fc comprises one or more amino acid substitutions (e.g., relative to a wild-type Fc region of the same isotype).
- the one or more amino acid substitutions are selected from L235A, G237A, S229P, L236E (Reddy et al. J Immunol 164:1925-1933(2000)), S267E, E318A, L328F, M252Y, S254T, and/or T256E according to the EU numbering convention.
- the Fc may further comprise L235A, G237A, and E318A according to the EU numbering convention. In some embodiments of any of the IgG4 modified Fc, the Fc may further comprise S228P and L235E according to the EU numbering convention. In some embodiments of any of the IgG4 modified Fc, the IgG4 modified Fc may further comprise S267E and L328F according to the EU numbering convention. [0274] In some embodiments of any of the IgG4 modified Fc, the IgG4 modified Fc comprises may be combined with an S228P mutation according to the EU numbering convention (Angal et al. Mol Immunol. 30: 105-108 (1993)) and/or with one or more mutations described in (Peters et al. J Biol Chem. 287(29):24525-33 (2012)) to enhance antibody stabilization.
- the IgG4 modified Fc may further comprise one or more mutations to enhance the antibody half-life in human serum (e.g., one or more (including all) of M252Y, S254T, and T256E mutations according to the EU numbering convention).
- the Fc comprises L235E according to EU numbering.
- the Fc comprises one or more amino acid substitutions at a residue position selected from C127S, F234A, L235A, L235E, S267E, K322A, L328F, E345R, E430G, S440Y, and any combination thereof, according to EU numbering.
- the Fc comprises an amino acid substitution at positions E430G, L243A, L235A, and P33 IS according to EU numbering.
- the Fc comprises an amino acid substitution at positions E430G and P33 IS according to EU numbering.
- the Fc comprises an amino acid substitution at positions E430G and K322A according to EU numbering. In some embodiments of any of the IgG4 modified Fc, the Fc comprises an amino acid substitution at position E430 according to EU numbering. In some embodiments of any of the IgG4 modified Fc, the Fc region comprises an amino acid substitution at positions E430G and K322A according to EU numbering. In some embodiments of any of the IgG4 modified Fc, the Fc comprises an amino acid substitution at positions S267E and L328F according to EU numbering. In some embodiments of any of the IgG4 modified Fc, the Fc comprises an amino acid substitution at position C127S according to EU numbering. In some embodiments of any of the IgG4 modified Fc, the Fc comprises an amino acid substitution at positions E345R, E430G and S440Y according to EU numbering.
- the antibody is a derivative.
- derivative refers to a molecule that includes a chemical modification other than an insertion, deletion, or substitution of amino acids (or nucleic acids).
- derivatives comprise covalent modifications, including, but not limited to, chemical bonding with polymers, lipids, or other organic or inorganic moieties.
- a chemically modified antigen binding protein can have a greater circulating half-life than an antigen binding protein that is not chemically modified.
- a chemically modified antigen binding protein can have improved targeting capacity for desired cells, tissues, and/or organs.
- a derivative antigen binding protein is covalently modified to include one or more water soluble polymer attachments, including, but not limited to, polyethylene glycol, polyoxyethylene glycol, or polypropylene glycol. See, e.g., U.S. Pat. Nos. 4640835, 4496689, 4301144, 4670417, 4791192 and 4179337.
- a derivative antigen binding protein comprises one or more polymer, including, but not limited to, monomethoxy- polyethylene glycol, dextran, cellulose, , copolymers of ethylene glycol/propylene glycol, carboxymethylcellulose, polyvinyl pyrrolidone, poly-1, 3-dioxolane, poly-1, 3, 6-trioxane, ethylene/maleic anhydride copolymer, polyaminoacids (either homopolymers or random copolymers), poly-(N-vinyl pyrrolidone)-polyethylene glycol, propylene glycol homopolymers, a polypropylene oxide/ethylene oxide co-polymer, polyoxyethylated polyols (e.g., glycerol) and polyvinyl alcohol, as well as mixtures of such polymers.
- polymer including, but not limited to, monomethoxy- polyethylene glycol, dextran, cellulose, , copolymers of ethylene glyco
- a derivative is covalently modified with polyethylene glycol (PEG) subunits.
- PEG polyethylene glycol
- one or more water-soluble polymer is bonded at one or more specific position, for example at the amino terminus, of a derivative.
- one or more water- soluble polymer is randomly attached to one or more side chains of a derivative.
- PEG is used to improve the therapeutic capacity for an antigen binding protein.
- PEG is used to improve the therapeutic capacity for a humanized antibody.
- Peptide analogs are commonly used in the pharmaceutical industry as non-peptide drugs with properties analogous to those of the template peptide. These types of non-peptide compound are termed “peptide mimetics” or “peptidomimetics.” Fauchere, J. Adv. Drug Res., 15:29 (1986); and Evans et al. J. Med. Chem., 30: 1229 (1987), which are incorporated herein by reference for any purpose. Such compounds are often developed with the aid of computerized molecular modeling. Peptide mimetics that are structurally similar to therapeutically useful peptides can be used to produce a similar therapeutic effect.
- a paradigm polypeptide i.e., a polypeptide that has a biochemical property or pharmacological activity
- Systematic substitution of one or more amino acids of a consensus sequence with a D-amino acid of the same type can be used in certain embodiments to generate more stable peptides.
- constrained peptides comprising a consensus sequence or a substantially identical consensus sequence variation can be generated by methods known in the art (Rizo and Gierasch Ann. Rev. Biochem., 61:387 (1992), incorporated herein by reference for any purpose); for example, by adding internal cysteine residues capable of forming intramolecular disulfide bridges which cyclize the peptide.
- Drug conjugation involves coupling of a biological active cytotoxic (anticancer) payload or drug to an antibody that specifically targets a certain tumor marker (e.g. a polypeptide that, ideally, is only to be found in or on tumor cells).
- a certain tumor marker e.g. a polypeptide that, ideally, is only to be found in or on tumor cells.
- Antibodies track these proteins down in the body and attach themselves to the surface of cancer cells.
- the biochemical reaction between the antibody and the target protein (antigen) triggers a signal in the tumor cell, which then absorbs or internalizes the antibody together with the cytotoxin.
- the cytotoxic drug is released and kills the cancer. Due to this targeting, ideally the drug has lower side effects and gives a wider therapeutic window than other chemotherapeutic agents.
- Anti-MerTK antibodies of the present disclosure may be produced using recombinant methods and compositions, e.g., as described in U.S. Patent No. 4816567.
- isolated nucleic acids having a nucleotide sequence encoding any of the anti-MerTK antibodies of the present disclosure are provided. Such nucleic acids may encode an amino acid sequence comprising the VL and/or an amino acid sequence comprising the VH of the anti-MerTK antibody (e.g., the light and/or heavy chains of the antibody).
- one or more vectors e.g., expression vectors
- a host cell comprising such nucleic acid is also provided.
- the host cell comprises (e.g., has been transduced with): (1) a vector comprising a nucleic acid that encodes an amino acid sequence comprising the VL of the antibody and an amino acid sequence comprising the VH of the antibody, or (2) a first vector comprising a nucleic acid that encodes an amino acid sequence comprising the VL of the antibody and a second vector comprising a nucleic acid that encodes an amino acid sequence comprising the VH of the antibody.
- the host cell is eukaryotic, e.g., a Chinese Hamster Ovary (CHO) cell or lymphoid cell (e.g., Y0, NS0, Sp20 cell).
- Host cells of the present disclosure also include, without limitation, isolated cells, in vitro cultured cells, and ex vivo cultured cells.
- an anti-MerTK antibody of the present disclosure includes culturing a host cell of the present disclosure comprising a nucleic acid encoding the anti-MerTK antibody, under conditions suitable for expression of the antibody. In some embodiments, the antibody is subsequently recovered from the host cell (or host cell culture medium).
- a nucleic acid encoding the anti-MerTK antibody is isolated and inserted into one or more vectors for further cloning and/or expression in a host cell. Such nucleic acid may be readily isolated and sequenced using conventional procedures (e.g., by using oligonucleotide probes that are capable of binding specifically to genes encoding the heavy and light chains of the antibody).
- Suitable vectors comprising a nucleic acid sequence encoding any of the anti-MerTK antibodies of the present disclosure, or cell-surface expressed fragments or polypeptides thereof polypeptides (including antibodies) described herein include, without limitation, cloning vectors and expression vectors.
- Suitable cloning vectors can be constructed according to standard techniques, or may be selected from a large number of cloning vectors available in the art. While the cloning vector selected may vary according to the host cell intended to be used, useful cloning vectors generally have the ability to self- replicate, may possess a single target for a particular restriction endonuclease, and/or may carry genes for a marker that can be used in selecting clones comprising the vector.
- Suitable examples include plasmids and bacterial viruses, e.g., pUC18, pUC19, Bluescript (e.g., pBS SK+) and its derivatives, mpl8, mpl9, pBR322, pMB9, ColEl, pCRl, RP4, phage DNAs, and shuttle vectors such as pSA3 and pAT28.
- Bluescript e.g., pBS SK+
- mpl8 mpl9 mpl9
- pBR322 mpl9
- ColEl ColEl
- pCRl pCRl
- RP4 phage DNAs
- shuttle vectors such as pSA3 and pAT28.
- Suitable host cells for cloning or expression of antibody-encoding vectors include prokaryotic or eukaryotic cells.
- anti-MerTK antibodies of the present disclosure may be produced in bacteria, in particular when glycosylation and Fc effector function are not needed.
- antibody fragments and polypeptides in bacteria e.g., U.S. Patent Nos. 5648237, 5789199, and 5840523. After expression, the antibody may be isolated from the bacterial cell paste in a soluble fraction and can be further purified.
- eukaryotic microorganisms such as filamentous fungi or yeast
- suitable cloning or expression hosts for antibody-encoding vectors including fungi and yeast strains whose glycosylation pathways have been “humanized,” resulting in the production of an antibody with a partially or fully human glycosylation pattern (e.g., Gemgross Nat. Biotech. 22: 1409-1414 (2004); and Fi et al. Nat. Biotech. 24:210-215 (2006)).
- Suitable host cells for the expression of glycosylated antibody can also be derived from multicellular organisms (invertebrates and vertebrates). Examples of invertebrate cells include plant and insect cells. Numerous baculoviral strains have been identified which may be used in conjunction with insect cells, particularly for transfection of Spodoptera frugiperda cells. Plant cell cultures can also be utilized as hosts (e.g., U.S. Patent Nos. 5959177, 6040498, 6420548, 7125978, and 6417429, describing PFANTIBODIESTM technology for producing antibodies in transgenic plants).
- Vertebrate cells may also be used as hosts.
- mammalian cell lines that are adapted to grow in suspension may be useful.
- useful mammalian host cell lines are monkey kidney CV1 line transformed by SV40 (COS-7); human embryonic kidney line (293 or 293 cells as described, e.g., in Graham et al. J. Gen Virol. 36:59 (1977)); baby hamster kidney cells (BHK); mouse sertoli cells (TM4 cells as described, e.g., in Mather, Biol. Reprod.
- monkey kidney cells (CV1); African green monkey kidney cells (VERO-76); human cervical carcinoma cells (HEFA); canine kidney cells (MDCK; buffalo rat liver cells (BRF 3A); human lung cells (W138); human liver cells (Hep G2); mouse mammary tumor (MMT 060562); TRI cells, as described, e.g., in Mather et al. Annals N. Y. Acad. Sci. 383:44-68 (1982); MRC 5 cells; and FS4 cells.
- Other useful mammalian host cell lines include Chinese hamster ovary (CHO) cells, including DHFR- CHO cells (Urlaub et al. Proc. Natl. Acad. Sci.
- compositions and/or pharmaceutical formulations comprising the anti-MerTK antibodies of the present disclosure and a pharmaceutically acceptable carrier.
- pharmaceutically acceptable carrier preferably are nontoxic to recipients at the dosages and concentrations employed.
- the pharmaceutical compositions and/or pharmaceutical formulations to be used for in vivo administration can be sterile. This is readily accomplished by fdtration through, e.g., sterile fdtration membranes
- compositions and/or pharmaceutical formulations provided herein are useful as a medicament, e.g., for treating cancer.
- anti-MerTK antibodies of the present disclosure may be used for treating diseases and disorders.
- the present disclosure provides methods for treating an individual having cancer comprising administering to the individual a therapeutically effective amount of an anti-MerTK antibody of the present disclosure.
- modulating the activity of MerTK with an anti-MerTK antibody of the present disclosure is an effective means of treating cancer.
- methods for treating cancer in a subject in need thereof comprising administering to the subject an anti-MerTK antibody of the present disclosure, or a pharmaceutical composition comprising an anti-MerTK antibody of the present disclosure.
- a method for treating cancer in a subject in need thereof comprising administering to the subject an anti-MerTK antibody of the present disclosure, wherein the anti-MerTK antibody reduces efferocytosis by phagocytic cells.
- a method for treating cancer in a subject in need thereof comprising administering to the subject an anti-MerTK antibody of the present disclosure, wherein the anti-MerTK antibody induces Ml- like macrophage polarization.
- the cancer is selected from sarcoma, bladder cancer, breast cancer, colon cancer, endometrial cancer, kidney cancer, renal cancer, leukemia, lung cancer, non-small cell lung cancer, melanoma, lymphoma, pancreatic cancer, prostate cancer, ovarian cancer, stomach cancer, thyroid cancer, cancer of the uterus, liver cancer, cervical cancer, testicular cancer, squamous cell carcinoma, glioma, glioblastoma, adenoma, and neuroblastoma.
- the cancer is selected from glioblastoma multiforme, bladder carcinoma, and esophageal carcinoma.
- the cancer is triple-negative breast carcinoma.
- the cancer may be a primary tumor. In some embodiments, the cancer may be a metastatic tumor at a second site derived from any of the above types of cancer.
- an anti-MerTK antibody of the present disclosure is useful for treating cancer in s subject in need thereof, wherein the cancer expresses MerTK.
- an anti-MerTK antibody of the present disclosure may be administered in conjunction with one or more therapeutic agents that act as a checkpoint inhibitor. In some embodiments, the method further includes administering to the individual at least one antibody that specifically binds to an inhibitory immune checkpoint molecule, and/or another standard or investigational anti -cancer therapy.
- the inhibitory checkpoint molecule is selected from PD1, PD-L1, and PD- L2, In some embodiments, the at least one antibody that specifically binds to an inhibitory checkpoint molecule is administered in combination with the anti-MerTK antibody of the present disclosure [0297] In some embodiments, the at least one antibody that specifically binds to an inhibitory checkpoint molecule is selected from an anti-PD-Ll antibody, an anti-PD-L2 antibody, and an anti -PD- 1 antibody [0298] In some embodiments, a subject or individual is a mammal.
- Mammals include, without limitation, domesticated animals (e.g., cows, sheep, cats, dogs, and horses), primates (e.g., humans and non-human primates such as monkeys), rabbits, and rodents (e.g., mice and rats).
- domesticated animals e.g., cows, sheep, cats, dogs, and horses
- primates e.g., humans and non-human primates such as monkeys
- rabbits e.g., mice and rats
- rodents e.g., mice and rats.
- the subject or individual is a human.
- any of the anti-MerTK antibodies provided herein is useful for detecting the presence of MerTK in a sample or an individual.
- the term "detecting” as used herein encompasses quantitative or qualitative detection.
- methods of using the antibodies of this disclosure for diagnostic purposes such as the detection of MerTK in an individual or in tissue samples derived from an individual.
- the individual is a human.
- the tissue sample is phagocytic cells (e.g., macrophages, dendritic cells), tumor tissue, cancer cells, etc.
- the detection method may involve quantification of the antigen-bound antibody.
- Antibody detection in biological samples may occur with any method known in the art, including immunofluorescence microscopy, immunocytochemistry, immunohistochemistry, ELISA, FACS analysis, immunoprecipitation, or micro-positron emission tomography.
- the antibody is radiolabeled, for example with 18 F and subsequently detected utilizing micro-positron emission tomography analysis.
- Antibody-binding may also be quantified in a patient by non-invasive techniques such as positron emission tomography (PET), X-ray computed tomography, single-photon emission computed tomography (SPECT), computed tomography (CT), and computed axial tomography (CAT).
- PET positron emission tomography
- SPECT single-photon emission computed tomography
- CT computed tomography
- CAT computed axial tomography
- Article of manufacture may include one or more containers comprising an antibody described herein.
- Containers may be any suitable packaging including, but is not limited to, vials, bottles, jars, flexible packaging (e.g., sealed Mylar or plastic bags), and the like.
- the containers may be unit doses, bulk packages (e.g., multi-dose packages) or sub-unit doses.
- kits may further include a second agent.
- the second agent is a pharmaceutically-acceptable buffer or diluting agent including.
- the second agent is a pharmaceutically active agent.
- the article of manufactures further include instructions for use in accordance with the methods of this disclosure.
- the instructions generally include information as to dosage, dosing schedule, and route of administration for the intended treatment.
- these instructions comprise a description of administration of the isolated antibody of the present disclosure (e.g., an anti-MerTK antibody described herein) to treat an individual having a disease, disorder, or injury, such as for example cancer, according to any methods of this disclosure.
- the instructions include instructions for use of the anti-MerTK antibody and the second agent (e.g., second pharmaceutically active agent).
- Example 1 Production of His-conjugated and murine Fc-conjugated MerTK polypeptides [0305] Human, cyno, and murine MerTK polypeptides containing poly His or TEVS/Thrombin/murine IgG2a-Fc tagged fusion proteins for use in the generation and characterization of anti-MerTK antibodies of the present disclosure were generated as follows.
- Nucleic acid encoding the extracellular domain (ECD) of human MerTK (SEQ ID NO: 2), cyno MerTK (SEQ ID NO: 3), and murine MerTK (SEQ ID NO: 4) were each cloned into a mammalian expression vector containing nucleic acid encoding a heterologous signal peptide as well as containing either a PolyHis Fc tag or TEVS/Thrombin/murine IgG2a Fc tag.
- a VTRGGV GPF SDP VKIFIP AHGWVDY AP S STP APGNADP VLII
- Cyno MerTK ECD amino acid sequence (SEQ ID NO: 3):
- Murine MerTK ECD amino acid sequence (SEQ ID NO: 4):
- the human, cyno, and murine MerTK nucleic acid fusion constructs were transiently transfected into HEK293 cells.
- the recombinant fusion polypeptides were purified from the supernatants of the cells using Mabselect resin (GE Healthcare, Cat# 17519902) following the manufacturer’s instructions.
- Mabselect resin GE Healthcare, Cat# 17519902
- commercially available DDDDK-tagged human MerTK fusion polypeptide (Sino Biological, Wayne, PA, Cat# I0298-HCCH) or human IgGl Fc-tagged murine MerTK fusion proteins (R&D systems, Minneapolis, MA, Cat# 591 -MR- 100) were also used for anti -MerTK antibody characterization as described below.
- Example 2 Generation of human and murine MerTK overexpressing CHO cell lines
- Human MerTK and murine MerTK overexpressing CHO cell lines were prepared as follows.
- Human MerTK open reading frame (ORF) clone Fenti virus particle (Cat# RC215289F4V) and mouse MerTK ORF clone Fentivirus particle (Cat# MR225392L4V) (Origene, Rockville, MD) (both mGFP- tagged) were used for preparing human MerTK overexpressing CHO-K1 and murine MerTK overexpressing CHO-K1 stable cell line generation, respectively.
- CHO cells were cultured in F12-K media (ATCC, Cat# ATCC 30-2004) containing 10% FBS (Gibco) until >80% confluent. The cells were then dissociated with Trypsin buffer (0.25%
- EDTA/Trypsin Gibco, Cat# 25200056
- EDTA/Trypsin Gibco, Cat# 25200056
- plated at 70-80% confluency in 6-well plates 24 hours prior to transduction with either the human or murine MerTK lentivirus construct The following day, cells were incubated with the lentiviral particle at 4°C for 2 hours and then the plates were incubated at 37°C in 5% CO2. Two days later, puromycin (Invivogen, San Diego, CA, Cat# ant-pr-1) was added for selection; selected puromycin-resistant cells were frozen in Cell Recovery Freezing Medium (Gibco, Cat# 12648010) for subsequent use.
- puromycin Invivogen, San Diego, CA, Cat# ant-pr-1
- puromycin-resistant cells were frozen in Cell Recovery Freezing Medium (Gibco, Cat# 12648010) for subsequent use.
- human MerTK overexpressing CHO cells (CHO-huMerTK OE cells) and mouse MerTK overexpressing CHO cells (CHO-muMerTK OE cells) generated as described above were plated at l-2xl0 5 cells per well in 96-well U-bottom plates and incubated with a commercially available mouse anti-human MerTK monoclonal antibody (BioFegend, Clone:
- rat anti-mouse MerTK monoclonal antibody (ThermoFisher, Clone: DS5MMER, Cat# 12-5751-82) for 30 minutes on ice.
- Cells were rinsed twice with ice-cold FACS buffer (2% FBS+PBS) and then incubated with APC-conjugated goat anti-mouse antibody (Jackson ImmunoResearch, West Grove, PA, Cat#l 15-606-071) or goat-anti-rat antibody (Jackson ImmunoResearch, Cat# 112-606-071) for 30 min on ice.
- the cells were washed with ice-cold FACS buffer and then resuspended in a final volume of 50-200m1 of FACS buffer containing 0.25pl/well propidium iodide (BD, Cat#556463).
- MerTK expression was examined on various human cell types and tissues, including U937 cells (ATCC CRF-1593.2; human macrophage cell line), SK-MEF-5 cells (ATCC HTB-70; human melanoma cell line), A375 cells (ATCC CRL-1619; human melanoma cell line), THP-1 cells (ATCC TIB-202; human monocyte-like cell line), CHO-huMerTK OE cells, human monocytes, human monocyte-derived macrophages, and human monocyte-derived dendritic cells. Additionally, MerTK expression was examined on human monocytes, macrophages, and dendritic cells obtained from human tumor samples as outlined below.
- Monocytes were isolated from peripheral blood mononuclear cells (PBMCs) from healthy human donors using RosetteSep monocyte isolation antibody cocktail (Stem Cell Technologies).
- the isolated human monocytes were either differentiated into human macrophages with 50ng/mL M-CSF (Peprotech) or were differentiated into human dendritic cells (DCs) with lOOng/mL GM-CSF and lOOng/mF IF-4 (Peprotech).
- the human macrophages or human dendritic cells were incubated with a commercially available fluorochrome-conjugated anti-human MerTK antibody (BioFegend, clone 590H11G1E3) for 30 minutes on ice in the dark.
- Cells were washed twice in FACS buffer (PBS + 2% FBS, 2mM EDTA), and analysis of MerTK expression on the surface of the cells was performed using a BD FACS CantoII system.
- Figure 1 shows results of FACS analysis of human MerTK expression on human myeloid cells (i.e., dendritic cells, macrophages).
- dendritic cells (DCs) and macrophages from two different human donors displayed anti-MerTK antibody reactivity, indicating these cells express MerTK on their cell surface.
- Figure 2 shows results of FACS analysis of human MerTK expression on various cell lines, including A375 cells, THP-1 cells, U937 cells, SK-MEF-5 cells, and CHO-huMerTK OE cells.
- U937 cells, SK-MEF-5 cells, and CHO-huMerTK OE cells displayed anti-MerTK antibody reactivity, indicating that these cell lines express MerTK on their cell surface.
- mice (Charles River Laboratories, Wilmington, MA) or MerTK knock-out (KO) mice (Jackson Laboratories, Bar Harbor, ME) were immunized twice a week by subcutaneous or intraperitoneal injections of purified extracellular domain polypeptides of human, cyno, and mouse MerTK (obtained as described above in Example 1) with or without adjuvant. A total of 8 injections were performed over 4 weeks. Three days following the final injection, spleens and lymph nodes were harvested from the mice for hybridoma cell line generation.
- Lymphocytes from the spleens and lymph nodes of the immunized mice were isolated and then fused with P3X63Ag8.653 (CRL-1580, American Type Culture Collection, Rockville, MD) or SP2/mIL- 6 (CRL-2016, American Type Culture Collection, Rockville, MD) mouse myeloma cells via electrofusion (Hybrimmune, BTX, Holliston, MA) and incubated at 37°C, 5% CO2, overnight in Clonacell-HY Medium C (STEMCELL Technologies, Vancouver, BC, Canada, Cat# 03803).
- the fused cells were centrifuged and resuspended in 10ml of ClonaCell-HY Medium C with anti -mouse IgG Fc-FITC (Jackson ImmunoResearch, West Grove, PA) and then gently mixed with 90ml of methylcellulose-based ClonaCell-HY Medium D (STEMCELL Technologies, Cat# 03804) containing HAT components.
- the cells were plated into Nunc OmniTrays (Thermo Fisher Scientific, Rochester, NY) and allowed to grow at 37°C, 5% CO2 for seven days.
- Example 5 Screening of anti-MerTK antibody hybridoma supernatants by FACS [0325] Hybridoma culture supernatants from 1,728 hybridomas obtained as described above were screened for their ability to bind MerTK on various cell types, including CHO cells stably overexpressing human MerTK (CHO-huMerTK OE cells) or stably overexpressing mouse MerTK (CHO-muMerTK OE cells) (generated as described above), and CHO parental cells; U937 cells (ATCC CRL-1593.2), SK- MEL-5 cells (ATCC HTB-70) (which endogenously express human MerTK), J774A.1 cells (ATCC TIB- 67) (which endogenously express mouse MerTK), and A375 cells (ATCC CRL-1619). THP-1 cells (ATCC TIB-202), which have no or minimal expression of MerTK, served as non-MerTK expressing negative control cells in these experiments.
- CHO-huMerTK OE cells stably overexpressing human
- the cells were again washed twice with ice-cold FACS buffer and resuspended in a final volume of 30m1 of FACS buffer containing 0.25 m ⁇ /w cl 1 propidium iodide (BD Biosciences, Cat#556463). Binding intensity on cells was analyzed using the FACS Canto system (BD Biosciences), with sorting gates drawn to exclude dead (i.e., propidium iodide-positive) cells. The ratio of APC Mean Fluorescence Intensity (MFI) on each barcoded cell population was determined for each anti-MerTK hybridoma supernatant tested.
- MFI APC Mean Fluorescence Intensity
- Example 6 Screening of anti-MerTK antibody hybridoma supernatants by recombinant MerTK protein binding assay
- Hybridoma culture supernatants from 1,728 hybridomas obtained as described above were screened for their ability to bind polyHis-tagged human, cyno, and mouse MerTK (prepared as described above in Example 1) as compared to binding to an irrelevant His-tagged control protein. Briefly, 96-well polystyrene plates were coated with lpg/ml of human, cyno, or mouse poly -His-tagged MerTK polypeptide in coating buffer (0.05M carbonate buffer, pH 9.6, Sigma, Cat# C3041) overnight at 4°C.
- coating buffer 0.05M carbonate buffer, pH 9.6, Sigma, Cat# C3041
- Anti -mouse IgG Fc-HRP Jackson Immunoresearch, Cat# 115-035-071
- secondary antibody was diluted 1:5000 in ELISA diluent, added to each well at 50pl/well, and incubated for 30 minutes at room temperature with shaking. After a final set of washes (3c300m1 in PBST), 50pl/well of TMB substrate (BioFx, Cat#TMBW-1000-01) was added to the wells. The reaction was then quenched after 5-10 mins with 50pl/well of stop solution (BioFx, Cat#BSTP- 1000-01).
- Example 7 MerTK ligand Gas6 and ligand ProS blocking assay using anti-MerTK hybridoma supernatants
- Anti-MerTK antibody hybridoma supernatants identified as described above were evaluated for their ability to block binding of human Gas6 ligand and/or block binding of human ProS ligand to human MerTK by ELISA. Briefly, rabbit anti-human IgG antibody (Jackson ImmunoResearch, Cat#309-005- 008) was coated at 2pg/ml onto high-protein binding plates at 4°C overnight. After washing with 0.05% Tween20 in PBS three times, 5% BSA in PBS was added for 1 hour.
- Recombinant human MerTK-human Fc Chimera protein (R&D systems, Cat#391-MR-100) was added at 2pg/ml for 1 hour and plates were washed before the addition of 40m1 of anti-MerTK hybridoma supernatants and 40m1 of His tag- conjugated recombinant Gas6 (R&D systems, Cat# 885-GSB-050) at 3mg/ml or His tag-conjugated recombinant ProS (R&D systems, Cat# 9489-PS-100) at 20mg/ml.
- a total of 308 anti-MerTK hybridoma supernatant clones were screened for their ability to block Gas6 and/or block ProS ligand binding to MerTK.
- Twenty-nine (29) anti-MerTK hybridoma clones blocked the binding of both ProS ligand and Gas6 ligand to recombinant human MerTK protein.
- One hundred forty-five (145) anti-MerTK hybridoma clones blocked binding of ProS ligand to human MerTK protein only and did not block the binding of Gas6 ligand to recombinant human MerTK protein.
- the remainder of the 308 anti-MerTK hybridoma clones screened by this assay did not block either ProS ligand or Gas6 ligand binding to recombinant human MerTK protein in this assay.
- the hybridoma supernatants were characterized further regarding their ability to block efferocytosis by phagocytic cells as described below.
- Example 8 Efferocytosis blocking assay using anti-MerTK hybridoma supernatants
- Anti-MerTK antibody hybridoma supernatants identified above as positive for MerTK binding reactivity were evaluated for their ability to block efferocytosis by human macrophages as follows. Human macrophages were differentiated from human monocytes for 7 days in the presence of human M- CSF. Macrophages were harvested (by scraping), resuspended in PBS, and plated on 96-well plates at 5xl0 4 cells/well. Cells were starved for 1 hour followed by the addition of anti-MerTK hybridoma supernatants to each well for 30 min at 37°C.
- Jurkat cells were treated with ImM staurosporin (SigmaAldrich) for 3 hours at 37°C (to induce apoptosis) and labeled with pHrodo (ThermoFisher) for 30 min at room temperature. After washing with PBS, pHrodo labeled Jurkat cells were added into each well at 1:4 ratio (1 macrophage cell to 4 Jurkat cells) for 1 hour. The plates were washed with PBS and then cells were stained with APC-conjugated anti-human CD 14 for 30 minutes on ice in the dark. Cells were then washed twice in FACS buffer (PBS + 2% FBS), and flow cytometry was performed on a BD FACS CantoII. Data were analyzed using FlowJo software.
- efferocytosis-positive macrophages were identified by setting pHrodo CD 14 double positive cells as an analysis gate and then applying this exact gate to all the samples. Baseline efferocytosis levels were established using macrophages cultured with media alone and this was set to 100% efferocytosis activity.
- Relative efferocytosis levels were calculated as a percent of efferocytosis observed in cells treated with media alone compared to that observed in cells treated with anti-MerTK hybridoma supernatants.
- additional anti-MerTK antibodies were used: mouse anti-human MerTK antibody HI (BioLegend, Clone ID: 590H11G1E3, mouse IgGl) and human anti-human MerTK antibody M6 (disclosed in W02016/106221).
- Table 1 and Table 2 below show results from these efferocytosis experiments, as % efferocytosis (media alone was set to 100% efferocytosis).
- exemplary hybridoma supernatants tested are indicated on the left and labeled as hybridoma supernatant ID number; these supernatants were from hybridoma clones identified from immunization of wildtype B ALB/c mice.
- exemplary hybridoma supernatants tested are indicated on the left and labeled as hybridoma supernatant ID number; these supernatants were from hybridoma clones identified from immunization of MerTK KO mice.
- antibody ID refers to anti-MerTK antibodies of the present disclosure that were selected for additional characterization and thus given a specific anti-MerTK antibody name, as indicated.
- the third, fourth and fifth columns (“Donor” identification numbers) indicate the percent efferocytosis relative to media treatment alone. Note that in comparison to efferocytosis in macrophages in the absence of antibody (media treatment alone), no significant change in efferocytosis was observed in cells treated with isotype control mouse IgGl antibody.
- Anti-MerTK antibodies from the hybridomas described above were subcloned as follows. 5xl0 5 hybridoma cells were harvested and washed with PBS and then the cell pellets were flash frozen in dry ice and stored at -20°C. Total RNA was extracted by using RNeasy Mini Kit (QIAGEN, Cat#74104) following the manufacturer’s protocol. cDNA was generated using Clontech’s SMARTer RACE 573’ Kit (Takara Bio USA, Cat# 634859) following the manufacturer’s protocol. Variable heavy and light immunoglobulin regions were cloned separately by touchdown PCR using the 5' UPM primer provided in the RACE kit and reverse primers recognizing the heavy chain and light chain constant regions.
- the resulting PCR products were purified and ligated into a pCR2.1-TOPO cloning vector (TOPO TA cloning Kit, Invitrogen Cat#450641) and transformed into Escherichia coli (E. coli) cells. Transformed colonies were isolated and the variable heavy chain (VH) and variable light chain (VL) nucleic acids were sequenced for each corresponding hybridoma cell line.
- VH variable heavy chain
- VL variable light chain
- variable heavy chain regions and variable light chain regions were amplified by PCR using primers containing endonuclease restriction sites and then subcloned into pLEV-123 (LakePharma, San Carlos, CA) mammalian expression vector encoding human IgGl-Fc-LALAPS (human IgGl Fc comprising amino acid substitutions L234A, L235A, and P331S by EU numbering) and IgG Kappa.
- Anti-MerTK hybridoma clones were cultured in serum free hybridoma media and the anti-MerTK antibodies in the supernatants purified on Hamilton STAR platform (Hamilton Company, Reno, NV) using Protein A tips (Phynexus Inc, San Jose, CA). Anti-MerTK antibodies were also produced via direct cloning of the variable gene regions obtained from the hybridomas into a recombinant expression plasmid for production of chimeric antibodies containing a human Fc domain (human IgGl containing LALAPS amino acid substitutions described above). Using the Tuna293TM Process (LakePharma, San Carlos, CA), HEK293 cell were seeded into shake flasks and expanded using serum-free chemically defined media.
- the expression plasmids were transiently transfected into the cells and the culture supernatants were harvested 7 days later. After clarification by centrifugation and filtration, the anti-MerTK antibodies in the supernatants were purified via Protein A chromatography.
- Example 11 Blocking efferocytosis with recombinant anti-MerTK antibodies
- phagocytic cells e.g., human macrophages or mouse bone-marrow derived macrophages
- Human macrophages were differentiated from human monocytes for 7 days in the presence of human M-CSF.
- Mouse bone marrow derived macrophages were differentiated from mouse bone marrow cells for 7 days in the presence of mouse M-CSF (Peprotech, Cat# 315-02).
- human macrophages and mouse macrophages were harvested (by scraping), resuspended in PBS, and plated on 96-well plates at 5xl0 4 cells/well.
- IC50 determinations cells were starved for 1 hour followed by the addition of 10m1 of recombinant anti-MerTK antibody to each well for 30 min at 37°C.
- recombinant anti-MerTK antibodies were titrated to a final concentration range of between 66.6nM to 4pM and then each serially diluted antibody was added to each well for 30 min at 37°C.
- Jurkat cells were treated with ImM staurosporin (SigmaAldrich) for 3 hours at 37°C (to induce apoptosis) and labeled with pHrodo (ThermoFisher) for 30 min at room temperature. After washing with PBS, pHrodo labeled Jurkat cells were added into each well at 1:4 ratio (1 macrophage: 4 Jurkat cells) for 1 hour. The plates were washed with PBS and then the cells were stained with APC-conjugated anti human CD 14 or anti-mouse CD1 lb for 30 minutes on ice in the dark. Cells were then washed twice in FACS buffer (PBS + 2% FBS), and flow cytometry was performed on a BD FACS Canto II. Data were analyzed using FlowJo software.
- rat anti-mouse MerTK antibody DS5MMER eBioscience, Clone ID DS5MMER, rat IgG2a
- mouse anti-human MerTK antibody HI BioFegend, Clone ID: 590H11G1E3, mouse IgGl
- mouse anti-human MerTK antibody H2 R&D systems, Clone ID: 125518, mouse IgG2b
- mouse anti-human MerTK antibody H3 R&D systems, Clone ID 125508, mouse IgG2b
- mouse anti-human MerTK antibody H6 eBioscience, Clone ID: A3KCAT, mouse IgGl
- mouse anti-human MerTK antibody H7 (Sino Biological, Clone ID: 09, Mouse IgG2b)
- human anti human MerTK antibody M6 (disclosed in WO2016/106221, huIgGl F
- efferocytosis-positive macrophages were identified by setting pHrodo CD 14 double positive cells as an analysis gate and then applying this exact gate to all the samples. Baseline efferocytosis levels were established using macrophages cultured with media alone and this was set to 100% efferocytosis activity. Relative efferocytosis levels were calculated as a percent of efferocytosis observed in cells treated with media alone compared to that observed in cells treated with anti-MerTK antibodies.
- Efferocytosis blocking studies were performed by addition of 10pg/ml of recombinant anti- MerTK antibody of the present disclosure to the macrophages.
- Table 6 and Table 7 show % efferocytosis of anti-MerTK antibodies of the present disclosure on efferocytosis activity by macrophages obtained from various human donors.
- anti-MerTK antibodies of the present disclosure reduced or decreased efferocytosis by human macrophages (e.g., reduced efferocytosis by about 50% to about 98%). Although the efferocytosis blocking activity by anti-MerTK antibodies was different depending on donors, there was a general trend of each antibody.
- FIG. 4 and Figure 5 shows efferocytosis blocking results of exemplary anti-MerTK antibodies of the present disclosure.
- anti-MerTK antibodies MTK-06, MTK-10, MTK-15, MTK-16, and MTK-21 of the present disclosure inhibited efferocytosis of apoptotic cells by human macrophages in a dose dependent manner.
- anti-MerTK antibodies of the present disclosure are effective at reducing or decreasing efferocytosis activity by human macrophages.
- anti-MerTK antibodies MTK-24, MTK-29, MTK-31, and MTK-33 of the present disclosure inhibited efferocytosis of apoptotic cells by mouse bone marrow derived macrophages in a dose dependent manner. These results indicated that anti-MerTK antibodies of the present disclosure are effective at reducing or decreasing efferocytosis activity by mouse bone marrow derived macrophages.
- Table 8 below shows IC50 values of anti-MerTK antibodies of the present disclosure for reducing or decreasing efferocytosis by human macrophages with a range of IC50 values.
- anti-MerTK antibodies of the present disclosure reduced or decreased efferocytosis by human macrophages with an IC50 range of about 1.2 nM to about 28 nM.
- Table 9 and Table 10 show IC50 values of anti-MerTK antibodies of the present disclosure on efferocytosis activity by mouse macrophages and macrophages obtained from various human donors.
- anti-MerTK antibodies of the present disclosure were effective at reducing efferocytosis by human macrophages and mouse macrophages. Additionally, these results showed that anti-MerTK antibodies of the present disclosure reduced efferocytosis by human macrophages at an IC50 of about 0.13 nM to about 30 nM.
- Example 12 Anti-MerTK antibodies bind to SK-MEL-5 cells and CHO-muMerTK OE cells [0351] To determine whether recombinant anti-human MerTK antibodies of the present disclosure bind to human MerTK endogenously expressed on SK-MEL-5 cells and to CHO cells overexpressing mouse MerTK (CHO-muMerTK OE cells), the following experiments were performed. SK-MEL-5 cells and CHO-muMerTK OE cells were plated at 40,000 cells/well. Anti-MerTK antibodies were titrated to a final concentration range of between 66.6nM to 4pM and then added to the cells.
- Figure 6 shows anti-human MerTK antibodies MTK-06, MTK-10, MTK-11, MTK-13, MTK-15, and MTK-16 bind to MerTK endogenously expressed on SK-MEL-5 in a dose dependent manner.
- Table 11, Table 12, and Table 13 below show Kd values from FACS analysis of anti-MerTK antibodies binding to SK-MEL-5 cells (Table 11 and Table 12) and to CHO-muMerTK-OE cells (Table 13).
- Anti-MerTK antibodies binds to SK-MEL-5 or CHO-muMerTK overexpressing cells in a dose dependent manner with Kd value in the picomolar to nanomolar range.
- Anti-MerTK antibody such as MTK-06 or MTK-12 showed better binding to SK-MEL-5 compared to M6 antibody.
- Data in Tables 11, 12, and 13 above also show that anti-MerTK antibodies MTK-24, MTK-29, MTK-30, MTK-31, and MTK-33 bind to human MerTK endogenously expressed on human SK-MEL-5 cells and to murine MerTK recombinantly expressed in CHO cells.
- Example 13 Anti-MerTK antibody blocking of ligand Gas6 and ligand ProS binding to MerTK [0355] To determine the ligand blocking activity of anti-MerTK antibodies of the present disclosure, ligand blocking assays was performed to test whether a given anti-MerTK antibody blocks binding of ligand Gas6 or ligand ProS to human MerTK.
- Rabbit anti-human IgG polyclonal antibody (Jackson ImmunoResearch, Cat#309-005-008) was captured to a high-protein binding plate at 2pg/ml 4°C overnight. After washing with 0.05% Tween20 in PBS three times, 5% BSA in PBS was added for 1 hour. Recombinant human MerTK human Fc Chimera protein (R&D systems, Cat#391-MR-100) was added at 2pg/ml for 1 hour and the plates were then washed.
- Anti-MerTK antibodies were titrated to final concentration range of between 66.6nM to 4pM and then 40m1 of serially diluted antibody and 40m1 of His tag -conjugated recombinant Gas6 protein (R&D systems, Cat# 885-GSB-050) at 3pg/ml or His tag-conjugated recombinant ProS protein (R&D systems, Cat# 9489-PS-100) at 20pg/ml. After a further incubation for 1 hour, plates were washed and incubated for 1 hour with HRP-conjugated anti-6x His tag antibody (Abeam, Cat# abl 187). Plates were then washed and an HRP substrate (TMB) was used to develop the plates. After sufficient color change was observed, the reaction was stopped by adding 50m12N H2SO4 and the OD was measured using a spectrophotometer (BioTek).
- Figure 7 shows that exemplary anti-MerTK antibodies of the present disclosure (MTK-07, MTK- 16, and MTK-21) inhibited (e.g., blocked) Gas6 ligand binding to human MerTK in a dose dependent manner.
- anti-MerTK antibodies MTK-06, MTK-08, MTK-09, and MTK-15 did not block Gas6 ligand binding to human MerTK.
- Figure 8 shows that exemplary anti-MerTK antibodies of the present disclosure (MTK-03, MTK-07, MTK-09, MTK-17, MTK-18, and MTK-23) inhibited (e.g., blocked) ProS ligand binding to human MerTK in a dose dependent manner.
- IC50 values [nM] were determined using OD450 values obtained from the dose-response curves analyzed with Prism software.
- Table 14 and Table 15 show IC50 values determined for anti-MerTK antibody blocking of Gas6 ligand binding and ProS ligand binding to MerTK.
- Anti-MerTK antibody MTK-22 did not block Gas6 ligand binding or ProS ligand biding to MerTK; however, anti-MerTK antibody MTK-22 was effective at reducing efferocytosis as shown in Examples above. Dashes indicate lack of significant blocking; “n.a.” indicates data not available.
- anti-MerTK antibodies of the present disclosure were tested for their ability to block Gas6 ligand binding and/or ProS ligand binding to human MerTK.
- anti-MerTK antibodies of the present disclosure (MTK-03, MTK-07, MTK-10, MTK-12, MTK-13, MTK-16, MTK-17, MTK-18, MTK-20, MTK-21, MTK-24, MTK-25, MTK-26, MTK-27, MTK-30, MTK-31, MTK-33, MTK-35, and MTK-36) blocked the binding of both ProS ligand and Gas6 ligand to recombinant human MerTK protein (herein referred to as ProS/Gas6 double blockers); fifteen (15) anti- MerTK antibodies of the present disclosure (MTK-01, MTK-02, MTK-04, MTK-05, MTK-06, MTK-08, MTK-09, MTK-11, MTK-14, MTK-15, MTK-19
- Anti-MerTK antibody MTK-22 did not block either ProS ligand or Gas6 ligand binding to recombinant human MerTK protein as measured in this assay; however, anti-MerTK antibody MTK-22 was effective at reducing efferocytosis as shown in Examples above.
- Anti-MerTK antibody M6 and anti-MerTK antibody CDX AB2000-A7 displayed ProS ligand and Gas6 ligand blocking.
- Anti-MerTK antibody HI and anti-MerTK antibody H2 displayed ProS ligand blocking only; neither of these antibodies displayed Gas6 ligand blocking.
- anti-MerTK antibodies of the present disclosure can selectively modulate Gas6 and ProS binding to MerTK and can selectively modulate Gas6 and ProS activity.
- Example 14 Binding kinetics of anti-MerTK antibodies
- Binding kinetics of human anti-MerTK IgGl LALAPS antibodies of the present disclosure to human, cyno, and murine MerTK were evaluated using a Carterra LSA instrument (Carterra, Salt Lake City, UT). Briefly, anti-MerTK antibodies were prepared by diluting to 10pg/ml in lOmM Acetate, pH 4.25 (Carterra), at 300pl/well.
- a HC200M sensor chip (Carterra) was activated using the single channel flow cell with a 7-minute injection ofa 1:1:1 mixture of lOOmM MES pH 5.5, lOOmM sulfo-NHS, 400mM EDC (all reconstituted in MES pH 5.5; 100 pi of each mixed in vial immediately before running assay).
- the antibodies were injected over the activated chip in a 96-spot array for 15 minutes.
- the remaining unconjugated active groups on the chip were then blocked by injecting 1M Ethanolamine pH 8.5 (Carterra) for 7 minutes using the single channel flow cell.
- anti-MerTK antibodies of the present disclosure showed a range of affinities to MerTK and species binding specificity.
- affinity of anti-MerTK antibodies of the present disclosure for binding to human MerTK ranged from 1.4nm to 81nM
- affinity of anti-MerTK antibodies of the present disclosure for binding to cyno MerTK ranged from 1.6nm to 107nM
- affinity of anti-MerTK antibodies of the present disclosure for binding to murine MerTK ranged from 30nM to 186nM.
- Example 15 Cross-reactivity of anti-MerTK antibodies to human, cyno, and mouse MerTK [0366] Species cross-reactivity of anti-MerTK antibodies of the present disclosure was determined from the binding kinetic analysis data described above. The results of species binding cross-reactivity analysis are shown below in Table 17.
- Two anti-MerTK antibodies of the present disclosure showed specific binding only to human MerTK and did not show binding to cyno or mouse MerTK (antibody MTK-05 and antibody MTK-12).
- Six anti-MerTK antibodies of the present disclosure tested displayed cross-reactivity to both human and mouse MerTK (MTK-19, MTK-24, MTK-30, MTK-31, MTK-32, and MTK-33).
- Six anti-MerTK antibodies of the present disclosure tested displayed cross-reactivity to human, cyno, and mouse MerTK (MTK-19, MTK- 24, MTK-30, MTK-31, MTK-32, and MTK-33). Additionally, Example 12 above showed that anti- MerTK antibodies MTK-24 and MTK-29 also bind to human and murine MerTK.
- Example 16 Epitope binning analysis of anti-MerTK antibodies
- Epitope binning analysis was performed on the anti-MerTK antibodies of the present disclosure by performing a tandem injection approach using a Carterra LSA instrument (Carterra, Salt Lake City, UT). Briefly, hybridoma purified mouse anti-MerTK antibodies of the present disclosure, anti-MerTK antibodies HI, H2, H3, H6, and M6, and anti-his IgG were diluted to 15pg/ml in lOmM Acetate, pH 4.75 (Carterra), at 300pl/well. A second set of samples was prepared by 5-fold dilution of the antibodies to 3pg/ml in the same buffer.
- a HC200M sensor chip (Carterra) was activated using the single channel flow cell with a 7-minute injection of a 1:1:1 mixture of lOOmM MES pH 5.5, lOOmM sulfo-NHS, 400mM EDC (as described above). After switching to the multi-channel array flow cell, the 15pg/ml dilutions of antibodies were injected over the activated chip in a 96-spot array for 15 minutes. A second array was printed by injection of the 3pg/ml dilutions of the antibodies in a second 96-spot array. The remaining unconjugated active groups on the chip were then blocked by injecting 1M Ethanolamine pH 8.5 (Carterra) over the entire chip surface for 7 minutes using the single channel flow cell.
- Antibodies which were able to bind antigen captured by an immobilized antibody were designated as “sandwich” or “pairing” antibodies, and these antibodies were assigned into a different epitope bin from that of the immobilized antibody.
- a matrix of pairing and non-pairing antibodies was constructed from the binding results of these experiments, which allowed for an epitope bin landscape of the anti-MerTK antibodies to be generated.
- Treatment groups received lOmg/kg of control antibodies, 3mg/kg of anti-PDLl (clone: BM1) alone, lOmg/kg of anti-MerTK antibody DS5MMER alone, or 3mg/kg of anti-PDLl plus anti-MerTK antibody DS5MMER together. Following the initiation of antibody dosing, mice were weighed, and tumor volume was measured using a caliber twice per week. The study was terminated when tumors in the control group reached approximately 2000mm 3 .
- Figure 10A and 10B show that either anti-MerTK antibody DS5MMER treatment alone or combination treatment with anti-PDLl antibody reduced tumor growth in vivo. These results indicated that anti-MerTK antibodies are effective at reducing tumor volume and delaying tumor growth in vivo. These results further showed that anti-MerTK antibodies, when used in combination with an anti-PD-Ll antibody, displayed greater reduction of tumor volume and growth compared to either antibody alone.
- Example 18 Modulating pro-inflammatory cytokine production
- dendritic cells or macrophages were harvested by scraping cells. Macrophages or dendritic cells were plated on 96-well plates at 5xl0 4 cells/well and cultured with 10pg/mL of antibody at 37°C for overnight. The following day, supernatants were collected and a 13-plex human proinflammatory chemokine and human macrophages/microglia LEGENDplex bead array (BioLegend) was used according to the manufacturer’s protocol. All samples were run on BD FACS Canto II and analysis was performed using LEGENDplex analysis software (BioLegend).
- FIGS 11A, 11B, 11C, and 11D show changes in the level of MCP1 (CCL2), MlP-lot (CCL3), MIP-Ib (CCL4), and TNF, respectively, from human macrophages following overnight treatment with anti-MerTK antibody MTK-15, MTK-16, MTK-29, or MTK-33.
- Anti-MerTK antibodies MTK-16 and MTK-29 markedly increased the level of MCP1, MlP-lot, MIR-Ib, and TNF in human macrophages.
- the level of MCP1 significantly increased in response to anti-MerTK antibody MTK-33 compared to that observed upon treatment with control antibody.
- anti-MerTK antibodies MTK-15, MTK-16, MTK-29, and MTK-33 induce pro-inflammatory chemokine or cytokine production in human macrophages in a MerTK-dependent way.
- anti-MerTK antibodies of the present disclosure are effective at increasing pro-inflammatory cytokines and chemokines in myeloid cells, indicative that anti-MerTK antibodies of the present disclosure are effective at activating myeloid cells (e.g, macrophages).
- anti-MerTK antibodies of the present disclosure are effective at increasing Ml -like macrophage polarization and thus mediating anti-tumor immunity.
- Example 19 Effect of anti-MerTK antibody treatment in colon cancer in vivo
- anti-PDLl antibody (clone BM1) was administered intraperitoneally at 3mg/kg to all the treatment groups twice a week. Tumor volume was measured three times per week using a caliber. Mice were humanely euthanized when either tumor volume reached approximately 2000mm 3 or ulceration occurred. Two independent in vivo experiments were performed in these studies.
- FIGS 12A and Figure 12B show that treatment of mice with anti-PDLl antibody and either anti-MerTK antibody MTK-29 or MTK-33 reduced tumor growth rate (shown as tumor volume over time) compared to that observed in mice treated with either anti-PDLl antibody alone or with control antibody.
- anti-MerTK antibody MTK-29 and MTK-33 are synergistic at reducing tumor volume (reduced tumor growth rate) when administered in combination with anti-PDLl antibody compared to that observed upon treatment with anti-PDLl antibody alone.
- a separate set of in vivo experiments was also performed, using a combination of anti-PDLl antibody and anti-MerTK antibody MTK-29 or anti-MerTK antibody MTK-33.
- administration of anti-PDLl antibody lead to reduced tumor volume compared to that observed with control antibody treatment.
- Administration of a combination of anti-PDLl antibody and either anti- MerTK antibody MTK-29 or MTK-33 resulted in a greater reduction in tumor volume compared to mice administered anti-PDLl antibody alone.
- anti-MerTK antibody MTK-29 administered in combination with anti-PDLl antibody resulted in a significantly greater (p ⁇ 0.05) reduction in tumor growth rate compared to that observed in mice treated with anti-PDLl antibody alone.
- Figures 14A, 14B, 14C, and 14D show the differences in tumor growth rate (tumor volume over time) of individual mice in control, anti-PDLl antibody alone, anti-PDLl antibody in combination with anti-MerTK antibody MTK-29, and anti-PDLl antibody in combination with anti-MerTK antibody MTK-33, respectively.
- Figures 14A, 14B, 14C, and 14D are plotted using a linear scale on the y-axis.
- Figures 15A, 15B, 15C, and 15D are these same results plotted using a Log2 scale on the y-axis.
- combination treatment with anti-PDLl antibody and either anti-MerTK antibody MTK-29 or MTK-33 resulted in near complete regression of tumors in 4 out of 9 mice examined in these studies.
- Figure 16 shows a survival curve of the tumor-bearing mice from these studies.
- Median survival time of mice administered control antibody was 28 days; median survival time of mice administered anti- PDLl antibody alone was 35 days; median survival time of mice administered anti-PDLl antibody in combination with anti-MerTK antibody MTK-29 was 35 days; and median survival time of mice administered anti-PDLl antibody in combination with anti-MerTK antibody MTK-33 extends beyond the final 42-day post tumor implant time-point: 6 out of 9 mice were still alive on day 42 following this combination treatment.
- Example 20 Modulation of pro-inflammatory cytokine or chemokine production in mice
- LEGENDplex mouse proinflammatory chemokine panel (Biolegend, Catalog# 740451) and LEGENDplex mouse macrophage/microglia panel (Biolegend, Catalog# 740846) were used according to the manufacturer’s instructions as follows. Briefly, serum samples from the mice were diluted 4-fold with Assay Buffer. Standard Cocktail was serially diluted with Assay Buffer. For setting up the standard, 25 m ⁇ of Matrix B, 25m1 of standard solution, and 25m1 of Mixed Beads were added. For seting up sample wells, 25m1 of Assay Buffer, 25m1 of diluted serum samples, and 25m1 of Mixed Beads were added. Each plate was placed on a plate shaker at 500rpm for 2 hours.
- Figures 17A, 17B, 17C, 17D, and 17E show the levels of KC (CXCL1), MCP1 (CCL2), MIP-la (CCL3), MIP-Ib (CCL4), and IL-6, respectively, in mice following administration of anti-MerTK antibodies of the present disclosure.
- CXCL1 CXCL1
- MCP1 CCL2
- MIP-la CCL3
- MIP-Ib CCL4
- IL-6 IL-6
- anti-MerTK antibody MTK-24, MTK-29, MTK-30, or MTK-33 induced pro-inflammatory chemokine or cytokine production in mouse peripheral cells in a MerTK-dependent way.
- anti-MerTK antibodies of the present disclosure are effective at increasing pro- inflammatory chemokine/cytokine levels in vivo, thus providing further evidence that anti-MerTK antibodies of the present disclosure are effective at activating an anti -tumor immune response.
- Example 21 Modulation of pro-inflammatory cytokine or chemokine production in non-human primates
- Figures 18A, 18B, 18C, and 18D show the time course of changes in levels of MCP1 (CCL2), MIP-Ib (CCL4), TNF, and IFN, respectively, in plasma obtained from cynomolgus monkeys administered anti-MerTK antibody MTK-15, MTK-16, or MTK-21, or vehicle control.
- the peak levels of MCP1 occurred around 12 hours post-dose.
- Administration of anti-MerTK antibody MTK-15 resulted in an increase in the levels of MIR-Ib, TNF, and IFN up to 72 hours post-dose.
- anti-MerTK antibody MTK15, MTK-16, or MTK-21 increased pro-inflammatory chemokine or cytokine production in cynomolgus monkey peripheral cells in a MerTK-dependent way.
- anti-MerTK antibodies of the present disclosure are effective at increasing MCP1, MIP-16, TNF, and IFN (which are pro-inflammatory cytokines/chemokines) in vivo in non-human primates.
- anti-MerTK antibodies that block binding of both ProS and Gas6 to MerTK may provide a better in vivo safety profde than anti-MerTK antibodies that block binding of ProS to MerTK but that do not block binding of Gas6 to MerTK.
- anti-MerTK antibodies that bind to the Ig 1 domain of MerTK may provide a better in vivo safety profde than anti-MerTK antibodies that bind to both the Ig2 and FN 1 domains of MerTK.
- Example 22 phospho-AKT assay in human macrophages
- pAKT phospho-AKT
- HTRF Homogeneous Time Resolved Fluorescence
- Figures 19A and 19B show exemplary anti-MerTK antibodies of the present disclosure (MTK-9, MTK-12, MTK-15, MTK-16, MTK-18, MTK-20, MTK-21, MTK-22, MTK-29, and MTK-33) inhibited Gas6-mediated pAKT activity in a dose-dependent manner.
- Table 18 above shows IC50 values determined for anti-MerTK antibody blocking of Gas6-mediated pAKT activity.
- anti-MerTK antibodies of the present disclosure inhibited ligand (e.g., Gas6) mediated MerTK signaling.
- ligand e.g., Gas6
- MerTK is a member of the TAM family, whose members share a unique domain structure containing an N-terminal region (N), two Immunoglobulin-like domains (Igl and Ig2), two Fibronectin type III domains (FN1 and FN2), a juxta-membrane region (JM), and an intracellular tyrosine kinase domain.
- N N-terminal region
- Igl and Ig2 two Immunoglobulin-like domains
- FN1 and FN2 Fibronectin type III domains
- JM juxta-membrane region
- ECD extracellular domain
- Human MerTK ECD can be divided into the following domains, the amino acid sequences of which are shown below in Table 19:
- Axl protein another member of the TAM family, shares a common domain structure to that of MerTK, having the following domains and associated amino acid sequences in its ECD:
- DNA encoding the domain-swapped chimeras and deletion mutants, with a signal sequence (MGW SCIILFLVATATGVHS (SEQ ID NO:461) in MerTK constructs, and MGWSCIILFLVATATG (SEQ ID NO:462) in Axl constructs) and a linker+His+Avi tag (GGSGHHHHHHGGGLNDIFEAQKIEWHE; SEQ ID NO:463) were prepared by gene synthesis and cloned into the expression vector pcDNAtopo3.4 (GeneArt, ThermoFisher).
- Expi293 cells were transfected with 20pg of plasmids and ExpiFectamine following recommended procedures (ThermoFisher). Transfected cells were grown in 20mF cultures with shaking at 37°C and 5% CO2 for four days. Cells were pelleted by centrifugation and the supernatants were fdtered through 0.2mM fdters by vacuum.
- Table 21 shows the configurations of the various Axl/MerTK domain-swapped chimeras that were generated for use in these studies.
- an M (MerTK) or an A (Axl) indicates from which protein that particular domain was included (i.e., swapped) in the corresponding chimeric protein construct; N (N-terminal domain), Igl (immunoglobulin-like domain 1), Ig2 (immunoglobulin-like domain 2), FN1 (fibronectin type III domain 1), FN2 (fibronectin type III domain 2), and JM (juxta- membrane domain).
- Binding of anti-MerTK antibodies of the present disclosure to these domain-swapped chimera or deletion mutants was tested by Surface Plasmon Resonance (SPR) using Carterra LSA.
- Purified anti-MerTK antibodies were immobilized in duplicate on aHC30M chip (Carterra) by amine coupling, following the manufacturer’s instructions (described previously).
- Supernatants containing the constructs were diluted 1:1 with running buffer containing 0.5 mg/mL BSA (HBS-TE, Carterra) and injected over the immobilized antibodies. The surface was regenerated with lOmM Glycine pH2.0 after each construct injection.
- Sensorgrams were analyzed using Carterra Epitope software to identify patterns of construct binding.
- anti-MerTK antibodies of the present disclosure were also used in these studies: rat anti-mouse MerTK antibody DS5MMER (eBioscience, Clone ID DS5MMER, rat IgG2a), mouse anti-human MerTK antibody HI (BioLegend, Clone ID: 590H11G1E3, mouse IgGl), mouse anti-human MerTK antibody H2 (R&D systems, Clone ID: 125518, mouse IgG2b), mouse anti-human MerTK antibody H3 (R&D systems, Clone ID 125508, mouse IgG2b), mouse anti-human MerTK antibody H6 (eBioscience, Clone ID: A3KCAT, mouse IgGl), mouse anti human MerTK antibody H7 (Sino Biological, Clone ID: 09, Mouse IgG2b), human anti-human MerTK antibody M6 (disclosed in W02016/106221, huIgGl LALAPS), and human anti-human
- Anti-MerTK antibodies MTK-06, MTK-15, MTK- 29, MTK-30, CDX AB3000, HI, and H2 bound only to chimeric protein constructs that contained both the MerTK Ig2 and FN1 domains.
- Anti-MerTK antibodies H3 and H7 bound to chimeric protein constructs containing the MerTK juxta membrane region. None of the anti-MerTK antibodies tested above bound to the ECD domain of human Axl (data not shown).
- Example 24 Effect of anti-MerTK antibody treatment in transgenic mouse colon cancer model [0396] The effect of anti-MerTK antibodies on tumor growth in vivo was performed as follows using an in vivo mouse colon cancer model in which the mice were transgenic to include human MerTK. MC38 mouse cancer cells were implanted subcutaneously on the shaved right flank of huMerTK Knock-In (KI) mice (Ozgene, Perth, Australia), where human MerTK was introduced into the mouse genome.
- KI huMerTK Knock-In mice
- mice When tumor size reached approximately 80- 130mm 3 in volume, mice were treated with lOmg/kg of MTK-33 plus 3mg/kg of anti-PDLl (clone BM1), lOmg/kg of MTK-16 plus 3mg/kg of anti-PDLl, 3mg/kg of anti- PDL1 alone, or lOmg/kg of control antibody twice a week. Tumor volume was measured three times a week.
- Figure 20A shows that a combination of anti-PDLl antibody with either anti-MerTK antibody MTK-16 or anti-MerTK antibody MTK-33 moderately reduced the tumor growth rate compared to that observed in mice treated with either anti-PDLl antibody alone or with control antibody.
- Figure 20B shows the tumor growth of individual mouse in each group and the combination treatment of anti-PDLl with either MTK-16 or MTK-33 led to the complete regression of tumors from 3 or 4 out of 9 mice.
- this data show that human MerTK binding anti-MerTK antibody MTK-16 or MTK-33 in combination with anti-PDLl antibody improved efficacy in inhibiting tumor growth
- Example 25 Humanization of murine anti-MERTK mouse antibodies
- the parental mouse anti-MerTK antibody MTK-16 contains a heavy chain variable region comprising the amino acid sequence of:
- LIQLVQSGPELKKPGETVKISCKASGYTFTNHGMNWVKQDPGKGLKWMGWINTYTGEPTYADD FKGRFVFSMETSASAAFLQINNLKNEDTATYFCARKGVTAARYFDYWGQGTTLTVSS (SEQ ID NO:20), and a light chain variable region comprising the amino acid sequence of: DIVMTQSPKFMSTSVGDRVSITCKASQNVRTAVAWYKKKPGQSPKAFINFASNRHTGVPDRFTG SGSGTDFTFTISNVQSEDFADYFCFQHWNYPFTFGGGTKFEIK (SEQ ID NO:55).
- the parental mouse anti-MerTK antibody MTK-33 contains a heavy chain variable region comprising the amino acid sequence of:
- the parental mouse anti-MerTK antibody MTK-15 contains a heavy chain variable region comprising the amino acid sequence of:
- the parent mouse anti-MerTK antibody MTK-29 contains a heavy chain variable region comprising the amino acid sequence of:
- QIQLVQSGPELKKPGETVKISCKSSGFTFTTYGMSWVKQAPGKGLKWMGWINTYSGVPTYTDDF KGRFAFSLETSASTASLQINNLKNEDTATYFCARYTNYGYFDYWGQGTTLTVSS (SEQ ID NO:33), and a light chain variable region comprising the amino acid sequence of: QIVLSQSPAILSASPGEKVTMTCRATSSVGYMHWYQQKPGSSPKPWIYATSNLASGVPARFSGSG SGTSY SLTISRVEAEHAATYY CQQWGSNPFTFGSGTKLEIK (SEQ ID NO:68).
- One method of humanizing non-human antibodies is to transplant the CDRs from a non-human (e.g., murine) antibody onto a human antibody acceptor framework.
- CDR transplantation may result in attenuation or complete loss of affinity of the humanized antibody to its target due to perturbation in its framework.
- certain amino acid residues in the human framework may need to be replaced by amino acid residues from the corresponding positions of the murine antibody framework (referred to as back mutations) in order to restore attenuated or lost affinity as a result of humanization. Therefore, the amino acid residues to be replaced in the context of the selected human antibody germline acceptor framework must be determined so that the humanized antibody substantially retains functions and paratopes.
- retained or improved thermal stability and solubility are desired for good manufacturability and downstream development.
- VH and VL amino acid sequences of the mouse anti-MerTK monoclonal antibodies to be humanized were compared to human VL, VH, LJ, and HJ functional germline amino acid sequences taken from IMGT (http://www.imgt.org/). Pseudo-genes and open reading frames were excluded from these analyses.
- IMGT http://www.imgt.org/.
- Pseudo-genes and open reading frames were excluded from these analyses.
- Per one mouse monoclonal antibody (query) one or two of the most similar VH and one of the most similar VL germline amino acid sequences were selected and combined with the most similar VJ and HJ genes, producing one or two humanized amino acid sequences.
- the CDRs to be transplanted onto the human framework were defined according to the AbM definition.
- the query and the humanized amino acid sequences were used to create Lv homology models using BioMOE module or the Antibody Modeler module of MOE (Molecular Operating Environment, Chemical Computing Group, Montreal, Canada).
- AMBER10:EHT force field analysis was used for energy minimization through the entire antibody homology modeling process.
- molecular descriptors such as interaction energy between VL and VH, coordinate -based isoelctric point (3D pi), hydrophobic patch, and charged surface area were calculated, analyzed, and sorted by scoring metrics provided by MOE. These molecular descriptors were utilized to prioritize the humanized monoclonal antibodies for downstream experimental procedures, including protein expression, purification, binding affinity studies, and functional assays.
- the BioMOE module of MOE provides a tool, Mutation Site Properties, to visualize and classify potential residues for back-mutation.
- back-mutation is defined as amino acid substitution which is reverted to the original query amino acid sequence replacing the humanized amino acid sequence.
- the original query reference
- the humanized variant was compared individually to the selected humanized variants for both the primary amino acid sequence and the 3D structure of the 3D Fv homology model.
- Changes between the reference (i.e., parental) antibody and the humanized variant were classified based on amino acid type difference, interaction potential with CDR residues, impact potential for VL / VH pairing, and potential change in hydrophobic and charged surface area in and near the CDRs.
- Affinity maturation of humanized anti-MerTK antibodies MTK-33, MTK-29, and MTK-16 were also performed. Briefly, certain amino acid residues in the heavy chain or light chain were selectively mutagenized and mutants that improved binding were selected through additional rounds of screening. This process simultaneously improved specificity, species cross-reactivity, and developability profiles. Characterization of the affinity-matured anti-MerTK antibodies described herein included SPR affinity measurements on Carterra LSA and efferocytosis blocking assays on human macrophage. After multiple rounds of affinity maturation, anti-MerTK antibodies with desired affinity were obtained.
- VH variable heavy chains
- VL variable light chains
- HVR hypervariable regions
- Table 27 and Table 28 provide amino acid sequences for the heavy chain HVRs and the light chain HVRs, respectively, for anti-MerTK antibody MTK-15 variants.
- Table 29 and Table 30 provide amino acid sequences for the heavy chain HVRs and the light chian HVRs, respectively, for anti-MerTK antibody MTK-16 variants.
- Table 31 and Table 32 provide amino acid sequences for the heavy chain HVRs and the light chain HVRs, respectively, for anti-MerTK antibody MTK-29 variants.
- Table 33 and Table 34 provide amino acid sequences for the heavy chain HVRs and the light chain HVRs, respectively, for anti-MerTK antibody MTK-33 variants.
- Example 26 Blocking efferocytosis with humanized and affinity-matured anti-MerTK antibodies
- the ability of humanized and affinity-matured anti-MerTK antibodies of the present disclosure to block efferocytosis was evaluated using methods as described above in Example 11 with the following modifications. Differentiated human macrophages were treated with lOOnM Dexamethasone (Sigma- Aldrich) and 10pg/ml huM-CSF (R&D systems) for 2 days. 50,000 cells of polarized macrophages were seeded in 96-well plate. Humanized or affinity-matured anti-MerTK antibodies were titrated to a final concentration range of between 66.6nM to 4pM and then each serially diluted antibody was added to each well for 30 min at 37°C.
- affinity matured variants of anti-MerTK antibodies displayed lower IC50 values for blocking efferocytosis (e.g., MTK-15.1, MTK-15.4, MTK-15.5, MTK-15.6, MTK-15.7, MTK-15.8, MTK-15.10, MTK-15.13, MTK-15.15, MTK-16.1, and MTK-33.15)
- Affinity-matured variants of MTK- 15 showed a range of IC50 values of 0.228 nM to 2.4 nM
- affinity-matured variants of MTK-16 showed a range of IC50 values of 0.36 nM to 1.01 nM
- affinity -matured variants of MTK-29 showed a range of IC50 values of 0.5 nM to 1.12 nM
- affinity-matured variants of MTK-33 showed a range of IC50 values of 0.41 nM to 23.9 nM.
- Example 27 Binding kinetics of humanized and affinity-matured anti-MerTK antibodies [0415] Binding kinetics of humanized and affinity-matured anti-MerTK antibodies of the present disclosure to human, murine, and cynomolgus MerTK proteins were evaluated as follows. Briefly, anti- MerTK antibodies were prepared by diluting to 10pg/ml in lOmM Acetate, pH 4.25 (Carterra, Salt Lake City, Utah), at 300pl/well.
- a HC200M sensor chip (Carterra) was activated using the single channel flow cell with a 7-minute injection of a 1:1:1 mixture of lOOmM MES pH 5.5, lOOmM sulfo-NHS, 400mM EDC (all reconstituted in MES pH 5.5; 100 pi of each mixed in vial immediately before running assay).
- the antibodies were injected over the activated chip in a 96-spot array for 15 minutes.
- the remaining unconjugated active groups on the chip were then blocked by injecting 1M Ethanolamine pH 8.5 (Carterra) for 7 minutes using the single channel flow cell.
- affinity of anti-MerTK antibodies of the present disclosure for binding to human MerTK ranged from 0.1 nM to 86 nM
- affinity of anti-MerTK antibodies of the present disclosure for binding to cyno MerTK ranged from 0.3 nM to 1450 nM
- affinity of anti-MerTK antibodies of the present disclosure for binding to murine MerTK ranged from 44 nM to 2800 nM.
- MTK-33.10 light chain amino acid sequence is set forth below:
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Immunology (AREA)
- Life Sciences & Earth Sciences (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Biochemistry (AREA)
- Molecular Biology (AREA)
- Genetics & Genomics (AREA)
- Biophysics (AREA)
- Veterinary Medicine (AREA)
- General Chemical & Material Sciences (AREA)
- Pharmacology & Pharmacy (AREA)
- Public Health (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Animal Behavior & Ethology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Pain & Pain Management (AREA)
- Rheumatology (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Peptides Or Proteins (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
Priority Applications (13)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| AU2020401319A AU2020401319A1 (en) | 2019-12-13 | 2020-12-11 | Anti-MerTK antibodies and methods of use thereof |
| BR112022011570A BR112022011570A2 (pt) | 2019-12-13 | 2020-12-11 | Anticorpos anti-mertk e métodos de uso dos mesmos |
| PH1/2022/551398A PH12022551398A1 (en) | 2019-12-13 | 2020-12-11 | Anti-mertk antibodies and methods of use thereof |
| PE2022001063A PE20221326A1 (es) | 2019-12-13 | 2020-12-11 | Anticuerpos anti-mertk y metodos de uso de los mismos |
| CR20220329A CR20220329A (es) | 2019-12-13 | 2020-12-11 | Anticuerpos anti–mertk y metodos de uso de los mismos |
| JP2022535544A JP2023506465A (ja) | 2019-12-13 | 2020-12-11 | 抗MerTK抗体及びその使用方法 |
| CN202080095766.6A CN115151307A (zh) | 2019-12-13 | 2020-12-11 | 抗mertk抗体和其使用方法 |
| EP20842361.6A EP4072680A1 (en) | 2019-12-13 | 2020-12-11 | Anti-mertk antibodies and methods of use thereof |
| CA3160210A CA3160210A1 (en) | 2019-12-13 | 2020-12-11 | Anti-mertk antibodies and methods of use thereof |
| IL293827A IL293827A (en) | 2019-12-13 | 2020-12-11 | Anti-mertk antibodies and methods of use thereof |
| MX2022007231A MX2022007231A (es) | 2019-12-13 | 2020-12-11 | Anticuerpos anti-mertk y metodos de uso de los mismos. |
| KR1020227023798A KR20220127252A (ko) | 2019-12-13 | 2020-12-11 | 항-mertk 항체 및 이의 사용 방법 |
| CONC2022/0008314A CO2022008314A2 (es) | 2019-12-13 | 2022-06-14 | Anticuerpos anti–mertk y métodos de uso de los mismos |
Applications Claiming Priority (6)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201962947855P | 2019-12-13 | 2019-12-13 | |
| US62/947,855 | 2019-12-13 | ||
| US202063016821P | 2020-04-28 | 2020-04-28 | |
| US63/016,821 | 2020-04-28 | ||
| US202063121773P | 2020-12-04 | 2020-12-04 | |
| US63/121,773 | 2020-12-04 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2021119508A1 true WO2021119508A1 (en) | 2021-06-17 |
Family
ID=74186824
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2020/064640 Ceased WO2021119508A1 (en) | 2019-12-13 | 2020-12-11 | Anti-mertk antibodies and methods of use thereof |
Country Status (18)
| Country | Link |
|---|---|
| US (2) | US11897968B2 (https=) |
| EP (1) | EP4072680A1 (https=) |
| JP (1) | JP2023506465A (https=) |
| KR (1) | KR20220127252A (https=) |
| CN (1) | CN115151307A (https=) |
| AU (1) | AU2020401319A1 (https=) |
| BR (1) | BR112022011570A2 (https=) |
| CA (1) | CA3160210A1 (https=) |
| CL (1) | CL2022001554A1 (https=) |
| CO (1) | CO2022008314A2 (https=) |
| CR (1) | CR20220329A (https=) |
| EC (1) | ECSP22055004A (https=) |
| IL (1) | IL293827A (https=) |
| MX (1) | MX2022007231A (https=) |
| PE (1) | PE20221326A1 (https=) |
| PH (1) | PH12022551398A1 (https=) |
| TW (1) | TW202136303A (https=) |
| WO (1) | WO2021119508A1 (https=) |
Cited By (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2022266221A1 (en) | 2021-06-16 | 2022-12-22 | Alector Llc | Monovalent anti-mertk antibodies and methods of use thereof |
| WO2022266223A1 (en) | 2021-06-16 | 2022-12-22 | Alector Llc | Bispecific anti-mertk and anti-pdl1 antibodies and methods of use thereof |
| WO2022241212A3 (en) * | 2021-05-14 | 2023-04-06 | Inspirna, Inc. | Mertk peptides and uses thereof |
| WO2023063026A1 (ja) * | 2021-10-15 | 2023-04-20 | 株式会社カイオム・バイオサイエンス | MerTKに特異的に結合する抗体又はその断片、及び抗腫瘍剤 |
| US11897968B2 (en) | 2019-12-13 | 2024-02-13 | Alector Llc | Anti-MerTK antibodies and methods of use thereof |
| US12281174B2 (en) | 2019-02-26 | 2025-04-22 | Inspirna, Inc. | High-affinity anti-MERTK antibodies and uses thereof |
Families Citing this family (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN119654342B (zh) * | 2022-07-28 | 2025-07-18 | 乐普创一生物科技(上海)有限公司 | 抗MerTK抗体及其用途 |
Citations (65)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4179337A (en) | 1973-07-20 | 1979-12-18 | Davis Frank F | Non-immunogenic polypeptides |
| US4301144A (en) | 1979-07-11 | 1981-11-17 | Ajinomoto Company, Incorporated | Blood substitute containing modified hemoglobin |
| US4496689A (en) | 1983-12-27 | 1985-01-29 | Miles Laboratories, Inc. | Covalently attached complex of alpha-1-proteinase inhibitor with a water soluble polymer |
| US4640835A (en) | 1981-10-30 | 1987-02-03 | Nippon Chemiphar Company, Ltd. | Plasminogen activator derivatives |
| US4670417A (en) | 1985-06-19 | 1987-06-02 | Ajinomoto Co., Inc. | Hemoglobin combined with a poly(alkylene oxide) |
| US4791192A (en) | 1986-06-26 | 1988-12-13 | Takeda Chemical Industries, Ltd. | Chemically modified protein with polyethyleneglycol |
| US4816567A (en) | 1983-04-08 | 1989-03-28 | Genentech, Inc. | Recombinant immunoglobin preparations |
| EP0404097A2 (de) | 1989-06-22 | 1990-12-27 | BEHRINGWERKE Aktiengesellschaft | Bispezifische und oligospezifische, mono- und oligovalente Rezeptoren, ihre Herstellung und Verwendung |
| WO1993001161A1 (en) | 1991-07-11 | 1993-01-21 | Pfizer Limited | Process for preparing sertraline intermediates |
| EP0546073A1 (en) | 1990-08-29 | 1993-06-16 | Genpharm Int | NON-HUMAN TRANSGENIC ANIMALS CAPABLE OF PRODUCING HETEROLOGOUS ANTIBODIES. |
| WO1993016185A2 (en) | 1992-02-06 | 1993-08-19 | Creative Biomolecules, Inc. | Biosynthetic binding protein for cancer marker |
| US5530101A (en) | 1988-12-28 | 1996-06-25 | Protein Design Labs, Inc. | Humanized immunoglobulins |
| US5545807A (en) | 1988-10-12 | 1996-08-13 | The Babraham Institute | Production of antibodies from transgenic animals |
| US5571894A (en) | 1991-02-05 | 1996-11-05 | Ciba-Geigy Corporation | Recombinant antibodies specific for a growth factor receptor |
| US5587458A (en) | 1991-10-07 | 1996-12-24 | Aronex Pharmaceuticals, Inc. | Anti-erbB-2 antibodies, combinations thereof, and therapeutic and diagnostic uses thereof |
| WO1997011971A1 (en) | 1995-09-28 | 1997-04-03 | Alexion Pharmaceuticals, Inc. | Porcine cell interaction proteins |
| US5641870A (en) | 1995-04-20 | 1997-06-24 | Genentech, Inc. | Low pH hydrophobic interaction chromatography for antibody purification |
| US5648237A (en) | 1991-09-19 | 1997-07-15 | Genentech, Inc. | Expression of functional antibody fragments |
| US5739277A (en) | 1995-04-14 | 1998-04-14 | Genentech Inc. | Altered polypeptides with increased half-life |
| US5750373A (en) | 1990-12-03 | 1998-05-12 | Genentech, Inc. | Enrichment method for variant proteins having altered binding properties, M13 phagemids, and growth hormone variants |
| US5766886A (en) | 1991-12-13 | 1998-06-16 | Xoma Corporation | Modified antibody variable domains |
| US5770429A (en) | 1990-08-29 | 1998-06-23 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US5789199A (en) | 1994-11-03 | 1998-08-04 | Genentech, Inc. | Process for bacterial production of polypeptides |
| US5821337A (en) | 1991-06-14 | 1998-10-13 | Genentech, Inc. | Immunoglobulin variants |
| US5840523A (en) | 1995-03-01 | 1998-11-24 | Genetech, Inc. | Methods and compositions for secretion of heterologous polypeptides |
| US5869046A (en) | 1995-04-14 | 1999-02-09 | Genentech, Inc. | Altered polypeptides with increased half-life |
| US5869619A (en) | 1991-12-13 | 1999-02-09 | Xoma Corporation | Modified antibody variable domains |
| US5959177A (en) | 1989-10-27 | 1999-09-28 | The Scripps Research Institute | Transgenic plants expressing assembled secretory antibodies |
| WO1999058572A1 (en) | 1998-05-08 | 1999-11-18 | Cambridge University Technical Services Limited | Binding molecules derived from immunoglobulins which do not trigger complement mediated lysis |
| US6040498A (en) | 1998-08-11 | 2000-03-21 | North Caroline State University | Genetically engineered duckweed |
| US6075181A (en) | 1990-01-12 | 2000-06-13 | Abgenix, Inc. | Human antibodies derived from immunized xenomice |
| US6133426A (en) | 1997-02-21 | 2000-10-17 | Genentech, Inc. | Humanized anti-IL-8 monoclonal antibodies |
| US6150584A (en) | 1990-01-12 | 2000-11-21 | Abgenix, Inc. | Human antibodies derived from immunized xenomice |
| US6248516B1 (en) | 1988-11-11 | 2001-06-19 | Medical Research Council | Single domain ligands, receptors comprising said ligands methods for their production, and use of said ligands and receptors |
| US6420548B1 (en) | 1999-10-04 | 2002-07-16 | Medicago Inc. | Method for regulating transcription of foreign genes |
| US20020164328A1 (en) | 2000-10-06 | 2002-11-07 | Toyohide Shinkawa | Process for purifying antibody |
| US20030115614A1 (en) | 2000-10-06 | 2003-06-19 | Yutaka Kanda | Antibody composition-producing cell |
| US20030157108A1 (en) | 2001-10-25 | 2003-08-21 | Genentech, Inc. | Glycoprotein compositions |
| US20040093621A1 (en) | 2001-12-25 | 2004-05-13 | Kyowa Hakko Kogyo Co., Ltd | Antibody composition which specifically binds to CD20 |
| US20040109865A1 (en) | 2002-04-09 | 2004-06-10 | Kyowa Hakko Kogyo Co., Ltd. | Antibody composition-containing medicament |
| US20040110282A1 (en) | 2002-04-09 | 2004-06-10 | Kyowa Hakko Kogyo Co., Ltd. | Cells in which activity of the protein involved in transportation of GDP-fucose is reduced or lost |
| US20040110704A1 (en) | 2002-04-09 | 2004-06-10 | Kyowa Hakko Kogyo Co., Ltd. | Cells of which genome is modified |
| US20040132140A1 (en) | 2002-04-09 | 2004-07-08 | Kyowa Hakko Kogyo Co., Ltd. | Production process for antibody composition |
| US6982321B2 (en) | 1986-03-27 | 2006-01-03 | Medical Research Council | Altered antibodies |
| US7041870B2 (en) | 2000-11-30 | 2006-05-09 | Medarex, Inc. | Transgenic transchromosomal rodents for making human antibodies |
| WO2006058202A2 (en) | 2004-11-24 | 2006-06-01 | The Regents Of The University Of Colorado | Mer diagnostic and therapeutic agents |
| US7087409B2 (en) | 1997-12-05 | 2006-08-08 | The Scripps Research Institute | Humanization of murine antibody |
| US7125978B1 (en) | 1999-10-04 | 2006-10-24 | Medicago Inc. | Promoter for regulating expression of foreign genes |
| US7189826B2 (en) | 1997-11-24 | 2007-03-13 | Institute For Human Genetics And Biochemistry | Monoclonal human natural antibodies |
| US20070061900A1 (en) | 2000-10-31 | 2007-03-15 | Murphy Andrew J | Methods of modifying eukaryotic cells |
| US20070148167A1 (en) | 2005-02-14 | 2007-06-28 | Strohl William R | Non-immunostimulatory antibody and compositions containing the same |
| WO2007106585A1 (en) | 2006-03-15 | 2007-09-20 | Alexion Pharmaceuticals, Inc. | Treatment of paroxysmal nocturnal hemoglobinuria patients by an inhibitor of complement |
| US20070292936A1 (en) | 2006-05-09 | 2007-12-20 | Genentech, Inc. | Binding polypeptides with optimized scaffolds |
| WO2008079246A2 (en) | 2006-12-21 | 2008-07-03 | Medarex, Inc. | Cd44 antibodies |
| US20090002360A1 (en) | 2007-05-25 | 2009-01-01 | Innolux Display Corp. | Liquid crystal display device and method for driving same |
| US7527791B2 (en) | 2004-03-31 | 2009-05-05 | Genentech, Inc. | Humanized anti-TGF-beta antibodies |
| WO2009062112A2 (en) | 2007-11-09 | 2009-05-14 | The Salk Institute For Biological Studies | Use of tam receptor inhibitors as antimicrobials |
| WO2016001830A1 (en) | 2014-07-01 | 2016-01-07 | Friedrich Miescher Institute For Biomedical Research | Combination of a brafv600e inhibitor and mertk inhibitor to treat melanoma |
| WO2016106221A1 (en) | 2014-12-22 | 2016-06-30 | The Rockefeller University | Anti-mertk agonistic antibodies and uses thereof |
| WO2019005756A1 (en) | 2017-06-28 | 2019-01-03 | The Rockefeller University | CONJUGATES AGONIST ANTIBODY ANTI-MERTK-MEDICINE |
| WO2019084307A1 (en) | 2017-10-26 | 2019-05-02 | Celldex Therapeutics, Inc. | ANTI-MERTK ANTIBODIES AND METHODS OF USE |
| WO2020076799A1 (en) | 2018-10-09 | 2020-04-16 | Bristol-Myers Squibb Company | Anti-mertk antibodies for treating cancer |
| WO2020106461A2 (en) | 2018-11-08 | 2020-05-28 | Celldex Therapeutics, Inc. | Anti-mertk antibodies and methods of use thereof |
| WO2020176497A1 (en) | 2019-02-26 | 2020-09-03 | Rgenix, Inc. | High-affinity anti-mertk antibodies and uses thereof |
| WO2020214995A1 (en) | 2019-04-19 | 2020-10-22 | Genentech, Inc. | Anti-mertk antibodies and their methods of use |
Family Cites Families (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP1790664A1 (en) * | 2005-11-24 | 2007-05-30 | Ganymed Pharmaceuticals AG | Monoclonal antibodies against claudin-18 for treatment of cancer |
| CN107312098B (zh) * | 2017-07-18 | 2020-06-12 | 深圳市免疫基因治疗研究院 | 一种基于cd22的嵌合抗原受体及其应用 |
| MX2022007231A (es) | 2019-12-13 | 2022-07-12 | Alector Llc | Anticuerpos anti-mertk y metodos de uso de los mismos. |
| CN116075525A (zh) | 2020-03-31 | 2023-05-05 | 艾莱克特有限责任公司 | 抗mertk抗体及其使用方法 |
| WO2022266221A1 (en) | 2021-06-16 | 2022-12-22 | Alector Llc | Monovalent anti-mertk antibodies and methods of use thereof |
| EP4355786A1 (en) | 2021-06-16 | 2024-04-24 | Alector LLC | Bispecific anti-mertk and anti-pdl1 antibodies and methods of use thereof |
-
2020
- 2020-12-11 MX MX2022007231A patent/MX2022007231A/es unknown
- 2020-12-11 PH PH1/2022/551398A patent/PH12022551398A1/en unknown
- 2020-12-11 IL IL293827A patent/IL293827A/en unknown
- 2020-12-11 PE PE2022001063A patent/PE20221326A1/es unknown
- 2020-12-11 BR BR112022011570A patent/BR112022011570A2/pt not_active Application Discontinuation
- 2020-12-11 KR KR1020227023798A patent/KR20220127252A/ko not_active Withdrawn
- 2020-12-11 US US17/118,921 patent/US11897968B2/en active Active
- 2020-12-11 EP EP20842361.6A patent/EP4072680A1/en active Pending
- 2020-12-11 AU AU2020401319A patent/AU2020401319A1/en not_active Abandoned
- 2020-12-11 CN CN202080095766.6A patent/CN115151307A/zh active Pending
- 2020-12-11 CR CR20220329A patent/CR20220329A/es unknown
- 2020-12-11 JP JP2022535544A patent/JP2023506465A/ja not_active Withdrawn
- 2020-12-11 TW TW109143983A patent/TW202136303A/zh unknown
- 2020-12-11 WO PCT/US2020/064640 patent/WO2021119508A1/en not_active Ceased
- 2020-12-11 CA CA3160210A patent/CA3160210A1/en active Pending
-
2022
- 2022-06-10 CL CL2022001554A patent/CL2022001554A1/es unknown
- 2022-06-14 CO CONC2022/0008314A patent/CO2022008314A2/es unknown
- 2022-07-13 EC ECSENADI202255004A patent/ECSP22055004A/es unknown
-
2023
- 2023-12-21 US US18/392,569 patent/US20240287204A1/en active Pending
Patent Citations (69)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4179337A (en) | 1973-07-20 | 1979-12-18 | Davis Frank F | Non-immunogenic polypeptides |
| US4301144A (en) | 1979-07-11 | 1981-11-17 | Ajinomoto Company, Incorporated | Blood substitute containing modified hemoglobin |
| US4640835A (en) | 1981-10-30 | 1987-02-03 | Nippon Chemiphar Company, Ltd. | Plasminogen activator derivatives |
| US4816567A (en) | 1983-04-08 | 1989-03-28 | Genentech, Inc. | Recombinant immunoglobin preparations |
| US4496689A (en) | 1983-12-27 | 1985-01-29 | Miles Laboratories, Inc. | Covalently attached complex of alpha-1-proteinase inhibitor with a water soluble polymer |
| US4670417A (en) | 1985-06-19 | 1987-06-02 | Ajinomoto Co., Inc. | Hemoglobin combined with a poly(alkylene oxide) |
| US6982321B2 (en) | 1986-03-27 | 2006-01-03 | Medical Research Council | Altered antibodies |
| US4791192A (en) | 1986-06-26 | 1988-12-13 | Takeda Chemical Industries, Ltd. | Chemically modified protein with polyethyleneglycol |
| US5545807A (en) | 1988-10-12 | 1996-08-13 | The Babraham Institute | Production of antibodies from transgenic animals |
| US6248516B1 (en) | 1988-11-11 | 2001-06-19 | Medical Research Council | Single domain ligands, receptors comprising said ligands methods for their production, and use of said ligands and receptors |
| US5530101A (en) | 1988-12-28 | 1996-06-25 | Protein Design Labs, Inc. | Humanized immunoglobulins |
| US5693762A (en) | 1988-12-28 | 1997-12-02 | Protein Design Labs, Inc. | Humanized immunoglobulins |
| US5585089A (en) | 1988-12-28 | 1996-12-17 | Protein Design Labs, Inc. | Humanized immunoglobulins |
| US5693761A (en) | 1988-12-28 | 1997-12-02 | Protein Design Labs, Inc. | Polynucleotides encoding improved humanized immunoglobulins |
| EP0404097A2 (de) | 1989-06-22 | 1990-12-27 | BEHRINGWERKE Aktiengesellschaft | Bispezifische und oligospezifische, mono- und oligovalente Rezeptoren, ihre Herstellung und Verwendung |
| US6417429B1 (en) | 1989-10-27 | 2002-07-09 | The Scripps Research Institute | Transgenic plants expressing assembled secretory antibodies |
| US5959177A (en) | 1989-10-27 | 1999-09-28 | The Scripps Research Institute | Transgenic plants expressing assembled secretory antibodies |
| US6150584A (en) | 1990-01-12 | 2000-11-21 | Abgenix, Inc. | Human antibodies derived from immunized xenomice |
| US6075181A (en) | 1990-01-12 | 2000-06-13 | Abgenix, Inc. | Human antibodies derived from immunized xenomice |
| US5770429A (en) | 1990-08-29 | 1998-06-23 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| EP0546073A1 (en) | 1990-08-29 | 1993-06-16 | Genpharm Int | NON-HUMAN TRANSGENIC ANIMALS CAPABLE OF PRODUCING HETEROLOGOUS ANTIBODIES. |
| US5750373A (en) | 1990-12-03 | 1998-05-12 | Genentech, Inc. | Enrichment method for variant proteins having altered binding properties, M13 phagemids, and growth hormone variants |
| US5571894A (en) | 1991-02-05 | 1996-11-05 | Ciba-Geigy Corporation | Recombinant antibodies specific for a growth factor receptor |
| US5821337A (en) | 1991-06-14 | 1998-10-13 | Genentech, Inc. | Immunoglobulin variants |
| WO1993001161A1 (en) | 1991-07-11 | 1993-01-21 | Pfizer Limited | Process for preparing sertraline intermediates |
| US5648237A (en) | 1991-09-19 | 1997-07-15 | Genentech, Inc. | Expression of functional antibody fragments |
| US5587458A (en) | 1991-10-07 | 1996-12-24 | Aronex Pharmaceuticals, Inc. | Anti-erbB-2 antibodies, combinations thereof, and therapeutic and diagnostic uses thereof |
| US5766886A (en) | 1991-12-13 | 1998-06-16 | Xoma Corporation | Modified antibody variable domains |
| US5869619A (en) | 1991-12-13 | 1999-02-09 | Xoma Corporation | Modified antibody variable domains |
| WO1993016185A2 (en) | 1992-02-06 | 1993-08-19 | Creative Biomolecules, Inc. | Biosynthetic binding protein for cancer marker |
| US5789199A (en) | 1994-11-03 | 1998-08-04 | Genentech, Inc. | Process for bacterial production of polypeptides |
| US5840523A (en) | 1995-03-01 | 1998-11-24 | Genetech, Inc. | Methods and compositions for secretion of heterologous polypeptides |
| US5869046A (en) | 1995-04-14 | 1999-02-09 | Genentech, Inc. | Altered polypeptides with increased half-life |
| US5739277A (en) | 1995-04-14 | 1998-04-14 | Genentech Inc. | Altered polypeptides with increased half-life |
| US5641870A (en) | 1995-04-20 | 1997-06-24 | Genentech, Inc. | Low pH hydrophobic interaction chromatography for antibody purification |
| WO1997011971A1 (en) | 1995-09-28 | 1997-04-03 | Alexion Pharmaceuticals, Inc. | Porcine cell interaction proteins |
| US6133426A (en) | 1997-02-21 | 2000-10-17 | Genentech, Inc. | Humanized anti-IL-8 monoclonal antibodies |
| US7189826B2 (en) | 1997-11-24 | 2007-03-13 | Institute For Human Genetics And Biochemistry | Monoclonal human natural antibodies |
| US7087409B2 (en) | 1997-12-05 | 2006-08-08 | The Scripps Research Institute | Humanization of murine antibody |
| WO1999058572A1 (en) | 1998-05-08 | 1999-11-18 | Cambridge University Technical Services Limited | Binding molecules derived from immunoglobulins which do not trigger complement mediated lysis |
| US6040498A (en) | 1998-08-11 | 2000-03-21 | North Caroline State University | Genetically engineered duckweed |
| US6420548B1 (en) | 1999-10-04 | 2002-07-16 | Medicago Inc. | Method for regulating transcription of foreign genes |
| US7125978B1 (en) | 1999-10-04 | 2006-10-24 | Medicago Inc. | Promoter for regulating expression of foreign genes |
| US20020164328A1 (en) | 2000-10-06 | 2002-11-07 | Toyohide Shinkawa | Process for purifying antibody |
| US20030115614A1 (en) | 2000-10-06 | 2003-06-19 | Yutaka Kanda | Antibody composition-producing cell |
| US20070061900A1 (en) | 2000-10-31 | 2007-03-15 | Murphy Andrew J | Methods of modifying eukaryotic cells |
| US7041870B2 (en) | 2000-11-30 | 2006-05-09 | Medarex, Inc. | Transgenic transchromosomal rodents for making human antibodies |
| US20030157108A1 (en) | 2001-10-25 | 2003-08-21 | Genentech, Inc. | Glycoprotein compositions |
| US20040093621A1 (en) | 2001-12-25 | 2004-05-13 | Kyowa Hakko Kogyo Co., Ltd | Antibody composition which specifically binds to CD20 |
| US20040109865A1 (en) | 2002-04-09 | 2004-06-10 | Kyowa Hakko Kogyo Co., Ltd. | Antibody composition-containing medicament |
| US20040132140A1 (en) | 2002-04-09 | 2004-07-08 | Kyowa Hakko Kogyo Co., Ltd. | Production process for antibody composition |
| US20040110704A1 (en) | 2002-04-09 | 2004-06-10 | Kyowa Hakko Kogyo Co., Ltd. | Cells of which genome is modified |
| US20040110282A1 (en) | 2002-04-09 | 2004-06-10 | Kyowa Hakko Kogyo Co., Ltd. | Cells in which activity of the protein involved in transportation of GDP-fucose is reduced or lost |
| US7527791B2 (en) | 2004-03-31 | 2009-05-05 | Genentech, Inc. | Humanized anti-TGF-beta antibodies |
| WO2006058202A2 (en) | 2004-11-24 | 2006-06-01 | The Regents Of The University Of Colorado | Mer diagnostic and therapeutic agents |
| US20070148167A1 (en) | 2005-02-14 | 2007-06-28 | Strohl William R | Non-immunostimulatory antibody and compositions containing the same |
| WO2007106585A1 (en) | 2006-03-15 | 2007-09-20 | Alexion Pharmaceuticals, Inc. | Treatment of paroxysmal nocturnal hemoglobinuria patients by an inhibitor of complement |
| US20070292936A1 (en) | 2006-05-09 | 2007-12-20 | Genentech, Inc. | Binding polypeptides with optimized scaffolds |
| WO2008079246A2 (en) | 2006-12-21 | 2008-07-03 | Medarex, Inc. | Cd44 antibodies |
| US20090002360A1 (en) | 2007-05-25 | 2009-01-01 | Innolux Display Corp. | Liquid crystal display device and method for driving same |
| WO2009062112A2 (en) | 2007-11-09 | 2009-05-14 | The Salk Institute For Biological Studies | Use of tam receptor inhibitors as antimicrobials |
| WO2016001830A1 (en) | 2014-07-01 | 2016-01-07 | Friedrich Miescher Institute For Biomedical Research | Combination of a brafv600e inhibitor and mertk inhibitor to treat melanoma |
| WO2016106221A1 (en) | 2014-12-22 | 2016-06-30 | The Rockefeller University | Anti-mertk agonistic antibodies and uses thereof |
| WO2019005756A1 (en) | 2017-06-28 | 2019-01-03 | The Rockefeller University | CONJUGATES AGONIST ANTIBODY ANTI-MERTK-MEDICINE |
| WO2019084307A1 (en) | 2017-10-26 | 2019-05-02 | Celldex Therapeutics, Inc. | ANTI-MERTK ANTIBODIES AND METHODS OF USE |
| WO2020076799A1 (en) | 2018-10-09 | 2020-04-16 | Bristol-Myers Squibb Company | Anti-mertk antibodies for treating cancer |
| WO2020106461A2 (en) | 2018-11-08 | 2020-05-28 | Celldex Therapeutics, Inc. | Anti-mertk antibodies and methods of use thereof |
| WO2020176497A1 (en) | 2019-02-26 | 2020-09-03 | Rgenix, Inc. | High-affinity anti-mertk antibodies and uses thereof |
| WO2020214995A1 (en) | 2019-04-19 | 2020-10-22 | Genentech, Inc. | Anti-mertk antibodies and their methods of use |
Non-Patent Citations (112)
| Title |
|---|
| ALEGRE ET AL., TRANSPLANTATION, vol. 57, 1994, pages 1537 - 1543 |
| AL-KHERSAN ET AL., GRAEFES ARCH CLIM EXP OPHTHALMOL, vol. 255, 2017, pages 1613 - 1619 |
| ALMAGROFRANSSON, FRONT. BIOSCI., vol. 13, 2008, pages 1619 - 1633 |
| ALVARADO D ET AL: "Monoclonal antibodies targeting the MerTK receptor de-repress the innate immune response", JOURNAL FOR IMMUNOTHERAPY OF CANCER 20181101 BIOMED CENTRAL LTD. NLD, vol. 6, no. Supplement 1, 1 November 2018 (2018-11-01), ISSN: 2051-1426 * |
| ANGAL ET AL., MOL IMMUNOL, vol. 30, 1993, pages 105 - 108 |
| ANGELILLO-SCHERRER ET AL., J CLIN INVEST, vol. 118, 2008, pages 583 - 596 |
| ARMOUR ET AL., EUR J IMMUNOL, vol. 29, 1999, pages 2613 - 2624 |
| ARMOUR ET AL., MOLECULAR IMMUNOLOGY, vol. 40, 2003, pages 585 - 593 |
| ARMOUR ET AL., THE HAEMATOLOGY JOURNAL, vol. 1, 2000, pages 27 |
| ARMOUR, IMMUNOLOGY, vol. 40, 2003, pages 585 - 593 |
| BACA ET AL., J. BIOL. CHEM., vol. 272, 1997, pages 10678 - 10684 |
| BOERNER ET AL., J. IMMUNOL., vol. 147, 1991, pages 86 |
| BOLT S ET AL., EUR J LMMUNOL, vol. 23, 1993, pages 403 - 411 |
| BONDANZA ET AL., J EXP MED, vol. 200, 2004, pages 1157 |
| BRANDAO ET AL., BLOOD CANCER, vol. 3, 2013, pages e101 |
| CARTER ET AL., PROC. NATL. ACAD. SCI. USA, vol. 89, 1992, pages 4285 |
| CHEN ET AL., J. MOL. BIOL., vol. 293, 1999, pages 865 - 881 |
| CHEUNG ET AL., VIROLOGY, vol. 176, 1990, pages 546 - 552 |
| CHOTHIALESK, J. MOL. BIOL., vol. 196, 1987, pages 901 - 917 |
| CHU ET AL., MOL IMMUNOL, vol. 45, 2008, pages 3926 - 3933 |
| CLAIRE E. J. WATERBORG ET AL: "Protective Role of the MER Tyrosine Kinase via Efferocytosis in Rheumatoid Arthritis Models", FRONTIERS IN IMMUNOLOGY, vol. 9, 13 April 2018 (2018-04-13), CH, XP055468915, ISSN: 1664-3224, DOI: 10.3389/fimmu.2018.00742 * |
| COLE ET AL., TRANSPLANTATION, vol. 68, 1999, pages 563 - 571 |
| CUMMINGS ET AL., CLIN CANCER RES, vol. 19, 2013, pages 5275 - 5280 |
| CUMMINGS ET AL., ONCOTARGET, vol. 5, 2014, pages 10434 - 10445 |
| DATABASE EMBASE [online] ELSEVIER SCIENCE PUBLISHERS, AMSTERDAM, NL; 1 July 2019 (2019-07-01), TAKEDA S ET AL: "Characterization of the anti-cancer and immunologic activity of RGX-019, a novel pre-clinical stage humanized monoclonal antibody targeting the MERTK receptor", XP002802779, Database accession no. EMB-628710551 * |
| DATABASE EMBASE [online] ELSEVIER SCIENCE PUBLISHERS, AMSTERDAM, NL; 1 July 2019 (2019-07-01), WHITE K F ET AL: "MERTK-specific antibodies that have therapeutic antitumor activity in mice disrupt the integrity of the retinal pigmented epithelium in cynomolgus monkeys", XP002802778, Database accession no. EMB-628913013 * |
| DATABASE EMBASE [online] ELSEVIER SCIENCE PUBLISHERS, AMSTERDAM, NL; 1 November 2018 (2018-11-01), ALVARADO D ET AL: "Monoclonal antibodies targeting the MerTK receptor de-repress the innate immune response", XP002802777, Database accession no. EMB-627523980 * |
| DAYOUBBREKKEN, CELL COMMUNICATIONS AND SIGNALING, vol. 18, 2020, pages 29 |
| DUCRY ET AL., BIOCONJUGATE CHEMISTRY, vol. 21, no. 1, 2010, pages 5 - 13 |
| ELLIOTT ET AL., J IMMUNOL, vol. 198, 2017, pages 1387 - 1394 |
| EVANS ET AL., J. MED. CHEM., vol. 30, 1987, pages 1229 |
| FAUCHERE, J. ADV. DRUG RES., vol. 15, 1986, pages 29 |
| FELLOUSE, PROC. NATL. ACAD. SCI. USA, vol. 101, no. 34, 2004, pages 12467 - 12472 |
| GERNGROSS, NAT. BIOTECH., vol. 22, 2004, pages 1409 - 1414 |
| GINISTY AURÉLIE ET AL: "Evidence for a Subventricular Zone Neural Stem Cell Phagocytic Activity Stimulated by the Vitamin K-Dependent Factor Protein S : Phagocytic Activity of Neural Stem Cells", STEM CELLS, vol. 33, no. 2, 22 January 2015 (2015-01-22), pages 515 - 525, XP055798175, ISSN: 1066-5099, Retrieved from the Internet <URL:https://api.wiley.com/onlinelibrary/tdm/v1/articles/10.1002%2Fstem.1862> DOI: 10.1002/stem.1862 * |
| GRAHAM ET AL., CLIN CANCER RES, vol. 12, 2006, pages 2662 - 2669 |
| GRAHAM ET AL., J. GEN VIROL., vol. 36, 1977, pages 59 |
| GRAHAM ET AL., NAT REV CANCER, vol. 14, 2014, pages 769 - 785 |
| GRIFFITHS ET AL., EMBO J., vol. 12, 1993, pages 725 - 734 |
| HOOGENBOOM ET AL., J. MOL. BIOL., vol. 227, 1992, pages 381 - 388 |
| HUDSON ET AL., NAT. MED., vol. 9, 2003, pages 129 - 134 |
| HUEY ET AL., CANCERS, vol. 8, 2016, pages 101 |
| HUTCHINS ET AL., PROC NATL ACAD SCI USA, vol. 92, 1995, pages 11980 - 11984 |
| JANSEN ET AL., J PROTEOME RES, vol. 11, 2011, pages 728 - 735 |
| KANDA ET AL., BIOTECHNOL. BIOENG., vol. 94, no. 4, 2006, pages 680 - 688 |
| KARL M O ET AL: "Endogenous Gas6 and Ca^2^+-channel activation modulate phagocytosis by retinal pigment epithelium", CELLULAR SIGNALLING, ELSEVIER SCIENCE LTD, GB, vol. 20, no. 6, 1 June 2008 (2008-06-01), pages 1159 - 1168, XP022620920, ISSN: 0898-6568, [retrieved on 20080216], DOI: 10.1016/J.CELLSIG.2008.02.005 * |
| KEATING ET AL., ONCOGENE, vol. 25, 2006, pages 6092 |
| KEDAGE ET AL., MABS, vol. 12, 2020, pages e1685832 |
| KIRKLAND ET AL., J. IMMUNOL., vol. 137, 1986, pages 3614 - 3619 |
| KOZBOR, J. IMMUNOL., vol. 133, 1984, pages 3001 |
| KYTE ET AL., J. MOL. BIOL., vol. 157, 1982, pages 105 - 131 |
| LAVAIL ET AL., ADV EXP MED BIOL, vol. 854, 2016, pages 487 - 493 |
| LAZAR ET AL., PROC NATL ACAD SCI USA, vol. 103, 2006, pages 4005 - 4010 |
| LEE ET AL., J. IMMUNOL. METHODS, vol. 284, no. 2, 2004, pages 119 - 132 |
| LEE-SHERICK ET AL., ONCOGENE, vol. 32, 2013, pages 5359 - 5368 |
| LI ET AL., NAT. BIOTECH., vol. 24, 2006, pages 210 - 215 |
| LI ET AL., PROC. NATL. ACAD. SCI. USA, vol. 1, no. 03, 2006, pages 3557 - 3562 |
| LIGHTLE ET AL., PROTEIN SCI., vol. 19, 2010, pages 753 - 762 |
| LINGER ET AL., ADV CANCER RES, vol. 100, 2008, pages 35 - 83 |
| LINGER ET AL., BLOOD, vol. 122, 2013, pages 1599 - 1609 |
| LINGER ET AL., EXPERT OPIN THER TARGETS, vol. 14, 2010, pages 1073 - 1090 |
| LONBERG, CURR. OPIN. IMMUNOL., vol. 20, 2008, pages 450 - 459 |
| LORACH ET AL., NATURE SCIENTIFIC REPORTS, vol. 8, 2018, pages 11312 |
| MATHER ET AL., ANNALS N. Y. ACAD. SCI., vol. 383, 1982, pages 44 - 68 |
| MATHER, BIOL. REPROD., vol. 23, 1980, pages 243 - 251 |
| MATHIEU DONDELINGER ET AL: "Understanding the Significance and Implications of Antibody Numbering and Antigen-Binding Surface/Residue Definition", FRONTIERS IN IMMUNOLOGY, vol. 9, 16 October 2018 (2018-10-16), pages 1 - 15, XP055572450, DOI: 10.3389/fimmu.2018.02278 * |
| MCEARCHERN ET AL., BLOOD, vol. 109, 2007, pages 1185 - 1192 |
| MOLDENHAUER ET AL., SCAND. J. IMMUNOL., vol. 32, 1990, pages 77 - 82 |
| MOODY ET AL., INT J CANCER, vol. 139, 2016, pages 1340 - 1349 |
| MOREL ET AL., MOLEC. IMMUNOL., vol. 25, 1988, pages 7 - 15 |
| MORRIS: "Methods in Molecular Biology", vol. 66, 1996, HUMANA PRESS, article "Epitope Mapping Protocols" |
| OKAZAKI ET AL., J. MOL. BIOL., vol. 336, no. 5, 2004, pages 1239 - 1249 |
| PETERS ET AL., J BIOL CHEM, vol. 287, no. 29, 2012, pages 24525 - 33 |
| PRESTA ET AL., J. IMMUNOL., vol. 151, 1993, pages 2623 |
| REDDY ET AL., J LMMUNOL, vol. 164, 2000, pages 1925 - 1933 |
| REDDY ET AL., J. IMMUNOLOGY, vol. 164, 2000, pages 1925 - 1933 |
| RIPKA ET AL., ARCH. BIOCHEM. BIOPHYS., vol. 249, 1986, pages 533 - 545 |
| RIZOGIERASCH, ANN. REV. BIOCHEM., vol. 61, 1992, pages 387 |
| ROSOK ET AL., J. BIOL. CHEM., vol. 271, 1996, pages 22611 - 22618 |
| ROTHLIN ET AL., ANNU REV IMMUNOL, vol. 33, 2015, pages 355 - 391 |
| SANTULLI-MAROTTO SANDRA ET AL: "Discovering Molecules That Regulate Efferocytosis Using Primary Human Macrophages and High Content Imaging", PLOS ONE, vol. 10, no. 12, 16 December 2015 (2015-12-16), pages e0145078, XP055791070, DOI: 10.1371/journal.pone.0145078 * |
| SAZINSKY ET AL., PROC NATL ACAD SCI USA, vol. 105, 2008, pages 20167 - 20172 |
| SCHLEGEL ET AL., J CLIN INVEST, vol. 123, 2013, pages 2257 - 2267 |
| SHI ET AL., J HEMATOLOGY & ONCOLOGY, vol. 11, 2018, pages 43 |
| SHIELDS ET AL., R. J. BIOL. CHEM., vol. 276, 2001, pages 6591 - 6604 |
| STACH ET AL., CELL DEATH DIFF, vol. 7, 2000, pages 911 |
| STAHLI ET AL., METHODS IN ENZYMOLOGY, vol. 9, 1983, pages 242 - 253 |
| STANFORD JAMIE C. ET AL: "Efferocytosis produces a prometastatic landscape during postpartum mammary gland involution", THE JOURNAL OF CLINICAL INVESTIGATION, vol. 124, no. 11, 24 September 2014 (2014-09-24), GB, pages 4737 - 4752, XP055798170, ISSN: 0021-9738, DOI: 10.1172/JCI76375 * |
| SUOFU QIN ET AL: "Roles of v5, FAK and MerTK in oxidative stress inhibition of RPE cell phagocytosis", EXPERIMENTAL EYE RESEARCH, ACADEMIC PRESS LTD, LONDON, vol. 94, no. 1, 15 November 2011 (2011-11-15), pages 63 - 70, XP028440757, ISSN: 0014-4835, [retrieved on 20111125], DOI: 10.1016/J.EXER.2011.11.007 * |
| TAKEDA S ET AL: "Characterization of the anti-cancer and immunologic activity of RGX-019, a novel pre-clinical stage humanized monoclonal antibody targeting the MERTK receptor", CANCER RESEARCH 20190701 AMERICAN ASSOCIATION FOR CANCER RESEARCH INC. NLD, vol. 79, no. 13, Supplement, 1 July 2019 (2019-07-01), ISSN: 1538-7445 * |
| TODT JILL C. ET AL: "The receptor tyrosine kinase MerTK activates phospholipase C [gamma]2 during recognition of apoptotic thymocytes by murine macrophages", JOURNAL OF LEUKOCYTE BIOLOGY, vol. 75, no. 4, 2 January 2004 (2004-01-02), GB, pages 705 - 713, XP055798380, ISSN: 0741-5400, Retrieved from the Internet <URL:https://api.wiley.com/onlinelibrary/tdm/v1/articles/10.1189%2Fjlb.0903439> DOI: 10.1189/jlb.0903439 * |
| TWORKOSKI ET AL., MOL CANCER RES, 2011 |
| TWORKOSKI ET AL., PIGMENT CELL MELANOMA, vol. 26, 2013, pages 527 - 541 |
| UBIL ET AL., J CLIN INVEST, vol. 128, 2018, pages 2356 - 2369 |
| URLAUB ET AL., PROC. NATL. ACAD. SCI. USA, vol. 77, 1980, pages 4216 |
| VAN DIJK ET AL., CURR. OPIN. PHARMACOL., vol. 5, 2001, pages 368 - 74 |
| VERMA ET AL., MOL CANCER THER, vol. 10, 2011, pages 1763 - 1773 |
| VOLLMERS ET AL., HISTOLOGY AND HISTOPATHOLOGY, vol. 20, no. 3, 2005, pages 927 - 937 |
| VOLLMERS ET AL., METHODS AND FINDINGS IN EXPERIMENTAL AND CLINICAL PHARMACOLOGY, vol. 27, no. 3, 2005, pages 185 - 91 |
| WERFELCOOK, SEM IMMUNOPATHOLOGY, vol. 40, 2018, pages 545 - 554 |
| WHITE ET AL., CANCER CELL, vol. 27, 2015, pages 138 - 148 |
| WHITE K F ET AL: "MERTK-specific antibodies that have therapeutic antitumor activity in mice disrupt the integrity of the retinal pigmented epithelium in cynomolgus monkeys", CANCER RESEARCH 20190701 AMERICAN ASSOCIATION FOR CANCER RESEARCH INC. NLD, vol. 79, no. 13, Supplement, 1 July 2019 (2019-07-01), ISSN: 1538-7445 * |
| WILSON ET AL., CANCER CELL, vol. 19, 2011, pages 101 - 113 |
| WINTER ET AL., ANN. REV. IMMUNOL., vol. 12, 1994, pages 433 - 455 |
| XIE ET AL., ONCOTARGET, vol. 6, 2015, pages 9206 - 9219 |
| XU ET AL., CELL IMMUNOL, vol. 200, 2000, pages 16 - 26 |
| YAMANE-OHNUKI ET AL., BIOTECH. BIOENG., vol. 87, 2004, pages 614 |
| YAZAKIWU: "Methods in Molecular Biology,", vol. 248, 2003, HUMANA PRESS, pages: 255 - 268 |
| YI ET AL., ONCOTARGET, vol. 8, 2017, pages 96656 - 96667 |
| ZAPATA ET AL., PROTEIN ENG, vol. 8, no. 10, 1995, pages 1057 - 1062 |
| ZHANG BING ET AL: "MerTK Downregulates Lipopolysaccharide-Induced Inflammation Through SOCS1 Protein but Does Not Affect Phagocytosis ofEscherichia coliin Macrophages", INFLAMMATION, PLENUM PRESS, NEW YORK, NY, US, vol. 42, no. 1, 24 August 2018 (2018-08-24), pages 113 - 123, XP036705135, ISSN: 0360-3997, [retrieved on 20180824], DOI: 10.1007/S10753-018-0877-5 * |
| ZHOU ET AL., IMMUNITY, vol. 52, 2020, pages 1 - 17 |
Cited By (9)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US12281174B2 (en) | 2019-02-26 | 2025-04-22 | Inspirna, Inc. | High-affinity anti-MERTK antibodies and uses thereof |
| US11897968B2 (en) | 2019-12-13 | 2024-02-13 | Alector Llc | Anti-MerTK antibodies and methods of use thereof |
| WO2022241212A3 (en) * | 2021-05-14 | 2023-04-06 | Inspirna, Inc. | Mertk peptides and uses thereof |
| EP4337679A4 (en) * | 2021-05-14 | 2025-03-26 | Inspirna, Inc. | MERTK PEPTIDES AND THEIR USES |
| WO2022266221A1 (en) | 2021-06-16 | 2022-12-22 | Alector Llc | Monovalent anti-mertk antibodies and methods of use thereof |
| WO2022266223A1 (en) | 2021-06-16 | 2022-12-22 | Alector Llc | Bispecific anti-mertk and anti-pdl1 antibodies and methods of use thereof |
| WO2023063026A1 (ja) * | 2021-10-15 | 2023-04-20 | 株式会社カイオム・バイオサイエンス | MerTKに特異的に結合する抗体又はその断片、及び抗腫瘍剤 |
| JPWO2023063026A1 (https=) * | 2021-10-15 | 2023-04-20 | ||
| EP4417625A4 (en) * | 2021-10-15 | 2026-01-14 | Chiome Bioscience Inc | ANTIBODY OR FRAGMENT THEREOF THAT BINDS SPECIFICALLY TO MERTK, AND ANTITUMORAL AGENT |
Also Published As
| Publication number | Publication date |
|---|---|
| CO2022008314A2 (es) | 2022-07-08 |
| US20210261685A1 (en) | 2021-08-26 |
| KR20220127252A (ko) | 2022-09-19 |
| ECSP22055004A (es) | 2022-08-31 |
| AU2020401319A1 (en) | 2022-06-30 |
| CA3160210A1 (en) | 2021-06-17 |
| JP2023506465A (ja) | 2023-02-16 |
| US20240287204A1 (en) | 2024-08-29 |
| EP4072680A1 (en) | 2022-10-19 |
| BR112022011570A2 (pt) | 2022-12-13 |
| IL293827A (en) | 2022-08-01 |
| MX2022007231A (es) | 2022-07-12 |
| US11897968B2 (en) | 2024-02-13 |
| CL2022001554A1 (es) | 2023-03-24 |
| PE20221326A1 (es) | 2022-09-09 |
| PH12022551398A1 (en) | 2023-10-09 |
| CR20220329A (es) | 2022-11-23 |
| CN115151307A (zh) | 2022-10-04 |
| TW202136303A (zh) | 2021-10-01 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| JP7486636B2 (ja) | 抗ms4a4a抗体及びその使用方法 | |
| US11897968B2 (en) | Anti-MerTK antibodies and methods of use thereof | |
| US20240294650A1 (en) | Anti-mertk antibodies and methods of use thereof | |
| CN114341181B (zh) | 抗ms4a4a抗体及其使用方法 | |
| JP2023113896A (ja) | 抗ms4a6a抗体及びその使用方法 | |
| US20240279341A1 (en) | Bispecific anti-mertk and anti-pdl1 antibodies and methods of use thereof | |
| US20250270343A1 (en) | Anti-gpnmb antibodies and methods of use thereof | |
| US20250333523A1 (en) | Anti-IL18 Binding Protein Antibodies and Methods of Use Thereof | |
| WO2023010076A1 (en) | Anti-sirp-alpha antibodies and methods of use thereof | |
| US20240279358A1 (en) | Monovalent anti-mertk antibodies and methods of use thereof | |
| US20240254227A1 (en) | Anti-CD300LB Antibodies and Methods of Use Thereof | |
| HK40075433A (en) | Anti-mertk antibodies and methods of use thereof | |
| CN117396514A (zh) | 单价抗mertk抗体及其使用方法 | |
| HK40101180A (zh) | 双特异性抗mertk和抗pdl1抗体及其使用方法 | |
| HK40084838A (en) | Anti-mertk antibodies and methods of use thereof | |
| HK40097282A (zh) | 单价抗mertk抗体及其使用方法 | |
| HK40095975A (zh) | 用於治疗和预防冠状病毒感染的抗tmem106b抗体 | |
| CN117157321A (zh) | 用于治疗和预防冠状病毒感染的抗tmem106b抗体 |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 20842361 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 3160210 Country of ref document: CA |
|
| ENP | Entry into the national phase |
Ref document number: 2022535544 Country of ref document: JP Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: NC2022/0008314 Country of ref document: CO |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112022011570 Country of ref document: BR |
|
| ENP | Entry into the national phase |
Ref document number: 2020401319 Country of ref document: AU Date of ref document: 20201211 Kind code of ref document: A |
|
| WWP | Wipo information: published in national office |
Ref document number: NC2022/0008314 Country of ref document: CO |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2020842361 Country of ref document: EP Effective date: 20220713 |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01E Ref document number: 112022011570 Country of ref document: BR Free format text: COM BASE NA PORTARIA 405 DE 21/12/2020, SOLICITA-SE QUE SEJA APRESENTADO, EM ATE 60 (SESSENTA) DIAS, NOVO CONTEUDO DE LISTAGEM DE SEQUENCIA POIS O CONTEUDO APRESENTADO NA PETICAO NO 870220071817 POSSUI O CAMPO 110 COM DADO DIVERGENTE. DEVERA SER INCLUIDO O CAMPO 140 / 141 UMA VEZ QUE O DEPOSITANTE JA POSSUI O NUMERO DO PEDIDO NO BRASIL. |
|
| ENP | Entry into the national phase |
Ref document number: 112022011570 Country of ref document: BR Kind code of ref document: A2 Effective date: 20220613 |
|
| WWR | Wipo information: refused in national office |
Ref document number: NC2022/0008314 Country of ref document: CO |
|
| WWW | Wipo information: withdrawn in national office |
Ref document number: 789402 Country of ref document: NZ |